F485203

General Info

Members Datasets Scaffolds Average Seq Length
902 241 1804 89

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_12389642|Ga0105239_123896421
Length 103
Sequence VLPGIIGVVQATEAIKLLLGLGDPLIGRLLTYDALGMRFREVKLRRDPKCPLCGEHPTITDLSIHRSSVDACATPDNGSSGGHPAAESDRGSGSRARGPAPAR

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
169 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
175 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 99.45
Stem 0
Stem Tuber 0
Unclassified 4.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_12389642 3300010375 Archaea 615
2 JGI25406J46586_10038387 3300003203 Archaea 1717
3 JGI26128J50194_1003713 3300003347 Bacteria 1013
4 JGI25405J52794_10015986 3300003911 Bacteria 1478
5 Ga0065707_10403385 3300005295 Bacteria 850
6 Ga0070676_10008156 3300005328 Bacteria 5635
7 Ga0070690_100063604 3300005330 Bacteria 2382
8 Ga0070670_100958661 3300005331 Archaea 777
9 Ga0068869_100038846 3300005334 Bacteria 3396
10 Ga0068869_101760687 3300005334 Bacteria 554
11 Ga0070680_100034611 3300005336 Bacteria 4073
12 Ga0070680_100073509 3300005336 Bacteria 2812
13 Ga0070680_100620223 3300005336 Bacteria 929
14 Ga0070680_100714173 3300005336 Unclassified 863
15 Ga0070680_100908791 3300005336 Bacteria 760
16 Ga0070689_100100304 3300005340 Bacteria 2291
17 Ga0070691_10008258 3300005341 Bacteria 4770
18 Ga0070691_10066045 3300005341 Bacteria 1748
19 Ga0070691_10291794 3300005341 Bacteria 888
20 Ga0070692_10737496 3300005345 Bacteria 667
21 Ga0070669_101777689 3300005353 Unclassified 538
22 Ga0070675_100827764 3300005354 Bacteria 847
23 Ga0070659_100003351 3300005366 Bacteria 11398
24 Ga0070667_102239632 3300005367 Unclassified 515
25 Ga0070703_10000725 3300005406 Bacteria 11075
26 Ga0070703_10013794 3300005406 Bacteria 2298
27 Ga0070703_10049956 3300005406 Bacteria 1334
28 Ga0070703_10164385 3300005406 Archaea 845
29 Ga0070703_10237788 3300005406 Bacteria 733
30 Ga0070701_10118116 3300005438 Bacteria 1491
31 Ga0070701_10263969 3300005438 Bacteria 1045
32 Ga0070711_100254664 3300005439 Bacteria 1379
33 Ga0070705_100045846 3300005440 Bacteria 2518
34 Ga0070705_100292867 3300005440 Bacteria 1163
35 Ga0070705_100310618 3300005440 Bacteria 1134
36 Ga0070705_100343428 3300005440 Bacteria 1086
37 Ga0070700_100217438 3300005441 Bacteria 1352
38 Ga0070700_101296842 3300005441 Bacteria 612
39 Ga0070694_100005446 3300005444 Bacteria 7706
40 Ga0070694_100113388 3300005444 Bacteria 1934
41 Ga0070694_100173168 3300005444 Bacteria 1591
42 Ga0070694_100353162 3300005444 Unclassified 1139
43 Ga0070694_100648055 3300005444 Bacteria 855
44 Ga0070708_100018280 3300005445 Bacteria 5866
45 Ga0070708_100022591 3300005445 Bacteria 5336
46 Ga0070708_100035921 3300005445 Bacteria 4320
47 Ga0070708_100105423 3300005445 Bacteria 2586
48 Ga0070708_100163478 3300005445 Bacteria 2075
49 Ga0070708_100185615 3300005445 Bacteria 1945
50 Ga0070708_100187271 3300005445 Bacteria 1936
51 Ga0070708_100229090 3300005445 Bacteria 1743
52 Ga0070708_100563109 3300005445 Bacteria 1075
53 Ga0070708_100612113 3300005445 Bacteria 1027
54 Ga0070708_101200352 3300005445 Unclassified 710
55 Ga0070708_101832810 3300005445 Unclassified 563
56 Ga0070708_102056074 3300005445 Unclassified 528
57 Ga0070678_101790688 3300005456 Bacteria 579
58 Ga0070662_100065228 3300005457 Bacteria 2669
59 Ga0070662_100595371 3300005457 Bacteria 930
60 Ga0068867_100177632 3300005459 Bacteria 1691
61 Ga0068867_100253909 3300005459 Bacteria 1431
62 Ga0068867_100397257 3300005459 Bacteria 1162
63 Ga0070685_10280270 3300005466 Bacteria 1116
64 Ga0070706_100006667 3300005467 Bacteria 10893
65 Ga0070706_100011568 3300005467 Bacteria 8198
66 Ga0070706_100013416 3300005467 Bacteria 7575
67 Ga0070706_100015077 3300005467 Bacteria 7139
68 Ga0070706_100091241 3300005467 Bacteria 2825
69 Ga0070706_100125685 3300005467 Bacteria 2391
70 Ga0070706_100194033 3300005467 Bacteria 1897
71 Ga0070706_100212173 3300005467 Bacteria 1808
72 Ga0070706_100451132 3300005467 Bacteria 1197
73 Ga0070706_100658713 3300005467 Unclassified 972
74 Ga0070706_101527574 3300005467 Bacteria 610
75 Ga0070707_100002450 3300005468 Bacteria 17677
76 Ga0070707_100003414 3300005468 Bacteria 15010
77 Ga0070707_100128152 3300005468 Bacteria 2466
78 Ga0070707_100143179 3300005468 Bacteria 2327
79 Ga0070707_100233556 3300005468 Bacteria 1790
80 Ga0070707_100390875 3300005468 Archaea 1351
81 Ga0070707_100465098 3300005468 Bacteria 1226
82 Ga0070707_101118788 3300005468 Bacteria 754
83 Ga0070707_101174785 3300005468 Unclassified 733
84 Ga0070707_101456616 3300005468 Bacteria 651
85 Ga0070698_100007324 3300005471 Bacteria 11944
86 Ga0070698_100019917 3300005471 Bacteria 7037
87 Ga0070698_100020823 3300005471 Bacteria 6872
88 Ga0070698_100062494 3300005471 Bacteria 3757
89 Ga0070698_100092124 3300005471 Bacteria 3012
90 Ga0070698_100266104 3300005471 Unclassified 1646
91 Ga0070698_100305549 3300005471 Bacteria 1521
92 Ga0070698_100393556 3300005471 Unclassified 1319
93 Ga0070698_102165973 3300005471 Unclassified 509
94 Ga0070699_100002872 3300005518 Bacteria 15355
95 Ga0070699_100026475 3300005518 Bacteria 5000
96 Ga0070699_100028821 3300005518 Bacteria 4787
97 Ga0070699_100048243 3300005518 Bacteria 3684
98 Ga0070699_100088840 3300005518 Bacteria 2700
99 Ga0070699_100101950 3300005518 Bacteria 2516
100 Ga0070699_100125198 3300005518 Bacteria 2262
101 Ga0070699_100664215 3300005518 Bacteria 952
102 Ga0070699_100709929 3300005518 Bacteria 919
103 Ga0070699_100716304 3300005518 Bacteria 914
104 Ga0070699_101548378 3300005518 Bacteria 608
105 Ga0070699_101707823 3300005518 Bacteria 576
106 Ga0070699_102181506 3300005518 Bacteria 505
107 Ga0070684_100129115 3300005535 Bacteria 2279
108 Ga0070697_100001072 3300005536 Bacteria 20653
109 Ga0070697_100011661 3300005536 Bacteria 6870
110 Ga0070697_100028298 3300005536 Bacteria 4487
111 Ga0070697_100132698 3300005536 Bacteria 2089
112 Ga0070697_100139685 3300005536 Bacteria 2036
113 Ga0070697_100328097 3300005536 Bacteria 1319
114 Ga0070697_100348063 3300005536 Bacteria 1279
115 Ga0070697_100389066 3300005536 Bacteria 1209
116 Ga0070697_100460559 3300005536 Bacteria 1108
117 Ga0070697_100751897 3300005536 Bacteria 861
118 Ga0070697_101563086 3300005536 Unclassified 590
119 Ga0070697_101704309 3300005536 Unclassified 564
120 Ga0068853_100344100 3300005539 Bacteria 1386
121 Ga0070686_100202869 3300005544 Bacteria 1423
122 Ga0070695_100004437 3300005545 Bacteria 8238
123 Ga0070695_100013763 3300005545 Bacteria 4863
124 Ga0070695_100021061 3300005545 Bacteria 3986
125 Ga0070695_100023838 3300005545 Bacteria 3768
126 Ga0070695_100503036 3300005545 Bacteria 937
127 Ga0070695_100921664 3300005545 Bacteria 707
128 Ga0070696_100029322 3300005546 Bacteria 3760
129 Ga0070696_100061231 3300005546 Bacteria 2633
130 Ga0070696_100086675 3300005546 Bacteria 2223
131 Ga0070696_100284771 3300005546 Bacteria 1261
132 Ga0070696_100713084 3300005546 Bacteria 819
133 Ga0070693_100784709 3300005547 Unclassified 705
134 Ga0070704_100085169 3300005549 Bacteria 2339
135 Ga0070704_100241986 3300005549 Bacteria 1477
136 Ga0070704_100297371 3300005549 Bacteria 1344
137 Ga0070704_100405926 3300005549 Bacteria 1164
138 Ga0070704_100598656 3300005549 Bacteria 969
139 Ga0070704_100680831 3300005549 Bacteria 910
140 Ga0070704_100855067 3300005549 Unclassified 816
141 Ga0070704_100985374 3300005549 Bacteria 762
142 Ga0070704_101801085 3300005549 Unclassified 566
143 Ga0068857_100014868 3300005577 Bacteria 6788
144 Ga0068857_100038717 3300005577 Bacteria 4222
145 Ga0068857_101027105 3300005577 Unclassified 794
146 Ga0068854_100856682 3300005578 Bacteria 796
147 Ga0068852_102659985 3300005616 Bacteria 520
148 Ga0068859_100607651 3300005617 Bacteria 1186
149 Ga0068859_100812707 3300005617 Archaea 1022
150 Ga0068859_100963791 3300005617 Bacteria 936
151 Ga0068864_100452834 3300005618 Bacteria 1227
152 Ga0068866_10578221 3300005718 Bacteria 755
153 Ga0068866_10750958 3300005718 Archaea 674
154 Ga0068861_100013321 3300005719 Bacteria 5754
155 Ga0068861_100208447 3300005719 Bacteria 1645
156 Ga0068870_10150696 3300005840 Bacteria 1370
157 Ga0068863_100005187 3300005841 Bacteria 12850
158 Ga0068863_100482582 3300005841 Bacteria 1219
159 Ga0068858_100330633 3300005842 Bacteria 1458
160 Ga0068858_100603652 3300005842 Bacteria 1064
161 Ga0068860_100001643 3300005843 Bacteria 23951
162 Ga0068860_100151860 3300005843 Bacteria 2230
163 Ga0068860_100682315 3300005843 Bacteria 1036
164 Ga0068860_101046484 3300005843 Bacteria 835
165 Ga0068862_100022944 3300005844 Bacteria 5225
166 Ga0068862_100075563 3300005844 Bacteria 2914
167 Ga0068862_101343708 3300005844 Unclassified 717
168 Ga0081455_10000261 3300005937 Bacteria 69458
169 Ga0081455_10654979 3300005937 Unclassified 676
170 Ga0081538_10010550 3300005981 Bacteria 7570
171 Ga0081539_10000069 3300005985 Bacteria 236854
172 Ga0070716_100007683 3300006173 Bacteria 5320
173 Ga0070712_101046916 3300006175 Bacteria 707
174 Ga0075427_10030829 3300006194 Bacteria 880
175 Ga0075427_10048199 3300006194 Bacteria 730
176 Ga0075428_100007893 3300006844 Bacteria 11799
177 Ga0075428_100008824 3300006844 Bacteria 11187
178 Ga0075428_100009335 3300006844 Bacteria 10881
179 Ga0075428_100048603 3300006844 Bacteria 4655
180 Ga0075428_100170462 3300006844 Bacteria 2360
181 Ga0075428_100280803 3300006844 Bacteria 1792
182 Ga0075428_100739651 3300006844 Bacteria 1047
183 Ga0075428_101397629 3300006844 Bacteria 735
184 Ga0075428_101637265 3300006844 Unclassified 672
185 Ga0075430_100000651 3300006846 Bacteria 26480
186 Ga0075430_100002531 3300006846 Bacteria 15234
187 Ga0075430_100025656 3300006846 Bacteria 5015
188 Ga0075430_100040922 3300006846 Bacteria 3922
189 Ga0075430_100088076 3300006846 Bacteria 2598
190 Ga0075430_100088528 3300006846 Bacteria 2591
191 Ga0075430_100260275 3300006846 Bacteria 1437
192 Ga0075430_101158270 3300006846 Archaea 637
193 Ga0075431_100000016 3300006847 Bacteria 85421
194 Ga0075431_100000063 3300006847 Bacteria 61188
195 Ga0075431_100000691 3300006847 Bacteria 29037
196 Ga0075431_100000906 3300006847 Bacteria 26122
197 Ga0075431_100003499 3300006847 Bacteria 15227
198 Ga0075431_100004979 3300006847 Bacteria 13072
199 Ga0075431_100013996 3300006847 Bacteria 8103
200 Ga0075431_100015125 3300006847 Bacteria 7816
201 Ga0075431_100026408 3300006847 Bacteria 5958
202 Ga0075431_100545888 3300006847 Bacteria 1147
203 Ga0075431_100766677 3300006847 Bacteria 939
204 Ga0075431_100990496 3300006847 Unclassified 808
205 Ga0075431_101057790 3300006847 Unclassified 777
206 Ga0075433_10000062 3300006852 Bacteria 46932
207 Ga0075433_10000079 3300006852 Bacteria 43978
208 Ga0075433_10016113 3300006852 Bacteria 6149
209 Ga0075433_10073157 3300006852 Bacteria 3014
210 Ga0075433_10099845 3300006852 Bacteria 2569
211 Ga0075433_10212199 3300006852 Archaea 1720
212 Ga0075433_10213462 3300006852 Bacteria 1715
213 Ga0075433_10489880 3300006852 Bacteria 1083
214 Ga0075433_10544514 3300006852 Bacteria 1021
215 Ga0075433_10842231 3300006852 Bacteria 801
216 Ga0075434_100000486 3300006871 Bacteria 29858
217 Ga0075434_100010470 3300006871 Bacteria 8695
218 Ga0075434_100018172 3300006871 Bacteria 6788
219 Ga0075434_100018606 3300006871 Bacteria 6712
220 Ga0075434_100029139 3300006871 Bacteria 5429
221 Ga0075434_100072870 3300006871 Bacteria 3427
222 Ga0075434_100118583 3300006871 Bacteria 2660
223 Ga0075434_100163262 3300006871 Bacteria 2247
224 Ga0075434_100224780 3300006871 Bacteria 1897
225 Ga0075434_100342202 3300006871 Bacteria 1517
226 Ga0075434_100608734 3300006871 Bacteria 1111
227 Ga0075434_100883688 3300006871 Bacteria 909
228 Ga0075434_101341080 3300006871 Archaea 726
229 Ga0075434_101741588 3300006871 Unclassified 630
230 Ga0075429_100002697 3300006880 Bacteria 14960
231 Ga0075429_100003138 3300006880 Bacteria 14041
232 Ga0075429_100005669 3300006880 Bacteria 10771
233 Ga0075429_100054579 3300006880 Bacteria 3476
234 Ga0075429_100068491 3300006880 Bacteria 3089
235 Ga0075429_100073007 3300006880 Bacteria 2988
236 Ga0075429_100558943 3300006880 Bacteria 1003
237 Ga0075429_100654248 3300006880 Bacteria 921
238 Ga0075429_100908319 3300006880 Bacteria 771
239 Ga0068865_100137550 3300006881 Bacteria 1838
240 Ga0068865_100524870 3300006881 Bacteria 991
241 Ga0075436_100001689 3300006914 Bacteria 15096
242 Ga0075436_100022019 3300006914 Bacteria 4376
243 Ga0075436_100220608 3300006914 Bacteria 1345
244 Ga0075436_100234539 3300006914 Bacteria 1304
245 Ga0075436_100310363 3300006914 Bacteria 1132
246 Ga0075436_100838585 3300006914 Bacteria 686
247 Ga0097620_100607640 3300006931 Bacteria 1186
248 Ga0097620_100812804 3300006931 Archaea 1022
249 Ga0097620_100963468 3300006931 Bacteria 936
250 Ga0075435_100026121 3300007076 Bacteria 4552
251 Ga0075435_100038124 3300007076 Bacteria 3831
252 Ga0075435_100070166 3300007076 Bacteria 2859
253 Ga0075435_100205482 3300007076 Bacteria 1669
254 Ga0075435_100492369 3300007076 Bacteria 1060
255 Ga0075435_100608683 3300007076 Bacteria 948
256 Ga0075435_100773728 3300007076 Bacteria 835
257 Ga0075435_100823459 3300007076 Bacteria 808
258 Ga0099794_10001549 3300007265 Bacteria 8106
259 Ga0099794_10005743 3300007265 Bacteria 5000
260 Ga0099794_10131084 3300007265 Bacteria 1266
261 Ga0105240_10927577 3300009093 Bacteria 935
262 Ga0111539_10067520 3300009094 Bacteria 4223
263 Ga0111539_10223939 3300009094 Bacteria 2191
264 Ga0111539_10313888 3300009094 Bacteria 1824
265 Ga0105245_10688477 3300009098 Bacteria 1055
266 Ga0114129_10000002 3300009147 Bacteria 204413
267 Ga0114129_10000093 3300009147 Bacteria 85690
268 Ga0114129_10007115 3300009147 Bacteria 15919
269 Ga0114129_10010241 3300009147 Bacteria 13375
270 Ga0114129_10011506 3300009147 Bacteria 12599
271 Ga0114129_10014552 3300009147 Bacteria 11212
272 Ga0114129_10017219 3300009147 Bacteria 10294
273 Ga0114129_10023149 3300009147 Bacteria 8811
274 Ga0114129_10041198 3300009147 Bacteria 6509
275 Ga0114129_10041341 3300009147 Bacteria 6497
276 Ga0114129_10049117 3300009147 Bacteria 5930
277 Ga0114129_10062486 3300009147 Bacteria 5202
278 Ga0114129_10077043 3300009147 Bacteria 4640
279 Ga0114129_10217953 3300009147 Bacteria 2576
280 Ga0114129_10475823 3300009147 Bacteria 1635
281 Ga0114129_10502894 3300009147 Bacteria 1583
282 Ga0114129_10709387 3300009147 Bacteria 1292
283 Ga0114129_11191187 3300009147 Bacteria 949
284 Ga0114129_11289987 3300009147 Bacteria 905
285 Ga0114129_11335453 3300009147 Archaea 887
286 Ga0114129_11498150 3300009147 Bacteria 829
287 Ga0114129_12475423 3300009147 Bacteria 621
288 Ga0114129_13102790 3300009147 Bacteria 543
289 Ga0105243_10125865 3300009148 Bacteria 2168
290 Ga0105243_10632601 3300009148 Bacteria 1035
291 Ga0105241_10348471 3300009174 Bacteria 1285
292 Ga0105241_10792831 3300009174 Bacteria 872
293 Ga0105241_11545616 3300009174 Bacteria 640
294 Ga0105242_10233353 3300009176 Bacteria 1650
295 Ga0105242_10390432 3300009176 Bacteria 1296
296 Ga0105242_10585667 3300009176 Unclassified 1075
297 Ga0105242_12700294 3300009176 Bacteria 546
298 Ga0105248_10153904 3300009177 Bacteria 2594
299 Ga0105249_10042812 3300009553 Bacteria 4119
300 Ga0105249_10065289 3300009553 Bacteria 3348
301 Ga0105249_11960585 3300009553 Bacteria 658
302 Ga0105249_12311984 3300009553 Bacteria 610
303 Ga0105249_12661313 3300009553 Bacteria 572
304 Ga0105239_12397434 3300010375 Bacteria 614
305 Ga0157371_10298276 3300013102 Bacteria 1166
306 Ga0157378_10518294 3300013297 Bacteria 1193
307 Ga0157378_12373909 3300013297 Unclassified 582
308 Ga0157378_12859876 3300013297 Bacteria 535
309 Ga0163162_10001333 3300013306 Bacteria 23026
310 Ga0163162_10119599 3300013306 Bacteria 2737
311 Ga0163162_10650823 3300013306 Bacteria 1177
312 Ga0157375_10027047 3300013308 Bacteria 5357
313 Ga0157375_10097402 3300013308 Bacteria 3016
314 Ga0157375_10454443 3300013308 Bacteria 1446
315 Ga0157375_11541216 3300013308 Bacteria 785
316 Ga0157375_11841831 3300013308 Archaea 718
317 Ga0163163_10512468 3300014325 Bacteria 1262
318 Ga0157380_10134638 3300014326 Bacteria 2113
319 Ga0157380_10740805 3300014326 Bacteria 993
320 Ga0157379_10314336 3300014968 Bacteria 1429
321 Ga0157379_11146766 3300014968 Bacteria 746
322 Ga0207656_10421676 3300025321 Bacteria 672
323 Ga0207653_10006168 3300025885 Bacteria 3736
324 Ga0207653_10011139 3300025885 Bacteria 2807
325 Ga0207653_10388046 3300025885 Bacteria 547
326 Ga0207642_10236760 3300025899 Bacteria 1029
327 Ga0207688_10010118 3300025901 Bacteria 5131
328 Ga0207680_10779960 3300025903 Bacteria 685
329 Ga0207699_10477941 3300025906 Bacteria 897
330 Ga0207645_10013441 3300025907 Bacteria 5516
331 Ga0207643_10664214 3300025908 Bacteria 673
332 Ga0207684_10001531 3300025910 Bacteria 24753
333 Ga0207684_10001738 3300025910 Bacteria 23045
334 Ga0207684_10011202 3300025910 Bacteria 7854
335 Ga0207684_10041903 3300025910 Bacteria 3881
336 Ga0207684_10062527 3300025910 Bacteria 3161
337 Ga0207684_10166020 3300025910 Bacteria 1902
338 Ga0207684_10170808 3300025910 Bacteria 1874
339 Ga0207684_10238133 3300025910 Bacteria 1570
340 Ga0207684_10341861 3300025910 Bacteria 1289
341 Ga0207684_10402420 3300025910 Bacteria 1177
342 Ga0207684_10513928 3300025910 Bacteria 1026
343 Ga0207654_10003053 3300025911 Bacteria 8489
344 Ga0207663_10080076 3300025916 Bacteria 2135
345 Ga0207660_10014059 3300025917 Bacteria 5254
346 Ga0207660_10220355 3300025917 Bacteria 1489
347 Ga0207646_10001305 3300025922 Bacteria 30967
348 Ga0207646_10009124 3300025922 Bacteria 9844
349 Ga0207646_10013823 3300025922 Bacteria 7697
350 Ga0207646_10020795 3300025922 Bacteria 6077
351 Ga0207646_10054597 3300025922 Bacteria 3573
352 Ga0207646_10074913 3300025922 Bacteria 3023
353 Ga0207646_10117467 3300025922 Bacteria 2389
354 Ga0207646_10233382 3300025922 Bacteria 1662
355 Ga0207646_10233394 3300025922 Bacteria 1662
356 Ga0207646_10622921 3300025922 Bacteria 968
357 Ga0207646_10983217 3300025922 Bacteria 746
358 Ga0207681_10252245 3300025923 Bacteria 1378
359 Ga0207687_10468155 3300025927 Bacteria 1047
360 Ga0207690_10001453 3300025932 Bacteria 14822
361 Ga0207706_10525894 3300025933 Bacteria 1020
362 Ga0207706_10528490 3300025933 Bacteria 1017
363 Ga0207686_10109710 3300025934 Bacteria 1859
364 Ga0207709_10314499 3300025935 Bacteria 1170
365 Ga0207709_10518572 3300025935 Bacteria 933
366 Ga0207670_10048096 3300025936 Bacteria 2844
367 Ga0207670_10081624 3300025936 Bacteria 2263
368 Ga0207670_11205233 3300025936 Bacteria 641
369 Ga0207669_11101631 3300025937 Bacteria 670
370 Ga0207665_10001341 3300025939 Bacteria 16596
371 Ga0207691_10058087 3300025940 Bacteria 3519
372 Ga0207711_10082901 3300025941 Bacteria 2804
373 Ga0207711_11460066 3300025941 Unclassified 627
374 Ga0207689_10540897 3300025942 Bacteria 978
375 Ga0207712_10083137 3300025961 Bacteria 2336
376 Ga0207712_10097118 3300025961 Bacteria 2182
377 Ga0207712_11126924 3300025961 Bacteria 699
378 Ga0207668_10217268 3300025972 Bacteria 1533
379 Ga0207640_10594623 3300025981 Bacteria 936
380 Ga0207640_10891761 3300025981 Bacteria 776
381 Ga0207703_10243477 3300026035 Archaea 1618
382 Ga0207703_10263224 3300026035 Bacteria 1559
383 Ga0207708_10059691 3300026075 Bacteria 2911
384 Ga0207708_10260744 3300026075 Bacteria 1399
385 Ga0207708_10644762 3300026075 Bacteria 901
386 Ga0207641_10043633 3300026088 Bacteria 3767
387 Ga0207641_10524953 3300026088 Bacteria 1152
388 Ga0207641_11222349 3300026088 Bacteria 751
389 Ga0207648_10001162 3300026089 Bacteria 29501
390 Ga0207648_10148415 3300026089 Bacteria 2069
391 Ga0207648_10465312 3300026089 Bacteria 1153
392 Ga0207648_10639924 3300026089 Bacteria 982
393 Ga0207676_10013719 3300026095 Bacteria 5819
394 Ga0207674_10023993 3300026116 Bacteria 6523
395 Ga0207674_10109688 3300026116 Bacteria 2736
396 Ga0207675_100003114 3300026118 Bacteria 16265
397 Ga0207675_100330664 3300026118 Bacteria 1490
398 Ga0207698_11924826 3300026142 Bacteria 606
399 Ga0209969_1004189 3300027360 Bacteria 2020
400 Ga0209996_1001817 3300027395 Bacteria 2612
401 Ga0209984_1000534 3300027424 Bacteria 4156
402 Ga0209995_1000699 3300027471 Bacteria 5127
403 Ga0209968_1001901 3300027526 Bacteria 3174
404 Ga0209968_1065668 3300027526 Archaea 643
405 Ga0209970_1002557 3300027614 Bacteria 3081
406 Ga0210002_1000999 3300027617 Bacteria 3915
407 Ga0209983_1000090 3300027665 Bacteria 14724
408 Ga0209983_1027191 3300027665 Unclassified 1211
409 Ga0209588_1014705 3300027671 Bacteria 2399
410 Ga0209588_1028141 3300027671 Archaea 1789
411 Ga0209588_1040451 3300027671 Bacteria 1504
412 Ga0209588_1170949 3300027671 Bacteria 684
413 Ga0209971_1002250 3300027682 Bacteria 4669
414 Ga0209966_1000024 3300027695 Bacteria 67059
415 Ga0209998_10000054 3300027717 Bacteria 46941
416 Ga0209974_10000555 3300027876 Bacteria 12465
417 Ga0207428_10000193 3300027907 Bacteria 84889
418 Ga0207428_10000284 3300027907 Bacteria 68587
419 Ga0207428_10094429 3300027907 Bacteria 2319
420 Ga0268266_10713808 3300028379 Bacteria 967
421 Ga0268265_10093373 3300028380 Bacteria 2410
422 Ga0268265_10176086 3300028380 Bacteria 1833
423 Ga0268265_10194972 3300028380 Bacteria 1752
424 Ga0268265_10228422 3300028380 Bacteria 1634
425 Ga0268265_10433588 3300028380 Bacteria 1223
426 Ga0268265_10452288 3300028380 Bacteria 1200
427 Ga0268264_10428394 3300028381 Bacteria 1277
428 Ga0268264_10948953 3300028381 Bacteria 865
429 Ga0268264_11756414 3300028381 Unclassified 631
430 Ga0307408_100200887 3300031548 Bacteria 1613
431 Ga0307408_100263671 3300031548 Bacteria 1427
432 Ga0307405_12044802 3300031731 Unclassified 513
433 Ga0307413_10096044 3300031824 Bacteria 1945
434 Ga0307410_10121223 3300031852 Bacteria 1907
435 Ga0307410_10272598 3300031852 Bacteria 1324
436 Ga0307406_10594739 3300031901 Bacteria 911
437 Ga0307409_100247709 3300031995 Bacteria 1627
438 Ga0307416_100110372 3300032002 Archaea 2422
439 Ga0307416_103513018 3300032002 Unclassified 524
440 Ga0307414_10208389 3300032004 Bacteria 1596
441 Ga0307411_10092240 3300032005 Bacteria 2118
442 Ga0373948_0034812 3300034817 Bacteria 1031
443 Ga0373959_0141224 3300034820 Bacteria 603
444 Ga0373938_0062010 3300034957 Bacteria 877
445 Ga0373938_0093463 3300034957 Bacteria 747
446 Ga0373929_0121762 3300035085 Bacteria 676
447 Ga0373929_0155510 3300035085 Bacteria 616
448 Ga0373940_0094890 3300035088 Bacteria 898
449 Ga0373940_0195925 3300035088 Bacteria 662
450 Ga0373949_0158619 3300035090 Unclassified 658
451 Ga0373951_0082459 3300035091 Bacteria 834
452 Ga0373952_0020413 3300035092 Bacteria 1389
453 Ga0373952_0185666 3300035092 Bacteria 602
454 Ga0373932_0302882 3300035112 Bacteria 597
455 Ga0373939_0045845 3300035114 Bacteria 1336
456 Ga0373939_0420299 3300035114 Bacteria 557
457 Ga0373941_0315986 3300035115 Bacteria 627
458 Ga0373961_0018899 3300035241 Bacteria 1804
459 Ga0373962_0050782 3300035242 Bacteria 1195
460 Ga0373962_0090800 3300035242 Bacteria 940
461 Ga0373962_0333633 3300035242 Unclassified 545
462 Ga0373931_0009689 3300035691 Bacteria 4612
463 Ga0373931_0035796 3300035691 Bacteria 2583
464 Ga0373947_0512275 3300035725 Bacteria 816
465 Ga0395899_0017675 3300037312 Bacteria 5432
466 Ga0395900_0000485 3300037418 Bacteria 56437
467 Ga0395900_0044596 3300037418 Bacteria 4568
468 Ga0395898_0003712 3300037466 Bacteria 16942
469 Ga0395905_0315144 3300037471 Bacteria 1453
470 Ga0395901_0002188 3300038443 Bacteria 19956
471 Ga0395901_0093842 3300038443 Bacteria 3143
472 Ga0242420_086300 3300038996 Bacteria 654
473 Ga0439441_007918 3300042001 Bacteria 1725
474 Ga0439448_0211848 3300042005 Bacteria 680
475 Ga0439450_022227 3300042008 Bacteria 1368
476 Ga0439455_0020845 3300042012 Bacteria 1557
477 Ga0439463_084718 3300042016 Bacteria 816
478 Ga0450913_006401 3300042117 Bacteria 864
479 Ga0450914_014653 3300042118 Bacteria 812
480 Ga0439464_0000215 3300042439 Bacteria 10388
481 Ga0439460_0004088 3300042461 Bacteria 3545
482 Ga0451577_0004681 3300042876 Bacteria 14357
483 Ga0451577_0066131 3300042876 Bacteria 3225
484 Ga0451577_0127367 3300042876 Bacteria 2282
485 Ga0453683_0006906 3300044673 Bacteria 7741
486 Ga0453683_0013349 3300044673 Bacteria 5367
487 Ga0453683_0016037 3300044673 Bacteria 4841
488 Ga0453684_0493327 3300044712 Bacteria 1357
489 Ga0453684_0584327 3300044712 Bacteria 1226
490 Ga0451576_0002366 3300045051 Bacteria 28426
491 Ga0451576_0072505 3300045051 Bacteria 3583
492 Ga0451576_0263731 3300045051 Bacteria 1801
493 Ga0451576_0264323 3300045051 Bacteria 1798
494 Ga0451576_0358226 3300045051 Bacteria 1527
495 Ga0451576_0483306 3300045051 Bacteria 1301
496 Ga0451576_0803123 3300045051 Bacteria 988
497 Ga0495603_0105674 3300046455 Bacteria 1643
498 Ga0495591_169850 3300046458 Bacteria 521
499 Ga0495580_0029975 3300046472 Bacteria 3944
500 Ga0495580_0211747 3300046472 Bacteria 1333
501 Ga0495580_0414473 3300046472 Bacteria 907
502 Ga0495580_0592442 3300046472 Unclassified 733
503 Ga0495584_0354518 3300046491 Bacteria 745
504 Ga0495642_0042687 3300046528 Bacteria 1848
505 Ga0495642_0050405 3300046528 Bacteria 1712
506 Ga0495642_0270378 3300046528 Bacteria 744
507 Ga0495642_0385172 3300046528 Bacteria 618
508 Ga0495598_0390448 3300046537 Unclassified 542
509 Ga0495621_0043768 3300046539 Bacteria 1580
510 Ga0495656_0214473 3300046615 Archaea 960
511 Ga0495659_0077398 3300046664 Bacteria 1256
512 Ga0495659_0121395 3300046664 Bacteria 1029
513 Ga0495659_0204881 3300046664 Bacteria 810
514 Ga0495659_0257377 3300046664 Bacteria 729
515 Ga0495588_0287289 3300046674 Bacteria 867
516 Ga0495669_0011243 3300046684 Bacteria 3798
517 Ga0495669_0074770 3300046684 Bacteria 1549
518 Ga0495669_0128613 3300046684 Bacteria 1191
519 Ga0495670_0129645 3300046691 Bacteria 1314
520 Ga0495636_0097446 3300047318 Bacteria 1282
521 Ga0496102_0677834 3300048905 Bacteria 954
522 Ga0496102_1949832 3300048905 Bacteria 504
523 Ga0496104_0934097 3300048907 Bacteria 772
524 Ga0496106_0428241 3300048909 Bacteria 1063
525 Ga0496107_0966800 3300048910 Unclassified 619
526 Ga0501032_0101712 3300049569 Bacteria 1904
527 Ga0501032_0985603 3300049569 Bacteria 530
528 Ga0501033_0148399 3300049570 Bacteria 1693
529 Ga0501033_0573904 3300049570 Bacteria 775
530 Ga0501033_0631332 3300049570 Bacteria 733
531 Ga0501033_0636231 3300049570 Bacteria 729
532 Ga0501036_0038453 3300049572 Bacteria 4050
533 Ga0501036_0085535 3300049572 Bacteria 2666
534 Ga0501036_0259544 3300049572 Bacteria 1456
535 Ga0501036_0340654 3300049572 Bacteria 1252
536 Ga0501036_0386051 3300049572 Bacteria 1169
537 Ga0501036_0573501 3300049572 Bacteria 937
538 Ga0501037_0108231 3300049573 Bacteria 2003
539 Ga0501037_0566113 3300049573 Bacteria 766
540 Ga0501037_0693431 3300049573 Bacteria 678
541 Ga0501038_0001975 3300049574 Bacteria 18946
542 Ga0501038_0088179 3300049574 Bacteria 2605
543 Ga0501038_0273222 3300049574 Bacteria 1332
544 Ga0501038_0353541 3300049574 Bacteria 1144
545 Ga0501038_0532633 3300049574 Bacteria 895
546 Ga0501038_0829871 3300049574 Bacteria 686
547 Ga0501038_1051062 3300049574 Bacteria 596
548 Ga0501039_0010475 3300049575 Bacteria 7065
549 Ga0501039_0076124 3300049575 Bacteria 2609
550 Ga0501039_0080355 3300049575 Bacteria 2537
551 Ga0501039_0157937 3300049575 Bacteria 1782
552 Ga0501039_0686332 3300049575 Bacteria 801
553 Ga0501039_0760613 3300049575 Bacteria 756
554 Ga0501039_0818427 3300049575 Bacteria 726
555 Ga0501039_1205208 3300049575 Bacteria 585
556 Ga0501040_0011071 3300049576 Bacteria 5896
557 Ga0501040_0087574 3300049576 Bacteria 2162
558 Ga0501040_0104503 3300049576 Bacteria 1978
559 Ga0501040_0134488 3300049576 Bacteria 1740
560 Ga0501040_0152716 3300049576 Bacteria 1629
561 Ga0501040_0232955 3300049576 Bacteria 1312
562 Ga0501040_0240005 3300049576 Bacteria 1292
563 Ga0501040_0341864 3300049576 Bacteria 1071
564 Ga0501040_0527737 3300049576 Bacteria 852
565 Ga0501040_0843379 3300049576 Bacteria 663
566 Ga0501041_0006959 3300049577 Bacteria 6634
567 Ga0501041_0016795 3300049577 Bacteria 4356
568 Ga0501041_0085468 3300049577 Bacteria 1945
569 Ga0501041_0121420 3300049577 Bacteria 1624
570 Ga0501041_0238324 3300049577 Bacteria 1143
571 Ga0501041_0529083 3300049577 Bacteria 751
572 Ga0501041_0981824 3300049577 Bacteria 543
573 Ga0501042_0002073 3300049578 Bacteria 12162
574 Ga0501042_0112306 3300049578 Bacteria 1962
575 Ga0501042_0160828 3300049578 Bacteria 1620
576 Ga0501042_0197932 3300049578 Bacteria 1449
577 Ga0501042_0387733 3300049578 Bacteria 1012
578 Ga0501042_0942251 3300049578 Bacteria 629
579 Ga0501042_1044244 3300049578 Bacteria 596
580 Ga0501043_0096981 3300049579 Bacteria 2318
581 Ga0501043_0300726 3300049579 Bacteria 1226
582 Ga0501043_0738038 3300049579 Bacteria 717
583 Ga0501043_1116048 3300049579 Bacteria 557
584 Ga0501046_0001074 3300049580 Bacteria 26812
585 Ga0501046_0095780 3300049580 Bacteria 2280
586 Ga0501046_0213358 3300049580 Bacteria 1432
587 Ga0501046_0221842 3300049580 Bacteria 1399
588 Ga0501046_0470499 3300049580 Bacteria 902
589 Ga0501046_1012411 3300049580 Bacteria 576
590 Ga0501046_1171220 3300049580 Bacteria 529
591 Ga0501047_0048644 3300049581 Bacteria 4095
592 Ga0501048_0009943 3300049582 Bacteria 7123
593 Ga0501048_0021451 3300049582 Bacteria 4730
594 Ga0501048_0052047 3300049582 Bacteria 2913
595 Ga0501048_0268895 3300049582 Bacteria 1211
596 Ga0501048_0330950 3300049582 Bacteria 1085
597 Ga0501048_1245247 3300049582 Unclassified 535
598 Ga0501067_0111897 3300049583 Bacteria 1518
599 Ga0501068_0095607 3300049584 Bacteria 1837
600 Ga0501068_0099553 3300049584 Bacteria 1801
601 Ga0501068_0151576 3300049584 Bacteria 1457
602 Ga0501068_0162507 3300049584 Bacteria 1408
603 Ga0501068_0206774 3300049584 Bacteria 1246
604 Ga0501068_0770530 3300049584 Bacteria 630
605 Ga0501068_0868840 3300049584 Bacteria 593
606 Ga0501069_0049316 3300049585 Archaea 2340
607 Ga0501069_0230908 3300049585 Bacteria 1077
608 Ga0501069_0320082 3300049585 Bacteria 911
609 Ga0501069_0576699 3300049585 Unclassified 674
610 Ga0501070_0504627 3300049586 Bacteria 972
611 Ga0501070_0550978 3300049586 Bacteria 923
612 Ga0501070_0886482 3300049586 Bacteria 697
613 Ga0501070_1228880 3300049586 Bacteria 574
614 Ga0501071_0072657 3300049587 Bacteria 2509
615 Ga0501071_0115707 3300049587 Bacteria 1984
616 Ga0501071_0116719 3300049587 Bacteria 1976
617 Ga0501071_0278719 3300049587 Bacteria 1265
618 Ga0501071_0436157 3300049587 Bacteria 1002
619 Ga0501071_1003989 3300049587 Bacteria 645
620 Ga0501072_0000423 3300049588 Bacteria 30232
621 Ga0501072_0028547 3300049588 Bacteria 4356
622 Ga0501072_0072541 3300049588 Bacteria 2721
623 Ga0501072_0118894 3300049588 Bacteria 2106
624 Ga0501072_0152296 3300049588 Bacteria 1844
625 Ga0501072_0154615 3300049588 Bacteria 1829
626 Ga0501072_0305689 3300049588 Bacteria 1264
627 Ga0501072_0358367 3300049588 Bacteria 1158
628 Ga0501072_0562234 3300049588 Bacteria 900
629 Ga0501072_0568878 3300049588 Bacteria 894
630 Ga0501072_0825346 3300049588 Bacteria 725
631 Ga0501073_0141858 3300049589 Bacteria 1665
632 Ga0501073_0222743 3300049589 Bacteria 1303
633 Ga0501073_0718106 3300049589 Bacteria 689
634 Ga0501074_0002837 3300049590 Bacteria 12134
635 Ga0501074_0166720 3300049590 Archaea 1573
636 Ga0501074_0230380 3300049590 Bacteria 1319
637 Ga0501074_0597937 3300049590 Bacteria 780
638 Ga0501074_1282675 3300049590 Bacteria 513
639 Ga0501075_0000141 3300049591 Bacteria 36003
640 Ga0501075_0011292 3300049591 Bacteria 6320
641 Ga0501075_0013083 3300049591 Bacteria 5915
642 Ga0501075_0034179 3300049591 Bacteria 3784
643 Ga0501075_0115234 3300049591 Bacteria 2043
644 Ga0501075_0148767 3300049591 Bacteria 1785
645 Ga0501075_0174000 3300049591 Bacteria 1643
646 Ga0501075_0204149 3300049591 Bacteria 1507
647 Ga0501075_0256326 3300049591 Bacteria 1333
648 Ga0501075_0275384 3300049591 Bacteria 1282
649 Ga0501075_0300502 3300049591 Bacteria 1223
650 Ga0501075_0303137 3300049591 Bacteria 1217
651 Ga0501075_0357971 3300049591 Bacteria 1112
652 Ga0501075_0548270 3300049591 Bacteria 883
653 Ga0501075_0794054 3300049591 Bacteria 720
654 Ga0501075_0971274 3300049591 Bacteria 645
655 Ga0501076_0000006 3300049592 Bacteria 125308
656 Ga0501076_0039553 3300049592 Bacteria 3702
657 Ga0501076_0066421 3300049592 Bacteria 2879
658 Ga0501076_0069848 3300049592 Bacteria 2807
659 Ga0501076_0071264 3300049592 Bacteria 2780
660 Ga0501076_0078947 3300049592 Bacteria 2641
661 Ga0501076_0212081 3300049592 Bacteria 1582
662 Ga0501076_0243327 3300049592 Bacteria 1472
663 Ga0501076_0248861 3300049592 Bacteria 1454
664 Ga0501076_0422106 3300049592 Bacteria 1097
665 Ga0501076_0530583 3300049592 Bacteria 970
666 Ga0501076_0587286 3300049592 Bacteria 919
667 Ga0501076_0602617 3300049592 Bacteria 906
668 Ga0501076_1162091 3300049592 Bacteria 635
669 Ga0501076_1282703 3300049592 Bacteria 602
670 Ga0501076_1548440 3300049592 Bacteria 544
671 Ga0501077_0036932 3300049593 Bacteria 3112
672 Ga0501077_0157610 3300049593 Bacteria 1441
673 Ga0501077_0185066 3300049593 Bacteria 1323
674 Ga0501077_0249042 3300049593 Bacteria 1130
675 Ga0501077_0251718 3300049593 Bacteria 1123
676 Ga0501077_0268251 3300049593 Bacteria 1086
677 Ga0501077_0296442 3300049593 Bacteria 1030
678 Ga0501077_0359598 3300049593 Bacteria 929
679 Ga0501077_0384608 3300049593 Bacteria 897
680 Ga0501077_0397930 3300049593 Bacteria 880
681 Ga0501077_0626791 3300049593 Bacteria 691
682 Ga0501077_1077560 3300049593 Bacteria 517
683 Ga0501079_0000821 3300049741 Bacteria 21134
684 Ga0501079_0003456 3300049741 Bacteria 11606
685 Ga0501079_0011097 3300049741 Bacteria 6873
686 Ga0501079_0039920 3300049741 Bacteria 3621
687 Ga0501079_0093212 3300049741 Bacteria 2333
688 Ga0501079_0098156 3300049741 Bacteria 2271
689 Ga0501079_0155483 3300049741 Bacteria 1783
690 Ga0501079_0269744 3300049741 Bacteria 1330
691 Ga0501079_0377421 3300049741 Bacteria 1111
692 Ga0501079_0441374 3300049741 Bacteria 1022
693 Ga0501079_0446222 3300049741 Bacteria 1016
694 Ga0501079_0464093 3300049741 Bacteria 995
695 Ga0501079_0626325 3300049741 Bacteria 847
696 Ga0501079_0783333 3300049741 Bacteria 751
697 Ga0501079_0941139 3300049741 Bacteria 680
698 Ga0501079_1161743 3300049741 Bacteria 608
699 Ga0501079_1248809 3300049741 Bacteria 585
700 Ga0501079_1414216 3300049741 Unclassified 547
701 Ga0501080_0008268 3300049742 Bacteria 9424
702 Ga0501080_0053772 3300049742 Bacteria 3750
703 Ga0501080_0091894 3300049742 Bacteria 2819
704 Ga0501080_0263173 3300049742 Bacteria 1571
705 Ga0501080_0370037 3300049742 Bacteria 1292
706 Ga0501080_0373611 3300049742 Bacteria 1285
707 Ga0501080_0960601 3300049742 Bacteria 743
708 Ga0501080_1018267 3300049742 Bacteria 718
709 Ga0501080_1618861 3300049742 Bacteria 548
710 Ga0501081_0004035 3300049743 Bacteria 9415
711 Ga0501081_0004786 3300049743 Bacteria 8714
712 Ga0501081_0017880 3300049743 Bacteria 4701
713 Ga0501081_0020424 3300049743 Bacteria 4415
714 Ga0501081_0043530 3300049743 Bacteria 3080
715 Ga0501081_0069602 3300049743 Bacteria 2451
716 Ga0501081_0073728 3300049743 Bacteria 2381
717 Ga0501081_0134287 3300049743 Bacteria 1770
718 Ga0501081_0145841 3300049743 Bacteria 1698
719 Ga0501081_0168379 3300049743 Bacteria 1581
720 Ga0501081_0206884 3300049743 Bacteria 1424
721 Ga0501081_0344705 3300049743 Bacteria 1097
722 Ga0501081_0452954 3300049743 Bacteria 953
723 Ga0501081_0493619 3300049743 Bacteria 912
724 Ga0501081_0649077 3300049743 Archaea 791
725 Ga0501081_0674880 3300049743 Bacteria 775
726 Ga0501081_0802429 3300049743 Bacteria 708
727 Ga0501081_0930462 3300049743 Unclassified 656
728 Ga0501081_1166788 3300049743 Bacteria 583
729 Ga0501081_1399188 3300049743 Bacteria 531
730 Ga0501083_0067779 3300049744 Bacteria 2375
731 Ga0501083_0068461 3300049744 Bacteria 2362
732 Ga0501083_0184100 3300049744 Bacteria 1363
733 Ga0501083_0279888 3300049744 Bacteria 1085
734 Ga0501083_0308239 3300049744 Bacteria 1030
735 Ga0501035_0439417 3300049822 Bacteria 1081
736 Ga0501035_0745123 3300049822 Bacteria 787
737 Ga0501035_1012270 3300049822 Bacteria 653
738 Ga0501035_1343273 3300049822 Bacteria 550
739 Ga0501045_0002035 3300049824 Bacteria 13656
740 Ga0501045_0022959 3300049824 Bacteria 4471
741 Ga0501045_0040002 3300049824 Bacteria 3412
742 Ga0501045_0131923 3300049824 Bacteria 1857
743 Ga0501045_0216607 3300049824 Archaea 1426
744 Ga0501045_0400067 3300049824 Unclassified 1022
745 nmdc:mga05p37_100_c1 3300050507 Bacteria 77275
746 nmdc:mga05p37_1205158_c1 3300050507 Archaea 782
747 nmdc:mga05p37_1217749_c1 3300050507 Archaea 776
748 nmdc:mga05p37_1398_c1 3300050507 Bacteria 28070
749 nmdc:mga05p37_156627_c1 3300050507 Bacteria 2783
750 nmdc:mga05p37_172083_c1 3300050507 Bacteria 2641
751 nmdc:mga05p37_1865925_c1 3300050507 Unclassified 576
752 nmdc:mga05p37_187162_c1 3300050507 Bacteria 2517
753 nmdc:mga05p37_1967968_c1 3300050507 Bacteria 555
754 nmdc:mga05p37_199635_c1 3300050507 Bacteria 2423
755 nmdc:mga05p37_2195736_c1 3300050507 Archaea 513
756 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
757 nmdc:mga05p37_308948_c1 3300050507 Bacteria 1366
758 nmdc:mga05p37_32611_c1 3300050507 Bacteria 6371
759 nmdc:mga05p37_54621_c1 3300050507 Bacteria 4913
760 nmdc:mga05p37_591814_c1 3300050507 Bacteria 1254
761 nmdc:mga05p37_60011_c1 3300050507 Bacteria 4684
762 nmdc:mga05p37_65958_c1 3300050507 Bacteria 4454
763 nmdc:mga05p37_73637_c1 3300050507 Bacteria 4204
764 nmdc:mga05p37_782820_c1 3300050507 Unclassified 1046
765 nmdc:mga05p37_80900_c1 3300050507 Bacteria 4002
766 nmdc:mga09592_1445494_c1 3300050508 Bacteria 561
767 nmdc:mga09592_1603692_c1 3300050508 Archaea 527
768 nmdc:mga09592_223173_c1 3300050508 Bacteria 1633
769 nmdc:mga09592_38326_c1 3300050508 Bacteria 4023
770 nmdc:mga09592_41672_c1 3300050508 Bacteria 3860
771 nmdc:mga09592_5209_c1 3300050508 Bacteria 10564
772 nmdc:mga09592_61561_c1 3300050508 Bacteria 3175
773 nmdc:mga09592_6169_c1 3300050508 Bacteria 9759
774 nmdc:mga09592_72752_c1 3300050508 Bacteria 2920
775 nmdc:mga09592_7973_c1 3300050508 Bacteria 8606
776 nmdc:mga09592_8801_c1 3300050508 Bacteria 8213
777 nmdc:mga0qj67_1635_c1 3300050509 Bacteria 15766
778 nmdc:mga0qj67_221090_c1 3300050509 Bacteria 1537
779 nmdc:mga0qj67_41676_c1 3300050509 Bacteria 3612
780 nmdc:mga0qj67_67818_c1 3300050509 Bacteria 2843
781 nmdc:mga0qj67_69696_c1 3300050509 Bacteria 2804
782 nmdc:mga0qj67_706964_c1 3300050509 Bacteria 801
783 nmdc:mga0qj67_92293_c1 3300050509 Bacteria 2434
784 nmdc:mga06r32_115674_c1 3300050510 Bacteria 2642
785 nmdc:mga06r32_11635_c1 3300050510 Bacteria 7921
786 nmdc:mga06r32_1262_c1 3300050510 Bacteria 22732
787 nmdc:mga06r32_1396_c1 3300050510 Bacteria 21822
788 nmdc:mga06r32_157832_c1 3300050510 Bacteria 2251
789 nmdc:mga06r32_24249_c1 3300050510 Bacteria 5627
790 nmdc:mga06r32_268395_c1 3300050510 Bacteria 1694
791 nmdc:mga06r32_483776_c1 3300050510 Archaea 1216
792 nmdc:mga06r32_717279_c1 3300050510 Bacteria 965
793 nmdc:mga06r32_796925_c1 3300050510 Archaea 906
794 nmdc:mga08y16_161630_c1 3300050511 Bacteria 2327
795 nmdc:mga08y16_1725_c1 3300050511 Bacteria 22185
796 nmdc:mga08y16_202937_c1 3300050511 Bacteria 2054
797 nmdc:mga08y16_270633_c1 3300050511 Bacteria 1754
798 nmdc:mga08y16_302896_c1 3300050511 Bacteria 1647
799 nmdc:mga08y16_350039_c1 3300050511 Bacteria 1518
800 nmdc:mga08y16_8141_c1 3300050511 Bacteria 10967
801 nmdc:mga08y16_935_c1 3300050511 Bacteria 28355
802 nmdc:mga0n895_1115554_c1 3300050512 Archaea 766
803 nmdc:mga0n895_114751_c1 3300050512 Bacteria 2712
804 nmdc:mga0n895_13802_c1 3300050512 Bacteria 7307
805 nmdc:mga0n895_17004_c1 3300050512 Bacteria 6691
806 nmdc:mga0n895_1774892_c1 3300050512 Bacteria 578
807 nmdc:mga0n895_182018_c1 3300050512 Archaea 2133
808 nmdc:mga0n895_203890_c1 3300050512 Bacteria 2008
809 nmdc:mga0n895_247598_c1 3300050512 Bacteria 1809
810 nmdc:mga0n895_268793_c1 3300050512 Bacteria 1730
811 nmdc:mga0n895_320097_c1 3300050512 Bacteria 1572
812 nmdc:mga0n895_36019_c1 3300050512 Bacteria 4776
813 nmdc:mga0n895_41284_c1 3300050512 Bacteria 4484
814 nmdc:mga0n895_426_c1 3300050512 Bacteria 28280
815 nmdc:mga0n895_7041_c1 3300050512 Bacteria 9608
816 nmdc:mga0n895_7798_c1 3300050512 Bacteria 9225
817 nmdc:mga0n895_952692_c1 3300050512 Bacteria 842
818 nmdc:mga0rr50_10085_c1 3300050513 Bacteria 5978
819 nmdc:mga0rr50_144669_c1 3300050513 Bacteria 1915
820 nmdc:mga0rr50_1542927_c1 3300050513 Bacteria 561
821 nmdc:mga0rr50_251865_c1 3300050513 Bacteria 1467
822 nmdc:mga0rr50_578787_c1 3300050513 Bacteria 957
823 nmdc:mga0rr50_83578_c1 3300050513 Bacteria 2469
824 nmdc:mga0rr50_93782_c1 3300050513 Bacteria 2343
825 nmdc:mga0rr50_97756_c1 3300050513 Bacteria 2300
826 nmdc:mga0rr50_98681_c1 3300050513 Bacteria 2290
827 nmdc:mga08x19_173809_c1 3300050514 Bacteria 1468
828 nmdc:mga08x19_294578_c1 3300050514 Bacteria 1126
829 nmdc:mga08x19_341294_c1 3300050514 Bacteria 1045
830 nmdc:mga08x19_361_c1 3300050514 Bacteria 32660
831 nmdc:mga08x19_4703_c1 3300050514 Bacteria 8096
832 nmdc:mga08x19_647504_c1 3300050514 Bacteria 749
833 nmdc:mga08x19_708009_c1 3300050514 Bacteria 715
834 nmdc:mga08x19_763495_c1 3300050514 Bacteria 687
835 nmdc:mga0a205_1003392_c1 3300050515 Archaea 682
836 nmdc:mga0a205_130328_c1 3300050515 Archaea 2415
837 nmdc:mga0a205_142_c1 3300050515 Bacteria 45750
838 nmdc:mga0a205_1484_c1 3300050515 Bacteria 20007
839 nmdc:mga0a205_202932_c1 3300050515 Bacteria 1873
840 nmdc:mga0a205_209393_c1 3300050515 Bacteria 1839
841 nmdc:mga0a205_217824_c1 3300050515 Bacteria 1796
842 nmdc:mga0a205_225238_c1 3300050515 Archaea 1760
843 nmdc:mga0a205_37577_c1 3300050515 Bacteria 4656
844 nmdc:mga0a205_41840_c1 3300050515 Bacteria 4414
845 nmdc:mga0a205_535_c1 3300050515 Bacteria 29966
846 nmdc:mga0a205_55419_c1 3300050515 Bacteria 3829
847 nmdc:mga0a205_743070_c1 3300050515 Bacteria 830
848 nmdc:mga0a205_861_c1 3300050515 Bacteria 24835
849 nmdc:mga0a205_933360_c1 3300050515 Archaea 715
850 Ga0501084_0005292 3300054114 Bacteria 10561
851 Ga0501084_0041813 3300054114 Bacteria 3834
852 Ga0501084_0051906 3300054114 Bacteria 3432
853 Ga0501084_0060263 3300054114 Bacteria 3177
854 Ga0501084_0061178 3300054114 Bacteria 3153
855 Ga0501084_0229373 3300054114 Bacteria 1567
856 Ga0501084_0239525 3300054114 Bacteria 1531
857 Ga0501084_0336440 3300054114 Bacteria 1275
858 Ga0501084_0673181 3300054114 Bacteria 873
859 Ga0501084_0716705 3300054114 Bacteria 843
860 Ga0501084_0758835 3300054114 Bacteria 817
861 Ga0501084_0906663 3300054114 Bacteria 741
862 Ga0501084_0939469 3300054114 Bacteria 727
863 Ga0501084_1032492 3300054114 Bacteria 691
864 Ga0501084_1376614 3300054114 Bacteria 591
865 Ga0501084_1388920 3300054114 Bacteria 588
866 Ga0501084_1800463 3300054114 Bacteria 511
867 Ga0590075_073578 3300059424 Bacteria 884
868 Ga0501082_0002508 3300060353 Bacteria 16067
869 Ga0501082_0012037 3300060353 Bacteria 7435
870 Ga0501082_0013916 3300060353 Bacteria 6918
871 Ga0501082_0026172 3300060353 Bacteria 5028
872 Ga0501082_0037541 3300060353 Bacteria 4176
873 Ga0501082_0064387 3300060353 Bacteria 3158
874 Ga0501082_0180174 3300060353 Bacteria 1838
875 Ga0501082_0241397 3300060353 Bacteria 1572
876 Ga0501082_0317291 3300060353 Bacteria 1358
877 Ga0501082_0328558 3300060353 Bacteria 1332
878 Ga0501082_0572249 3300060353 Bacteria 988
879 Ga0501082_0970766 3300060353 Bacteria 743
880 Ga0501082_1273160 3300060353 Bacteria 642
881 Ga0501082_1716570 3300060353 Bacteria 548
882 Ga0530510_0000001 3300061734 Bacteria 285623
883 Ga0530510_0000604 3300061734 Bacteria 23092
884 Ga0530510_0002774 3300061734 Bacteria 12045
885 Ga0530510_0035782 3300061734 Bacteria 3579
886 Ga0530510_0108669 3300061734 Bacteria 2030
887 Ga0530510_0126058 3300061734 Bacteria 1882
888 Ga0530510_0153109 3300061734 Bacteria 1703
889 Ga0530510_0182840 3300061734 Bacteria 1555
890 Ga0530510_0204775 3300061734 Bacteria 1466
891 Ga0530510_0218573 3300061734 Bacteria 1416
892 Ga0530510_0311539 3300061734 Bacteria 1179
893 Ga0530510_0314972 3300061734 Bacteria 1172
894 Ga0530510_0315954 3300061734 Bacteria 1170
895 Ga0530510_0329166 3300061734 Bacteria 1146
896 Ga0530510_0357738 3300061734 Bacteria 1097
897 Ga0530510_0475296 3300061734 Bacteria 946
898 Ga0530510_0751632 3300061734 Bacteria 743
899 Ga0530510_0751681 3300061734 Bacteria 743
900 Ga0530510_0953673 3300061734 Unclassified 656
901 Ga0530510_0999983 3300061734 Bacteria 640
902 Ga0530510_1411162 3300061734 Bacteria 534
903 Ga0105239_12389642
904 JGI25406J46586_10038387
905 JGI26128J50194_1003713
906 JGI25405J52794_10015986
907 Ga0065707_10403385
908 Ga0070676_10008156
909 Ga0070690_100063604
910 Ga0070670_100958661
911 Ga0068869_100038846
912 Ga0068869_101760687
913 Ga0070680_100034611
914 Ga0070680_100073509
915 Ga0070680_100620223
916 Ga0070680_100714173
917 Ga0070680_100908791
918 Ga0070689_100100304
919 Ga0070691_10008258
920 Ga0070691_10066045
921 Ga0070691_10291794
922 Ga0070692_10737496
923 Ga0070669_101777689
924 Ga0070675_100827764
925 Ga0070659_100003351
926 Ga0070667_102239632
927 Ga0070703_10000725
928 Ga0070703_10013794
929 Ga0070703_10049956
930 Ga0070703_10164385
931 Ga0070703_10237788
932 Ga0070701_10118116
933 Ga0070701_10263969
934 Ga0070711_100254664
935 Ga0070705_100045846
936 Ga0070705_100292867
937 Ga0070705_100310618
938 Ga0070705_100343428
939 Ga0070700_100217438
940 Ga0070700_101296842
941 Ga0070694_100005446
942 Ga0070694_100113388
943 Ga0070694_100173168
944 Ga0070694_100353162
945 Ga0070694_100648055
946 Ga0070708_100018280
947 Ga0070708_100022591
948 Ga0070708_100035921
949 Ga0070708_100105423
950 Ga0070708_100163478
951 Ga0070708_100185615
952 Ga0070708_100187271
953 Ga0070708_100229090
954 Ga0070708_100563109
955 Ga0070708_100612113
956 Ga0070708_101200352
957 Ga0070708_101832810
958 Ga0070708_102056074
959 Ga0070678_101790688
960 Ga0070662_100065228
961 Ga0070662_100595371
962 Ga0068867_100177632
963 Ga0068867_100253909
964 Ga0068867_100397257
965 Ga0070685_10280270
966 Ga0070706_100006667
967 Ga0070706_100011568
968 Ga0070706_100013416
969 Ga0070706_100015077
970 Ga0070706_100091241
971 Ga0070706_100125685
972 Ga0070706_100194033
973 Ga0070706_100212173
974 Ga0070706_100451132
975 Ga0070706_100658713
976 Ga0070706_101527574
977 Ga0070707_100002450
978 Ga0070707_100003414
979 Ga0070707_100128152
980 Ga0070707_100143179
981 Ga0070707_100233556
982 Ga0070707_100390875
983 Ga0070707_100465098
984 Ga0070707_101118788
985 Ga0070707_101174785
986 Ga0070707_101456616
987 Ga0070698_100007324
988 Ga0070698_100019917
989 Ga0070698_100020823
990 Ga0070698_100062494
991 Ga0070698_100092124
992 Ga0070698_100266104
993 Ga0070698_100305549
994 Ga0070698_100393556
995 Ga0070698_102165973
996 Ga0070699_100002872
997 Ga0070699_100026475
998 Ga0070699_100028821
999 Ga0070699_100048243
1000 Ga0070699_100088840
1001 Ga0070699_100101950
1002 Ga0070699_100125198
1003 Ga0070699_100664215
1004 Ga0070699_100709929
1005 Ga0070699_100716304
1006 Ga0070699_101548378
1007 Ga0070699_101707823
1008 Ga0070699_102181506
1009 Ga0070684_100129115
1010 Ga0070697_100001072
1011 Ga0070697_100011661
1012 Ga0070697_100028298
1013 Ga0070697_100132698
1014 Ga0070697_100139685
1015 Ga0070697_100328097
1016 Ga0070697_100348063
1017 Ga0070697_100389066
1018 Ga0070697_100460559
1019 Ga0070697_100751897
1020 Ga0070697_101563086
1021 Ga0070697_101704309
1022 Ga0068853_100344100
1023 Ga0070686_100202869
1024 Ga0070695_100004437
1025 Ga0070695_100013763
1026 Ga0070695_100021061
1027 Ga0070695_100023838
1028 Ga0070695_100503036
1029 Ga0070695_100921664
1030 Ga0070696_100029322
1031 Ga0070696_100061231
1032 Ga0070696_100086675
1033 Ga0070696_100284771
1034 Ga0070696_100713084
1035 Ga0070693_100784709
1036 Ga0070704_100085169
1037 Ga0070704_100241986
1038 Ga0070704_100297371
1039 Ga0070704_100405926
1040 Ga0070704_100598656
1041 Ga0070704_100680831
1042 Ga0070704_100855067
1043 Ga0070704_100985374
1044 Ga0070704_101801085
1045 Ga0068857_100014868
1046 Ga0068857_100038717
1047 Ga0068857_101027105
1048 Ga0068854_100856682
1049 Ga0068852_102659985
1050 Ga0068859_100607651
1051 Ga0068859_100812707
1052 Ga0068859_100963791
1053 Ga0068864_100452834
1054 Ga0068866_10578221
1055 Ga0068866_10750958
1056 Ga0068861_100013321
1057 Ga0068861_100208447
1058 Ga0068870_10150696
1059 Ga0068863_100005187
1060 Ga0068863_100482582
1061 Ga0068858_100330633
1062 Ga0068858_100603652
1063 Ga0068860_100001643
1064 Ga0068860_100151860
1065 Ga0068860_100682315
1066 Ga0068860_101046484
1067 Ga0068862_100022944
1068 Ga0068862_100075563
1069 Ga0068862_101343708
1070 Ga0081455_10000261
1071 Ga0081455_10654979
1072 Ga0081538_10010550
1073 Ga0081539_10000069
1074 Ga0070716_100007683
1075 Ga0070712_101046916
1076 Ga0075427_10030829
1077 Ga0075427_10048199
1078 Ga0075428_100007893
1079 Ga0075428_100008824
1080 Ga0075428_100009335
1081 Ga0075428_100048603
1082 Ga0075428_100170462
1083 Ga0075428_100280803
1084 Ga0075428_100739651
1085 Ga0075428_101397629
1086 Ga0075428_101637265
1087 Ga0075430_100000651
1088 Ga0075430_100002531
1089 Ga0075430_100025656
1090 Ga0075430_100040922
1091 Ga0075430_100088076
1092 Ga0075430_100088528
1093 Ga0075430_100260275
1094 Ga0075430_101158270
1095 Ga0075431_100000016
1096 Ga0075431_100000063
1097 Ga0075431_100000691
1098 Ga0075431_100000906
1099 Ga0075431_100003499
1100 Ga0075431_100004979
1101 Ga0075431_100013996
1102 Ga0075431_100015125
1103 Ga0075431_100026408
1104 Ga0075431_100545888
1105 Ga0075431_100766677
1106 Ga0075431_100990496
1107 Ga0075431_101057790
1108 Ga0075433_10000062
1109 Ga0075433_10000079
1110 Ga0075433_10016113
1111 Ga0075433_10073157
1112 Ga0075433_10099845
1113 Ga0075433_10212199
1114 Ga0075433_10213462
1115 Ga0075433_10489880
1116 Ga0075433_10544514
1117 Ga0075433_10842231
1118 Ga0075434_100000486
1119 Ga0075434_100010470
1120 Ga0075434_100018172
1121 Ga0075434_100018606
1122 Ga0075434_100029139
1123 Ga0075434_100072870
1124 Ga0075434_100118583
1125 Ga0075434_100163262
1126 Ga0075434_100224780
1127 Ga0075434_100342202
1128 Ga0075434_100608734
1129 Ga0075434_100883688
1130 Ga0075434_101341080
1131 Ga0075434_101741588
1132 Ga0075429_100002697
1133 Ga0075429_100003138
1134 Ga0075429_100005669
1135 Ga0075429_100054579
1136 Ga0075429_100068491
1137 Ga0075429_100073007
1138 Ga0075429_100558943
1139 Ga0075429_100654248
1140 Ga0075429_100908319
1141 Ga0068865_100137550
1142 Ga0068865_100524870
1143 Ga0075436_100001689
1144 Ga0075436_100022019
1145 Ga0075436_100220608
1146 Ga0075436_100234539
1147 Ga0075436_100310363
1148 Ga0075436_100838585
1149 Ga0097620_100607640
1150 Ga0097620_100812804
1151 Ga0097620_100963468
1152 Ga0075435_100026121
1153 Ga0075435_100038124
1154 Ga0075435_100070166
1155 Ga0075435_100205482
1156 Ga0075435_100492369
1157 Ga0075435_100608683
1158 Ga0075435_100773728
1159 Ga0075435_100823459
1160 Ga0099794_10001549
1161 Ga0099794_10005743
1162 Ga0099794_10131084
1163 Ga0105240_10927577
1164 Ga0111539_10067520
1165 Ga0111539_10223939
1166 Ga0111539_10313888
1167 Ga0105245_10688477
1168 Ga0114129_10000002
1169 Ga0114129_10000093
1170 Ga0114129_10007115
1171 Ga0114129_10010241
1172 Ga0114129_10011506
1173 Ga0114129_10014552
1174 Ga0114129_10017219
1175 Ga0114129_10023149
1176 Ga0114129_10041198
1177 Ga0114129_10041341
1178 Ga0114129_10049117
1179 Ga0114129_10062486
1180 Ga0114129_10077043
1181 Ga0114129_10217953
1182 Ga0114129_10475823
1183 Ga0114129_10502894
1184 Ga0114129_10709387
1185 Ga0114129_11191187
1186 Ga0114129_11289987
1187 Ga0114129_11335453
1188 Ga0114129_11498150
1189 Ga0114129_12475423
1190 Ga0114129_13102790
1191 Ga0105243_10125865
1192 Ga0105243_10632601
1193 Ga0105241_10348471
1194 Ga0105241_10792831
1195 Ga0105241_11545616
1196 Ga0105242_10233353
1197 Ga0105242_10390432
1198 Ga0105242_10585667
1199 Ga0105242_12700294
1200 Ga0105248_10153904
1201 Ga0105249_10042812
1202 Ga0105249_10065289
1203 Ga0105249_11960585
1204 Ga0105249_12311984
1205 Ga0105249_12661313
1206 Ga0105239_12397434
1207 Ga0157371_10298276
1208 Ga0157378_10518294
1209 Ga0157378_12373909
1210 Ga0157378_12859876
1211 Ga0163162_10001333
1212 Ga0163162_10119599
1213 Ga0163162_10650823
1214 Ga0157375_10027047
1215 Ga0157375_10097402
1216 Ga0157375_10454443
1217 Ga0157375_11541216
1218 Ga0157375_11841831
1219 Ga0163163_10512468
1220 Ga0157380_10134638
1221 Ga0157380_10740805
1222 Ga0157379_10314336
1223 Ga0157379_11146766
1224 Ga0207656_10421676
1225 Ga0207653_10006168
1226 Ga0207653_10011139
1227 Ga0207653_10388046
1228 Ga0207642_10236760
1229 Ga0207688_10010118
1230 Ga0207680_10779960
1231 Ga0207699_10477941
1232 Ga0207645_10013441
1233 Ga0207643_10664214
1234 Ga0207684_10001531
1235 Ga0207684_10001738
1236 Ga0207684_10011202
1237 Ga0207684_10041903
1238 Ga0207684_10062527
1239 Ga0207684_10166020
1240 Ga0207684_10170808
1241 Ga0207684_10238133
1242 Ga0207684_10341861
1243 Ga0207684_10402420
1244 Ga0207684_10513928
1245 Ga0207654_10003053
1246 Ga0207663_10080076
1247 Ga0207660_10014059
1248 Ga0207660_10220355
1249 Ga0207646_10001305
1250 Ga0207646_10009124
1251 Ga0207646_10013823
1252 Ga0207646_10020795
1253 Ga0207646_10054597
1254 Ga0207646_10074913
1255 Ga0207646_10117467
1256 Ga0207646_10233382
1257 Ga0207646_10233394
1258 Ga0207646_10622921
1259 Ga0207646_10983217
1260 Ga0207681_10252245
1261 Ga0207687_10468155
1262 Ga0207690_10001453
1263 Ga0207706_10525894
1264 Ga0207706_10528490
1265 Ga0207686_10109710
1266 Ga0207709_10314499
1267 Ga0207709_10518572
1268 Ga0207670_10048096
1269 Ga0207670_10081624
1270 Ga0207670_11205233
1271 Ga0207669_11101631
1272 Ga0207665_10001341
1273 Ga0207691_10058087
1274 Ga0207711_10082901
1275 Ga0207711_11460066
1276 Ga0207689_10540897
1277 Ga0207712_10083137
1278 Ga0207712_10097118
1279 Ga0207712_11126924
1280 Ga0207668_10217268
1281 Ga0207640_10594623
1282 Ga0207640_10891761
1283 Ga0207703_10243477
1284 Ga0207703_10263224
1285 Ga0207708_10059691
1286 Ga0207708_10260744
1287 Ga0207708_10644762
1288 Ga0207641_10043633
1289 Ga0207641_10524953
1290 Ga0207641_11222349
1291 Ga0207648_10001162
1292 Ga0207648_10148415
1293 Ga0207648_10465312
1294 Ga0207648_10639924
1295 Ga0207676_10013719
1296 Ga0207674_10023993
1297 Ga0207674_10109688
1298 Ga0207675_100003114
1299 Ga0207675_100330664
1300 Ga0207698_11924826
1301 Ga0209969_1004189
1302 Ga0209996_1001817
1303 Ga0209984_1000534
1304 Ga0209995_1000699
1305 Ga0209968_1001901
1306 Ga0209968_1065668
1307 Ga0209970_1002557
1308 Ga0210002_1000999
1309 Ga0209983_1000090
1310 Ga0209983_1027191
1311 Ga0209588_1014705
1312 Ga0209588_1028141
1313 Ga0209588_1040451
1314 Ga0209588_1170949
1315 Ga0209971_1002250
1316 Ga0209966_1000024
1317 Ga0209998_10000054
1318 Ga0209974_10000555
1319 Ga0207428_10000193
1320 Ga0207428_10000284
1321 Ga0207428_10094429
1322 Ga0268266_10713808
1323 Ga0268265_10093373
1324 Ga0268265_10176086
1325 Ga0268265_10194972
1326 Ga0268265_10228422
1327 Ga0268265_10433588
1328 Ga0268265_10452288
1329 Ga0268264_10428394
1330 Ga0268264_10948953
1331 Ga0268264_11756414
1332 Ga0307408_100200887
1333 Ga0307408_100263671
1334 Ga0307405_12044802
1335 Ga0307413_10096044
1336 Ga0307410_10121223
1337 Ga0307410_10272598
1338 Ga0307406_10594739
1339 Ga0307409_100247709
1340 Ga0307416_100110372
1341 Ga0307416_103513018
1342 Ga0307414_10208389
1343 Ga0307411_10092240
1344 Ga0373948_0034812
1345 Ga0373959_0141224
1346 Ga0373938_0062010
1347 Ga0373938_0093463
1348 Ga0373929_0121762
1349 Ga0373929_0155510
1350 Ga0373940_0094890
1351 Ga0373940_0195925
1352 Ga0373949_0158619
1353 Ga0373951_0082459
1354 Ga0373952_0020413
1355 Ga0373952_0185666
1356 Ga0373932_0302882
1357 Ga0373939_0045845
1358 Ga0373939_0420299
1359 Ga0373941_0315986
1360 Ga0373961_0018899
1361 Ga0373962_0050782
1362 Ga0373962_0090800
1363 Ga0373962_0333633
1364 Ga0373931_0009689
1365 Ga0373931_0035796
1366 Ga0373947_0512275
1367 Ga0395899_0017675
1368 Ga0395900_0000485
1369 Ga0395900_0044596
1370 Ga0395898_0003712
1371 Ga0395905_0315144
1372 Ga0395901_0002188
1373 Ga0395901_0093842
1374 Ga0242420_086300
1375 Ga0439441_007918
1376 Ga0439448_0211848
1377 Ga0439450_022227
1378 Ga0439455_0020845
1379 Ga0439463_084718
1380 Ga0450913_006401
1381 Ga0450914_014653
1382 Ga0439464_0000215
1383 Ga0439460_0004088
1384 Ga0451577_0004681
1385 Ga0451577_0066131
1386 Ga0451577_0127367
1387 Ga0453683_0006906
1388 Ga0453683_0013349
1389 Ga0453683_0016037
1390 Ga0453684_0493327
1391 Ga0453684_0584327
1392 Ga0451576_0002366
1393 Ga0451576_0072505
1394 Ga0451576_0263731
1395 Ga0451576_0264323
1396 Ga0451576_0358226
1397 Ga0451576_0483306
1398 Ga0451576_0803123
1399 Ga0495603_0105674
1400 Ga0495591_169850
1401 Ga0495580_0029975
1402 Ga0495580_0211747
1403 Ga0495580_0414473
1404 Ga0495580_0592442
1405 Ga0495584_0354518
1406 Ga0495642_0042687
1407 Ga0495642_0050405
1408 Ga0495642_0270378
1409 Ga0495642_0385172
1410 Ga0495598_0390448
1411 Ga0495621_0043768
1412 Ga0495656_0214473
1413 Ga0495659_0077398
1414 Ga0495659_0121395
1415 Ga0495659_0204881
1416 Ga0495659_0257377
1417 Ga0495588_0287289
1418 Ga0495669_0011243
1419 Ga0495669_0074770
1420 Ga0495669_0128613
1421 Ga0495670_0129645
1422 Ga0495636_0097446
1423 Ga0496102_0677834
1424 Ga0496102_1949832
1425 Ga0496104_0934097
1426 Ga0496106_0428241
1427 Ga0496107_0966800
1428 Ga0501032_0101712
1429 Ga0501032_0985603
1430 Ga0501033_0148399
1431 Ga0501033_0573904
1432 Ga0501033_0631332
1433 Ga0501033_0636231
1434 Ga0501036_0038453
1435 Ga0501036_0085535
1436 Ga0501036_0259544
1437 Ga0501036_0340654
1438 Ga0501036_0386051
1439 Ga0501036_0573501
1440 Ga0501037_0108231
1441 Ga0501037_0566113
1442 Ga0501037_0693431
1443 Ga0501038_0001975
1444 Ga0501038_0088179
1445 Ga0501038_0273222
1446 Ga0501038_0353541
1447 Ga0501038_0532633
1448 Ga0501038_0829871
1449 Ga0501038_1051062
1450 Ga0501039_0010475
1451 Ga0501039_0076124
1452 Ga0501039_0080355
1453 Ga0501039_0157937
1454 Ga0501039_0686332
1455 Ga0501039_0760613
1456 Ga0501039_0818427
1457 Ga0501039_1205208
1458 Ga0501040_0011071
1459 Ga0501040_0087574
1460 Ga0501040_0104503
1461 Ga0501040_0134488
1462 Ga0501040_0152716
1463 Ga0501040_0232955
1464 Ga0501040_0240005
1465 Ga0501040_0341864
1466 Ga0501040_0527737
1467 Ga0501040_0843379
1468 Ga0501041_0006959
1469 Ga0501041_0016795
1470 Ga0501041_0085468
1471 Ga0501041_0121420
1472 Ga0501041_0238324
1473 Ga0501041_0529083
1474 Ga0501041_0981824
1475 Ga0501042_0002073
1476 Ga0501042_0112306
1477 Ga0501042_0160828
1478 Ga0501042_0197932
1479 Ga0501042_0387733
1480 Ga0501042_0942251
1481 Ga0501042_1044244
1482 Ga0501043_0096981
1483 Ga0501043_0300726
1484 Ga0501043_0738038
1485 Ga0501043_1116048
1486 Ga0501046_0001074
1487 Ga0501046_0095780
1488 Ga0501046_0213358
1489 Ga0501046_0221842
1490 Ga0501046_0470499
1491 Ga0501046_1012411
1492 Ga0501046_1171220
1493 Ga0501047_0048644
1494 Ga0501048_0009943
1495 Ga0501048_0021451
1496 Ga0501048_0052047
1497 Ga0501048_0268895
1498 Ga0501048_0330950
1499 Ga0501048_1245247
1500 Ga0501067_0111897
1501 Ga0501068_0095607
1502 Ga0501068_0099553
1503 Ga0501068_0151576
1504 Ga0501068_0162507
1505 Ga0501068_0206774
1506 Ga0501068_0770530
1507 Ga0501068_0868840
1508 Ga0501069_0049316
1509 Ga0501069_0230908
1510 Ga0501069_0320082
1511 Ga0501069_0576699
1512 Ga0501070_0504627
1513 Ga0501070_0550978
1514 Ga0501070_0886482
1515 Ga0501070_1228880
1516 Ga0501071_0072657
1517 Ga0501071_0115707
1518 Ga0501071_0116719
1519 Ga0501071_0278719
1520 Ga0501071_0436157
1521 Ga0501071_1003989
1522 Ga0501072_0000423
1523 Ga0501072_0028547
1524 Ga0501072_0072541
1525 Ga0501072_0118894
1526 Ga0501072_0152296
1527 Ga0501072_0154615
1528 Ga0501072_0305689
1529 Ga0501072_0358367
1530 Ga0501072_0562234
1531 Ga0501072_0568878
1532 Ga0501072_0825346
1533 Ga0501073_0141858
1534 Ga0501073_0222743
1535 Ga0501073_0718106
1536 Ga0501074_0002837
1537 Ga0501074_0166720
1538 Ga0501074_0230380
1539 Ga0501074_0597937
1540 Ga0501074_1282675
1541 Ga0501075_0000141
1542 Ga0501075_0011292
1543 Ga0501075_0013083
1544 Ga0501075_0034179
1545 Ga0501075_0115234
1546 Ga0501075_0148767
1547 Ga0501075_0174000
1548 Ga0501075_0204149
1549 Ga0501075_0256326
1550 Ga0501075_0275384
1551 Ga0501075_0300502
1552 Ga0501075_0303137
1553 Ga0501075_0357971
1554 Ga0501075_0548270
1555 Ga0501075_0794054
1556 Ga0501075_0971274
1557 Ga0501076_0000006
1558 Ga0501076_0039553
1559 Ga0501076_0066421
1560 Ga0501076_0069848
1561 Ga0501076_0071264
1562 Ga0501076_0078947
1563 Ga0501076_0212081
1564 Ga0501076_0243327
1565 Ga0501076_0248861
1566 Ga0501076_0422106
1567 Ga0501076_0530583
1568 Ga0501076_0587286
1569 Ga0501076_0602617
1570 Ga0501076_1162091
1571 Ga0501076_1282703
1572 Ga0501076_1548440
1573 Ga0501077_0036932
1574 Ga0501077_0157610
1575 Ga0501077_0185066
1576 Ga0501077_0249042
1577 Ga0501077_0251718
1578 Ga0501077_0268251
1579 Ga0501077_0296442
1580 Ga0501077_0359598
1581 Ga0501077_0384608
1582 Ga0501077_0397930
1583 Ga0501077_0626791
1584 Ga0501077_1077560
1585 Ga0501079_0000821
1586 Ga0501079_0003456
1587 Ga0501079_0011097
1588 Ga0501079_0039920
1589 Ga0501079_0093212
1590 Ga0501079_0098156
1591 Ga0501079_0155483
1592 Ga0501079_0269744
1593 Ga0501079_0377421
1594 Ga0501079_0441374
1595 Ga0501079_0446222
1596 Ga0501079_0464093
1597 Ga0501079_0626325
1598 Ga0501079_0783333
1599 Ga0501079_0941139
1600 Ga0501079_1161743
1601 Ga0501079_1248809
1602 Ga0501079_1414216
1603 Ga0501080_0008268
1604 Ga0501080_0053772
1605 Ga0501080_0091894
1606 Ga0501080_0263173
1607 Ga0501080_0370037
1608 Ga0501080_0373611
1609 Ga0501080_0960601
1610 Ga0501080_1018267
1611 Ga0501080_1618861
1612 Ga0501081_0004035
1613 Ga0501081_0004786
1614 Ga0501081_0017880
1615 Ga0501081_0020424
1616 Ga0501081_0043530
1617 Ga0501081_0069602
1618 Ga0501081_0073728
1619 Ga0501081_0134287
1620 Ga0501081_0145841
1621 Ga0501081_0168379
1622 Ga0501081_0206884
1623 Ga0501081_0344705
1624 Ga0501081_0452954
1625 Ga0501081_0493619
1626 Ga0501081_0649077
1627 Ga0501081_0674880
1628 Ga0501081_0802429
1629 Ga0501081_0930462
1630 Ga0501081_1166788
1631 Ga0501081_1399188
1632 Ga0501083_0067779
1633 Ga0501083_0068461
1634 Ga0501083_0184100
1635 Ga0501083_0279888
1636 Ga0501083_0308239
1637 Ga0501035_0439417
1638 Ga0501035_0745123
1639 Ga0501035_1012270
1640 Ga0501035_1343273
1641 Ga0501045_0002035
1642 Ga0501045_0022959
1643 Ga0501045_0040002
1644 Ga0501045_0131923
1645 Ga0501045_0216607
1646 Ga0501045_0400067
1647 nmdc:mga05p37_100_c1
1648 nmdc:mga05p37_1205158_c1
1649 nmdc:mga05p37_1217749_c1
1650 nmdc:mga05p37_1398_c1
1651 nmdc:mga05p37_156627_c1
1652 nmdc:mga05p37_172083_c1
1653 nmdc:mga05p37_1865925_c1
1654 nmdc:mga05p37_187162_c1
1655 nmdc:mga05p37_1967968_c1
1656 nmdc:mga05p37_199635_c1
1657 nmdc:mga05p37_2195736_c1
1658 nmdc:mga05p37_2_c1
1659 nmdc:mga05p37_308948_c1
1660 nmdc:mga05p37_32611_c1
1661 nmdc:mga05p37_54621_c1
1662 nmdc:mga05p37_591814_c1
1663 nmdc:mga05p37_60011_c1
1664 nmdc:mga05p37_65958_c1
1665 nmdc:mga05p37_73637_c1
1666 nmdc:mga05p37_782820_c1
1667 nmdc:mga05p37_80900_c1
1668 nmdc:mga09592_1445494_c1
1669 nmdc:mga09592_1603692_c1
1670 nmdc:mga09592_223173_c1
1671 nmdc:mga09592_38326_c1
1672 nmdc:mga09592_41672_c1
1673 nmdc:mga09592_5209_c1
1674 nmdc:mga09592_61561_c1
1675 nmdc:mga09592_6169_c1
1676 nmdc:mga09592_72752_c1
1677 nmdc:mga09592_7973_c1
1678 nmdc:mga09592_8801_c1
1679 nmdc:mga0qj67_1635_c1
1680 nmdc:mga0qj67_221090_c1
1681 nmdc:mga0qj67_41676_c1
1682 nmdc:mga0qj67_67818_c1
1683 nmdc:mga0qj67_69696_c1
1684 nmdc:mga0qj67_706964_c1
1685 nmdc:mga0qj67_92293_c1
1686 nmdc:mga06r32_115674_c1
1687 nmdc:mga06r32_11635_c1
1688 nmdc:mga06r32_1262_c1
1689 nmdc:mga06r32_1396_c1
1690 nmdc:mga06r32_157832_c1
1691 nmdc:mga06r32_24249_c1
1692 nmdc:mga06r32_268395_c1
1693 nmdc:mga06r32_483776_c1
1694 nmdc:mga06r32_717279_c1
1695 nmdc:mga06r32_796925_c1
1696 nmdc:mga08y16_161630_c1
1697 nmdc:mga08y16_1725_c1
1698 nmdc:mga08y16_202937_c1
1699 nmdc:mga08y16_270633_c1
1700 nmdc:mga08y16_302896_c1
1701 nmdc:mga08y16_350039_c1
1702 nmdc:mga08y16_8141_c1
1703 nmdc:mga08y16_935_c1
1704 nmdc:mga0n895_1115554_c1
1705 nmdc:mga0n895_114751_c1
1706 nmdc:mga0n895_13802_c1
1707 nmdc:mga0n895_17004_c1
1708 nmdc:mga0n895_1774892_c1
1709 nmdc:mga0n895_182018_c1
1710 nmdc:mga0n895_203890_c1
1711 nmdc:mga0n895_247598_c1
1712 nmdc:mga0n895_268793_c1
1713 nmdc:mga0n895_320097_c1
1714 nmdc:mga0n895_36019_c1
1715 nmdc:mga0n895_41284_c1
1716 nmdc:mga0n895_426_c1
1717 nmdc:mga0n895_7041_c1
1718 nmdc:mga0n895_7798_c1
1719 nmdc:mga0n895_952692_c1
1720 nmdc:mga0rr50_10085_c1
1721 nmdc:mga0rr50_144669_c1
1722 nmdc:mga0rr50_1542927_c1
1723 nmdc:mga0rr50_251865_c1
1724 nmdc:mga0rr50_578787_c1
1725 nmdc:mga0rr50_83578_c1
1726 nmdc:mga0rr50_93782_c1
1727 nmdc:mga0rr50_97756_c1
1728 nmdc:mga0rr50_98681_c1
1729 nmdc:mga08x19_173809_c1
1730 nmdc:mga08x19_294578_c1
1731 nmdc:mga08x19_341294_c1
1732 nmdc:mga08x19_361_c1
1733 nmdc:mga08x19_4703_c1
1734 nmdc:mga08x19_647504_c1
1735 nmdc:mga08x19_708009_c1
1736 nmdc:mga08x19_763495_c1
1737 nmdc:mga0a205_1003392_c1
1738 nmdc:mga0a205_130328_c1
1739 nmdc:mga0a205_142_c1
1740 nmdc:mga0a205_1484_c1
1741 nmdc:mga0a205_202932_c1
1742 nmdc:mga0a205_209393_c1
1743 nmdc:mga0a205_217824_c1
1744 nmdc:mga0a205_225238_c1
1745 nmdc:mga0a205_37577_c1
1746 nmdc:mga0a205_41840_c1
1747 nmdc:mga0a205_535_c1
1748 nmdc:mga0a205_55419_c1
1749 nmdc:mga0a205_743070_c1
1750 nmdc:mga0a205_861_c1
1751 nmdc:mga0a205_933360_c1
1752 Ga0501084_0005292
1753 Ga0501084_0041813
1754 Ga0501084_0051906
1755 Ga0501084_0060263
1756 Ga0501084_0061178
1757 Ga0501084_0229373
1758 Ga0501084_0239525
1759 Ga0501084_0336440
1760 Ga0501084_0673181
1761 Ga0501084_0716705
1762 Ga0501084_0758835
1763 Ga0501084_0906663
1764 Ga0501084_0939469
1765 Ga0501084_1032492
1766 Ga0501084_1376614
1767 Ga0501084_1388920
1768 Ga0501084_1800463
1769 Ga0590075_073578
1770 Ga0501082_0002508
1771 Ga0501082_0012037
1772 Ga0501082_0013916
1773 Ga0501082_0026172
1774 Ga0501082_0037541
1775 Ga0501082_0064387
1776 Ga0501082_0180174
1777 Ga0501082_0241397
1778 Ga0501082_0317291
1779 Ga0501082_0328558
1780 Ga0501082_0572249
1781 Ga0501082_0970766
1782 Ga0501082_1273160
1783 Ga0501082_1716570
1784 Ga0530510_0000001
1785 Ga0530510_0000604
1786 Ga0530510_0002774
1787 Ga0530510_0035782
1788 Ga0530510_0108669
1789 Ga0530510_0126058
1790 Ga0530510_0153109
1791 Ga0530510_0182840
1792 Ga0530510_0204775
1793 Ga0530510_0218573
1794 Ga0530510_0311539
1795 Ga0530510_0314972
1796 Ga0530510_0315954
1797 Ga0530510_0329166
1798 Ga0530510_0357738
1799 Ga0530510_0475296
1800 Ga0530510_0751632
1801 Ga0530510_0751681
1802 Ga0530510_0953673
1803 Ga0530510_0999983
1804 Ga0530510_1411162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

1

52

0.95

Map