F485062

General Info

Members Datasets Scaffolds Average Seq Length
898 224 898 107

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100636320|Ga0070690_1006363202
Length 114
Sequence MAHAHVRRGDLVEVIKGRNKARKDKPPTRGKVLRVLPDEGRVLVEKVNMIKKHQRPTQKLRQGGIIEREGLFSLSNVLLVCSRCDRPARAGTKILADGRKTRVCRRCGESIDKG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
126 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
127 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
128 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
149 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
150 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10317297 3300005289 Bacteria 858
2 Ga0065704_10430950 3300005289 Bacteria 723
3 Ga0065715_10039911 3300005293 Bacteria 912
4 Ga0065707_10005566 3300005295 Bacteria 3127
5 Ga0065707_10772991 3300005295 Unclassified 610
6 Ga0065707_11134497 3300005295 Bacteria 508
7 Ga0070690_100452076 3300005330 Bacteria 953
8 Ga0070690_100515497 3300005330 Bacteria 897
9 Ga0070690_100636320 3300005330 Bacteria 813
10 Ga0070690_100914841 3300005330 Bacteria 687
11 Ga0070690_100943993 3300005330 Bacteria 677
12 Ga0068869_101314509 3300005334 Bacteria 638
13 Ga0070680_100021232 3300005336 Bacteria 5159
14 Ga0070680_100894332 3300005336 Bacteria 766
15 Ga0070689_100161838 3300005340 Bacteria 1810
16 Ga0070692_10034691 3300005345 Bacteria 2550
17 Ga0070692_10297623 3300005345 Bacteria 984
18 Ga0070692_10581771 3300005345 Bacteria 738
19 Ga0070692_10909053 3300005345 Bacteria 609
20 Ga0070668_100090665 3300005347 Bacteria 2408
21 Ga0070669_100089585 3300005353 Bacteria 2305
22 Ga0070669_100137486 3300005353 Bacteria 1880
23 Ga0070669_101076240 3300005353 Bacteria 692
24 Ga0070669_101307848 3300005353 Bacteria 628
25 Ga0070667_101006610 3300005367 Bacteria 778
26 Ga0070703_10008252 3300005406 Bacteria 2929
27 Ga0070703_10119323 3300005406 Bacteria 955
28 Ga0070701_10005353 3300005438 Bacteria 5289
29 Ga0070705_100013153 3300005440 Bacteria 4225
30 Ga0070705_100017087 3300005440 Bacteria 3781
31 Ga0070705_100105983 3300005440 Bacteria 1786
32 Ga0070705_100224139 3300005440 Bacteria 1304
33 Ga0070705_100244644 3300005440 Bacteria 1255
34 Ga0070705_100699778 3300005440 Bacteria 796
35 Ga0070700_100125616 3300005441 Bacteria 1724
36 Ga0070694_100076927 3300005444 Bacteria 2311
37 Ga0070694_100272362 3300005444 Bacteria 1288
38 Ga0070694_100485825 3300005444 Bacteria 981
39 Ga0070694_100592412 3300005444 Bacteria 892
40 Ga0070708_100003463 3300005445 Bacteria 12349
41 Ga0070708_100013141 3300005445 Bacteria 6775
42 Ga0070708_100019434 3300005445 Bacteria 5707
43 Ga0070708_100026250 3300005445 Bacteria 4984
44 Ga0070708_100158164 3300005445 Bacteria 2110
45 Ga0070708_100201875 3300005445 Bacteria 1861
46 Ga0070708_100324467 3300005445 Bacteria 1450
47 Ga0070708_100733247 3300005445 Bacteria 929
48 Ga0070708_100733248 3300005445 Bacteria 929
49 Ga0070708_101658364 3300005445 Bacteria 595
50 Ga0070708_101874054 3300005445 Bacteria 556
51 Ga0070708_102167365 3300005445 Bacteria 514
52 Ga0070663_100754709 3300005455 Bacteria 831
53 Ga0070662_100017188 3300005457 Bacteria 4870
54 Ga0068867_100125054 3300005459 Bacteria 1992
55 Ga0068867_100225325 3300005459 Bacteria 1513
56 Ga0068867_100708131 3300005459 Bacteria 889
57 Ga0068867_101526383 3300005459 Bacteria 623
58 Ga0070706_100001965 3300005467 Bacteria 21177
59 Ga0070706_100019969 3300005467 Bacteria 6177
60 Ga0070706_100024048 3300005467 Bacteria 5609
61 Ga0070706_100093850 3300005467 Bacteria 2784
62 Ga0070706_100280930 3300005467 Bacteria 1554
63 Ga0070706_100713906 3300005467 Bacteria 929
64 Ga0070706_100747054 3300005467 Bacteria 906
65 Ga0070706_101752503 3300005467 Bacteria 565
66 Ga0070706_101953702 3300005467 Bacteria 532
67 Ga0070707_100008827 3300005468 Bacteria 9346
68 Ga0070707_100039526 3300005468 Bacteria 4509
69 Ga0070707_100143317 3300005468 Bacteria 2325
70 Ga0070707_100186579 3300005468 Bacteria 2022
71 Ga0070707_100226753 3300005468 Bacteria 1819
72 Ga0070707_100239655 3300005468 Bacteria 1765
73 Ga0070707_100352809 3300005468 Bacteria 1429
74 Ga0070707_100576550 3300005468 Bacteria 1087
75 Ga0070707_101024720 3300005468 Bacteria 791
76 Ga0070698_100002716 3300005471 Bacteria 19449
77 Ga0070698_100038873 3300005471 Bacteria 4903
78 Ga0070698_100128600 3300005471 Bacteria 2489
79 Ga0070698_100735235 3300005471 Bacteria 929
80 Ga0070698_100735236 3300005471 Bacteria 929
81 Ga0070698_100950825 3300005471 Bacteria 805
82 Ga0070699_100009009 3300005518 Bacteria 8645
83 Ga0070699_100010853 3300005518 Bacteria 7883
84 Ga0070699_100031321 3300005518 Bacteria 4590
85 Ga0070699_100040461 3300005518 Bacteria 4036
86 Ga0070699_100323376 3300005518 Bacteria 1387
87 Ga0070699_100405482 3300005518 Bacteria 1233
88 Ga0070699_100414056 3300005518 Bacteria 1220
89 Ga0070699_100694663 3300005518 Bacteria 929
90 Ga0070699_100943849 3300005518 Bacteria 790
91 Ga0070699_101117734 3300005518 Bacteria 723
92 Ga0070679_100718537 3300005530 Bacteria 942
93 Ga0070679_101018918 3300005530 Bacteria 772
94 Ga0070697_100007608 3300005536 Bacteria 8432
95 Ga0070697_100037448 3300005536 Bacteria 3919
96 Ga0070697_100067619 3300005536 Bacteria 2923
97 Ga0070697_100183333 3300005536 Bacteria 1775
98 Ga0070697_100217547 3300005536 Bacteria 1628
99 Ga0070697_100648879 3300005536 Bacteria 929
100 Ga0070697_100648880 3300005536 Bacteria 929
101 Ga0070697_100761853 3300005536 Bacteria 856
102 Ga0070697_101605869 3300005536 Bacteria 581
103 Ga0070672_101064070 3300005543 Bacteria 718
104 Ga0070695_100006901 3300005545 Bacteria 6724
105 Ga0070695_100362666 3300005545 Bacteria 1089
106 Ga0070696_100018915 3300005546 Bacteria 4663
107 Ga0070696_100047071 3300005546 Bacteria 2992
108 Ga0070696_100060691 3300005546 Bacteria 2644
109 Ga0070696_100191422 3300005546 Bacteria 1523
110 Ga0070696_100495907 3300005546 Bacteria 971
111 Ga0070696_100518606 3300005546 Bacteria 951
112 Ga0070696_101204003 3300005546 Bacteria 640
113 Ga0070693_101455100 3300005547 Bacteria 534
114 Ga0070704_100187993 3300005549 Bacteria 1658
115 Ga0070704_100193667 3300005549 Bacteria 1636
116 Ga0070704_100268124 3300005549 Bacteria 1409
117 Ga0070704_101501862 3300005549 Bacteria 620
118 Ga0070664_101600909 3300005564 Bacteria 617
119 Ga0068857_100046867 3300005577 Bacteria 3836
120 Ga0068857_100949469 3300005577 Bacteria 826
121 Ga0068854_100590113 3300005578 Bacteria 947
122 Ga0068854_101289732 3300005578 Bacteria 657
123 Ga0070702_100176299 3300005615 Bacteria 1395
124 Ga0070702_100658836 3300005615 Bacteria 793
125 Ga0068859_100071027 3300005617 Bacteria 3517
126 Ga0068859_100961950 3300005617 Bacteria 937
127 Ga0068866_10943440 3300005718 Bacteria 609
128 Ga0068866_11069242 3300005718 Bacteria 577
129 Ga0068866_11127799 3300005718 Bacteria 563
130 Ga0068861_100922776 3300005719 Bacteria 828
131 Ga0068870_10169661 3300005840 Bacteria 1301
132 Ga0068863_100043410 3300005841 Bacteria 4269
133 Ga0068863_100967447 3300005841 Bacteria 853
134 Ga0068863_101692915 3300005841 Bacteria 642
135 Ga0068858_101022397 3300005842 Bacteria 810
136 Ga0068858_101530007 3300005842 Bacteria 658
137 Ga0068860_100022088 3300005843 Bacteria 6159
138 Ga0068860_100036271 3300005843 Bacteria 4725
139 Ga0068860_100325993 3300005843 Bacteria 1508
140 Ga0068862_100193511 3300005844 Bacteria 1831
141 Ga0068862_100209979 3300005844 Bacteria 1759
142 Ga0068862_100273868 3300005844 Bacteria 1545
143 Ga0068862_100954461 3300005844 Bacteria 846
144 Ga0081455_10065534 3300005937 Bacteria 3038
145 Ga0081455_10469097 3300005937 Bacteria 855
146 Ga0081540_1121483 3300005983 Bacteria 1083
147 Ga0081540_1202013 3300005983 Bacteria 722
148 Ga0081539_10001809 3300005985 Bacteria 33796
149 Ga0075432_10077243 3300006058 Bacteria 1203
150 Ga0075432_10101556 3300006058 Bacteria 1063
151 Ga0075432_10181897 3300006058 Bacteria 823
152 Ga0070715_10671350 3300006163 Bacteria 616
153 Ga0070715_11045397 3300006163 Unclassified 511
154 Ga0070712_100014991 3300006175 Bacteria 4983
155 Ga0075428_100002425 3300006844 Bacteria 20258
156 Ga0075428_100003976 3300006844 Bacteria 16226
157 Ga0075428_100007571 3300006844 Bacteria 12033
158 Ga0075428_100054721 3300006844 Bacteria 4373
159 Ga0075428_100071069 3300006844 Bacteria 3804
160 Ga0075428_100137079 3300006844 Bacteria 2661
161 Ga0075428_100149371 3300006844 Bacteria 2538
162 Ga0075428_100362358 3300006844 Bacteria 1555
163 Ga0075428_101105534 3300006844 Bacteria 837
164 Ga0075428_101611853 3300006844 Bacteria 678
165 Ga0075428_101637166 3300006844 Bacteria 672
166 Ga0075430_100000851 3300006846 Bacteria 23937
167 Ga0075430_100002159 3300006846 Bacteria 16284
168 Ga0075430_100004590 3300006846 Bacteria 11623
169 Ga0075430_100037664 3300006846 Bacteria 4099
170 Ga0075430_100058518 3300006846 Bacteria 3240
171 Ga0075430_100094860 3300006846 Bacteria 2494
172 Ga0075430_100177136 3300006846 Bacteria 1774
173 Ga0075430_100763745 3300006846 Bacteria 797
174 Ga0075431_100000559 3300006847 Bacteria 31330
175 Ga0075431_100003805 3300006847 Bacteria 14672
176 Ga0075431_100004746 3300006847 Bacteria 13363
177 Ga0075431_100006659 3300006847 Bacteria 11475
178 Ga0075431_100006978 3300006847 Bacteria 11229
179 Ga0075431_100011238 3300006847 Bacteria 9017
180 Ga0075431_100028459 3300006847 Bacteria 5743
181 Ga0075431_100044099 3300006847 Bacteria 4600
182 Ga0075431_100060059 3300006847 Bacteria 3924
183 Ga0075431_100063119 3300006847 Bacteria 3822
184 Ga0075431_100120372 3300006847 Bacteria 2709
185 Ga0075431_100287972 3300006847 Bacteria 1662
186 Ga0075431_100520668 3300006847 Bacteria 1179
187 Ga0075431_100522967 3300006847 Bacteria 1176
188 Ga0075431_100754111 3300006847 Bacteria 949
189 Ga0075433_10000942 3300006852 Bacteria 20529
190 Ga0075433_10047049 3300006852 Bacteria 3752
191 Ga0075433_10063809 3300006852 Bacteria 3228
192 Ga0075433_10237955 3300006852 Bacteria 1616
193 Ga0075433_10239061 3300006852 Bacteria 1612
194 Ga0075433_10282741 3300006852 Bacteria 1470
195 Ga0075433_10384123 3300006852 Bacteria 1240
196 Ga0075433_10453840 3300006852 Bacteria 1130
197 Ga0075433_10524968 3300006852 Bacteria 1041
198 Ga0075433_10595211 3300006852 Bacteria 971
199 Ga0075433_11119286 3300006852 Bacteria 684
200 Ga0075434_100015284 3300006871 Bacteria 7357
201 Ga0075434_100090005 3300006871 Bacteria 3070
202 Ga0075434_100096177 3300006871 Bacteria 2967
203 Ga0075434_100135357 3300006871 Bacteria 2483
204 Ga0075434_100505789 3300006871 Bacteria 1229
205 Ga0075434_100515174 3300006871 Bacteria 1217
206 Ga0075434_100516361 3300006871 Bacteria 1215
207 Ga0075434_100652696 3300006871 Bacteria 1070
208 Ga0075434_100760493 3300006871 Bacteria 986
209 Ga0075434_100889679 3300006871 Bacteria 905
210 Ga0075434_101121174 3300006871 Bacteria 800
211 Ga0075429_100000843 3300006880 Bacteria 24082
212 Ga0075429_100010320 3300006880 Bacteria 8081
213 Ga0075429_100030300 3300006880 Bacteria 4700
214 Ga0075429_100033384 3300006880 Bacteria 4471
215 Ga0075429_100062025 3300006880 Bacteria 3257
216 Ga0075429_100147777 3300006880 Bacteria 2057
217 Ga0075429_100198864 3300006880 Bacteria 1756
218 Ga0075429_100228590 3300006880 Bacteria 1629
219 Ga0075429_100349809 3300006880 Bacteria 1294
220 Ga0075429_100544913 3300006880 Bacteria 1017
221 Ga0075429_100745639 3300006880 Bacteria 858
222 Ga0075429_101138265 3300006880 Bacteria 681
223 Ga0075436_100139569 3300006914 Bacteria 1703
224 Ga0075436_100155188 3300006914 Bacteria 1612
225 Ga0075436_100186928 3300006914 Bacteria 1465
226 Ga0075436_100234212 3300006914 Bacteria 1305
227 Ga0075436_100256880 3300006914 Bacteria 1245
228 Ga0075436_100362033 3300006914 Bacteria 1046
229 Ga0075436_100400407 3300006914 Bacteria 995
230 Ga0075436_100673815 3300006914 Bacteria 765
231 Ga0075436_100891436 3300006914 Bacteria 665
232 Ga0097620_100071027 3300006931 Bacteria 3517
233 Ga0097620_100961988 3300006931 Bacteria 937
234 Ga0075435_100010307 3300007076 Bacteria 6829
235 Ga0075435_100023920 3300007076 Bacteria 4733
236 Ga0075435_100051537 3300007076 Bacteria 3316
237 Ga0075435_100060603 3300007076 Bacteria 3068
238 Ga0075435_100168335 3300007076 Bacteria 1848
239 Ga0075435_100176675 3300007076 Bacteria 1803
240 Ga0075435_100269734 3300007076 Bacteria 1451
241 Ga0075435_100354681 3300007076 Bacteria 1257
242 Ga0075435_100365157 3300007076 Bacteria 1239
243 Ga0075435_100433484 3300007076 Bacteria 1133
244 Ga0075435_101739753 3300007076 Bacteria 547
245 Ga0099794_10000935 3300007265 Bacteria 9858
246 Ga0099794_10049877 3300007265 Bacteria 2012
247 Ga0099794_10319134 3300007265 Bacteria 806
248 Ga0099794_10340455 3300007265 Bacteria 779
249 Ga0105240_12127495 3300009093 Bacteria 582
250 Ga0111539_10000675 3300009094 Bacteria 44135
251 Ga0111539_10021054 3300009094 Bacteria 8031
252 Ga0111539_10029559 3300009094 Bacteria 6672
253 Ga0111539_10054750 3300009094 Bacteria 4745
254 Ga0111539_10160027 3300009094 Bacteria 2634
255 Ga0111539_10178384 3300009094 Bacteria 2481
256 Ga0111539_10970421 3300009094 Bacteria 988
257 Ga0111539_11017208 3300009094 Bacteria 963
258 Ga0111539_11210942 3300009094 Bacteria 877
259 Ga0111539_12283805 3300009094 Bacteria 628
260 Ga0105245_10655121 3300009098 Bacteria 1080
261 Ga0114129_10000431 3300009147 Bacteria 49869
262 Ga0114129_10000487 3300009147 Bacteria 47969
263 Ga0114129_10011322 3300009147 Bacteria 12707
264 Ga0114129_10013876 3300009147 Bacteria 11480
265 Ga0114129_10022212 3300009147 Bacteria 9007
266 Ga0114129_10033145 3300009147 Bacteria 7299
267 Ga0114129_10036838 3300009147 Bacteria 6907
268 Ga0114129_10052065 3300009147 Bacteria 5746
269 Ga0114129_10084126 3300009147 Bacteria 4418
270 Ga0114129_10194135 3300009147 Bacteria 2755
271 Ga0114129_10198299 3300009147 Bacteria 2721
272 Ga0114129_10206562 3300009147 Bacteria 2657
273 Ga0114129_10229113 3300009147 Bacteria 2503
274 Ga0114129_10307783 3300009147 Bacteria 2110
275 Ga0114129_11062991 3300009147 Bacteria 1015
276 Ga0114129_11214155 3300009147 Bacteria 939
277 Ga0114129_11330911 3300009147 Bacteria 889
278 Ga0114129_12129555 3300009147 Bacteria 676
279 Ga0105243_10006180 3300009148 Bacteria 9262
280 Ga0105243_10139419 3300009148 Bacteria 2067
281 Ga0105243_11565425 3300009148 Bacteria 685
282 Ga0105243_12798269 3300009148 Bacteria 528
283 Ga0105242_10014946 3300009176 Bacteria 6017
284 Ga0105242_10222343 3300009176 Bacteria 1688
285 Ga0105242_10417053 3300009176 Bacteria 1257
286 Ga0105242_10553969 3300009176 Bacteria 1103
287 Ga0105248_10736718 3300009177 Bacteria 1112
288 Ga0105248_11897990 3300009177 Bacteria 676
289 Ga0105249_10025833 3300009553 Bacteria 5289
290 Ga0105249_10154628 3300009553 Bacteria 2211
291 Ga0105249_10209532 3300009553 Bacteria 1912
292 Ga0105249_10788316 3300009553 Bacteria 1014
293 Ga0105249_11705366 3300009553 Bacteria 702
294 Ga0157371_10050789 3300013102 Bacteria 2947
295 Ga0157378_10095871 3300013297 Bacteria 2702
296 Ga0157378_10540139 3300013297 Bacteria 1170
297 Ga0163162_10017924 3300013306 Bacteria 6929
298 Ga0163162_10679264 3300013306 Bacteria 1152
299 Ga0163162_11729240 3300013306 Bacteria 714
300 Ga0163162_13064193 3300013306 Bacteria 537
301 Ga0157375_10018537 3300013308 Bacteria 6314
302 Ga0157375_10720572 3300013308 Bacteria 1150
303 Ga0157380_10173845 3300014326 Bacteria 1885
304 Ga0157380_10178128 3300014326 Bacteria 1865
305 Ga0157380_10679101 3300014326 Bacteria 1032
306 Ga0157380_11819426 3300014326 Bacteria 668
307 Ga0163161_10055270 3300017792 Bacteria 2882
308 Ga0207653_10003065 3300025885 Bacteria 5303
309 Ga0207653_10019316 3300025885 Bacteria 2149
310 Ga0207642_10047798 3300025899 Bacteria 1915
311 Ga0207642_10769696 3300025899 Bacteria 611
312 Ga0207688_10383631 3300025901 Bacteria 869
313 Ga0207647_10508007 3300025904 Bacteria 671
314 Ga0207645_10146185 3300025907 Bacteria 1541
315 Ga0207643_10175728 3300025908 Bacteria 1294
316 Ga0207643_10584459 3300025908 Bacteria 718
317 Ga0207684_10000456 3300025910 Bacteria 53373
318 Ga0207684_10017002 3300025910 Bacteria 6248
319 Ga0207684_10026777 3300025910 Bacteria 4916
320 Ga0207684_10080224 3300025910 Bacteria 2776
321 Ga0207684_10109559 3300025910 Bacteria 2364
322 Ga0207684_10171017 3300025910 Bacteria 1873
323 Ga0207684_10213434 3300025910 Bacteria 1665
324 Ga0207684_10620920 3300025910 Bacteria 922
325 Ga0207684_10908464 3300025910 Bacteria 740
326 Ga0207684_11161508 3300025910 Bacteria 641
327 Ga0207684_11612903 3300025910 Bacteria 525
328 Ga0207654_10120612 3300025911 Bacteria 1646
329 Ga0207707_10180263 3300025912 Bacteria 1844
330 Ga0207693_10022725 3300025915 Bacteria 4982
331 Ga0207660_10004571 3300025917 Bacteria 9014
332 Ga0207660_10007743 3300025917 Bacteria 6956
333 Ga0207660_10578476 3300025917 Bacteria 914
334 Ga0207652_10537263 3300025921 Bacteria 1051
335 Ga0207646_10006057 3300025922 Bacteria 12598
336 Ga0207646_10010658 3300025922 Bacteria 8950
337 Ga0207646_10071164 3300025922 Bacteria 3106
338 Ga0207646_10147634 3300025922 Bacteria 2119
339 Ga0207646_10202508 3300025922 Bacteria 1793
340 Ga0207646_10552664 3300025922 Bacteria 1035
341 Ga0207646_10723825 3300025922 Bacteria 889
342 Ga0207646_10811274 3300025922 Bacteria 833
343 Ga0207646_11932812 3300025922 Bacteria 502
344 Ga0207681_10124378 3300025923 Bacteria 1896
345 Ga0207681_10253810 3300025923 Bacteria 1374
346 Ga0207681_10682272 3300025923 Bacteria 853
347 Ga0207681_11084822 3300025923 Bacteria 672
348 Ga0207706_10027307 3300025933 Bacteria 5105
349 Ga0207706_10096144 3300025933 Bacteria 2605
350 Ga0207706_11324814 3300025933 Bacteria 594
351 Ga0207686_10026045 3300025934 Bacteria 3410
352 Ga0207686_10232701 3300025934 Bacteria 1337
353 Ga0207709_10042714 3300025935 Bacteria 2729
354 Ga0207709_10538417 3300025935 Bacteria 917
355 Ga0207704_11494053 3300025938 Bacteria 580
356 Ga0207691_10026046 3300025940 Bacteria 5489
357 Ga0207691_10827251 3300025940 Bacteria 777
358 Ga0207691_11183169 3300025940 Bacteria 634
359 Ga0207712_10194757 3300025961 Bacteria 1602
360 Ga0207712_11137290 3300025961 Bacteria 696
361 Ga0207712_11862753 3300025961 Bacteria 539
362 Ga0207668_10031147 3300025972 Bacteria 3511
363 Ga0207678_10632085 3300026067 Bacteria 940
364 Ga0207708_10193343 3300026075 Bacteria 1621
365 Ga0207708_10635098 3300026075 Bacteria 908
366 Ga0207708_10660743 3300026075 Bacteria 890
367 Ga0207641_10195572 3300026088 Bacteria 1861
368 Ga0207641_10400304 3300026088 Bacteria 1318
369 Ga0207641_10929995 3300026088 Bacteria 864
370 Ga0207648_10017195 3300026089 Bacteria 6590
371 Ga0207648_10184040 3300026089 Bacteria 1849
372 Ga0207648_10234708 3300026089 Bacteria 1632
373 Ga0207648_11275735 3300026089 Bacteria 690
374 Ga0207674_10124226 3300026116 Bacteria 2547
375 Ga0207675_100151804 3300026118 Bacteria 2205
376 Ga0207683_11149787 3300026121 Bacteria 720
377 Ga0207698_11307224 3300026142 Bacteria 740
378 Ga0209984_1022750 3300027424 Bacteria 864
379 Ga0209995_1021355 3300027471 Bacteria 1073
380 Ga0209999_1069839 3300027543 Bacteria 673
381 Ga0209983_1013604 3300027665 Bacteria 1673
382 Ga0209983_1015634 3300027665 Bacteria 1565
383 Ga0209588_1012039 3300027671 Bacteria 2622
384 Ga0209588_1028511 3300027671 Bacteria 1777
385 Ga0209588_1166301 3300027671 Bacteria 695
386 Ga0209971_1043870 3300027682 Bacteria 1078
387 Ga0209971_1062339 3300027682 Bacteria 903
388 Ga0209966_1009422 3300027695 Bacteria 1744
389 Ga0209966_1017817 3300027695 Bacteria 1356
390 Ga0209998_10018662 3300027717 Bacteria 1474
391 Ga0209974_10033649 3300027876 Bacteria 1701
392 Ga0209974_10214664 3300027876 Bacteria 714
393 Ga0209974_10445658 3300027876 Bacteria 513
394 Ga0207428_10000095 3300027907 Bacteria 123199
395 Ga0207428_10000487 3300027907 Bacteria 47438
396 Ga0207428_10009686 3300027907 Bacteria 8632
397 Ga0207428_10235905 3300027907 Bacteria 1368
398 Ga0268265_10086615 3300028380 Bacteria 2490
399 Ga0268265_10187202 3300028380 Bacteria 1784
400 Ga0268265_10274353 3300028380 Bacteria 1506
401 Ga0268265_10933136 3300028380 Bacteria 854
402 Ga0268264_10137532 3300028381 Bacteria 2174
403 Ga0268264_10155241 3300028381 Bacteria 2056
404 Ga0268264_10506776 3300028381 Bacteria 1178
405 Ga0307408_100006349 3300031548 Bacteria 7843
406 Ga0307408_100019777 3300031548 Bacteria 4536
407 Ga0307408_100076778 3300031548 Bacteria 2486
408 Ga0307408_100141580 3300031548 Bacteria 1888
409 Ga0307413_11403768 3300031824 Bacteria 614
410 Ga0307410_10703073 3300031852 Bacteria 852
411 Ga0307410_10822148 3300031852 Bacteria 791
412 Ga0307406_10450772 3300031901 Bacteria 1032
413 Ga0307407_10139639 3300031903 Bacteria 1561
414 Ga0307407_11077132 3300031903 Bacteria 624
415 Ga0307409_100943405 3300031995 Bacteria 878
416 Ga0307409_101829446 3300031995 Bacteria 636
417 Ga0307416_101083771 3300032002 Bacteria 905
418 Ga0307416_101410754 3300032002 Bacteria 802
419 Ga0307416_102208863 3300032002 Bacteria 651
420 Ga0307414_10545910 3300032004 Bacteria 1032
421 Ga0307411_10011154 3300032005 Bacteria 4834
422 Ga0307411_10686226 3300032005 Bacteria 890
423 Ga0307411_11006500 3300032005 Bacteria 746
424 Ga0307415_101762651 3300032126 Bacteria 598
425 Ga0307415_102354265 3300032126 Bacteria 523
426 Ga0373948_0114363 3300034817 Bacteria 647
427 Ga0373950_0086002 3300034818 Bacteria 662
428 Ga0373958_0008605 3300034819 Bacteria 1659
429 Ga0373958_0147098 3300034819 Bacteria 587
430 Ga0373959_0182483 3300034820 Bacteria 546
431 Ga0373940_0067883 3300035088 Bacteria 1032
432 Ga0373949_0087794 3300035090 Bacteria 837
433 Ga0373951_0072212 3300035091 Bacteria 881
434 Ga0373932_0114435 3300035112 Bacteria 893
435 Ga0373939_0029277 3300035114 Bacteria 1574
436 Ga0373939_0051324 3300035114 Bacteria 1282
437 Ga0373939_0235327 3300035114 Bacteria 707
438 Ga0373941_0051909 3300035115 Bacteria 1306
439 Ga0373941_0086478 3300035115 Bacteria 1068
440 Ga0373942_0011047 3300035207 Bacteria 2135
441 Ga0373942_0110847 3300035207 Bacteria 848
442 Ga0373942_0265321 3300035207 Bacteria 587
443 Ga0373961_0052139 3300035241 Bacteria 1217
444 Ga0373962_0043496 3300035242 Bacteria 1273
445 Ga0373962_0185651 3300035242 Bacteria 697
446 Ga0373931_0002096 3300035691 Bacteria 8774
447 Ga0373931_0002585 3300035691 Bacteria 8062
448 Ga0373931_0323102 3300035691 Bacteria 959
449 Ga0373931_0787443 3300035691 Bacteria 633
450 Ga0316582_0534334 3300036647 Bacteria 808
451 Ga0395899_0008260 3300037312 Bacteria 8020
452 Ga0395899_0350728 3300037312 Bacteria 987
453 Ga0395900_0001056 3300037418 Bacteria 35315
454 Ga0395900_0242558 3300037418 Bacteria 1807
455 Ga0395900_0346351 3300037418 Bacteria 1460
456 Ga0395898_0013165 3300037466 Bacteria 8524
457 Ga0395905_0097819 3300037471 Bacteria 2756
458 Ga0316581_0046583 3300037588 Bacteria 1326
459 Ga0395901_0002023 3300038443 Bacteria 20845
460 Ga0395901_0107826 3300038443 Bacteria 2924
461 Ga0395901_1066364 3300038443 Bacteria 780
462 Ga0242420_001624 3300038996 Bacteria 3049
463 Ga0242420_035298 3300038996 Bacteria 940
464 Ga0242420_091411 3300038996 Bacteria 639
465 Ga0439461_0039751 3300041410 Bacteria 1012
466 Ga0451795_0988203 3300041456 Bacteria 863
467 Ga0439443_046264 3300042003 Bacteria 753
468 Ga0439456_065495 3300042013 Bacteria 802
469 Ga0439434_0191369 3300042435 Bacteria 687
470 Ga0439435_0016753 3300042436 Bacteria 1843
471 Ga0439435_0227322 3300042436 Bacteria 622
472 Ga0451577_0010501 3300042876 Bacteria 8843
473 Ga0451577_0053816 3300042876 Bacteria 3593
474 Ga0451577_0624024 3300042876 Bacteria 978
475 Ga0451577_0749916 3300042876 Bacteria 883
476 Ga0451577_0897007 3300042876 Bacteria 798
477 Ga0451577_1389163 3300042876 Bacteria 623
478 Ga0453683_0004189 3300044673 Bacteria 10317
479 Ga0453683_0261819 3300044673 Bacteria 1103
480 Ga0453684_0010446 3300044712 Bacteria 15876
481 Ga0453684_0219137 3300044712 Bacteria 2206
482 Ga0451576_0001624 3300045051 Bacteria 37678
483 Ga0451576_0081297 3300045051 Bacteria 3369
484 Ga0451576_0168635 3300045051 Bacteria 2285
485 Ga0451576_0178931 3300045051 Bacteria 2214
486 Ga0451576_0515794 3300045051 Bacteria 1256
487 Ga0451576_1170676 3300045051 Bacteria 803
488 Ga0495603_0188955 3300046455 Bacteria 1191
489 Ga0495580_0000020 3300046472 Bacteria 91314
490 Ga0495594_0460160 3300046499 Bacteria 723
491 Ga0495630_0709232 3300046517 Bacteria 770
492 Ga0495642_0029511 3300046528 Bacteria 2190
493 Ga0495654_0262300 3300046530 Bacteria 716
494 Ga0495654_0272344 3300046530 Bacteria 699
495 Ga0495598_0067749 3300046537 Bacteria 1117
496 Ga0495609_0382466 3300046538 Bacteria 565
497 Ga0495621_0535525 3300046539 Bacteria 508
498 Ga0495656_0592851 3300046615 Bacteria 593
499 Ga0495659_0062883 3300046664 Bacteria 1375
500 Ga0495659_0094409 3300046664 Bacteria 1152
501 Ga0495659_0158172 3300046664 Bacteria 913
502 Ga0495669_0069259 3300046684 Bacteria 1606
503 Ga0495669_0124712 3300046684 Bacteria 1209
504 Ga0495669_0220864 3300046684 Bacteria 908
505 Ga0495669_0536456 3300046684 Bacteria 569
506 Ga0495670_0419911 3300046691 Bacteria 723
507 Ga0495636_0061680 3300047318 Bacteria 1586
508 Ga0495636_0066615 3300047318 Bacteria 1531
509 Ga0495636_0089909 3300047318 Bacteria 1332
510 Ga0495636_0480978 3300047318 Bacteria 599
511 Ga0495677_0414427 3300047445 Bacteria 533
512 Ga0496103_0041890 3300048906 Bacteria 2816
513 Ga0496104_0113222 3300048907 Bacteria 2602
514 Ga0496107_0462407 3300048910 Bacteria 942
515 Ga0501311_104467 3300049527 Bacteria 504
516 Ga0501317_063254 3300049533 Bacteria 611
517 Ga0501031_0302505 3300049568 Bacteria 1036
518 Ga0501031_0357083 3300049568 Bacteria 946
519 Ga0501031_0412632 3300049568 Bacteria 873
520 Ga0501031_0724032 3300049568 Bacteria 638
521 Ga0501032_0036421 3300049569 Bacteria 3358
522 Ga0501032_0146588 3300049569 Bacteria 1554
523 Ga0501033_0023237 3300049570 Bacteria 4677
524 Ga0501033_0124456 3300049570 Bacteria 1870
525 Ga0501033_0126989 3300049570 Bacteria 1849
526 Ga0501033_0227538 3300049570 Bacteria 1326
527 Ga0501033_0706061 3300049570 Bacteria 686
528 Ga0501036_0002708 3300049572 Bacteria 13991
529 Ga0501036_0028611 3300049572 Bacteria 4709
530 Ga0501036_0191427 3300049572 Bacteria 1721
531 Ga0501036_0511097 3300049572 Bacteria 999
532 Ga0501036_1285326 3300049572 Unclassified 595
533 Ga0501037_0239711 3300049573 Bacteria 1271
534 Ga0501038_0001811 3300049574 Bacteria 19789
535 Ga0501038_0021614 3300049574 Bacteria 5773
536 Ga0501038_0069689 3300049574 Bacteria 2987
537 Ga0501038_0125620 3300049574 Bacteria 2112
538 Ga0501038_0275060 3300049574 Bacteria 1327
539 Ga0501038_0879224 3300049574 Bacteria 662
540 Ga0501039_0001335 3300049575 Bacteria 18046
541 Ga0501039_0016831 3300049575 Bacteria 5604
542 Ga0501039_0048162 3300049575 Bacteria 3295
543 Ga0501039_0052922 3300049575 Bacteria 3141
544 Ga0501039_0077957 3300049575 Bacteria 2577
545 Ga0501039_0388386 3300049575 Bacteria 1096
546 Ga0501039_0819240 3300049575 Bacteria 726
547 Ga0501039_1308892 3300049575 Bacteria 559
548 Ga0501040_0006127 3300049576 Bacteria 7800
549 Ga0501040_0022910 3300049576 Bacteria 4184
550 Ga0501040_0035873 3300049576 Bacteria 3364
551 Ga0501040_0046459 3300049576 Bacteria 2964
552 Ga0501040_0047939 3300049576 Bacteria 2919
553 Ga0501040_0055782 3300049576 Bacteria 2710
554 Ga0501040_0179547 3300049576 Bacteria 1500
555 Ga0501040_0230681 3300049576 Bacteria 1318
556 Ga0501040_0249342 3300049576 Bacteria 1266
557 Ga0501040_0290496 3300049576 Bacteria 1168
558 Ga0501040_0428924 3300049576 Bacteria 951
559 Ga0501040_0597530 3300049576 Bacteria 797
560 Ga0501041_0000355 3300049577 Bacteria 22648
561 Ga0501041_0009982 3300049577 Bacteria 5594
562 Ga0501041_0039483 3300049577 Bacteria 2865
563 Ga0501041_0047899 3300049577 Bacteria 2603
564 Ga0501041_0057508 3300049577 Bacteria 2378
565 Ga0501041_0150271 3300049577 Bacteria 1454
566 Ga0501041_0294387 3300049577 Bacteria 1022
567 Ga0501042_0000948 3300049578 Bacteria 16341
568 Ga0501042_0009210 3300049578 Bacteria 6570
569 Ga0501042_0079238 3300049578 Bacteria 2353
570 Ga0501042_0104718 3300049578 Bacteria 2036
571 Ga0501042_0146652 3300049578 Bacteria 1701
572 Ga0501042_0299781 3300049578 Bacteria 1161
573 Ga0501042_0307713 3300049578 Bacteria 1145
574 Ga0501042_0574113 3300049578 Bacteria 820
575 Ga0501042_0618715 3300049578 Unclassified 787
576 Ga0501043_0015166 3300049579 Bacteria 6033
577 Ga0501043_0345983 3300049579 Bacteria 1130
578 Ga0501043_0378606 3300049579 Bacteria 1072
579 Ga0501043_1327154 3300049579 Bacteria 501
580 Ga0501046_0005447 3300049580 Bacteria 11377
581 Ga0501046_0012349 3300049580 Bacteria 7275
582 Ga0501046_0026001 3300049580 Bacteria 4784
583 Ga0501046_0026439 3300049580 Bacteria 4741
584 Ga0501046_0181571 3300049580 Bacteria 1573
585 Ga0501046_0201356 3300049580 Bacteria 1481
586 Ga0501046_0265656 3300049580 Bacteria 1260
587 Ga0501046_0343037 3300049580 Bacteria 1085
588 Ga0501046_0345292 3300049580 Bacteria 1081
589 Ga0501046_0560205 3300049580 Bacteria 814
590 Ga0501046_0795560 3300049580 Unclassified 663
591 Ga0501048_0003958 3300049582 Bacteria 11254
592 Ga0501048_0033102 3300049582 Bacteria 3736
593 Ga0501048_0064638 3300049582 Bacteria 2587
594 Ga0501048_0166958 3300049582 Bacteria 1559
595 Ga0501048_0204094 3300049582 Bacteria 1401
596 Ga0501048_0264199 3300049582 Bacteria 1223
597 Ga0501048_0279976 3300049582 Bacteria 1186
598 Ga0501048_0292054 3300049582 Bacteria 1159
599 Ga0501048_0569748 3300049582 Bacteria 813
600 Ga0501048_1103762 3300049582 Unclassified 571
601 Ga0501067_0010535 3300049583 Bacteria 5119
602 Ga0501067_0081084 3300049583 Bacteria 1799
603 Ga0501068_0035130 3300049584 Bacteria 2991
604 Ga0501068_0101791 3300049584 Bacteria 1781
605 Ga0501068_0124913 3300049584 Bacteria 1606
606 Ga0501068_0158011 3300049584 Bacteria 1428
607 Ga0501068_0222894 3300049584 Bacteria 1199
608 Ga0501068_0443368 3300049584 Bacteria 839
609 Ga0501068_0837620 3300049584 Unclassified 604
610 Ga0501069_0342336 3300049585 Bacteria 881
611 Ga0501069_0550750 3300049585 Bacteria 690
612 Ga0501069_0563134 3300049585 Bacteria 682
613 Ga0501069_0615818 3300049585 Bacteria 652
614 Ga0501070_0184400 3300049586 Bacteria 1717
615 Ga0501070_0214296 3300049586 Bacteria 1580
616 Ga0501070_0656591 3300049586 Bacteria 832
617 Ga0501071_0000849 3300049587 Bacteria 16382
618 Ga0501071_0045651 3300049587 Bacteria 3145
619 Ga0501071_0067984 3300049587 Bacteria 2592
620 Ga0501071_0697079 3300049587 Bacteria 782
621 Ga0501071_0849012 3300049587 Bacteria 704
622 Ga0501071_0902348 3300049587 Bacteria 682
623 Ga0501071_0914188 3300049587 Bacteria 677
624 Ga0501071_1140949 3300049587 Bacteria 602
625 Ga0501071_1279969 3300049587 Bacteria 566
626 Ga0501072_0003324 3300049588 Bacteria 12098
627 Ga0501072_0005776 3300049588 Bacteria 9420
628 Ga0501072_0014068 3300049588 Bacteria 6132
629 Ga0501072_0016222 3300049588 Bacteria 5713
630 Ga0501072_0054889 3300049588 Bacteria 3140
631 Ga0501072_0093892 3300049588 Bacteria 2383
632 Ga0501072_0135380 3300049588 Bacteria 1964
633 Ga0501072_0142227 3300049588 Bacteria 1913
634 Ga0501072_0184339 3300049588 Bacteria 1665
635 Ga0501072_0360633 3300049588 Bacteria 1154
636 Ga0501072_0855930 3300049588 Bacteria 711
637 Ga0501072_1021507 3300049588 Unclassified 644
638 Ga0501072_1125751 3300049588 Bacteria 610
639 Ga0501073_0183388 3300049589 Bacteria 1449
640 Ga0501073_0459972 3300049589 Bacteria 880
641 Ga0501074_0007561 3300049590 Bacteria 7862
642 Ga0501074_0046419 3300049590 Bacteria 3141
643 Ga0501074_0091585 3300049590 Bacteria 2177
644 Ga0501074_0095327 3300049590 Bacteria 2131
645 Ga0501074_0158186 3300049590 Bacteria 1618
646 Ga0501075_0001033 3300049591 Bacteria 17853
647 Ga0501075_0001990 3300049591 Bacteria 13490
648 Ga0501075_0008499 3300049591 Bacteria 7161
649 Ga0501075_0009915 3300049591 Bacteria 6676
650 Ga0501075_0012463 3300049591 Bacteria 6043
651 Ga0501075_0021767 3300049591 Bacteria 4677
652 Ga0501075_0043196 3300049591 Bacteria 3380
653 Ga0501075_0069106 3300049591 Bacteria 2669
654 Ga0501075_0170493 3300049591 Bacteria 1661
655 Ga0501075_0193971 3300049591 Bacteria 1549
656 Ga0501075_0442517 3300049591 Bacteria 991
657 Ga0501075_0867437 3300049591 Bacteria 686
658 Ga0501075_0877850 3300049591 Bacteria 682
659 Ga0501075_1456501 3300049591 Bacteria 518
660 Ga0501076_0000979 3300049592 Bacteria 18705
661 Ga0501076_0002232 3300049592 Bacteria 13267
662 Ga0501076_0004384 3300049592 Bacteria 10028
663 Ga0501076_0009654 3300049592 Bacteria 7129
664 Ga0501076_0028793 3300049592 Bacteria 4316
665 Ga0501076_0030185 3300049592 Bacteria 4222
666 Ga0501076_0106110 3300049592 Bacteria 2267
667 Ga0501076_0181312 3300049592 Bacteria 1717
668 Ga0501076_0303754 3300049592 Bacteria 1308
669 Ga0501077_0002533 3300049593 Bacteria 10951
670 Ga0501077_0004004 3300049593 Bacteria 8891
671 Ga0501077_0007258 3300049593 Bacteria 6834
672 Ga0501077_0008904 3300049593 Bacteria 6227
673 Ga0501077_0140071 3300049593 Bacteria 1534
674 Ga0501077_0177896 3300049593 Bacteria 1352
675 Ga0501077_0266858 3300049593 Bacteria 1089
676 Ga0501077_0443968 3300049593 Bacteria 831
677 Ga0501077_0737224 3300049593 Unclassified 633
678 Ga0501077_0809413 3300049593 Unclassified 602
679 Ga0501079_0001475 3300049741 Bacteria 16640
680 Ga0501079_0011359 3300049741 Bacteria 6796
681 Ga0501079_0012904 3300049741 Bacteria 6377
682 Ga0501079_0015755 3300049741 Bacteria 5775
683 Ga0501079_0019976 3300049741 Bacteria 5118
684 Ga0501079_0035117 3300049741 Bacteria 3858
685 Ga0501079_0073643 3300049741 Bacteria 2640
686 Ga0501079_0110880 3300049741 Bacteria 2132
687 Ga0501079_0115926 3300049741 Bacteria 2082
688 Ga0501079_0176756 3300049741 Bacteria 1665
689 Ga0501079_0710716 3300049741 Bacteria 791
690 Ga0501079_0730646 3300049741 Bacteria 779
691 Ga0501079_1105692 3300049741 Unclassified 624
692 Ga0501080_0010137 3300049742 Bacteria 8619
693 Ga0501080_0015571 3300049742 Bacteria 7013
694 Ga0501080_0023877 3300049742 Bacteria 5667
695 Ga0501080_0099209 3300049742 Bacteria 2703
696 Ga0501080_0296963 3300049742 Bacteria 1466
697 Ga0501080_0850452 3300049742 Bacteria 798
698 Ga0501081_0000475 3300049743 Bacteria 22308
699 Ga0501081_0001239 3300049743 Bacteria 15520
700 Ga0501081_0002378 3300049743 Bacteria 11848
701 Ga0501081_0010657 3300049743 Bacteria 6006
702 Ga0501081_0012727 3300049743 Bacteria 5534
703 Ga0501081_0067148 3300049743 Bacteria 2495
704 Ga0501081_0073654 3300049743 Bacteria 2382
705 Ga0501081_0074045 3300049743 Bacteria 2376
706 Ga0501081_0077101 3300049743 Bacteria 2328
707 Ga0501081_0101055 3300049743 Bacteria 2039
708 Ga0501081_0141985 3300049743 Bacteria 1721
709 Ga0501081_0149441 3300049743 Bacteria 1678
710 Ga0501081_0275890 3300049743 Bacteria 1230
711 Ga0501081_0345977 3300049743 Bacteria 1095
712 Ga0501081_0661020 3300049743 Bacteria 784
713 Ga0501081_0698114 3300049743 Bacteria 762
714 Ga0501081_1260108 3300049743 Bacteria 560
715 Ga0501083_0016891 3300049744 Bacteria 5098
716 Ga0501083_0038897 3300049744 Bacteria 3232
717 Ga0501083_0330125 3300049744 Bacteria 992
718 Ga0501083_0440396 3300049744 Bacteria 848
719 Ga0501083_1083553 3300049744 Bacteria 521
720 Ga0501273_021871 3300049770 Bacteria 871
721 Ga0501035_0014697 3300049822 Bacteria 7227
722 Ga0501035_0319280 3300049822 Bacteria 1305
723 Ga0501035_0469796 3300049822 Bacteria 1039
724 Ga0501035_0690057 3300049822 Bacteria 824
725 Ga0501035_0940491 3300049822 Bacteria 682
726 Ga0501044_0272823 3300049823 Bacteria 1627
727 Ga0501044_1534816 3300049823 Bacteria 531
728 Ga0501045_0000682 3300049824 Bacteria 21537
729 Ga0501045_0008044 3300049824 Bacteria 7346
730 Ga0501045_0042489 3300049824 Bacteria 3308
731 Ga0501045_0079975 3300049824 Bacteria 2410
732 Ga0501045_0091167 3300049824 Bacteria 2253
733 Ga0501045_0242445 3300049824 Bacteria 1342
734 Ga0501045_0250483 3300049824 Bacteria 1318
735 Ga0501045_0264913 3300049824 Bacteria 1279
736 Ga0501045_0267709 3300049824 Bacteria 1272
737 Ga0501045_0412839 3300049824 Unclassified 1004
738 Ga0501045_1155398 3300049824 Bacteria 565
739 Ga0501045_1361854 3300049824 Bacteria 516
740 nmdc:mga05p37_1049514_c1 3300050507 Bacteria 860
741 nmdc:mga05p37_1052772_c1 3300050507 Bacteria 858
742 nmdc:mga05p37_13622_c1 3300050507 Bacteria 9746
743 nmdc:mga05p37_14246_c1 3300050507 Bacteria 9550
744 nmdc:mga05p37_1616_c1 3300050507 Bacteria 26114
745 nmdc:mga05p37_245336_c1 3300050507 Bacteria 2151
746 nmdc:mga05p37_282341_c1 3300050507 Bacteria 1979
747 nmdc:mga05p37_3121_c1 3300050507 Bacteria 19253
748 nmdc:mga05p37_33395_c1 3300050507 Bacteria 6302
749 nmdc:mga05p37_34567_c1 3300050507 Bacteria 6192
750 nmdc:mga05p37_35074_c1 3300050507 Bacteria 6150
751 nmdc:mga05p37_564117_c1 3300050507 Bacteria 1293
752 nmdc:mga05p37_70806_c1 3300050507 Bacteria 4290
753 nmdc:mga05p37_73202_c1 3300050507 Bacteria 4217
754 nmdc:mga05p37_739941_c1 3300050507 Bacteria 1086
755 nmdc:mga05p37_83387_c1 3300050507 Bacteria 3938
756 nmdc:mga05p37_845591_c1 3300050507 Bacteria 995
757 nmdc:mga09592_1122411_c1 3300050508 Unclassified 653
758 nmdc:mga09592_128303_c1 3300050508 Bacteria 2181
759 nmdc:mga09592_13087_c1 3300050508 Bacteria 6771
760 nmdc:mga09592_132575_c1 3300050508 Bacteria 2145
761 nmdc:mga09592_14096_c1 3300050508 Bacteria 6525
762 nmdc:mga09592_14462_c1 3300050508 Bacteria 6442
763 nmdc:mga09592_201664_c1 3300050508 Bacteria 1723
764 nmdc:mga09592_217712_c1 3300050508 Bacteria 1654
765 nmdc:mga09592_27761_c1 3300050508 Bacteria 4698
766 nmdc:mga09592_57951_c1 3300050508 Bacteria 3275
767 nmdc:mga09592_66302_c1 3300050508 Bacteria 3060
768 nmdc:mga09592_73465_c1 3300050508 Bacteria 2906
769 nmdc:mga09592_741279_c1 3300050508 Bacteria 834
770 nmdc:mga0qj67_11172_c1 3300050509 Bacteria 6725
771 nmdc:mga0qj67_150038_c1 3300050509 Bacteria 1891
772 nmdc:mga0qj67_232276_c1 3300050509 Bacteria 1496
773 nmdc:mga0qj67_245051_c1 3300050509 Bacteria 1454
774 nmdc:mga0qj67_252379_c1 3300050509 Bacteria 1431
775 nmdc:mga0qj67_2619_c1 3300050509 Bacteria 12899
776 nmdc:mga0qj67_5121_c1 3300050509 Bacteria 9545
777 nmdc:mga0qj67_544062_c1 3300050509 Bacteria 931
778 nmdc:mga0qj67_64242_c1 3300050509 Bacteria 2919
779 nmdc:mga0qj67_652_c1 3300050509 Bacteria 23881
780 nmdc:mga06r32_10547_c1 3300050510 Bacteria 8332
781 nmdc:mga06r32_150921_c1 3300050510 Bacteria 2302
782 nmdc:mga06r32_18264_c1 3300050510 Bacteria 6419
783 nmdc:mga06r32_1949_c1 3300050510 Bacteria 18394
784 nmdc:mga06r32_215006_c1 3300050510 Bacteria 1910
785 nmdc:mga06r32_21776_c1 3300050510 Bacteria 5917
786 nmdc:mga06r32_23363_c1 3300050510 Bacteria 5719
787 nmdc:mga06r32_250438_c1 3300050510 Bacteria 1759
788 nmdc:mga06r32_258567_c1 3300050510 Bacteria 1729
789 nmdc:mga06r32_259512_c1 3300050510 Bacteria 1725
790 nmdc:mga06r32_28227_c1 3300050510 Bacteria 5248
791 nmdc:mga06r32_440368_c1 3300050510 Bacteria 1283
792 nmdc:mga06r32_44381_c1 3300050510 Bacteria 4233
793 nmdc:mga06r32_49418_c1 3300050510 Bacteria 4021
794 nmdc:mga06r32_504915_c1 3300050510 Bacteria 1186
795 nmdc:mga06r32_8063_c1 3300050510 Bacteria 9478
796 nmdc:mga06r32_824652_c1 3300050510 Bacteria 887
797 nmdc:mga08y16_16604_c1 3300050511 Bacteria 7743
798 nmdc:mga08y16_1804_c1 3300050511 Bacteria 21719
799 nmdc:mga08y16_1953524_c1 3300050511 Bacteria 537
800 nmdc:mga08y16_495190_c1 3300050511 Bacteria 1242
801 nmdc:mga08y16_572865_c1 3300050511 Bacteria 1141
802 nmdc:mga08y16_64772_c1 3300050511 Bacteria 3816
803 nmdc:mga08y16_716_c1 3300050511 Bacteria 31529
804 nmdc:mga0n895_1095879_c1 3300050512 Bacteria 774
805 nmdc:mga0n895_119095_c1 3300050512 Bacteria 2661
806 nmdc:mga0n895_1461035_c1 3300050512 Bacteria 651
807 nmdc:mga0n895_14991_c1 3300050512 Bacteria 7060
808 nmdc:mga0n895_17413_c1 3300050512 Bacteria 6621
809 nmdc:mga0n895_188488_c1 3300050512 Bacteria 2094
810 nmdc:mga0n895_53476_c1 3300050512 Bacteria 3967
811 nmdc:mga0n895_58422_c1 3300050512 Bacteria 3803
812 nmdc:mga0n895_666820_c1 3300050512 Bacteria 1038
813 nmdc:mga0n895_734889_c1 3300050512 Bacteria 981
814 nmdc:mga0n895_74068_c1 3300050512 Bacteria 3382
815 nmdc:mga0n895_77155_c1 3300050512 Bacteria 3314
816 nmdc:mga0n895_852910_c1 3300050512 Bacteria 899
817 nmdc:mga0n895_98_c1 3300050512 Bacteria 51629
818 nmdc:mga0rr50_110548_c1 3300050513 Bacteria 2174
819 nmdc:mga0rr50_127068_c1 3300050513 Bacteria 2037
820 nmdc:mga0rr50_146129_c1 3300050513 Bacteria 1907
821 nmdc:mga0rr50_188595_c1 3300050513 Bacteria 1689
822 nmdc:mga0rr50_197525_c1 3300050513 Bacteria 1652
823 nmdc:mga0rr50_371180_c1 3300050513 Bacteria 1205
824 nmdc:mga0rr50_37885_c1 3300050513 Bacteria 3484
825 nmdc:mga0rr50_4985_c1 3300050513 Bacteria 7863
826 nmdc:mga0rr50_546038_c1 3300050513 Bacteria 987
827 nmdc:mga0rr50_8956_c1 3300050513 Bacteria 6258
828 nmdc:mga08x19_1083726_c1 3300050514 Bacteria 569
829 nmdc:mga08x19_116470_c1 3300050514 Bacteria 1787
830 nmdc:mga08x19_119161_c1 3300050514 Bacteria 1768
831 nmdc:mga08x19_18471_c1 3300050514 Bacteria 4273
832 nmdc:mga08x19_344186_c1 3300050514 Bacteria 1040
833 nmdc:mga08x19_691562_c1 3300050514 Bacteria 724
834 nmdc:mga08x19_80820_c1 3300050514 Bacteria 2134
835 nmdc:mga0a205_10695_c1 3300050515 Bacteria 8436
836 nmdc:mga0a205_107052_c1 3300050515 Bacteria 2694
837 nmdc:mga0a205_1187991_c1 3300050515 Bacteria 611
838 nmdc:mga0a205_1231066_c1 3300050515 Bacteria 596
839 nmdc:mga0a205_13385_c1 3300050515 Bacteria 7637
840 nmdc:mga0a205_13873_c1 3300050515 Bacteria 7511
841 nmdc:mga0a205_162356_c1 3300050515 Bacteria 2130
842 nmdc:mga0a205_196179_c1 3300050515 Bacteria 1910
843 nmdc:mga0a205_2218_c1 3300050515 Bacteria 17084
844 nmdc:mga0a205_234036_c1 3300050515 Bacteria 1720
845 nmdc:mga0a205_2425_c1 3300050515 Bacteria 16434
846 nmdc:mga0a205_509061_c1 3300050515 Bacteria 1061
847 nmdc:mga0a205_520447_c1 3300050515 Bacteria 1046
848 nmdc:mga0a205_551424_c1 3300050515 Bacteria 1008
849 nmdc:mga0a205_581361_c1 3300050515 Bacteria 974
850 nmdc:mga0a205_6280_c1 3300050515 Bacteria 10723
851 nmdc:mga0a205_728555_c1 3300050515 Bacteria 841
852 Ga0501084_0000677 3300054114 Bacteria 25964
853 Ga0501084_0004051 3300054114 Bacteria 11934
854 Ga0501084_0006689 3300054114 Bacteria 9477
855 Ga0501084_0009461 3300054114 Bacteria 8064
856 Ga0501084_0035131 3300054114 Bacteria 4190
857 Ga0501084_0052120 3300054114 Bacteria 3424
858 Ga0501084_0261986 3300054114 Bacteria 1459
859 Ga0501084_0375339 3300054114 Bacteria 1202
860 Ga0501084_0869636 3300054114 Bacteria 758
861 Ga0501084_0882768 3300054114 Bacteria 752
862 Ga0501084_1054304 3300054114 Bacteria 683
863 Ga0501084_1084397 3300054114 Bacteria 672
864 Ga0501084_1177034 3300054114 Bacteria 643
865 Ga0501084_1193529 3300054114 Bacteria 638
866 Ga0501084_1325935 3300054114 Bacteria 603
867 Ga0590071_082178 3300059421 Bacteria 802
868 Ga0590074_011664 3300059423 Bacteria 1474
869 Ga0590075_026662 3300059424 Bacteria 1455
870 Ga0590075_040896 3300059424 Bacteria 1185
871 Ga0590077_006877 3300059426 Bacteria 2330
872 Ga0501082_0002099 3300060353 Bacteria 17551
873 Ga0501082_0017314 3300060353 Bacteria 6208
874 Ga0501082_0023005 3300060353 Bacteria 5373
875 Ga0501082_0047119 3300060353 Bacteria 3715
876 Ga0501082_0064732 3300060353 Bacteria 3149
877 Ga0501082_0068071 3300060353 Bacteria 3066
878 Ga0501082_0076949 3300060353 Bacteria 2876
879 Ga0501082_0088868 3300060353 Bacteria 2667
880 Ga0501082_0142974 3300060353 Bacteria 2076
881 Ga0501082_0255132 3300060353 Bacteria 1526
882 Ga0501082_0260302 3300060353 Bacteria 1509
883 Ga0530510_0001293 3300061734 Bacteria 16724
884 Ga0530510_0003221 3300061734 Bacteria 11210
885 Ga0530510_0006450 3300061734 Bacteria 8169
886 Ga0530510_0006598 3300061734 Bacteria 8095
887 Ga0530510_0008795 3300061734 Bacteria 7064
888 Ga0530510_0029569 3300061734 Bacteria 3933
889 Ga0530510_0066892 3300061734 Bacteria 2606
890 Ga0530510_0207966 3300061734 Bacteria 1454
891 Ga0530510_0237852 3300061734 Bacteria 1355
892 Ga0530510_0252534 3300061734 Bacteria 1314
893 Ga0530510_0349535 3300061734 Bacteria 1110
894 Ga0530510_0411741 3300061734 Bacteria 1020
895 Ga0530510_0499249 3300061734 Bacteria 922
896 Ga0530510_0535220 3300061734 Bacteria 889
897 Ga0530510_0691684 3300061734 Bacteria 777
898 Ga0530510_1250849 3300061734 Bacteria 569

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1389163 Ga0451577_1389163_18_299 85
2 3300049770 Ga0501273_021871 Ga0501273_021871_543_824 93
3 3300005293 Ga0065715_10039911 Ga0065715_100399113 96
4 3300005336 Ga0070680_100021232 Ga0070680_1000212326 96
5 3300005444 Ga0070694_100272362 Ga0070694_1002723623 96
6 3300005455 Ga0070663_100754709 Ga0070663_1007547092 96
7 3300005467 Ga0070706_101752503 Ga0070706_1017525032 96
8 3300005530 Ga0070679_101018918 Ga0070679_1010189182 96
9 3300005615 Ga0070702_100176299 Ga0070702_1001762994 96
10 3300005617 Ga0068859_100961950 Ga0068859_1009619502 96
11 3300006931 Ga0097620_100961988 Ga0097620_1009619882 96
12 3300009148 Ga0105243_11565425 Ga0105243_115654251 96
13 3300009553 Ga0105249_10154628 Ga0105249_101546286 96
14 3300014326 Ga0157380_11819426 Ga0157380_118194262 96
15 3300049576 Ga0501040_0046459 Ga0501040_0046459_2173_2499 96
16 3300049577 Ga0501041_0057508 Ga0501041_0057508_1266_1592 96
17 3300049579 Ga0501043_0345983 Ga0501043_0345983_621_947 96
18 3300049580 Ga0501046_0012349 Ga0501046_0012349_5689_6015 96
19 3300049584 Ga0501068_0101791 Ga0501068_0101791_487_813 96
20 3300049587 Ga0501071_0902348 Ga0501071_0902348_214_540 96
21 3300049588 Ga0501072_0360633 Ga0501072_0360633_666_992 96
22 3300049590 Ga0501074_0095327 Ga0501074_0095327_1126_1452 96
23 3300049591 Ga0501075_1456501 Ga0501075_1456501_65_391 96
24 3300049592 Ga0501076_0002232 Ga0501076_0002232_6637_6963 96
25 3300049593 Ga0501077_0008904 Ga0501077_0008904_64_390 96
26 3300049741 Ga0501079_0015755 Ga0501079_0015755_5422_5748 96
27 3300049742 Ga0501080_0099209 Ga0501080_0099209_2310_2636 96
28 3300049743 Ga0501081_0000475 Ga0501081_0000475_21954_22280 96
29 3300049744 Ga0501083_0330125 Ga0501083_0330125_574_900 96
30 3300049824 Ga0501045_0250483 Ga0501045_0250483_881_1207 96
31 3300054114 Ga0501084_0035131 Ga0501084_0035131_3812_4138 96
32 3300060353 Ga0501082_0023005 Ga0501082_0023005_1480_1806 96
33 3300061734 Ga0530510_0003221 Ga0530510_0003221_10387_10713 96
34 3300061734 Ga0530510_0006598 Ga0530510_0006598_2387_2713 96
35 3300007265 Ga0099794_10049877 Ga0099794_100498775 97
36 3300025904 Ga0207647_10508007 Ga0207647_105080072 97
37 3300025917 Ga0207660_10007743 Ga0207660_100077438 97
38 3300025921 Ga0207652_10537263 Ga0207652_105372632 97
39 3300025938 Ga0207704_11494053 Ga0207704_114940532 97
40 3300025940 Ga0207691_11183169 Ga0207691_111831691 97
41 3300026067 Ga0207678_10632085 Ga0207678_106320852 97
42 3300026121 Ga0207683_11149787 Ga0207683_111497872 97
43 3300034819 Ga0373958_0147098 Ga0373958_0147098_39_365 97
44 3300034820 Ga0373959_0182483 Ga0373959_0182483_74_400 97
45 3300035115 Ga0373941_0051909 Ga0373941_0051909_735_1061 97
46 3300035207 Ga0373942_0110847 Ga0373942_0110847_460_786 97
47 3300035241 Ga0373961_0052139 Ga0373961_0052139_761_1087 97
48 3300035242 Ga0373962_0185651 Ga0373962_0185651_46_372 97
49 3300035691 Ga0373931_0002096 Ga0373931_0002096_5412_5738 97
50 3300035691 Ga0373931_0002585 Ga0373931_0002585_7276_7569 97
51 3300045051 Ga0451576_0168635 Ga0451576_0168635_192_518 97
52 3300048906 Ga0496103_0041890 Ga0496103_0041890_1057_1383 97
53 3300049582 Ga0501048_0279976 Ga0501048_0279976_220_513 97
54 3300049584 Ga0501068_0837620 Ga0501068_0837620_287_580 97
55 3300049585 Ga0501069_0615818 Ga0501069_0615818_203_496 97
56 3300050507 nmdc:mga05p37_845591_c1 nmdc:mga05p37_845591_c1_689_982 97
57 3300009094 Ga0111539_11210942 Ga0111539_112109422 98
58 3300027671 Ga0209588_1028511 Ga0209588_10285114 98
59 3300046517 Ga0495630_0709232 Ga0495630_0709232_361_681 98
60 3300005518 Ga0070699_100405482 Ga0070699_1004054822 99
61 3300005536 Ga0070697_100007608 Ga0070697_1000076084 99
62 3300006880 Ga0075429_100033384 Ga0075429_1000333844 100
63 3300025910 Ga0207684_11612903 Ga0207684_116129032 100
64 3300049574 Ga0501038_0879224 Ga0501038_0879224_309_635 100
65 3300049575 Ga0501039_0819240 Ga0501039_0819240_113_439 100
66 3300049576 Ga0501040_0249342 Ga0501040_0249342_770_1096 100
67 3300049577 Ga0501041_0047899 Ga0501041_0047899_2149_2475 100
68 3300049582 Ga0501048_0264199 Ga0501048_0264199_142_468 100
69 3300049588 Ga0501072_0135380 Ga0501072_0135380_947_1273 100
70 3300049592 Ga0501076_0106110 Ga0501076_0106110_1648_1974 100
71 3300049593 Ga0501077_0266858 Ga0501077_0266858_227_553 100
72 3300049741 Ga0501079_0110880 Ga0501079_0110880_892_1218 100
73 3300049743 Ga0501081_0141985 Ga0501081_0141985_763_1089 100
74 3300049744 Ga0501083_1083553 Ga0501083_1083553_63_389 100
75 3300054114 Ga0501084_1054304 Ga0501084_1054304_272_598 100
76 3300054114 Ga0501084_1193529 Ga0501084_1193529_161_487 100
77 3300060353 Ga0501082_0047119 Ga0501082_0047119_3221_3547 100
78 3300061734 Ga0530510_0006450 Ga0530510_0006450_1920_2246 100
79 3300061734 Ga0530510_0499249 Ga0530510_0499249_139_465 100
80 3300005445 Ga0070708_100019434 Ga0070708_10001943410 101
81 3300005467 Ga0070706_100019969 Ga0070706_1000199692 101
82 3300005468 Ga0070707_100352809 Ga0070707_1003528092 101
83 3300006871 Ga0075434_100516361 Ga0075434_1005163612 101
84 3300025910 Ga0207684_10080224 Ga0207684_100802246 101
85 3300025922 Ga0207646_10552664 Ga0207646_105526642 101
86 3300050512 nmdc:mga0n895_53476_c1 nmdc:mga0n895_53476_c1_3020_3346 101
87 3300041456 Ga0451795_0988203 Ga0451795_0988203_209_541 102
88 3300005330 Ga0070690_100452076 Ga0070690_1004520761 103
89 3300031548 Ga0307408_100006349 Ga0307408_1000063498 103
90 3300031852 Ga0307410_10703073 Ga0307410_107030732 103
91 3300032005 Ga0307411_10011154 Ga0307411_100111545 103
92 3300036647 Ga0316582_0534334 Ga0316582_0534334_252_563 103
93 3300037588 Ga0316581_0046583 Ga0316581_0046583_110_421 103
94 3300050515 nmdc:mga0a205_196179_c1 nmdc:mga0a205_196179_c1_1082_1393 103
95 3300038996 Ga0242420_035298 Ga0242420_035298_493_810 104
96 3300046684 Ga0495669_0536456 Ga0495669_0536456_229_549 105
97 3300005406 Ga0070703_10119323 Ga0070703_101193232 106
98 3300005444 Ga0070694_100592412 Ga0070694_1005924122 106
99 3300005445 Ga0070708_100158164 Ga0070708_1001581642 106
100 3300005445 Ga0070708_100324467 Ga0070708_1003244672 106
101 3300005445 Ga0070708_102167365 Ga0070708_1021673652 106
102 3300005467 Ga0070706_100024048 Ga0070706_1000240485 106
103 3300005468 Ga0070707_100039526 Ga0070707_10003952611 106
104 3300005468 Ga0070707_100186579 Ga0070707_1001865795 106
105 3300005468 Ga0070707_101024720 Ga0070707_1010247201 106
106 3300005518 Ga0070699_100040461 Ga0070699_1000404612 106
107 3300005518 Ga0070699_100323376 Ga0070699_1003233762 106
108 3300005518 Ga0070699_100414056 Ga0070699_1004140563 106
109 3300005546 Ga0070696_100047071 Ga0070696_1000470715 106
110 3300006871 Ga0075434_100760493 Ga0075434_1007604932 106
111 3300006914 Ga0075436_100234212 Ga0075436_1002342122 106
112 3300007076 Ga0075435_100051537 Ga0075435_1000515373 106
113 3300025910 Ga0207684_10109559 Ga0207684_101095595 106
114 3300025910 Ga0207684_10171017 Ga0207684_101710174 106
115 3300025910 Ga0207684_11161508 Ga0207684_111615081 106
116 3300025922 Ga0207646_10811274 Ga0207646_108112742 106
117 3300025922 Ga0207646_11932812 Ga0207646_119328121 106
118 3300044673 Ga0453683_0261819 Ga0453683_0261819_177_497 106
119 3300049570 Ga0501033_0706061 Ga0501033_0706061_269_589 106
120 3300049574 Ga0501038_0275060 Ga0501038_0275060_922_1245 106
121 3300049576 Ga0501040_0179547 Ga0501040_0179547_1059_1379 106
122 3300049578 Ga0501042_0574113 Ga0501042_0574113_256_576 106
123 3300049580 Ga0501046_0265656 Ga0501046_0265656_386_706 106
124 3300049587 Ga0501071_1140949 Ga0501071_1140949_211_531 106
125 3300049591 Ga0501075_0170493 Ga0501075_0170493_1215_1535 106
126 3300049742 Ga0501080_0850452 Ga0501080_0850452_32_352 106
127 3300049743 Ga0501081_0074045 Ga0501081_0074045_361_681 106
128 3300049743 Ga0501081_1260108 Ga0501081_1260108_102_422 106
129 3300049824 Ga0501045_1155398 Ga0501045_1155398_88_408 106
130 3300050512 nmdc:mga0n895_1095879_c1 nmdc:mga0n895_1095879_c1_24_344 106
131 3300050513 nmdc:mga0rr50_127068_c1 nmdc:mga0rr50_127068_c1_224_544 106
132 3300050515 nmdc:mga0a205_1231066_c1 nmdc:mga0a205_1231066_c1_266_586 106
133 3300054114 Ga0501084_1325935 Ga0501084_1325935_94_414 106
134 3300061734 Ga0530510_0207966 Ga0530510_0207966_94_414 106
135 3300061734 Ga0530510_1250849 Ga0530510_1250849_10_330 106
136 3300005295 Ga0065707_10772991 Ga0065707_107729912 107
137 3300005330 Ga0070690_100914841 Ga0070690_1009148411 107
138 3300005345 Ga0070692_10034691 Ga0070692_100346912 107
139 3300005345 Ga0070692_10909053 Ga0070692_109090531 107
140 3300005353 Ga0070669_101076240 Ga0070669_1010762402 107
141 3300005406 Ga0070703_10008252 Ga0070703_100082525 107
142 3300005438 Ga0070701_10005353 Ga0070701_100053535 107
143 3300005440 Ga0070705_100017087 Ga0070705_1000170878 107
144 3300005440 Ga0070705_100105983 Ga0070705_1001059834 107
145 3300005440 Ga0070705_100244644 Ga0070705_1002446441 107
146 3300005441 Ga0070700_100125616 Ga0070700_1001256164 107
147 3300005444 Ga0070694_100076927 Ga0070694_1000769272 107
148 3300005445 Ga0070708_100003463 Ga0070708_1000034636 107
149 3300005445 Ga0070708_100013141 Ga0070708_1000131415 107
150 3300005459 Ga0068867_100708131 Ga0068867_1007081311 107
151 3300005459 Ga0068867_101526383 Ga0068867_1015263832 107
152 3300005467 Ga0070706_100093850 Ga0070706_1000938505 107
153 3300005467 Ga0070706_100280930 Ga0070706_1002809304 107
154 3300005467 Ga0070706_101953702 Ga0070706_1019537021 107
155 3300005468 Ga0070707_100143317 Ga0070707_1001433171 107
156 3300005468 Ga0070707_100226753 Ga0070707_1002267532 107
157 3300005471 Ga0070698_100038873 Ga0070698_1000388735 107
158 3300005471 Ga0070698_100128600 Ga0070698_1001286002 107
159 3300005471 Ga0070698_100950825 Ga0070698_1009508252 107
160 3300005518 Ga0070699_100009009 Ga0070699_10000900910 107
161 3300005518 Ga0070699_100031321 Ga0070699_1000313219 107
162 3300005518 Ga0070699_101117734 Ga0070699_1011177342 107
163 3300005536 Ga0070697_100183333 Ga0070697_1001833335 107
164 3300005536 Ga0070697_100217547 Ga0070697_1002175473 107
165 3300005536 Ga0070697_101605869 Ga0070697_1016058692 107
166 3300005543 Ga0070672_101064070 Ga0070672_1010640702 107
167 3300005545 Ga0070695_100006901 Ga0070695_1000069019 107
168 3300005546 Ga0070696_100018915 Ga0070696_1000189155 107
169 3300005546 Ga0070696_100518606 Ga0070696_1005186063 107
170 3300005546 Ga0070696_101204003 Ga0070696_1012040032 107
171 3300005549 Ga0070704_100187993 Ga0070704_1001879933 107
172 3300005549 Ga0070704_100268124 Ga0070704_1002681245 107
173 3300005577 Ga0068857_100046867 Ga0068857_1000468675 107
174 3300005578 Ga0068854_101289732 Ga0068854_1012897322 107
175 3300005615 Ga0070702_100658836 Ga0070702_1006588361 107
176 3300005617 Ga0068859_100071027 Ga0068859_1000710275 107
177 3300005840 Ga0068870_10169661 Ga0068870_101696612 107
178 3300005841 Ga0068863_100043410 Ga0068863_10004341010 107
179 3300005842 Ga0068858_101530007 Ga0068858_1015300072 107
180 3300005843 Ga0068860_100036271 Ga0068860_10003627110 107
181 3300005844 Ga0068862_100209979 Ga0068862_1002099793 107
182 3300005983 Ga0081540_1202013 Ga0081540_12020132 107
183 3300006058 Ga0075432_10101556 Ga0075432_101015562 107
184 3300006163 Ga0070715_11045397 Ga0070715_110453972 107
185 3300006175 Ga0070712_100014991 Ga0070712_10001499110 107
186 3300006847 Ga0075431_100520668 Ga0075431_1005206682 107
187 3300006852 Ga0075433_10595211 Ga0075433_105952113 107
188 3300006852 Ga0075433_11119286 Ga0075433_111192862 107
189 3300006871 Ga0075434_100652696 Ga0075434_1006526962 107
190 3300006871 Ga0075434_100889679 Ga0075434_1008896792 107
191 3300006871 Ga0075434_101121174 Ga0075434_1011211742 107
192 3300006914 Ga0075436_100891436 Ga0075436_1008914362 107
193 3300006931 Ga0097620_100071027 Ga0097620_1000710275 107
194 3300007076 Ga0075435_100010307 Ga0075435_10001030712 107
195 3300007076 Ga0075435_100365157 Ga0075435_1003651572 107
196 3300007265 Ga0099794_10340455 Ga0099794_103404552 107
197 3300009094 Ga0111539_10021054 Ga0111539_1002105414 107
198 3300009094 Ga0111539_11017208 Ga0111539_110172082 107
199 3300009147 Ga0114129_12129555 Ga0114129_121295552 107
200 3300009148 Ga0105243_10006180 Ga0105243_1000618015 107
201 3300009176 Ga0105242_10014946 Ga0105242_100149469 107
202 3300009176 Ga0105242_10222343 Ga0105242_102223432 107
203 3300009177 Ga0105248_10736718 Ga0105248_107367182 107
204 3300009553 Ga0105249_10025833 Ga0105249_100258339 107
205 3300013102 Ga0157371_10050789 Ga0157371_100507895 107
206 3300014326 Ga0157380_10679101 Ga0157380_106791012 107
207 3300025885 Ga0207653_10003065 Ga0207653_100030657 107
208 3300025908 Ga0207643_10175728 Ga0207643_101757283 107
209 3300025910 Ga0207684_10017002 Ga0207684_100170028 107
210 3300025910 Ga0207684_10213434 Ga0207684_102134342 107
211 3300025910 Ga0207684_10620920 Ga0207684_106209201 107
212 3300025915 Ga0207693_10022725 Ga0207693_1002272510 107
213 3300025917 Ga0207660_10004571 Ga0207660_100045718 107
214 3300025922 Ga0207646_10010658 Ga0207646_1001065811 107
215 3300025922 Ga0207646_10147634 Ga0207646_101476341 107
216 3300025922 Ga0207646_10723825 Ga0207646_107238252 107
217 3300025923 Ga0207681_11084822 Ga0207681_110848222 107
218 3300025933 Ga0207706_10096144 Ga0207706_100961443 107
219 3300025934 Ga0207686_10026045 Ga0207686_100260456 107
220 3300025934 Ga0207686_10232701 Ga0207686_102327012 107
221 3300025935 Ga0207709_10042714 Ga0207709_100427144 107
222 3300025940 Ga0207691_10827251 Ga0207691_108272512 107
223 3300025961 Ga0207712_10194757 Ga0207712_101947575 107
224 3300026075 Ga0207708_10660743 Ga0207708_106607432 107
225 3300026088 Ga0207641_10195572 Ga0207641_101955723 107
226 3300026089 Ga0207648_10184040 Ga0207648_101840402 107
227 3300026089 Ga0207648_11275735 Ga0207648_112757352 107
228 3300026116 Ga0207674_10124226 Ga0207674_101242267 107
229 3300027695 Ga0209966_1017817 Ga0209966_10178171 107
230 3300027876 Ga0209974_10445658 Ga0209974_104456582 107
231 3300027907 Ga0207428_10000487 Ga0207428_1000048746 107
232 3300028380 Ga0268265_10187202 Ga0268265_101872023 107
233 3300028380 Ga0268265_10933136 Ga0268265_109331362 107
234 3300028381 Ga0268264_10155241 Ga0268264_101552412 107
235 3300038996 Ga0242420_001624 Ga0242420_001624_1097_1423 107
236 3300042003 Ga0439443_046264 Ga0439443_046264_297_623 107
237 3300042436 Ga0439435_0227322 Ga0439435_0227322_134_460 107
238 3300042876 Ga0451577_0010501 Ga0451577_0010501_1934_2260 107
239 3300042876 Ga0451577_0624024 Ga0451577_0624024_572_898 107
240 3300042876 Ga0451577_0749916 Ga0451577_0749916_490_816 107
241 3300044673 Ga0453683_0004189 Ga0453683_0004189_4146_4472 107
242 3300044712 Ga0453684_0010446 Ga0453684_0010446_9576_9902 107
243 3300045051 Ga0451576_0001624 Ga0451576_0001624_36863_37189 107
244 3300047318 Ga0495636_0089909 Ga0495636_0089909_226_552 107
245 3300047318 Ga0495636_0480978 Ga0495636_0480978_26_352 107
246 3300049533 Ga0501317_063254 Ga0501317_063254_261_584 107
247 3300049575 Ga0501039_1308892 Ga0501039_1308892_60_386 107
248 3300049582 Ga0501048_0569748 Ga0501048_0569748_470_796 107
249 3300049588 Ga0501072_1125751 Ga0501072_1125751_222_548 107
250 3300050508 nmdc:mga09592_217712_c1 nmdc:mga09592_217712_c1_1283_1609 107
251 3300050510 nmdc:mga06r32_504915_c1 nmdc:mga06r32_504915_c1_682_1008 107
252 3300050511 nmdc:mga08y16_1804_c1 nmdc:mga08y16_1804_c1_6350_6676 107
253 3300050511 nmdc:mga08y16_572865_c1 nmdc:mga08y16_572865_c1_12_338 107
254 3300050512 nmdc:mga0n895_58422_c1 nmdc:mga0n895_58422_c1_2761_3087 107
255 3300050512 nmdc:mga0n895_666820_c1 nmdc:mga0n895_666820_c1_350_676 107
256 3300050512 nmdc:mga0n895_734889_c1 nmdc:mga0n895_734889_c1_602_928 107
257 3300050513 nmdc:mga0rr50_146129_c1 nmdc:mga0rr50_146129_c1_475_801 107
258 3300050513 nmdc:mga0rr50_37885_c1 nmdc:mga0rr50_37885_c1_2171_2497 107
259 3300050514 nmdc:mga08x19_691562_c1 nmdc:mga08x19_691562_c1_221_547 107
260 3300050515 nmdc:mga0a205_10695_c1 nmdc:mga0a205_10695_c1_5496_5822 107
261 3300050515 nmdc:mga0a205_520447_c1 nmdc:mga0a205_520447_c1_142_468 107
262 3300050515 nmdc:mga0a205_6280_c1 nmdc:mga0a205_6280_c1_3299_3625 107
263 3300061734 Ga0530510_0691684 Ga0530510_0691684_381_707 107
264 3300005289 Ga0065704_10317297 Ga0065704_103172971 108
265 3300005289 Ga0065704_10430950 Ga0065704_104309502 108
266 3300005295 Ga0065707_10005566 Ga0065707_100055666 108
267 3300005295 Ga0065707_11134497 Ga0065707_111344972 108
268 3300005330 Ga0070690_100515497 Ga0070690_1005154971 108
269 3300005330 Ga0070690_100636320 Ga0070690_1006363202 108
270 3300005330 Ga0070690_100943993 Ga0070690_1009439931 108
271 3300005334 Ga0068869_101314509 Ga0068869_1013145091 108
272 3300005336 Ga0070680_100894332 Ga0070680_1008943322 108
273 3300005340 Ga0070689_100161838 Ga0070689_1001618384 108
274 3300005345 Ga0070692_10297623 Ga0070692_102976231 108
275 3300005345 Ga0070692_10581771 Ga0070692_105817712 108
276 3300005347 Ga0070668_100090665 Ga0070668_1000906652 108
277 3300005353 Ga0070669_100089585 Ga0070669_1000895852 108
278 3300005353 Ga0070669_100137486 Ga0070669_1001374862 108
279 3300005353 Ga0070669_101307848 Ga0070669_1013078482 108
280 3300005367 Ga0070667_101006610 Ga0070667_1010066101 108
281 3300005440 Ga0070705_100013153 Ga0070705_1000131534 108
282 3300005440 Ga0070705_100224139 Ga0070705_1002241393 108
283 3300005440 Ga0070705_100699778 Ga0070705_1006997782 108
284 3300005444 Ga0070694_100485825 Ga0070694_1004858252 108
285 3300005445 Ga0070708_100026250 Ga0070708_10002625010 108
286 3300005445 Ga0070708_100201875 Ga0070708_1002018754 108
287 3300005445 Ga0070708_100733247 Ga0070708_1007332472 108
288 3300005445 Ga0070708_100733248 Ga0070708_1007332482 108
289 3300005445 Ga0070708_101658364 Ga0070708_1016583642 108
290 3300005445 Ga0070708_101874054 Ga0070708_1018740541 108
291 3300005457 Ga0070662_100017188 Ga0070662_1000171887 108
292 3300005459 Ga0068867_100125054 Ga0068867_1001250544 108
293 3300005459 Ga0068867_100225325 Ga0068867_1002253252 108
294 3300005467 Ga0070706_100001965 Ga0070706_10000196524 108
295 3300005467 Ga0070706_100713906 Ga0070706_1007139062 108
296 3300005467 Ga0070706_100747054 Ga0070706_1007470541 108
297 3300005468 Ga0070707_100008827 Ga0070707_1000088279 108
298 3300005468 Ga0070707_100239655 Ga0070707_1002396551 108
299 3300005468 Ga0070707_100576550 Ga0070707_1005765502 108
300 3300005471 Ga0070698_100002716 Ga0070698_10000271613 108
301 3300005471 Ga0070698_100735235 Ga0070698_1007352352 108
302 3300005471 Ga0070698_100735236 Ga0070698_1007352362 108
303 3300005518 Ga0070699_100010853 Ga0070699_1000108535 108
304 3300005518 Ga0070699_100694663 Ga0070699_1006946632 108
305 3300005518 Ga0070699_100943849 Ga0070699_1009438492 108
306 3300005530 Ga0070679_100718537 Ga0070679_1007185372 108
307 3300005536 Ga0070697_100037448 Ga0070697_1000374485 108
308 3300005536 Ga0070697_100067619 Ga0070697_1000676197 108
309 3300005536 Ga0070697_100648879 Ga0070697_1006488791 108
310 3300005536 Ga0070697_100648880 Ga0070697_1006488801 108
311 3300005536 Ga0070697_100761853 Ga0070697_1007618532 108
312 3300005545 Ga0070695_100362666 Ga0070695_1003626662 108
313 3300005546 Ga0070696_100060691 Ga0070696_1000606916 108
314 3300005546 Ga0070696_100191422 Ga0070696_1001914222 108
315 3300005546 Ga0070696_100495907 Ga0070696_1004959072 108
316 3300005547 Ga0070693_101455100 Ga0070693_1014551002 108
317 3300005549 Ga0070704_100193667 Ga0070704_1001936672 108
318 3300005549 Ga0070704_101501862 Ga0070704_1015018622 108
319 3300005564 Ga0070664_101600909 Ga0070664_1016009092 108
320 3300005577 Ga0068857_100949469 Ga0068857_1009494692 108
321 3300005578 Ga0068854_100590113 Ga0068854_1005901132 108
322 3300005718 Ga0068866_10943440 Ga0068866_109434402 108
323 3300005718 Ga0068866_11069242 Ga0068866_110692421 108
324 3300005718 Ga0068866_11127799 Ga0068866_111277992 108
325 3300005719 Ga0068861_100922776 Ga0068861_1009227762 108
326 3300005841 Ga0068863_100967447 Ga0068863_1009674472 108
327 3300005841 Ga0068863_101692915 Ga0068863_1016929152 108
328 3300005842 Ga0068858_101022397 Ga0068858_1010223972 108
329 3300005843 Ga0068860_100022088 Ga0068860_10002208810 108
330 3300005843 Ga0068860_100325993 Ga0068860_1003259934 108
331 3300005844 Ga0068862_100193511 Ga0068862_1001935114 108
332 3300005844 Ga0068862_100273868 Ga0068862_1002738682 108
333 3300005844 Ga0068862_100954461 Ga0068862_1009544612 108
334 3300005937 Ga0081455_10065534 Ga0081455_100655346 108
335 3300005937 Ga0081455_10469097 Ga0081455_104690972 108
336 3300005983 Ga0081540_1121483 Ga0081540_11214832 108
337 3300005985 Ga0081539_10001809 Ga0081539_1000180914 108
338 3300006058 Ga0075432_10077243 Ga0075432_100772432 108
339 3300006058 Ga0075432_10181897 Ga0075432_101818971 108
340 3300006163 Ga0070715_10671350 Ga0070715_106713501 108
341 3300006844 Ga0075428_100002425 Ga0075428_10000242525 108
342 3300006844 Ga0075428_100003976 Ga0075428_10000397614 108
343 3300006844 Ga0075428_100007571 Ga0075428_10000757121 108
344 3300006844 Ga0075428_100054721 Ga0075428_1000547217 108
345 3300006844 Ga0075428_100071069 Ga0075428_1000710696 108
346 3300006844 Ga0075428_100137079 Ga0075428_1001370796 108
347 3300006844 Ga0075428_100149371 Ga0075428_1001493716 108
348 3300006844 Ga0075428_100362358 Ga0075428_1003623585 108
349 3300006844 Ga0075428_101105534 Ga0075428_1011055342 108
350 3300006844 Ga0075428_101611853 Ga0075428_1016118532 108
351 3300006844 Ga0075428_101637166 Ga0075428_1016371662 108
352 3300006846 Ga0075430_100000851 Ga0075430_10000085128 108
353 3300006846 Ga0075430_100002159 Ga0075430_1000021593 108
354 3300006846 Ga0075430_100004590 Ga0075430_10000459011 108
355 3300006846 Ga0075430_100037664 Ga0075430_1000376648 108
356 3300006846 Ga0075430_100058518 Ga0075430_1000585185 108
357 3300006846 Ga0075430_100094860 Ga0075430_1000948605 108
358 3300006846 Ga0075430_100177136 Ga0075430_1001771362 108
359 3300006846 Ga0075430_100763745 Ga0075430_1007637452 108
360 3300006847 Ga0075431_100000559 Ga0075431_10000055932 108
361 3300006847 Ga0075431_100003805 Ga0075431_1000038056 108
362 3300006847 Ga0075431_100004746 Ga0075431_10000474616 108
363 3300006847 Ga0075431_100006659 Ga0075431_1000066596 108
364 3300006847 Ga0075431_100006978 Ga0075431_1000069788 108
365 3300006847 Ga0075431_100011238 Ga0075431_1000112388 108
366 3300006847 Ga0075431_100028459 Ga0075431_1000284597 108
367 3300006847 Ga0075431_100044099 Ga0075431_1000440995 108
368 3300006847 Ga0075431_100060059 Ga0075431_1000600591 108
369 3300006847 Ga0075431_100063119 Ga0075431_1000631192 108
370 3300006847 Ga0075431_100120372 Ga0075431_1001203722 108
371 3300006847 Ga0075431_100287972 Ga0075431_1002879724 108
372 3300006847 Ga0075431_100522967 Ga0075431_1005229673 108
373 3300006847 Ga0075431_100754111 Ga0075431_1007541112 108
374 3300006852 Ga0075433_10000942 Ga0075433_1000094229 108
375 3300006852 Ga0075433_10047049 Ga0075433_100470498 108
376 3300006852 Ga0075433_10063809 Ga0075433_100638094 108
377 3300006852 Ga0075433_10237955 Ga0075433_102379552 108
378 3300006852 Ga0075433_10239061 Ga0075433_102390615 108
379 3300006852 Ga0075433_10282741 Ga0075433_102827414 108
380 3300006852 Ga0075433_10384123 Ga0075433_103841232 108
381 3300006852 Ga0075433_10453840 Ga0075433_104538403 108
382 3300006852 Ga0075433_10524968 Ga0075433_105249681 108
383 3300006871 Ga0075434_100015284 Ga0075434_1000152844 108
384 3300006871 Ga0075434_100090005 Ga0075434_1000900052 108
385 3300006871 Ga0075434_100096177 Ga0075434_1000961774 108
386 3300006871 Ga0075434_100135357 Ga0075434_1001353576 108
387 3300006871 Ga0075434_100505789 Ga0075434_1005057892 108
388 3300006871 Ga0075434_100515174 Ga0075434_1005151742 108
389 3300006880 Ga0075429_100000843 Ga0075429_10000084314 108
390 3300006880 Ga0075429_100010320 Ga0075429_1000103206 108
391 3300006880 Ga0075429_100030300 Ga0075429_1000303009 108
392 3300006880 Ga0075429_100062025 Ga0075429_1000620257 108
393 3300006880 Ga0075429_100147777 Ga0075429_1001477774 108
394 3300006880 Ga0075429_100198864 Ga0075429_1001988643 108
395 3300006880 Ga0075429_100228590 Ga0075429_1002285902 108
396 3300006880 Ga0075429_100349809 Ga0075429_1003498092 108
397 3300006880 Ga0075429_100544913 Ga0075429_1005449132 108
398 3300006880 Ga0075429_100745639 Ga0075429_1007456391 108
399 3300006880 Ga0075429_101138265 Ga0075429_1011382652 108
400 3300006914 Ga0075436_100139569 Ga0075436_1001395692 108
401 3300006914 Ga0075436_100155188 Ga0075436_1001551882 108
402 3300006914 Ga0075436_100186928 Ga0075436_1001869284 108
403 3300006914 Ga0075436_100256880 Ga0075436_1002568802 108
404 3300006914 Ga0075436_100362033 Ga0075436_1003620332 108
405 3300006914 Ga0075436_100400407 Ga0075436_1004004072 108
406 3300006914 Ga0075436_100673815 Ga0075436_1006738152 108
407 3300007076 Ga0075435_100023920 Ga0075435_1000239209 108
408 3300007076 Ga0075435_100060603 Ga0075435_1000606037 108
409 3300007076 Ga0075435_100168335 Ga0075435_1001683354 108
410 3300007076 Ga0075435_100176675 Ga0075435_1001766752 108
411 3300007076 Ga0075435_100269734 Ga0075435_1002697342 108
412 3300007076 Ga0075435_100354681 Ga0075435_1003546814 108
413 3300007076 Ga0075435_100433484 Ga0075435_1004334842 108
414 3300007076 Ga0075435_101739753 Ga0075435_1017397532 108
415 3300007265 Ga0099794_10000935 Ga0099794_1000093516 108
416 3300007265 Ga0099794_10319134 Ga0099794_103191342 108
417 3300009093 Ga0105240_12127495 Ga0105240_121274951 108
418 3300009094 Ga0111539_10000675 Ga0111539_1000067514 108
419 3300009094 Ga0111539_10029559 Ga0111539_1002955912 108
420 3300009094 Ga0111539_10054750 Ga0111539_1005475010 108
421 3300009094 Ga0111539_10160027 Ga0111539_101600276 108
422 3300009094 Ga0111539_10178384 Ga0111539_101783846 108
423 3300009094 Ga0111539_10970421 Ga0111539_109704212 108
424 3300009094 Ga0111539_12283805 Ga0111539_122838052 108
425 3300009098 Ga0105245_10655121 Ga0105245_106551212 108
426 3300009147 Ga0114129_10000431 Ga0114129_1000043157 108
427 3300009147 Ga0114129_10000487 Ga0114129_1000048755 108
428 3300009147 Ga0114129_10011322 Ga0114129_1001132213 108
429 3300009147 Ga0114129_10013876 Ga0114129_1001387611 108
430 3300009147 Ga0114129_10022212 Ga0114129_1002221214 108
431 3300009147 Ga0114129_10033145 Ga0114129_100331454 108
432 3300009147 Ga0114129_10036838 Ga0114129_100368388 108
433 3300009147 Ga0114129_10052065 Ga0114129_100520658 108
434 3300009147 Ga0114129_10084126 Ga0114129_100841267 108
435 3300009147 Ga0114129_10194135 Ga0114129_101941355 108
436 3300009147 Ga0114129_10198299 Ga0114129_101982994 108
437 3300009147 Ga0114129_10206562 Ga0114129_102065626 108
438 3300009147 Ga0114129_10229113 Ga0114129_102291134 108
439 3300009147 Ga0114129_10307783 Ga0114129_103077836 108
440 3300009147 Ga0114129_11062991 Ga0114129_110629912 108
441 3300009147 Ga0114129_11214155 Ga0114129_112141552 108
442 3300009147 Ga0114129_11330911 Ga0114129_113309112 108
443 3300009148 Ga0105243_10139419 Ga0105243_101394192 108
444 3300009148 Ga0105243_12798269 Ga0105243_127982692 108
445 3300009176 Ga0105242_10417053 Ga0105242_104170533 108
446 3300009176 Ga0105242_10553969 Ga0105242_105539692 108
447 3300009177 Ga0105248_11897990 Ga0105248_118979902 108
448 3300009553 Ga0105249_10209532 Ga0105249_102095322 108
449 3300009553 Ga0105249_10788316 Ga0105249_107883162 108
450 3300009553 Ga0105249_11705366 Ga0105249_117053661 108
451 3300013297 Ga0157378_10095871 Ga0157378_100958716 108
452 3300013297 Ga0157378_10540139 Ga0157378_105401392 108
453 3300013306 Ga0163162_10017924 Ga0163162_1001792412 108
454 3300013306 Ga0163162_10679264 Ga0163162_106792641 108
455 3300013306 Ga0163162_11729240 Ga0163162_117292402 108
456 3300013306 Ga0163162_13064193 Ga0163162_130641932 108
457 3300013308 Ga0157375_10018537 Ga0157375_1001853710 108
458 3300013308 Ga0157375_10720572 Ga0157375_107205722 108
459 3300014326 Ga0157380_10173845 Ga0157380_101738452 108
460 3300014326 Ga0157380_10178128 Ga0157380_101781282 108
461 3300017792 Ga0163161_10055270 Ga0163161_100552702 108
462 3300025885 Ga0207653_10019316 Ga0207653_100193161 108
463 3300025899 Ga0207642_10047798 Ga0207642_100477984 108
464 3300025899 Ga0207642_10769696 Ga0207642_107696962 108
465 3300025901 Ga0207688_10383631 Ga0207688_103836311 108
466 3300025907 Ga0207645_10146185 Ga0207645_101461854 108
467 3300025908 Ga0207643_10584459 Ga0207643_105844592 108
468 3300025910 Ga0207684_10000456 Ga0207684_1000045614 108
469 3300025910 Ga0207684_10026777 Ga0207684_100267775 108
470 3300025910 Ga0207684_10908464 Ga0207684_109084641 108
471 3300025911 Ga0207654_10120612 Ga0207654_101206121 108
472 3300025912 Ga0207707_10180263 Ga0207707_101802635 108
473 3300025917 Ga0207660_10578476 Ga0207660_105784763 108
474 3300025922 Ga0207646_10006057 Ga0207646_1000605714 108
475 3300025922 Ga0207646_10071164 Ga0207646_100711645 108
476 3300025922 Ga0207646_10202508 Ga0207646_102025084 108
477 3300025923 Ga0207681_10124378 Ga0207681_101243782 108
478 3300025923 Ga0207681_10253810 Ga0207681_102538102 108
479 3300025923 Ga0207681_10682272 Ga0207681_106822722 108
480 3300025933 Ga0207706_10027307 Ga0207706_100273077 108
481 3300025933 Ga0207706_11324814 Ga0207706_113248142 108
482 3300025935 Ga0207709_10538417 Ga0207709_105384171 108
483 3300025940 Ga0207691_10026046 Ga0207691_1002604610 108
484 3300025961 Ga0207712_11137290 Ga0207712_111372902 108
485 3300025961 Ga0207712_11862753 Ga0207712_118627531 108
486 3300025972 Ga0207668_10031147 Ga0207668_100311478 108
487 3300026075 Ga0207708_10193343 Ga0207708_101933433 108
488 3300026075 Ga0207708_10635098 Ga0207708_106350981 108
489 3300026088 Ga0207641_10400304 Ga0207641_104003042 108
490 3300026088 Ga0207641_10929995 Ga0207641_109299952 108
491 3300026089 Ga0207648_10017195 Ga0207648_100171958 108
492 3300026089 Ga0207648_10234708 Ga0207648_102347082 108
493 3300026118 Ga0207675_100151804 Ga0207675_1001518042 108
494 3300026142 Ga0207698_11307224 Ga0207698_113072242 108
495 3300027424 Ga0209984_1022750 Ga0209984_10227502 108
496 3300027471 Ga0209995_1021355 Ga0209995_10213552 108
497 3300027543 Ga0209999_1069839 Ga0209999_10698391 108
498 3300027665 Ga0209983_1013604 Ga0209983_10136042 108
499 3300027665 Ga0209983_1015634 Ga0209983_10156342 108
500 3300027671 Ga0209588_1012039 Ga0209588_10120392 108
501 3300027671 Ga0209588_1166301 Ga0209588_11663011 108
502 3300027682 Ga0209971_1043870 Ga0209971_10438701 108
503 3300027682 Ga0209971_1062339 Ga0209971_10623393 108
504 3300027695 Ga0209966_1009422 Ga0209966_10094224 108
505 3300027717 Ga0209998_10018662 Ga0209998_100186624 108
506 3300027876 Ga0209974_10033649 Ga0209974_100336492 108
507 3300027876 Ga0209974_10214664 Ga0209974_102146641 108
508 3300027907 Ga0207428_10000095 Ga0207428_1000009513 108
509 3300027907 Ga0207428_10009686 Ga0207428_100096869 108
510 3300027907 Ga0207428_10235905 Ga0207428_102359052 108
511 3300028380 Ga0268265_10086615 Ga0268265_100866155 108
512 3300028380 Ga0268265_10274353 Ga0268265_102743532 108
513 3300028381 Ga0268264_10137532 Ga0268264_101375326 108
514 3300028381 Ga0268264_10506776 Ga0268264_105067762 108
515 3300031548 Ga0307408_100019777 Ga0307408_1000197775 108
516 3300031548 Ga0307408_100076778 Ga0307408_1000767784 108
517 3300031548 Ga0307408_100141580 Ga0307408_1001415803 108
518 3300031824 Ga0307413_11403768 Ga0307413_114037682 108
519 3300031852 Ga0307410_10822148 Ga0307410_108221481 108
520 3300031901 Ga0307406_10450772 Ga0307406_104507722 108
521 3300031903 Ga0307407_10139639 Ga0307407_101396392 108
522 3300031903 Ga0307407_11077132 Ga0307407_110771321 108
523 3300031995 Ga0307409_100943405 Ga0307409_1009434052 108
524 3300031995 Ga0307409_101829446 Ga0307409_1018294462 108
525 3300032002 Ga0307416_101083771 Ga0307416_1010837712 108
526 3300032002 Ga0307416_101410754 Ga0307416_1014107541 108
527 3300032002 Ga0307416_102208863 Ga0307416_1022088632 108
528 3300032004 Ga0307414_10545910 Ga0307414_105459102 108
529 3300032005 Ga0307411_10686226 Ga0307411_106862262 108
530 3300032005 Ga0307411_11006500 Ga0307411_110065002 108
531 3300032126 Ga0307415_101762651 Ga0307415_1017626512 108
532 3300032126 Ga0307415_102354265 Ga0307415_1023542651 108
533 3300034817 Ga0373948_0114363 Ga0373948_0114363_146_472 108
534 3300034818 Ga0373950_0086002 Ga0373950_0086002_177_503 108
535 3300034819 Ga0373958_0008605 Ga0373958_0008605_371_697 108
536 3300035088 Ga0373940_0067883 Ga0373940_0067883_48_374 108
537 3300035090 Ga0373949_0087794 Ga0373949_0087794_204_530 108
538 3300035091 Ga0373951_0072212 Ga0373951_0072212_123_449 108
539 3300035112 Ga0373932_0114435 Ga0373932_0114435_117_443 108
540 3300035114 Ga0373939_0029277 Ga0373939_0029277_184_510 108
541 3300035114 Ga0373939_0051324 Ga0373939_0051324_694_1020 108
542 3300035114 Ga0373939_0235327 Ga0373939_0235327_159_485 108
543 3300035115 Ga0373941_0086478 Ga0373941_0086478_435_761 108
544 3300035207 Ga0373942_0011047 Ga0373942_0011047_1761_2087 108
545 3300035207 Ga0373942_0265321 Ga0373942_0265321_201_527 108
546 3300035242 Ga0373962_0043496 Ga0373962_0043496_864_1190 108
547 3300035691 Ga0373931_0323102 Ga0373931_0323102_479_805 108
548 3300035691 Ga0373931_0787443 Ga0373931_0787443_146_472 108
549 3300037312 Ga0395899_0008260 Ga0395899_0008260_6743_7069 108
550 3300037312 Ga0395899_0350728 Ga0395899_0350728_192_518 108
551 3300037418 Ga0395900_0001056 Ga0395900_0001056_25194_25520 108
552 3300037418 Ga0395900_0242558 Ga0395900_0242558_1116_1442 108
553 3300037418 Ga0395900_0346351 Ga0395900_0346351_815_1141 108
554 3300037466 Ga0395898_0013165 Ga0395898_0013165_2281_2607 108
555 3300037471 Ga0395905_0097819 Ga0395905_0097819_229_555 108
556 3300038443 Ga0395901_0002023 Ga0395901_0002023_4805_5131 108
557 3300038443 Ga0395901_0107826 Ga0395901_0107826_196_522 108
558 3300038443 Ga0395901_1066364 Ga0395901_1066364_408_734 108
559 3300038996 Ga0242420_091411 Ga0242420_091411_273_599 108
560 3300041410 Ga0439461_0039751 Ga0439461_0039751_385_711 108
561 3300042013 Ga0439456_065495 Ga0439456_065495_136_468 108
562 3300042435 Ga0439434_0191369 Ga0439434_0191369_122_460 108
563 3300042436 Ga0439435_0016753 Ga0439435_0016753_1090_1416 108
564 3300042876 Ga0451577_0053816 Ga0451577_0053816_1046_1372 108
565 3300042876 Ga0451577_0897007 Ga0451577_0897007_246_572 108
566 3300044712 Ga0453684_0219137 Ga0453684_0219137_226_552 108
567 3300045051 Ga0451576_0081297 Ga0451576_0081297_978_1304 108
568 3300045051 Ga0451576_0178931 Ga0451576_0178931_1160_1486 108
569 3300045051 Ga0451576_0515794 Ga0451576_0515794_80_415 108
570 3300045051 Ga0451576_1170676 Ga0451576_1170676_315_641 108
571 3300046455 Ga0495603_0188955 Ga0495603_0188955_468_794 108
572 3300046472 Ga0495580_0000020 Ga0495580_0000020_85363_85689 108
573 3300046499 Ga0495594_0460160 Ga0495594_0460160_335_661 108
574 3300046528 Ga0495642_0029511 Ga0495642_0029511_1008_1334 108
575 3300046530 Ga0495654_0262300 Ga0495654_0262300_192_518 108
576 3300046530 Ga0495654_0272344 Ga0495654_0272344_155_481 108
577 3300046537 Ga0495598_0067749 Ga0495598_0067749_368_694 108
578 3300046538 Ga0495609_0382466 Ga0495609_0382466_20_346 108
579 3300046539 Ga0495621_0535525 Ga0495621_0535525_26_352 108
580 3300046615 Ga0495656_0592851 Ga0495656_0592851_130_456 108
581 3300046664 Ga0495659_0062883 Ga0495659_0062883_38_364 108
582 3300046664 Ga0495659_0094409 Ga0495659_0094409_68_394 108
583 3300046664 Ga0495659_0158172 Ga0495659_0158172_77_403 108
584 3300046684 Ga0495669_0069259 Ga0495669_0069259_741_1067 108
585 3300046684 Ga0495669_0124712 Ga0495669_0124712_836_1162 108
586 3300046684 Ga0495669_0220864 Ga0495669_0220864_254_580 108
587 3300046691 Ga0495670_0419911 Ga0495670_0419911_351_677 108
588 3300047318 Ga0495636_0061680 Ga0495636_0061680_301_627 108
589 3300047318 Ga0495636_0066615 Ga0495636_0066615_62_388 108
590 3300047445 Ga0495677_0414427 Ga0495677_0414427_99_425 108
591 3300048907 Ga0496104_0113222 Ga0496104_0113222_73_399 108
592 3300048910 Ga0496107_0462407 Ga0496107_0462407_480_806 108
593 3300049527 Ga0501311_104467 Ga0501311_104467_50_376 108
594 3300049568 Ga0501031_0302505 Ga0501031_0302505_10_336 108
595 3300049568 Ga0501031_0357083 Ga0501031_0357083_289_615 108
596 3300049568 Ga0501031_0412632 Ga0501031_0412632_413_739 108
597 3300049568 Ga0501031_0724032 Ga0501031_0724032_251_577 108
598 3300049569 Ga0501032_0036421 Ga0501032_0036421_1070_1402 108
599 3300049569 Ga0501032_0146588 Ga0501032_0146588_1205_1537 108
600 3300049570 Ga0501033_0023237 Ga0501033_0023237_3847_4179 108
601 3300049570 Ga0501033_0124456 Ga0501033_0124456_36_362 108
602 3300049570 Ga0501033_0126989 Ga0501033_0126989_855_1181 108
603 3300049570 Ga0501033_0227538 Ga0501033_0227538_294_620 108
604 3300049572 Ga0501036_0002708 Ga0501036_0002708_13343_13675 108
605 3300049572 Ga0501036_0028611 Ga0501036_0028611_2735_3067 108
606 3300049572 Ga0501036_0191427 Ga0501036_0191427_529_855 108
607 3300049572 Ga0501036_0511097 Ga0501036_0511097_595_921 108
608 3300049572 Ga0501036_1285326 Ga0501036_1285326_227_553 108
609 3300049573 Ga0501037_0239711 Ga0501037_0239711_411_743 108
610 3300049574 Ga0501038_0001811 Ga0501038_0001811_4261_4593 108
611 3300049574 Ga0501038_0021614 Ga0501038_0021614_88_420 108
612 3300049574 Ga0501038_0069689 Ga0501038_0069689_731_1057 108
613 3300049574 Ga0501038_0125620 Ga0501038_0125620_1242_1568 108
614 3300049575 Ga0501039_0001335 Ga0501039_0001335_5706_6038 108
615 3300049575 Ga0501039_0016831 Ga0501039_0016831_4840_5166 108
616 3300049575 Ga0501039_0048162 Ga0501039_0048162_1766_2092 108
617 3300049575 Ga0501039_0052922 Ga0501039_0052922_505_837 108
618 3300049575 Ga0501039_0077957 Ga0501039_0077957_221_553 108
619 3300049575 Ga0501039_0388386 Ga0501039_0388386_395_721 108
620 3300049576 Ga0501040_0006127 Ga0501040_0006127_5790_6122 108
621 3300049576 Ga0501040_0022910 Ga0501040_0022910_3668_4000 108
622 3300049576 Ga0501040_0035873 Ga0501040_0035873_826_1152 108
623 3300049576 Ga0501040_0047939 Ga0501040_0047939_882_1208 108
624 3300049576 Ga0501040_0055782 Ga0501040_0055782_2081_2413 108
625 3300049576 Ga0501040_0230681 Ga0501040_0230681_458_784 108
626 3300049576 Ga0501040_0290496 Ga0501040_0290496_721_1047 108
627 3300049576 Ga0501040_0428924 Ga0501040_0428924_123_449 108
628 3300049576 Ga0501040_0597530 Ga0501040_0597530_367_693 108
629 3300049577 Ga0501041_0000355 Ga0501041_0000355_21305_21637 108
630 3300049577 Ga0501041_0009982 Ga0501041_0009982_309_641 108
631 3300049577 Ga0501041_0039483 Ga0501041_0039483_1004_1330 108
632 3300049577 Ga0501041_0150271 Ga0501041_0150271_441_767 108
633 3300049577 Ga0501041_0294387 Ga0501041_0294387_324_656 108
634 3300049578 Ga0501042_0000948 Ga0501042_0000948_9356_9688 108
635 3300049578 Ga0501042_0009210 Ga0501042_0009210_3090_3422 108
636 3300049578 Ga0501042_0079238 Ga0501042_0079238_1603_1929 108
637 3300049578 Ga0501042_0104718 Ga0501042_0104718_1343_1669 108
638 3300049578 Ga0501042_0146652 Ga0501042_0146652_666_992 108
639 3300049578 Ga0501042_0299781 Ga0501042_0299781_652_984 108
640 3300049578 Ga0501042_0307713 Ga0501042_0307713_127_453 108
641 3300049578 Ga0501042_0618715 Ga0501042_0618715_111_437 108
642 3300049579 Ga0501043_0015166 Ga0501043_0015166_425_757 108
643 3300049579 Ga0501043_0378606 Ga0501043_0378606_88_414 108
644 3300049579 Ga0501043_1327154 Ga0501043_1327154_84_416 108
645 3300049580 Ga0501046_0005447 Ga0501046_0005447_5808_6140 108
646 3300049580 Ga0501046_0026001 Ga0501046_0026001_2167_2493 108
647 3300049580 Ga0501046_0026439 Ga0501046_0026439_288_620 108
648 3300049580 Ga0501046_0181571 Ga0501046_0181571_840_1166 108
649 3300049580 Ga0501046_0201356 Ga0501046_0201356_488_814 108
650 3300049580 Ga0501046_0343037 Ga0501046_0343037_517_843 108
651 3300049580 Ga0501046_0345292 Ga0501046_0345292_503_829 108
652 3300049580 Ga0501046_0560205 Ga0501046_0560205_383_709 108
653 3300049580 Ga0501046_0795560 Ga0501046_0795560_211_537 108
654 3300049582 Ga0501048_0003958 Ga0501048_0003958_5131_5463 108
655 3300049582 Ga0501048_0033102 Ga0501048_0033102_2363_2689 108
656 3300049582 Ga0501048_0064638 Ga0501048_0064638_1457_1789 108
657 3300049582 Ga0501048_0166958 Ga0501048_0166958_584_910 108
658 3300049582 Ga0501048_0204094 Ga0501048_0204094_849_1181 108
659 3300049582 Ga0501048_0292054 Ga0501048_0292054_191_517 108
660 3300049582 Ga0501048_1103762 Ga0501048_1103762_53_379 108
661 3300049583 Ga0501067_0010535 Ga0501067_0010535_4424_4750 108
662 3300049583 Ga0501067_0081084 Ga0501067_0081084_462_788 108
663 3300049584 Ga0501068_0035130 Ga0501068_0035130_830_1162 108
664 3300049584 Ga0501068_0124913 Ga0501068_0124913_1081_1407 108
665 3300049584 Ga0501068_0158011 Ga0501068_0158011_10_336 108
666 3300049584 Ga0501068_0222894 Ga0501068_0222894_532_858 108
667 3300049584 Ga0501068_0443368 Ga0501068_0443368_348_680 108
668 3300049585 Ga0501069_0342336 Ga0501069_0342336_238_564 108
669 3300049585 Ga0501069_0550750 Ga0501069_0550750_194_520 108
670 3300049585 Ga0501069_0563134 Ga0501069_0563134_341_667 108
671 3300049586 Ga0501070_0184400 Ga0501070_0184400_900_1226 108
672 3300049586 Ga0501070_0214296 Ga0501070_0214296_720_1052 108
673 3300049586 Ga0501070_0656591 Ga0501070_0656591_298_624 108
674 3300049587 Ga0501071_0000849 Ga0501071_0000849_9992_10324 108
675 3300049587 Ga0501071_0045651 Ga0501071_0045651_231_563 108
676 3300049587 Ga0501071_0067984 Ga0501071_0067984_1435_1761 108
677 3300049587 Ga0501071_0697079 Ga0501071_0697079_323_649 108
678 3300049587 Ga0501071_0849012 Ga0501071_0849012_185_511 108
679 3300049587 Ga0501071_0914188 Ga0501071_0914188_271_597 108
680 3300049587 Ga0501071_1279969 Ga0501071_1279969_83_415 108
681 3300049588 Ga0501072_0003324 Ga0501072_0003324_5976_6308 108
682 3300049588 Ga0501072_0005776 Ga0501072_0005776_9061_9393 108
683 3300049588 Ga0501072_0014068 Ga0501072_0014068_1239_1565 108
684 3300049588 Ga0501072_0016222 Ga0501072_0016222_3464_3790 108
685 3300049588 Ga0501072_0054889 Ga0501072_0054889_1715_2041 108
686 3300049588 Ga0501072_0093892 Ga0501072_0093892_1031_1363 108
687 3300049588 Ga0501072_0142227 Ga0501072_0142227_489_815 108
688 3300049588 Ga0501072_0184339 Ga0501072_0184339_530_856 108
689 3300049588 Ga0501072_0855930 Ga0501072_0855930_87_413 108
690 3300049588 Ga0501072_1021507 Ga0501072_1021507_173_499 108
691 3300049589 Ga0501073_0183388 Ga0501073_0183388_274_606 108
692 3300049589 Ga0501073_0459972 Ga0501073_0459972_380_712 108
693 3300049590 Ga0501074_0007561 Ga0501074_0007561_1207_1533 108
694 3300049590 Ga0501074_0046419 Ga0501074_0046419_736_1062 108
695 3300049590 Ga0501074_0091585 Ga0501074_0091585_1806_2138 108
696 3300049590 Ga0501074_0158186 Ga0501074_0158186_692_1018 108
697 3300049591 Ga0501075_0001033 Ga0501075_0001033_11652_11984 108
698 3300049591 Ga0501075_0001990 Ga0501075_0001990_5771_6103 108
699 3300049591 Ga0501075_0008499 Ga0501075_0008499_5690_6016 108
700 3300049591 Ga0501075_0009915 Ga0501075_0009915_4392_4718 108
701 3300049591 Ga0501075_0012463 Ga0501075_0012463_4608_4934 108
702 3300049591 Ga0501075_0021767 Ga0501075_0021767_1774_2100 108
703 3300049591 Ga0501075_0043196 Ga0501075_0043196_2681_3013 108
704 3300049591 Ga0501075_0069106 Ga0501075_0069106_869_1195 108
705 3300049591 Ga0501075_0193971 Ga0501075_0193971_243_569 108
706 3300049591 Ga0501075_0442517 Ga0501075_0442517_305_631 108
707 3300049591 Ga0501075_0867437 Ga0501075_0867437_310_642 108
708 3300049591 Ga0501075_0877850 Ga0501075_0877850_114_440 108
709 3300049592 Ga0501076_0000979 Ga0501076_0000979_11527_11859 108
710 3300049592 Ga0501076_0004384 Ga0501076_0004384_3880_4212 108
711 3300049592 Ga0501076_0009654 Ga0501076_0009654_1575_1901 108
712 3300049592 Ga0501076_0028793 Ga0501076_0028793_225_557 108
713 3300049592 Ga0501076_0030185 Ga0501076_0030185_3429_3755 108
714 3300049592 Ga0501076_0181312 Ga0501076_0181312_1213_1539 108
715 3300049592 Ga0501076_0303754 Ga0501076_0303754_191_517 108
716 3300049593 Ga0501077_0002533 Ga0501077_0002533_6796_7122 108
717 3300049593 Ga0501077_0004004 Ga0501077_0004004_2772_3098 108
718 3300049593 Ga0501077_0007258 Ga0501077_0007258_5003_5335 108
719 3300049593 Ga0501077_0140071 Ga0501077_0140071_43_369 108
720 3300049593 Ga0501077_0177896 Ga0501077_0177896_681_1007 108
721 3300049593 Ga0501077_0443968 Ga0501077_0443968_468_794 108
722 3300049593 Ga0501077_0737224 Ga0501077_0737224_107_439 108
723 3300049593 Ga0501077_0809413 Ga0501077_0809413_121_447 108
724 3300049741 Ga0501079_0001475 Ga0501079_0001475_10201_10533 108
725 3300049741 Ga0501079_0011359 Ga0501079_0011359_789_1115 108
726 3300049741 Ga0501079_0012904 Ga0501079_0012904_5991_6317 108
727 3300049741 Ga0501079_0019976 Ga0501079_0019976_4491_4823 108
728 3300049741 Ga0501079_0035117 Ga0501079_0035117_1476_1808 108
729 3300049741 Ga0501079_0073643 Ga0501079_0073643_1979_2305 108
730 3300049741 Ga0501079_0115926 Ga0501079_0115926_1150_1476 108
731 3300049741 Ga0501079_0176756 Ga0501079_0176756_1239_1565 108
732 3300049741 Ga0501079_0710716 Ga0501079_0710716_398_730 108
733 3300049741 Ga0501079_0730646 Ga0501079_0730646_417_743 108
734 3300049741 Ga0501079_1105692 Ga0501079_1105692_155_481 108
735 3300049742 Ga0501080_0010137 Ga0501080_0010137_7558_7890 108
736 3300049742 Ga0501080_0015571 Ga0501080_0015571_3328_3660 108
737 3300049742 Ga0501080_0023877 Ga0501080_0023877_3869_4201 108
738 3300049742 Ga0501080_0296963 Ga0501080_0296963_553_879 108
739 3300049743 Ga0501081_0001239 Ga0501081_0001239_9414_9746 108
740 3300049743 Ga0501081_0002378 Ga0501081_0002378_4996_5328 108
741 3300049743 Ga0501081_0010657 Ga0501081_0010657_2930_3256 108
742 3300049743 Ga0501081_0012727 Ga0501081_0012727_641_973 108
743 3300049743 Ga0501081_0067148 Ga0501081_0067148_1921_2247 108
744 3300049743 Ga0501081_0073654 Ga0501081_0073654_962_1288 108
745 3300049743 Ga0501081_0077101 Ga0501081_0077101_467_793 108
746 3300049743 Ga0501081_0101055 Ga0501081_0101055_598_930 108
747 3300049743 Ga0501081_0149441 Ga0501081_0149441_312_638 108
748 3300049743 Ga0501081_0275890 Ga0501081_0275890_127_453 108
749 3300049743 Ga0501081_0345977 Ga0501081_0345977_296_622 108
750 3300049743 Ga0501081_0661020 Ga0501081_0661020_330_656 108
751 3300049743 Ga0501081_0698114 Ga0501081_0698114_72_404 108
752 3300049744 Ga0501083_0016891 Ga0501083_0016891_557_889 108
753 3300049744 Ga0501083_0038897 Ga0501083_0038897_2737_3063 108
754 3300049744 Ga0501083_0440396 Ga0501083_0440396_147_473 108
755 3300049822 Ga0501035_0014697 Ga0501035_0014697_5783_6115 108
756 3300049822 Ga0501035_0319280 Ga0501035_0319280_188_514 108
757 3300049822 Ga0501035_0469796 Ga0501035_0469796_320_646 108
758 3300049822 Ga0501035_0690057 Ga0501035_0690057_10_336 108
759 3300049822 Ga0501035_0940491 Ga0501035_0940491_34_366 108
760 3300049823 Ga0501044_0272823 Ga0501044_0272823_64_396 108
761 3300049823 Ga0501044_1534816 Ga0501044_1534816_184_516 108
762 3300049824 Ga0501045_0000682 Ga0501045_0000682_15388_15720 108
763 3300049824 Ga0501045_0008044 Ga0501045_0008044_2993_3325 108
764 3300049824 Ga0501045_0042489 Ga0501045_0042489_752_1078 108
765 3300049824 Ga0501045_0079975 Ga0501045_0079975_1093_1419 108
766 3300049824 Ga0501045_0091167 Ga0501045_0091167_314_640 108
767 3300049824 Ga0501045_0242445 Ga0501045_0242445_494_820 108
768 3300049824 Ga0501045_0264913 Ga0501045_0264913_650_982 108
769 3300049824 Ga0501045_0267709 Ga0501045_0267709_169_495 108
770 3300049824 Ga0501045_0412839 Ga0501045_0412839_183_509 108
771 3300049824 Ga0501045_1361854 Ga0501045_1361854_169_501 108
772 3300050507 nmdc:mga05p37_1049514_c1 nmdc:mga05p37_1049514_c1_33_359 108
773 3300050507 nmdc:mga05p37_1052772_c1 nmdc:mga05p37_1052772_c1_250_576 108
774 3300050507 nmdc:mga05p37_13622_c1 nmdc:mga05p37_13622_c1_3334_3660 108
775 3300050507 nmdc:mga05p37_14246_c1 nmdc:mga05p37_14246_c1_5833_6159 108
776 3300050507 nmdc:mga05p37_1616_c1 nmdc:mga05p37_1616_c1_25346_25672 108
777 3300050507 nmdc:mga05p37_245336_c1 nmdc:mga05p37_245336_c1_442_768 108
778 3300050507 nmdc:mga05p37_282341_c1 nmdc:mga05p37_282341_c1_450_776 108
779 3300050507 nmdc:mga05p37_3121_c1 nmdc:mga05p37_3121_c1_5613_5945 108
780 3300050507 nmdc:mga05p37_33395_c1 nmdc:mga05p37_33395_c1_5378_5704 108
781 3300050507 nmdc:mga05p37_34567_c1 nmdc:mga05p37_34567_c1_2611_2937 108
782 3300050507 nmdc:mga05p37_35074_c1 nmdc:mga05p37_35074_c1_174_500 108
783 3300050507 nmdc:mga05p37_564117_c1 nmdc:mga05p37_564117_c1_790_1116 108
784 3300050507 nmdc:mga05p37_70806_c1 nmdc:mga05p37_70806_c1_3790_4116 108
785 3300050507 nmdc:mga05p37_73202_c1 nmdc:mga05p37_73202_c1_1402_1728 108
786 3300050507 nmdc:mga05p37_739941_c1 nmdc:mga05p37_739941_c1_388_714 108
787 3300050507 nmdc:mga05p37_83387_c1 nmdc:mga05p37_83387_c1_27_353 108
788 3300050508 nmdc:mga09592_1122411_c1 nmdc:mga09592_1122411_c1_237_563 108
789 3300050508 nmdc:mga09592_128303_c1 nmdc:mga09592_128303_c1_1171_1497 108
790 3300050508 nmdc:mga09592_13087_c1 nmdc:mga09592_13087_c1_3052_3378 108
791 3300050508 nmdc:mga09592_132575_c1 nmdc:mga09592_132575_c1_956_1282 108
792 3300050508 nmdc:mga09592_14096_c1 nmdc:mga09592_14096_c1_4506_4832 108
793 3300050508 nmdc:mga09592_14462_c1 nmdc:mga09592_14462_c1_2916_3242 108
794 3300050508 nmdc:mga09592_201664_c1 nmdc:mga09592_201664_c1_672_998 108
795 3300050508 nmdc:mga09592_27761_c1 nmdc:mga09592_27761_c1_4336_4662 108
796 3300050508 nmdc:mga09592_57951_c1 nmdc:mga09592_57951_c1_2599_2925 108
797 3300050508 nmdc:mga09592_66302_c1 nmdc:mga09592_66302_c1_1560_1886 108
798 3300050508 nmdc:mga09592_73465_c1 nmdc:mga09592_73465_c1_2554_2880 108
799 3300050508 nmdc:mga09592_741279_c1 nmdc:mga09592_741279_c1_86_412 108
800 3300050509 nmdc:mga0qj67_11172_c1 nmdc:mga0qj67_11172_c1_621_947 108
801 3300050509 nmdc:mga0qj67_150038_c1 nmdc:mga0qj67_150038_c1_1179_1505 108
802 3300050509 nmdc:mga0qj67_232276_c1 nmdc:mga0qj67_232276_c1_980_1318 108
803 3300050509 nmdc:mga0qj67_245051_c1 nmdc:mga0qj67_245051_c1_528_854 108
804 3300050509 nmdc:mga0qj67_252379_c1 nmdc:mga0qj67_252379_c1_13_339 108
805 3300050509 nmdc:mga0qj67_2619_c1 nmdc:mga0qj67_2619_c1_5896_6222 108
806 3300050509 nmdc:mga0qj67_5121_c1 nmdc:mga0qj67_5121_c1_3533_3859 108
807 3300050509 nmdc:mga0qj67_544062_c1 nmdc:mga0qj67_544062_c1_480_806 108
808 3300050509 nmdc:mga0qj67_64242_c1 nmdc:mga0qj67_64242_c1_193_519 108
809 3300050509 nmdc:mga0qj67_652_c1 nmdc:mga0qj67_652_c1_5793_6119 108
810 3300050510 nmdc:mga06r32_10547_c1 nmdc:mga06r32_10547_c1_6001_6327 108
811 3300050510 nmdc:mga06r32_150921_c1 nmdc:mga06r32_150921_c1_1226_1552 108
812 3300050510 nmdc:mga06r32_18264_c1 nmdc:mga06r32_18264_c1_5272_5598 108
813 3300050510 nmdc:mga06r32_1949_c1 nmdc:mga06r32_1949_c1_2697_3023 108
814 3300050510 nmdc:mga06r32_215006_c1 nmdc:mga06r32_215006_c1_1486_1812 108
815 3300050510 nmdc:mga06r32_21776_c1 nmdc:mga06r32_21776_c1_2982_3308 108
816 3300050510 nmdc:mga06r32_23363_c1 nmdc:mga06r32_23363_c1_2908_3234 108
817 3300050510 nmdc:mga06r32_250438_c1 nmdc:mga06r32_250438_c1_681_1007 108
818 3300050510 nmdc:mga06r32_258567_c1 nmdc:mga06r32_258567_c1_1308_1640 108
819 3300050510 nmdc:mga06r32_259512_c1 nmdc:mga06r32_259512_c1_350_676 108
820 3300050510 nmdc:mga06r32_28227_c1 nmdc:mga06r32_28227_c1_2940_3266 108
821 3300050510 nmdc:mga06r32_440368_c1 nmdc:mga06r32_440368_c1_799_1125 108
822 3300050510 nmdc:mga06r32_44381_c1 nmdc:mga06r32_44381_c1_1952_2278 108
823 3300050510 nmdc:mga06r32_49418_c1 nmdc:mga06r32_49418_c1_3056_3388 108
824 3300050510 nmdc:mga06r32_8063_c1 nmdc:mga06r32_8063_c1_5269_5595 108
825 3300050510 nmdc:mga06r32_824652_c1 nmdc:mga06r32_824652_c1_42_368 108
826 3300050511 nmdc:mga08y16_16604_c1 nmdc:mga08y16_16604_c1_1682_2008 108
827 3300050511 nmdc:mga08y16_1953524_c1 nmdc:mga08y16_1953524_c1_157_483 108
828 3300050511 nmdc:mga08y16_495190_c1 nmdc:mga08y16_495190_c1_533_859 108
829 3300050511 nmdc:mga08y16_64772_c1 nmdc:mga08y16_64772_c1_3328_3654 108
830 3300050511 nmdc:mga08y16_716_c1 nmdc:mga08y16_716_c1_26324_26650 108
831 3300050512 nmdc:mga0n895_119095_c1 nmdc:mga0n895_119095_c1_2017_2343 108
832 3300050512 nmdc:mga0n895_1461035_c1 nmdc:mga0n895_1461035_c1_29_355 108
833 3300050512 nmdc:mga0n895_14991_c1 nmdc:mga0n895_14991_c1_3371_3697 108
834 3300050512 nmdc:mga0n895_17413_c1 nmdc:mga0n895_17413_c1_5160_5486 108
835 3300050512 nmdc:mga0n895_188488_c1 nmdc:mga0n895_188488_c1_1121_1447 108
836 3300050512 nmdc:mga0n895_74068_c1 nmdc:mga0n895_74068_c1_1163_1489 108
837 3300050512 nmdc:mga0n895_77155_c1 nmdc:mga0n895_77155_c1_2947_3273 108
838 3300050512 nmdc:mga0n895_852910_c1 nmdc:mga0n895_852910_c1_486_812 108
839 3300050512 nmdc:mga0n895_98_c1 nmdc:mga0n895_98_c1_3770_4096 108
840 3300050513 nmdc:mga0rr50_110548_c1 nmdc:mga0rr50_110548_c1_499_825 108
841 3300050513 nmdc:mga0rr50_188595_c1 nmdc:mga0rr50_188595_c1_413_739 108
842 3300050513 nmdc:mga0rr50_197525_c1 nmdc:mga0rr50_197525_c1_95_421 108
843 3300050513 nmdc:mga0rr50_371180_c1 nmdc:mga0rr50_371180_c1_736_1062 108
844 3300050513 nmdc:mga0rr50_4985_c1 nmdc:mga0rr50_4985_c1_3831_4157 108
845 3300050513 nmdc:mga0rr50_546038_c1 nmdc:mga0rr50_546038_c1_443_769 108
846 3300050513 nmdc:mga0rr50_8956_c1 nmdc:mga0rr50_8956_c1_5842_6168 108
847 3300050514 nmdc:mga08x19_1083726_c1 nmdc:mga08x19_1083726_c1_190_516 108
848 3300050514 nmdc:mga08x19_116470_c1 nmdc:mga08x19_116470_c1_359_685 108
849 3300050514 nmdc:mga08x19_119161_c1 nmdc:mga08x19_119161_c1_1294_1620 108
850 3300050514 nmdc:mga08x19_18471_c1 nmdc:mga08x19_18471_c1_3642_3968 108
851 3300050514 nmdc:mga08x19_344186_c1 nmdc:mga08x19_344186_c1_161_487 108
852 3300050514 nmdc:mga08x19_80820_c1 nmdc:mga08x19_80820_c1_31_357 108
853 3300050515 nmdc:mga0a205_107052_c1 nmdc:mga0a205_107052_c1_1677_2003 108
854 3300050515 nmdc:mga0a205_1187991_c1 nmdc:mga0a205_1187991_c1_45_371 108
855 3300050515 nmdc:mga0a205_13385_c1 nmdc:mga0a205_13385_c1_1102_1428 108
856 3300050515 nmdc:mga0a205_13873_c1 nmdc:mga0a205_13873_c1_4478_4804 108
857 3300050515 nmdc:mga0a205_162356_c1 nmdc:mga0a205_162356_c1_144_470 108
858 3300050515 nmdc:mga0a205_2218_c1 nmdc:mga0a205_2218_c1_11045_11371 108
859 3300050515 nmdc:mga0a205_234036_c1 nmdc:mga0a205_234036_c1_58_384 108
860 3300050515 nmdc:mga0a205_2425_c1 nmdc:mga0a205_2425_c1_1163_1489 108
861 3300050515 nmdc:mga0a205_509061_c1 nmdc:mga0a205_509061_c1_61_393 108
862 3300050515 nmdc:mga0a205_551424_c1 nmdc:mga0a205_551424_c1_251_577 108
863 3300050515 nmdc:mga0a205_581361_c1 nmdc:mga0a205_581361_c1_100_426 108
864 3300050515 nmdc:mga0a205_728555_c1 nmdc:mga0a205_728555_c1_439_765 108
865 3300054114 Ga0501084_0000677 Ga0501084_0000677_18745_19077 108
866 3300054114 Ga0501084_0004051 Ga0501084_0004051_11423_11755 108
867 3300054114 Ga0501084_0006689 Ga0501084_0006689_6586_6912 108
868 3300054114 Ga0501084_0009461 Ga0501084_0009461_1932_2258 108
869 3300054114 Ga0501084_0052120 Ga0501084_0052120_1025_1357 108
870 3300054114 Ga0501084_0261986 Ga0501084_0261986_799_1125 108
871 3300054114 Ga0501084_0375339 Ga0501084_0375339_750_1076 108
872 3300054114 Ga0501084_0869636 Ga0501084_0869636_360_686 108
873 3300054114 Ga0501084_0882768 Ga0501084_0882768_267_599 108
874 3300054114 Ga0501084_1084397 Ga0501084_1084397_34_360 108
875 3300054114 Ga0501084_1177034 Ga0501084_1177034_72_404 108
876 3300059421 Ga0590071_082178 Ga0590071_082178_124_450 108
877 3300059423 Ga0590074_011664 Ga0590074_011664_1025_1351 108
878 3300059424 Ga0590075_026662 Ga0590075_026662_154_480 108
879 3300059424 Ga0590075_040896 Ga0590075_040896_151_477 108
880 3300059426 Ga0590077_006877 Ga0590077_006877_90_416 108
881 3300060353 Ga0501082_0002099 Ga0501082_0002099_15113_15445 108
882 3300060353 Ga0501082_0017314 Ga0501082_0017314_2291_2617 108
883 3300060353 Ga0501082_0064732 Ga0501082_0064732_1810_2142 108
884 3300060353 Ga0501082_0068071 Ga0501082_0068071_2232_2558 108
885 3300060353 Ga0501082_0076949 Ga0501082_0076949_648_980 108
886 3300060353 Ga0501082_0088868 Ga0501082_0088868_933_1259 108
887 3300060353 Ga0501082_0142974 Ga0501082_0142974_890_1216 108
888 3300060353 Ga0501082_0255132 Ga0501082_0255132_76_402 108
889 3300060353 Ga0501082_0260302 Ga0501082_0260302_712_1038 108
890 3300061734 Ga0530510_0001293 Ga0530510_0001293_5773_6105 108
891 3300061734 Ga0530510_0008795 Ga0530510_0008795_3183_3515 108
892 3300061734 Ga0530510_0029569 Ga0530510_0029569_1540_1872 108
893 3300061734 Ga0530510_0066892 Ga0530510_0066892_2054_2386 108
894 3300061734 Ga0530510_0237852 Ga0530510_0237852_181_507 108
895 3300061734 Ga0530510_0252534 Ga0530510_0252534_381_707 108
896 3300061734 Ga0530510_0349535 Ga0530510_0349535_724_1050 108
897 3300061734 Ga0530510_0411741 Ga0530510_0411741_210_536 108
898 3300061734 Ga0530510_0535220 Ga0530510_0535220_362_688 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

47

111

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.953 5 105
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9471 4 105
6wru-assembly1.cif.gz_G structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid 0.9428 5 105
7ttu-assembly1.cif.gz_G 50s ribosomal subunit from staphylococcus aureus (strain atcc43300) 0.9421 5 105
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9414 5 105
ID Description Score Start End Superfamily
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9345 1 103 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9243 3 103 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9185 4 102 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9089 1 103 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8988 1 103 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1G2P436-F1-model_v4 Large ribosomal subunit protein uL24 0.9467 6 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G1V3V8-F1-model_v4 Large ribosomal subunit protein uL24 0.9426 3 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2M7RDH9-F1-model_v4 Large ribosomal subunit protein uL24 0.9413 5 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0F9XV12-F1-model_v4 Large ribosomal subunit protein uL24 0.9395 5 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-T0XPS5-F1-model_v4 Large ribosomal subunit protein uL24 0.9381 6 108 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
90.7 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map