F484763
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 888 | 400 | 1776 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0090137|Ga0373947_0090137_990_1781 |
| Length | 249 |
| Sequence | MFPPERIVCLTEETVETLYLLGEDRRIVGVSGYAVRPARVRREKPRVSAFISADFEKVLALEPDLVLTFSDLQADIAAELIRRSIAVHAFNHRDVAGIFDMIRTLGALVGAAEKAEALACALERRPRVYFEEWDEPMISGIRWVAELIEIAGGVEVFPALSLRKNARERIVSASELIAAAPDIIVGSWCGKKFVPAKVAARPGFDVIPAVRDGFLREIKSPLILQPGPAALTDGLDALAGIIAEWAASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 224 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 266 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 267 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 387 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 391 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 396 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 399 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 400 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.7 |
| Nodule | 0 |
| Rhizoplane | 9.35 |
| Rhizosphere | 87.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373947_0090137 | 3300035725 | Bacteria | 1911 |
| 2 | 2214789669 | 2209111006 | Bacteria | 2230 |
| 3 | ARcpr5oldR_c000760 | 3300000041 | Bacteria | 3684 |
| 4 | ARSoilYngRDRAFT_c00482 | 3300000042 | Bacteria | 4731 |
| 5 | ARcpr5yngRDRAFT_c000072 | 3300000043 | Bacteria | 16816 |
| 6 | ARcpr5yngRDRAFT_c000237 | 3300000043 | Bacteria | 8266 |
| 7 | ARSoilOldRDRAFT_c001406 | 3300000044 | Bacteria | 2245 |
| 8 | ARCol0oldRDRAFT_c00533 | 3300000045 | Bacteria | 3420 |
| 9 | ARCol0yngRDRAFT_1000004 | 3300000652 | Bacteria | 52222 |
| 10 | JGI24746J21847_1001076 | 3300001977 | Bacteria | 4283 |
| 11 | JGI24747J21853_1000546 | 3300001978 | Bacteria | 2405 |
| 12 | JGI24739J22299_10007126 | 3300001989 | Bacteria | 4208 |
| 13 | JGI24737J22298_10006063 | 3300001990 | Bacteria | 4145 |
| 14 | JGI24750J21931_1000974 | 3300002070 | Bacteria | 3790 |
| 15 | JGI24745J21846_1000518 | 3300002073 | Bacteria | 3419 |
| 16 | JGI24749J21850_1000223 | 3300002076 | Bacteria | 8863 |
| 17 | JGI24034J26672_10001177 | 3300002239 | Bacteria | 3421 |
| 18 | JGI24742J22300_10000106 | 3300002244 | Bacteria | 11917 |
| 19 | JGI24751J29686_10004363 | 3300002459 | Bacteria | 2870 |
| 20 | Ga0065717_1003477 | 3300005276 | Bacteria | 1259 |
| 21 | Ga0065712_10068434 | 3300005290 | Bacteria | 10667 |
| 22 | Ga0065715_10000492 | 3300005293 | Bacteria | 13012 |
| 23 | Ga0065715_10001897 | 3300005293 | Bacteria | 8356 |
| 24 | Ga0070658_10030728 | 3300005327 | Bacteria | 4314 |
| 25 | Ga0070658_10049324 | 3300005327 | Bacteria | 3410 |
| 26 | Ga0070658_10256565 | 3300005327 | Bacteria | 1484 |
| 27 | Ga0070676_10063757 | 3300005328 | Bacteria | 2196 |
| 28 | Ga0070683_100001872 | 3300005329 | Bacteria | 16425 |
| 29 | Ga0070683_100163774 | 3300005329 | Bacteria | 2110 |
| 30 | Ga0070683_100243024 | 3300005329 | Bacteria | 1712 |
| 31 | Ga0070683_100620404 | 3300005329 | Bacteria | 1035 |
| 32 | Ga0070690_100000911 | 3300005330 | Bacteria | 15081 |
| 33 | Ga0070670_100006702 | 3300005331 | Bacteria | 9759 |
| 34 | Ga0070670_100043677 | 3300005331 | Bacteria | 3852 |
| 35 | Ga0070670_100044390 | 3300005331 | Bacteria | 3822 |
| 36 | Ga0070677_10000405 | 3300005333 | Bacteria | 15015 |
| 37 | Ga0068869_100031332 | 3300005334 | Bacteria | 3740 |
| 38 | Ga0070666_10018290 | 3300005335 | Bacteria | 4504 |
| 39 | Ga0070680_100002868 | 3300005336 | Bacteria | 12797 |
| 40 | Ga0070680_100022191 | 3300005336 | Bacteria | 5051 |
| 41 | Ga0070680_100191558 | 3300005336 | Bacteria | 1723 |
| 42 | Ga0070680_100363206 | 3300005336 | Bacteria | 1232 |
| 43 | Ga0070682_100000695 | 3300005337 | Bacteria | 20200 |
| 44 | Ga0070682_100044513 | 3300005337 | Bacteria | 2748 |
| 45 | Ga0070682_100147125 | 3300005337 | Bacteria | 1612 |
| 46 | Ga0068868_100004530 | 3300005338 | Bacteria | 9750 |
| 47 | Ga0070660_100001014 | 3300005339 | Bacteria | 18890 |
| 48 | Ga0070660_100037141 | 3300005339 | Bacteria | 3692 |
| 49 | Ga0070689_100002731 | 3300005340 | Bacteria | 11575 |
| 50 | Ga0070689_100006121 | 3300005340 | Bacteria | 8293 |
| 51 | Ga0070689_100019191 | 3300005340 | Bacteria | 5052 |
| 52 | Ga0070689_100031956 | 3300005340 | Bacteria | 4001 |
| 53 | Ga0070689_100320092 | 3300005340 | Bacteria | 1295 |
| 54 | Ga0070691_10004905 | 3300005341 | Bacteria | 6089 |
| 55 | Ga0070687_100005586 | 3300005343 | Bacteria | 5102 |
| 56 | Ga0070687_100025195 | 3300005343 | Bacteria | 2850 |
| 57 | Ga0070692_10004599 | 3300005345 | Bacteria | 5782 |
| 58 | Ga0070692_10006234 | 3300005345 | Bacteria | 5163 |
| 59 | Ga0070692_10251618 | 3300005345 | Bacteria | 1058 |
| 60 | Ga0070669_100009769 | 3300005353 | Bacteria | 6833 |
| 61 | Ga0070669_100010358 | 3300005353 | Bacteria | 6620 |
| 62 | Ga0070675_100000240 | 3300005354 | Bacteria | 35499 |
| 63 | Ga0070671_100001756 | 3300005355 | Bacteria | 16477 |
| 64 | Ga0070671_100021816 | 3300005355 | Bacteria | 5230 |
| 65 | Ga0070671_100123712 | 3300005355 | Bacteria | 2177 |
| 66 | Ga0070674_100175210 | 3300005356 | Bacteria | 1638 |
| 67 | Ga0070673_100001384 | 3300005364 | Bacteria | 14177 |
| 68 | Ga0070688_100002036 | 3300005365 | Bacteria | 10197 |
| 69 | Ga0070688_100008370 | 3300005365 | Bacteria | 5611 |
| 70 | Ga0070659_100006064 | 3300005366 | Bacteria | 8719 |
| 71 | Ga0070659_100042499 | 3300005366 | Bacteria | 3553 |
| 72 | Ga0070659_100531933 | 3300005366 | Bacteria | 1005 |
| 73 | Ga0070667_100007621 | 3300005367 | Bacteria | 8975 |
| 74 | Ga0070667_100028211 | 3300005367 | Bacteria | 4673 |
| 75 | Ga0070703_10005641 | 3300005406 | Bacteria | 3503 |
| 76 | Ga0070709_10043512 | 3300005434 | Bacteria | 2777 |
| 77 | Ga0070714_100077502 | 3300005435 | Bacteria | 2887 |
| 78 | Ga0070714_100268757 | 3300005435 | Bacteria | 1581 |
| 79 | Ga0070713_100000381 | 3300005436 | Bacteria | 28351 |
| 80 | Ga0070713_100036624 | 3300005436 | Bacteria | 3960 |
| 81 | Ga0070710_10004837 | 3300005437 | Bacteria | 6369 |
| 82 | Ga0070710_10032016 | 3300005437 | Bacteria | 2845 |
| 83 | Ga0070710_10048727 | 3300005437 | Bacteria | 2367 |
| 84 | Ga0070710_10230763 | 3300005437 | Bacteria | 1182 |
| 85 | Ga0070701_10113421 | 3300005438 | Bacteria | 1518 |
| 86 | Ga0070711_100019336 | 3300005439 | Bacteria | 4368 |
| 87 | Ga0070711_100025003 | 3300005439 | Bacteria | 3903 |
| 88 | Ga0070705_100000923 | 3300005440 | Bacteria | 16429 |
| 89 | Ga0070705_100098831 | 3300005440 | Bacteria | 1838 |
| 90 | Ga0070700_100017352 | 3300005441 | Bacteria | 4114 |
| 91 | Ga0070700_100306708 | 3300005441 | Bacteria | 1161 |
| 92 | Ga0070708_100183979 | 3300005445 | Bacteria | 1954 |
| 93 | Ga0070708_100398795 | 3300005445 | Bacteria | 1297 |
| 94 | Ga0070663_100004180 | 3300005455 | Bacteria | 8442 |
| 95 | Ga0070663_100008652 | 3300005455 | Bacteria | 6273 |
| 96 | Ga0070678_100000466 | 3300005456 | Bacteria | 19307 |
| 97 | Ga0070678_100167204 | 3300005456 | Bacteria | 1787 |
| 98 | Ga0070662_100062896 | 3300005457 | Bacteria | 2713 |
| 99 | Ga0070681_10011001 | 3300005458 | Bacteria | 8944 |
| 100 | Ga0070681_10106851 | 3300005458 | Bacteria | 2740 |
| 101 | Ga0070681_10126041 | 3300005458 | Bacteria | 2493 |
| 102 | Ga0070681_10554664 | 3300005458 | Bacteria | 1063 |
| 103 | Ga0068867_100008852 | 3300005459 | Bacteria | 7103 |
| 104 | Ga0068867_100501005 | 3300005459 | Bacteria | 1044 |
| 105 | Ga0070685_10003702 | 3300005466 | Bacteria | 7737 |
| 106 | Ga0070685_10007939 | 3300005466 | Bacteria | 5438 |
| 107 | Ga0070707_100271315 | 3300005468 | Bacteria | 1649 |
| 108 | Ga0070699_100039662 | 3300005518 | Bacteria | 4077 |
| 109 | Ga0070699_100199130 | 3300005518 | Bacteria | 1781 |
| 110 | Ga0070679_100047818 | 3300005530 | Bacteria | 4263 |
| 111 | Ga0070679_100054789 | 3300005530 | Bacteria | 3972 |
| 112 | Ga0070679_100078235 | 3300005530 | Bacteria | 3296 |
| 113 | Ga0070679_100410570 | 3300005530 | Bacteria | 1300 |
| 114 | Ga0070684_100004983 | 3300005535 | Bacteria | 10141 |
| 115 | Ga0070684_100035555 | 3300005535 | Bacteria | 4264 |
| 116 | Ga0070684_100042900 | 3300005535 | Bacteria | 3906 |
| 117 | Ga0070684_100212578 | 3300005535 | Bacteria | 1763 |
| 118 | Ga0070697_100188942 | 3300005536 | Bacteria | 1748 |
| 119 | Ga0068853_100007526 | 3300005539 | Bacteria | 8715 |
| 120 | Ga0068853_100049924 | 3300005539 | Bacteria | 3598 |
| 121 | Ga0070672_100001488 | 3300005543 | Bacteria | 14545 |
| 122 | Ga0070686_100002467 | 3300005544 | Bacteria | 10198 |
| 123 | Ga0070686_100049777 | 3300005544 | Bacteria | 2660 |
| 124 | Ga0070686_100217258 | 3300005544 | Bacteria | 1380 |
| 125 | Ga0070695_100002425 | 3300005545 | Bacteria | 10717 |
| 126 | Ga0070695_100007070 | 3300005545 | Bacteria | 6651 |
| 127 | Ga0070695_100021352 | 3300005545 | Bacteria | 3960 |
| 128 | Ga0070695_100339197 | 3300005545 | Bacteria | 1122 |
| 129 | Ga0070696_100308908 | 3300005546 | Bacteria | 1213 |
| 130 | Ga0070693_100005725 | 3300005547 | Bacteria | 6000 |
| 131 | Ga0070665_100070199 | 3300005548 | Bacteria | 3510 |
| 132 | Ga0070704_100026993 | 3300005549 | Bacteria | 3801 |
| 133 | Ga0070704_100038609 | 3300005549 | Bacteria | 3272 |
| 134 | Ga0068855_100054238 | 3300005563 | Bacteria | 4711 |
| 135 | Ga0068855_100070252 | 3300005563 | Bacteria | 4074 |
| 136 | Ga0068855_100102169 | 3300005563 | Bacteria | 3300 |
| 137 | Ga0068855_100426530 | 3300005563 | Bacteria | 1450 |
| 138 | Ga0070664_100028233 | 3300005564 | Bacteria | 4667 |
| 139 | Ga0070664_100131947 | 3300005564 | Bacteria | 2195 |
| 140 | Ga0070664_100364403 | 3300005564 | Bacteria | 1317 |
| 141 | Ga0068857_100008023 | 3300005577 | Bacteria | 9105 |
| 142 | Ga0068857_100118687 | 3300005577 | Bacteria | 2381 |
| 143 | Ga0068854_100012212 | 3300005578 | Bacteria | 5620 |
| 144 | Ga0068854_100129421 | 3300005578 | Bacteria | 1926 |
| 145 | Ga0068854_100222927 | 3300005578 | Bacteria | 1492 |
| 146 | Ga0068854_100345320 | 3300005578 | Bacteria | 1217 |
| 147 | Ga0068856_100024347 | 3300005614 | Bacteria | 5891 |
| 148 | Ga0068856_100065975 | 3300005614 | Bacteria | 3577 |
| 149 | Ga0068856_100273572 | 3300005614 | Bacteria | 1705 |
| 150 | Ga0068852_100171370 | 3300005616 | Bacteria | 2035 |
| 151 | Ga0068852_100275419 | 3300005616 | Bacteria | 1621 |
| 152 | Ga0068859_100011206 | 3300005617 | Bacteria | 9015 |
| 153 | Ga0068866_10004547 | 3300005718 | Bacteria | 5688 |
| 154 | Ga0068866_10117479 | 3300005718 | Bacteria | 1493 |
| 155 | Ga0068866_10215576 | 3300005718 | Bacteria | 1155 |
| 156 | Ga0068866_10241705 | 3300005718 | Bacteria | 1100 |
| 157 | Ga0068861_100006386 | 3300005719 | Bacteria | 8031 |
| 158 | Ga0068861_100095061 | 3300005719 | Bacteria | 2359 |
| 159 | Ga0068861_100157745 | 3300005719 | Bacteria | 1868 |
| 160 | Ga0068870_10000332 | 3300005840 | Bacteria | 17580 |
| 161 | Ga0068870_10039943 | 3300005840 | Bacteria | 2430 |
| 162 | Ga0068863_100000674 | 3300005841 | Bacteria | 34508 |
| 163 | Ga0068863_100649037 | 3300005841 | Bacteria | 1047 |
| 164 | Ga0068858_100007301 | 3300005842 | Bacteria | 10703 |
| 165 | Ga0068858_100036109 | 3300005842 | Bacteria | 4582 |
| 166 | Ga0068858_100085564 | 3300005842 | Bacteria | 2933 |
| 167 | Ga0068858_100271730 | 3300005842 | Bacteria | 1613 |
| 168 | Ga0068858_100282438 | 3300005842 | Bacteria | 1581 |
| 169 | Ga0068860_100013916 | 3300005843 | Bacteria | 7887 |
| 170 | Ga0068860_100103831 | 3300005843 | Bacteria | 2713 |
| 171 | Ga0068860_100197954 | 3300005843 | Bacteria | 1946 |
| 172 | Ga0068860_100231325 | 3300005843 | Bacteria | 1796 |
| 173 | Ga0068860_100428076 | 3300005843 | Bacteria | 1313 |
| 174 | Ga0068862_100218992 | 3300005844 | Bacteria | 1723 |
| 175 | Ga0081455_10000059 | 3300005937 | Bacteria | 119148 |
| 176 | Ga0081455_10000678 | 3300005937 | Bacteria | 44138 |
| 177 | Ga0081455_10001419 | 3300005937 | Bacteria | 29668 |
| 178 | Ga0081540_1000234 | 3300005983 | Bacteria | 58203 |
| 179 | Ga0081540_1013934 | 3300005983 | Bacteria | 5190 |
| 180 | Ga0081539_10125547 | 3300005985 | Bacteria | 1268 |
| 181 | Ga0070717_10000564 | 3300006028 | Bacteria | 23614 |
| 182 | Ga0070717_10022047 | 3300006028 | Bacteria | 5027 |
| 183 | Ga0075368_10038232 | 3300006042 | Bacteria | 1878 |
| 184 | Ga0075368_10054891 | 3300006042 | Bacteria | 1588 |
| 185 | Ga0075432_10002448 | 3300006058 | Bacteria | 6181 |
| 186 | Ga0070715_10000587 | 3300006163 | Bacteria | 9568 |
| 187 | Ga0070715_10009322 | 3300006163 | Bacteria | 3457 |
| 188 | Ga0070716_100009907 | 3300006173 | Bacteria | 4764 |
| 189 | Ga0070716_100017891 | 3300006173 | Bacteria | 3684 |
| 190 | Ga0070716_100135543 | 3300006173 | Bacteria | 1563 |
| 191 | Ga0075367_10050959 | 3300006178 | Bacteria | 2446 |
| 192 | Ga0075369_10065810 | 3300006186 | Bacteria | 1589 |
| 193 | Ga0075369_10114476 | 3300006186 | Bacteria | 1217 |
| 194 | Ga0097621_100000521 | 3300006237 | Bacteria | 26987 |
| 195 | Ga0097621_100193656 | 3300006237 | Bacteria | 1762 |
| 196 | Ga0068871_100001830 | 3300006358 | Bacteria | 14363 |
| 197 | Ga0068871_100024340 | 3300006358 | Bacteria | 4694 |
| 198 | Ga0068871_100037205 | 3300006358 | Bacteria | 3880 |
| 199 | Ga0075428_100001505 | 3300006844 | Bacteria | 24947 |
| 200 | Ga0075430_100000015 | 3300006846 | Bacteria | 89952 |
| 201 | Ga0075430_100000070 | 3300006846 | Bacteria | 55805 |
| 202 | Ga0075430_100147466 | 3300006846 | Bacteria | 1960 |
| 203 | Ga0075431_100009121 | 3300006847 | Bacteria | 9948 |
| 204 | Ga0075431_100347929 | 3300006847 | Bacteria | 1491 |
| 205 | Ga0075433_10000820 | 3300006852 | Bacteria | 21656 |
| 206 | Ga0075433_10050839 | 3300006852 | Bacteria | 3609 |
| 207 | Ga0075433_10168764 | 3300006852 | Bacteria | 1948 |
| 208 | Ga0075434_100009003 | 3300006871 | Bacteria | 9298 |
| 209 | Ga0075434_100055731 | 3300006871 | Bacteria | 3928 |
| 210 | Ga0075434_100070192 | 3300006871 | Bacteria | 3493 |
| 211 | Ga0075434_100166100 | 3300006871 | Bacteria | 2227 |
| 212 | Ga0075434_100296697 | 3300006871 | Bacteria | 1636 |
| 213 | Ga0075434_100378363 | 3300006871 | Bacteria | 1437 |
| 214 | Ga0075429_100001029 | 3300006880 | Bacteria | 22286 |
| 215 | Ga0068865_100013146 | 3300006881 | Bacteria | 5224 |
| 216 | Ga0068865_100052429 | 3300006881 | Bacteria | 2827 |
| 217 | Ga0068865_100443188 | 3300006881 | Bacteria | 1072 |
| 218 | Ga0075436_100012357 | 3300006914 | Bacteria | 5851 |
| 219 | Ga0097620_100011206 | 3300006931 | Bacteria | 9015 |
| 220 | Ga0075435_100003677 | 3300007076 | Bacteria | 10447 |
| 221 | Ga0075435_100022284 | 3300007076 | Bacteria | 4886 |
| 222 | Ga0075435_100205153 | 3300007076 | Unclassified | 1671 |
| 223 | Ga0075435_100403091 | 3300007076 | Bacteria | 1176 |
| 224 | Ga0099795_10025308 | 3300007788 | Bacteria | 1989 |
| 225 | Ga0105244_10053800 | 3300009036 | Bacteria | 2044 |
| 226 | Ga0105250_10063540 | 3300009092 | Bacteria | 1486 |
| 227 | Ga0105240_10039973 | 3300009093 | Bacteria | 6004 |
| 228 | Ga0105240_10234796 | 3300009093 | Bacteria | 2129 |
| 229 | Ga0111539_10000138 | 3300009094 | Bacteria | 82968 |
| 230 | Ga0111539_10004385 | 3300009094 | Bacteria | 18464 |
| 231 | Ga0111539_10077827 | 3300009094 | Bacteria | 3903 |
| 232 | Ga0111539_10190840 | 3300009094 | Bacteria | 2391 |
| 233 | Ga0111539_10401252 | 3300009094 | Bacteria | 1597 |
| 234 | Ga0105245_10006547 | 3300009098 | Bacteria | 10227 |
| 235 | Ga0105245_10051521 | 3300009098 | Bacteria | 3690 |
| 236 | Ga0105245_10214712 | 3300009098 | Bacteria | 1853 |
| 237 | Ga0105245_10292879 | 3300009098 | Bacteria | 1595 |
| 238 | Ga0105245_10393445 | 3300009098 | Bacteria | 1383 |
| 239 | Ga0105247_10196694 | 3300009101 | Bacteria | 1352 |
| 240 | Ga0114129_10002312 | 3300009147 | Bacteria | 26434 |
| 241 | Ga0114129_10003950 | 3300009147 | Bacteria | 20934 |
| 242 | Ga0114129_10005495 | 3300009147 | Bacteria | 17913 |
| 243 | Ga0105243_10009075 | 3300009148 | Bacteria | 7596 |
| 244 | Ga0105243_10033868 | 3300009148 | Bacteria | 3951 |
| 245 | Ga0105243_10261720 | 3300009148 | Bacteria | 1549 |
| 246 | Ga0105243_10343123 | 3300009148 | Bacteria | 1369 |
| 247 | Ga0105241_10008372 | 3300009174 | Bacteria | 7615 |
| 248 | Ga0105241_10047193 | 3300009174 | Bacteria | 3274 |
| 249 | Ga0105242_10026910 | 3300009176 | Bacteria | 4561 |
| 250 | Ga0105242_10068220 | 3300009176 | Bacteria | 2942 |
| 251 | Ga0105242_10778744 | 3300009176 | Bacteria | 945 |
| 252 | Ga0105248_10006279 | 3300009177 | Bacteria | 13035 |
| 253 | Ga0105248_10136791 | 3300009177 | Bacteria | 2764 |
| 254 | Ga0105248_11155777 | 3300009177 | Bacteria | 875 |
| 255 | Ga0105237_10046611 | 3300009545 | Bacteria | 4360 |
| 256 | Ga0105237_10151147 | 3300009545 | Bacteria | 2318 |
| 257 | Ga0105238_10082779 | 3300009551 | Bacteria | 3199 |
| 258 | Ga0105238_10307616 | 3300009551 | Bacteria | 1569 |
| 259 | Ga0105249_10001029 | 3300009553 | Bacteria | 24663 |
| 260 | Ga0105249_10033885 | 3300009553 | Bacteria | 4625 |
| 261 | Ga0105249_10497450 | 3300009553 | Bacteria | 1264 |
| 262 | Ga0099796_10005416 | 3300010159 | Bacteria | 3185 |
| 263 | Ga0105239_10079079 | 3300010375 | Bacteria | 3619 |
| 264 | Ga0105239_10177750 | 3300010375 | Bacteria | 2381 |
| 265 | Ga0105239_10239161 | 3300010375 | Bacteria | 2038 |
| 266 | Ga0105246_10000702 | 3300011119 | Bacteria | 18882 |
| 267 | Ga0105246_10344240 | 3300011119 | Bacteria | 1219 |
| 268 | Ga0105246_10471846 | 3300011119 | Bacteria | 1059 |
| 269 | Ga0157371_10005592 | 3300013102 | Bacteria | 10562 |
| 270 | Ga0157371_10138019 | 3300013102 | Bacteria | 1737 |
| 271 | Ga0157369_10229282 | 3300013105 | Bacteria | 1942 |
| 272 | Ga0157374_10007209 | 3300013296 | Bacteria | 9471 |
| 273 | Ga0157374_10083463 | 3300013296 | Bacteria | 3035 |
| 274 | Ga0157374_10417733 | 3300013296 | Bacteria | 1340 |
| 275 | Ga0157378_10016518 | 3300013297 | Bacteria | 6465 |
| 276 | Ga0157378_10531083 | 3300013297 | Bacteria | 1179 |
| 277 | Ga0157378_10576074 | 3300013297 | Bacteria | 1134 |
| 278 | Ga0163162_10065860 | 3300013306 | Bacteria | 3671 |
| 279 | Ga0163162_10068737 | 3300013306 | Bacteria | 3594 |
| 280 | Ga0157372_10051950 | 3300013307 | Bacteria | 4563 |
| 281 | Ga0157372_10271185 | 3300013307 | Bacteria | 1972 |
| 282 | Ga0157375_10002908 | 3300013308 | Bacteria | 14847 |
| 283 | Ga0157375_10228668 | 3300013308 | Bacteria | 2019 |
| 284 | Ga0157375_10602895 | 3300013308 | Bacteria | 1257 |
| 285 | Ga0163163_10005259 | 3300014325 | Bacteria | 11164 |
| 286 | Ga0163163_10011735 | 3300014325 | Bacteria | 7959 |
| 287 | Ga0163163_10096637 | 3300014325 | Bacteria | 2975 |
| 288 | Ga0157380_10203809 | 3300014326 | Bacteria | 1757 |
| 289 | Ga0157380_10320205 | 3300014326 | Bacteria | 1437 |
| 290 | Ga0157377_10000729 | 3300014745 | Bacteria | 13605 |
| 291 | Ga0157377_10058600 | 3300014745 | Bacteria | 2193 |
| 292 | Ga0157379_10000345 | 3300014968 | Bacteria | 37352 |
| 293 | Ga0157379_10015335 | 3300014968 | Bacteria | 6722 |
| 294 | Ga0157379_10025251 | 3300014968 | Bacteria | 5277 |
| 295 | Ga0157379_10158270 | 3300014968 | Bacteria | 2044 |
| 296 | Ga0157376_10006980 | 3300014969 | Bacteria | 8010 |
| 297 | Ga0157376_10177905 | 3300014969 | Bacteria | 1942 |
| 298 | Ga0163161_10013155 | 3300017792 | Bacteria | 5752 |
| 299 | Ga0163161_10067363 | 3300017792 | Bacteria | 2615 |
| 300 | Ga0206354_11627161 | 3300020081 | Bacteria | 1684 |
| 301 | Ga0206353_10148134 | 3300020082 | Bacteria | 4720 |
| 302 | Ga0207673_1000178 | 3300025290 | Bacteria | 6339 |
| 303 | Ga0207697_10000390 | 3300025315 | Bacteria | 24639 |
| 304 | Ga0207697_10040619 | 3300025315 | Bacteria | 1910 |
| 305 | Ga0207692_10034254 | 3300025898 | Bacteria | 2457 |
| 306 | Ga0207692_10038818 | 3300025898 | Bacteria | 2338 |
| 307 | Ga0207692_10339042 | 3300025898 | Bacteria | 924 |
| 308 | Ga0207642_10001144 | 3300025899 | Bacteria | 8195 |
| 309 | Ga0207642_10045637 | 3300025899 | Bacteria | 1947 |
| 310 | Ga0207688_10008150 | 3300025901 | Bacteria | 5695 |
| 311 | Ga0207680_10015890 | 3300025903 | Bacteria | 3939 |
| 312 | Ga0207680_10383427 | 3300025903 | Bacteria | 991 |
| 313 | Ga0207647_10006274 | 3300025904 | Bacteria | 8656 |
| 314 | Ga0207647_10147925 | 3300025904 | Bacteria | 1374 |
| 315 | Ga0207685_10000901 | 3300025905 | Bacteria | 5645 |
| 316 | Ga0207685_10027329 | 3300025905 | Bacteria | 1995 |
| 317 | Ga0207699_10003447 | 3300025906 | Bacteria | 7538 |
| 318 | Ga0207699_10014956 | 3300025906 | Bacteria | 4018 |
| 319 | Ga0207645_10065712 | 3300025907 | Bacteria | 2318 |
| 320 | Ga0207645_10251147 | 3300025907 | Bacteria | 1170 |
| 321 | Ga0207643_10000581 | 3300025908 | Bacteria | 23180 |
| 322 | Ga0207643_10066405 | 3300025908 | Bacteria | 2068 |
| 323 | Ga0207705_10013986 | 3300025909 | Bacteria | 5784 |
| 324 | Ga0207705_10030571 | 3300025909 | Bacteria | 3843 |
| 325 | Ga0207684_10048056 | 3300025910 | Bacteria | 3619 |
| 326 | Ga0207654_10006384 | 3300025911 | Bacteria | 5932 |
| 327 | Ga0207654_10461652 | 3300025911 | Bacteria | 892 |
| 328 | Ga0207707_10008318 | 3300025912 | Bacteria | 9001 |
| 329 | Ga0207671_10022282 | 3300025914 | Bacteria | 4791 |
| 330 | Ga0207671_10094714 | 3300025914 | Bacteria | 2254 |
| 331 | Ga0207671_10476581 | 3300025914 | Bacteria | 995 |
| 332 | Ga0207693_10008185 | 3300025915 | Bacteria | 8567 |
| 333 | Ga0207693_10038451 | 3300025915 | Bacteria | 3769 |
| 334 | Ga0207693_10157254 | 3300025915 | Bacteria | 1788 |
| 335 | Ga0207663_10003382 | 3300025916 | Bacteria | 7795 |
| 336 | Ga0207663_10029839 | 3300025916 | Bacteria | 3209 |
| 337 | Ga0207663_10371908 | 3300025916 | Bacteria | 1087 |
| 338 | Ga0207660_10000192 | 3300025917 | Bacteria | 38947 |
| 339 | Ga0207660_10016157 | 3300025917 | Bacteria | 4937 |
| 340 | Ga0207660_10119745 | 3300025917 | Bacteria | 1992 |
| 341 | Ga0207660_10355688 | 3300025917 | Bacteria | 1174 |
| 342 | Ga0207660_10458661 | 3300025917 | Bacteria | 1031 |
| 343 | Ga0207662_10000647 | 3300025918 | Bacteria | 15732 |
| 344 | Ga0207662_10008193 | 3300025918 | Bacteria | 5716 |
| 345 | Ga0207662_10048450 | 3300025918 | Bacteria | 2517 |
| 346 | Ga0207662_10395756 | 3300025918 | Bacteria | 936 |
| 347 | Ga0207657_10001253 | 3300025919 | Bacteria | 27150 |
| 348 | Ga0207657_10065825 | 3300025919 | Bacteria | 3087 |
| 349 | Ga0207657_10077686 | 3300025919 | Bacteria | 2797 |
| 350 | Ga0207657_10114675 | 3300025919 | Bacteria | 2222 |
| 351 | Ga0207657_10294179 | 3300025919 | Bacteria | 1287 |
| 352 | Ga0207649_10000141 | 3300025920 | Bacteria | 60047 |
| 353 | Ga0207649_10285093 | 3300025920 | Bacteria | 1202 |
| 354 | Ga0207652_10004519 | 3300025921 | Bacteria | 11293 |
| 355 | Ga0207652_10082941 | 3300025921 | Bacteria | 2806 |
| 356 | Ga0207652_10115475 | 3300025921 | Bacteria | 2384 |
| 357 | Ga0207652_10207330 | 3300025921 | Bacteria | 1764 |
| 358 | Ga0207652_10225421 | 3300025921 | Bacteria | 1689 |
| 359 | Ga0207652_10565398 | 3300025921 | Bacteria | 1021 |
| 360 | Ga0207646_10411200 | 3300025922 | Bacteria | 1222 |
| 361 | Ga0207681_10000359 | 3300025923 | Bacteria | 32485 |
| 362 | Ga0207681_10057667 | 3300025923 | Bacteria | 2655 |
| 363 | Ga0207694_10051993 | 3300025924 | Bacteria | 3176 |
| 364 | Ga0207694_10366860 | 3300025924 | Bacteria | 1194 |
| 365 | Ga0207650_10004111 | 3300025925 | Bacteria | 9943 |
| 366 | Ga0207650_10004220 | 3300025925 | Bacteria | 9813 |
| 367 | Ga0207650_10092260 | 3300025925 | Bacteria | 2316 |
| 368 | Ga0207650_10471072 | 3300025925 | Bacteria | 1047 |
| 369 | Ga0207659_10000052 | 3300025926 | Bacteria | 79692 |
| 370 | Ga0207659_10223150 | 3300025926 | Bacteria | 1516 |
| 371 | Ga0207659_10283527 | 3300025926 | Bacteria | 1355 |
| 372 | Ga0207687_10000097 | 3300025927 | Bacteria | 64441 |
| 373 | Ga0207687_10023847 | 3300025927 | Bacteria | 4082 |
| 374 | Ga0207687_10076872 | 3300025927 | Bacteria | 2399 |
| 375 | Ga0207687_10417384 | 3300025927 | Bacteria | 1107 |
| 376 | Ga0207700_10003441 | 3300025928 | Bacteria | 9204 |
| 377 | Ga0207700_10024798 | 3300025928 | Bacteria | 4156 |
| 378 | Ga0207700_10064766 | 3300025928 | Bacteria | 2785 |
| 379 | Ga0207664_10053374 | 3300025929 | Bacteria | 3199 |
| 380 | Ga0207664_10286291 | 3300025929 | Bacteria | 1447 |
| 381 | Ga0207644_10000666 | 3300025931 | Bacteria | 21692 |
| 382 | Ga0207644_10022774 | 3300025931 | Bacteria | 4282 |
| 383 | Ga0207644_10070179 | 3300025931 | Bacteria | 2560 |
| 384 | Ga0207644_10077270 | 3300025931 | Bacteria | 2451 |
| 385 | Ga0207690_10000278 | 3300025932 | Bacteria | 36244 |
| 386 | Ga0207690_10121410 | 3300025932 | Bacteria | 1899 |
| 387 | Ga0207690_10605311 | 3300025932 | Bacteria | 895 |
| 388 | Ga0207706_10010711 | 3300025933 | Bacteria | 8374 |
| 389 | Ga0207706_10022229 | 3300025933 | Bacteria | 5692 |
| 390 | Ga0207706_10475002 | 3300025933 | Bacteria | 1080 |
| 391 | Ga0207686_10000870 | 3300025934 | Bacteria | 18250 |
| 392 | Ga0207686_10296490 | 3300025934 | Bacteria | 1199 |
| 393 | Ga0207709_10000987 | 3300025935 | Bacteria | 21246 |
| 394 | Ga0207709_10071846 | 3300025935 | Bacteria | 2199 |
| 395 | Ga0207670_10000781 | 3300025936 | Bacteria | 16732 |
| 396 | Ga0207670_10003950 | 3300025936 | Bacteria | 7920 |
| 397 | Ga0207670_10063716 | 3300025936 | Bacteria | 2523 |
| 398 | Ga0207669_10000206 | 3300025937 | Bacteria | 26791 |
| 399 | Ga0207669_10075757 | 3300025937 | Bacteria | 2133 |
| 400 | Ga0207704_10007001 | 3300025938 | Bacteria | 5296 |
| 401 | Ga0207704_10085700 | 3300025938 | Bacteria | 2052 |
| 402 | Ga0207665_10000248 | 3300025939 | Bacteria | 37228 |
| 403 | Ga0207665_10023525 | 3300025939 | Bacteria | 4058 |
| 404 | Ga0207691_10000798 | 3300025940 | Bacteria | 31316 |
| 405 | Ga0207691_10156003 | 3300025940 | Bacteria | 2005 |
| 406 | Ga0207711_10004870 | 3300025941 | Bacteria | 11394 |
| 407 | Ga0207711_10100639 | 3300025941 | Bacteria | 2557 |
| 408 | Ga0207711_10188767 | 3300025941 | Bacteria | 1877 |
| 409 | Ga0207689_10003457 | 3300025942 | Bacteria | 14430 |
| 410 | Ga0207689_10035132 | 3300025942 | Bacteria | 4164 |
| 411 | Ga0207661_10000143 | 3300025944 | Bacteria | 45329 |
| 412 | Ga0207661_10216528 | 3300025944 | Bacteria | 1691 |
| 413 | Ga0207667_10060669 | 3300025949 | Bacteria | 3958 |
| 414 | Ga0207667_10089201 | 3300025949 | Bacteria | 3188 |
| 415 | Ga0207651_10000080 | 3300025960 | Bacteria | 42826 |
| 416 | Ga0207651_10154666 | 3300025960 | Bacteria | 1790 |
| 417 | Ga0207712_10001232 | 3300025961 | Bacteria | 17669 |
| 418 | Ga0207712_10022172 | 3300025961 | Bacteria | 4179 |
| 419 | Ga0207640_10003188 | 3300025981 | Bacteria | 8828 |
| 420 | Ga0207677_10001118 | 3300026023 | Bacteria | 14623 |
| 421 | Ga0207703_10004276 | 3300026035 | Bacteria | 11747 |
| 422 | Ga0207703_10024313 | 3300026035 | Bacteria | 4766 |
| 423 | Ga0207703_10124122 | 3300026035 | Bacteria | 2220 |
| 424 | Ga0207703_10141321 | 3300026035 | Bacteria | 2090 |
| 425 | Ga0207639_10039795 | 3300026041 | Bacteria | 3505 |
| 426 | Ga0207639_10048506 | 3300026041 | Bacteria | 3215 |
| 427 | Ga0207678_10143586 | 3300026067 | Bacteria | 2037 |
| 428 | Ga0207708_10001889 | 3300026075 | Bacteria | 15476 |
| 429 | Ga0207708_10014799 | 3300026075 | Bacteria | 5840 |
| 430 | Ga0207708_10025692 | 3300026075 | Bacteria | 4456 |
| 431 | Ga0207708_10075489 | 3300026075 | Bacteria | 2585 |
| 432 | Ga0207708_10231923 | 3300026075 | Bacteria | 1482 |
| 433 | Ga0207708_10406267 | 3300026075 | Bacteria | 1127 |
| 434 | Ga0207702_10012711 | 3300026078 | Bacteria | 7006 |
| 435 | Ga0207702_10040456 | 3300026078 | Bacteria | 3907 |
| 436 | Ga0207702_10065063 | 3300026078 | Bacteria | 3122 |
| 437 | Ga0207702_10169152 | 3300026078 | Bacteria | 2002 |
| 438 | Ga0207702_10776052 | 3300026078 | Bacteria | 947 |
| 439 | Ga0207641_10003756 | 3300026088 | Bacteria | 13335 |
| 440 | Ga0207641_10352123 | 3300026088 | Bacteria | 1404 |
| 441 | Ga0207648_10005438 | 3300026089 | Bacteria | 12836 |
| 442 | Ga0207648_10019818 | 3300026089 | Bacteria | 6070 |
| 443 | Ga0207648_10038614 | 3300026089 | Bacteria | 4201 |
| 444 | Ga0207648_10079549 | 3300026089 | Bacteria | 2860 |
| 445 | Ga0207676_10000689 | 3300026095 | Bacteria | 26702 |
| 446 | Ga0207676_10036233 | 3300026095 | Bacteria | 3751 |
| 447 | Ga0207676_10315366 | 3300026095 | Bacteria | 1433 |
| 448 | Ga0207674_10002206 | 3300026116 | Bacteria | 24670 |
| 449 | Ga0207674_10140086 | 3300026116 | Bacteria | 2379 |
| 450 | Ga0207675_100002223 | 3300026118 | Bacteria | 19286 |
| 451 | Ga0207675_100003721 | 3300026118 | Bacteria | 14854 |
| 452 | Ga0207675_100088531 | 3300026118 | Bacteria | 2908 |
| 453 | Ga0207683_10003030 | 3300026121 | Bacteria | 14680 |
| 454 | Ga0207683_10003691 | 3300026121 | Bacteria | 13301 |
| 455 | Ga0207683_10029878 | 3300026121 | Bacteria | 4719 |
| 456 | Ga0207683_10041266 | 3300026121 | Bacteria | 4028 |
| 457 | Ga0207683_10058000 | 3300026121 | Bacteria | 3399 |
| 458 | Ga0207698_10005996 | 3300026142 | Bacteria | 7555 |
| 459 | Ga0207698_10228811 | 3300026142 | Bacteria | 1686 |
| 460 | Ga0207698_10257739 | 3300026142 | Bacteria | 1600 |
| 461 | Ga0210002_1000850 | 3300027617 | Bacteria | 4171 |
| 462 | Ga0209971_1003247 | 3300027682 | Bacteria | 3872 |
| 463 | Ga0209974_10002220 | 3300027876 | Bacteria | 7062 |
| 464 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 465 | Ga0207428_10000973 | 3300027907 | Bacteria | 31755 |
| 466 | Ga0207428_10001396 | 3300027907 | Bacteria | 25497 |
| 467 | Ga0207428_10259154 | 3300027907 | Bacteria | 1295 |
| 468 | Ga0268266_10073750 | 3300028379 | Bacteria | 2962 |
| 469 | Ga0268266_10104349 | 3300028379 | Bacteria | 2502 |
| 470 | Ga0268266_10306085 | 3300028379 | Bacteria | 1484 |
| 471 | Ga0268266_10455937 | 3300028379 | Bacteria | 1216 |
| 472 | Ga0268265_10008836 | 3300028380 | Bacteria | 6807 |
| 473 | Ga0268265_10138283 | 3300028380 | Bacteria | 2035 |
| 474 | Ga0268265_10844594 | 3300028380 | Bacteria | 895 |
| 475 | Ga0268264_10006787 | 3300028381 | Bacteria | 9616 |
| 476 | Ga0268264_10023177 | 3300028381 | Bacteria | 5066 |
| 477 | Ga0268264_10070794 | 3300028381 | Unclassified | 2953 |
| 478 | Ga0265337_1000182 | 3300028556 | Bacteria | 33103 |
| 479 | Ga0265338_10117750 | 3300028800 | Bacteria | 2125 |
| 480 | Ga0265325_10000034 | 3300031241 | Bacteria | 99371 |
| 481 | Ga0265325_10001553 | 3300031241 | Bacteria | 16007 |
| 482 | Ga0265325_10082028 | 3300031241 | Bacteria | 1601 |
| 483 | Ga0265325_10091863 | 3300031241 | Bacteria | 1496 |
| 484 | Ga0265340_10008869 | 3300031247 | Bacteria | 5419 |
| 485 | Ga0265340_10031716 | 3300031247 | Bacteria | 2641 |
| 486 | Ga0265316_10006848 | 3300031344 | Bacteria | 10821 |
| 487 | Ga0265316_10132179 | 3300031344 | Bacteria | 1879 |
| 488 | Ga0307513_10078656 | 3300031456 | Bacteria | 3410 |
| 489 | Ga0265313_10000345 | 3300031595 | Bacteria | 50388 |
| 490 | Ga0265313_10007339 | 3300031595 | Bacteria | 7559 |
| 491 | Ga0265313_10010794 | 3300031595 | Bacteria | 5737 |
| 492 | Ga0316575_10029767 | 3300031665 | Bacteria | 2133 |
| 493 | Ga0265314_10003737 | 3300031711 | Bacteria | 14574 |
| 494 | Ga0265342_10000203 | 3300031712 | Bacteria | 66540 |
| 495 | Ga0307406_10494243 | 3300031901 | Bacteria | 991 |
| 496 | Ga0316583_10000327 | 3300032133 | Bacteria | 13416 |
| 497 | Ga0373930_0003033 | 3300034816 | Bacteria | 2641 |
| 498 | Ga0373930_0003586 | 3300034816 | Bacteria | 2473 |
| 499 | Ga0373930_0004152 | 3300034816 | Bacteria | 2342 |
| 500 | Ga0373948_0000065 | 3300034817 | Bacteria | 11046 |
| 501 | Ga0373948_0012614 | 3300034817 | Bacteria | 1512 |
| 502 | Ga0373950_0002667 | 3300034818 | Bacteria | 2479 |
| 503 | Ga0373958_0000282 | 3300034819 | Bacteria | 6025 |
| 504 | Ga0373958_0002218 | 3300034819 | Bacteria | 2701 |
| 505 | Ga0373959_0005381 | 3300034820 | Bacteria | 2096 |
| 506 | Ga0373938_0000612 | 3300034957 | Bacteria | 5774 |
| 507 | Ga0373938_0000777 | 3300034957 | Bacteria | 5184 |
| 508 | Ga0373928_0014501 | 3300035084 | Bacteria | 1594 |
| 509 | Ga0373929_0004079 | 3300035085 | Bacteria | 2617 |
| 510 | Ga0373929_0006738 | 3300035085 | Bacteria | 2081 |
| 511 | Ga0373929_0008717 | 3300035085 | Bacteria | 1871 |
| 512 | Ga0373934_0003795 | 3300035086 | Bacteria | 5564 |
| 513 | Ga0373934_0152088 | 3300035086 | Bacteria | 948 |
| 514 | Ga0373940_0001606 | 3300035088 | Bacteria | 4147 |
| 515 | Ga0373940_0002487 | 3300035088 | Bacteria | 3593 |
| 516 | Ga0373940_0016256 | 3300035088 | Bacteria | 1842 |
| 517 | Ga0373944_0000062 | 3300035089 | Bacteria | 17879 |
| 518 | Ga0373944_0013006 | 3300035089 | Bacteria | 2302 |
| 519 | Ga0373949_0001405 | 3300035090 | Bacteria | 6901 |
| 520 | Ga0373949_0002166 | 3300035090 | Bacteria | 5146 |
| 521 | Ga0373951_0003414 | 3300035091 | Bacteria | 3854 |
| 522 | Ga0373951_0012434 | 3300035091 | Bacteria | 1914 |
| 523 | Ga0373952_0000544 | 3300035092 | Bacteria | 6623 |
| 524 | Ga0373952_0001537 | 3300035092 | Bacteria | 4204 |
| 525 | Ga0373952_0002894 | 3300035092 | Bacteria | 3102 |
| 526 | Ga0373952_0033419 | 3300035092 | Bacteria | 1154 |
| 527 | Ga0373923_0000277 | 3300035111 | Bacteria | 11228 |
| 528 | Ga0373923_0026713 | 3300035111 | Bacteria | 2298 |
| 529 | Ga0373932_0001652 | 3300035112 | Bacteria | 6105 |
| 530 | Ga0373932_0002120 | 3300035112 | Bacteria | 5156 |
| 531 | Ga0373936_0000954 | 3300035113 | Bacteria | 10327 |
| 532 | Ga0373936_0032970 | 3300035113 | Bacteria | 2051 |
| 533 | Ga0373939_0003012 | 3300035114 | Bacteria | 3956 |
| 534 | Ga0373941_0000106 | 3300035115 | Bacteria | 14078 |
| 535 | Ga0373941_0001163 | 3300035115 | Bacteria | 5487 |
| 536 | Ga0373941_0005867 | 3300035115 | Bacteria | 2920 |
| 537 | Ga0373941_0040362 | 3300035115 | Bacteria | 1439 |
| 538 | Ga0373945_0000385 | 3300035116 | Bacteria | 12632 |
| 539 | Ga0373945_0101268 | 3300035116 | Bacteria | 1127 |
| 540 | Ga0373953_0000952 | 3300035117 | Bacteria | 8097 |
| 541 | Ga0373953_0053216 | 3300035117 | Bacteria | 1640 |
| 542 | Ga0373954_0002467 | 3300035118 | Bacteria | 7759 |
| 543 | Ga0373954_0003174 | 3300035118 | Bacteria | 6946 |
| 544 | Ga0373954_0056309 | 3300035118 | Bacteria | 1850 |
| 545 | Ga0373956_0004014 | 3300035119 | Bacteria | 5913 |
| 546 | Ga0373956_0011075 | 3300035119 | Bacteria | 3713 |
| 547 | Ga0373956_0043960 | 3300035119 | Bacteria | 1990 |
| 548 | Ga0373957_0007623 | 3300035120 | Bacteria | 3470 |
| 549 | Ga0373943_0013449 | 3300035170 | Bacteria | 3696 |
| 550 | Ga0373946_0005016 | 3300035171 | Bacteria | 4767 |
| 551 | Ga0373946_0010105 | 3300035171 | Bacteria | 3489 |
| 552 | Ga0373946_0014082 | 3300035171 | Bacteria | 3013 |
| 553 | Ga0373946_0026768 | 3300035171 | Bacteria | 2277 |
| 554 | Ga0373955_0000366 | 3300035172 | Bacteria | 19051 |
| 555 | Ga0373955_0007406 | 3300035172 | Bacteria | 5046 |
| 556 | Ga0373955_0037956 | 3300035172 | Bacteria | 2564 |
| 557 | Ga0373955_0046423 | 3300035172 | Bacteria | 2348 |
| 558 | Ga0373942_0002044 | 3300035207 | Bacteria | 5014 |
| 559 | Ga0373942_0004697 | 3300035207 | Bacteria | 3165 |
| 560 | Ga0373961_0004557 | 3300035241 | Bacteria | 3348 |
| 561 | Ga0373962_0001666 | 3300035242 | Bacteria | 5277 |
| 562 | Ga0373962_0001945 | 3300035242 | Bacteria | 4927 |
| 563 | Ga0373962_0008630 | 3300035242 | Bacteria | 2511 |
| 564 | Ga0373931_0005024 | 3300035691 | Bacteria | 6083 |
| 565 | Ga0373935_0005061 | 3300035692 | Bacteria | 7764 |
| 566 | Ga0373935_0105347 | 3300035692 | Bacteria | 1865 |
| 567 | Ga0373935_0119567 | 3300035692 | Bacteria | 1758 |
| 568 | Ga0373935_0132262 | 3300035692 | Bacteria | 1677 |
| 569 | Ga0373927_0005034 | 3300035695 | Bacteria | 9145 |
| 570 | Ga0373927_0042727 | 3300035695 | Bacteria | 2937 |
| 571 | Ga0373933_0002080 | 3300035724 | Bacteria | 11489 |
| 572 | Ga0373933_0007702 | 3300035724 | Bacteria | 5881 |
| 573 | Ga0373933_0023393 | 3300035724 | Bacteria | 3529 |
| 574 | Ga0373947_0001101 | 3300035725 | Bacteria | 16589 |
| 575 | Ga0373937_0000037 | 3300036401 | Bacteria | 111413 |
| 576 | Ga0373937_0011894 | 3300036401 | Bacteria | 7638 |
| 577 | Ga0373937_0030460 | 3300036401 | Bacteria | 4887 |
| 578 | Ga0373937_0091598 | 3300036401 | Bacteria | 2817 |
| 579 | Ga0373925_0014949 | 3300037068 | Bacteria | 5611 |
| 580 | Ga0373925_0077188 | 3300037068 | Bacteria | 2527 |
| 581 | Ga0373925_0081872 | 3300037068 | Bacteria | 2455 |
| 582 | Ga0373925_0433904 | 3300037068 | Bacteria | 1074 |
| 583 | Ga0395900_0002100 | 3300037418 | Bacteria | 22308 |
| 584 | Ga0395898_0043461 | 3300037466 | Bacteria | 4427 |
| 585 | Ga0395898_0092471 | 3300037466 | Bacteria | 2909 |
| 586 | Ga0395901_0009830 | 3300038443 | Bacteria | 9698 |
| 587 | Ga0395901_0134825 | 3300038443 | Bacteria | 2595 |
| 588 | Ga0436365_1503001 | 3300039437 | Bacteria | 3746 |
| 589 | Ga0436361_0048384 | 3300039447 | Bacteria | 5306 |
| 590 | Ga0439450_034830 | 3300042008 | Bacteria | 1146 |
| 591 | Ga0439435_0006979 | 3300042436 | Bacteria | 2565 |
| 592 | Ga0439460_0032314 | 3300042461 | Bacteria | 1498 |
| 593 | Ga0451577_0116320 | 3300042876 | Bacteria | 2395 |
| 594 | Ga0466963_0137693 | 3300044694 | Bacteria | 1690 |
| 595 | Ga0466963_0310491 | 3300044694 | Bacteria | 1109 |
| 596 | Ga0453684_0169863 | 3300044712 | Bacteria | 2571 |
| 597 | Ga0466957_0222280 | 3300044842 | Bacteria | 1247 |
| 598 | Ga0451576_0033902 | 3300045051 | Bacteria | 5424 |
| 599 | Ga0466958_0102981 | 3300045836 | Bacteria | 1777 |
| 600 | Ga0466967_0405348 | 3300045976 | Bacteria | 1327 |
| 601 | Ga0466967_0667466 | 3300045976 | Bacteria | 1029 |
| 602 | Ga0495617_011839 | 3300046452 | Bacteria | 2975 |
| 603 | Ga0495592_0004523 | 3300046454 | Bacteria | 10182 |
| 604 | Ga0495592_0056649 | 3300046454 | Bacteria | 2895 |
| 605 | Ga0495603_0041113 | 3300046455 | Bacteria | 2765 |
| 606 | Ga0495603_0174759 | 3300046455 | Bacteria | 1243 |
| 607 | Ga0495603_0184854 | 3300046455 | Bacteria | 1205 |
| 608 | Ga0495591_035103 | 3300046458 | Bacteria | 1470 |
| 609 | Ga0495629_0004868 | 3300046459 | Bacteria | 10075 |
| 610 | Ga0495629_0063721 | 3300046459 | Bacteria | 2574 |
| 611 | Ga0495638_0010559 | 3300046460 | Bacteria | 6396 |
| 612 | Ga0495641_0002386 | 3300046461 | Bacteria | 14899 |
| 613 | Ga0495641_0031917 | 3300046461 | Bacteria | 2512 |
| 614 | Ga0495641_0088136 | 3300046461 | Bacteria | 1388 |
| 615 | Ga0495651_0001150 | 3300046462 | Bacteria | 20444 |
| 616 | Ga0495651_0022942 | 3300046462 | Bacteria | 4853 |
| 617 | Ga0495651_0156626 | 3300046462 | Bacteria | 1636 |
| 618 | Ga0495653_0001957 | 3300046463 | Bacteria | 16221 |
| 619 | Ga0495653_0005444 | 3300046463 | Bacteria | 10373 |
| 620 | Ga0495580_0001416 | 3300046472 | Bacteria | 21075 |
| 621 | Ga0495580_0227135 | 3300046472 | Bacteria | 1282 |
| 622 | Ga0495582_0010346 | 3300046473 | Bacteria | 5132 |
| 623 | Ga0495582_0011084 | 3300046473 | Bacteria | 4963 |
| 624 | Ga0495639_0000835 | 3300046475 | Bacteria | 14052 |
| 625 | Ga0495662_0006875 | 3300046476 | Bacteria | 5654 |
| 626 | Ga0495664_0000178 | 3300046477 | Bacteria | 31382 |
| 627 | Ga0495664_0003202 | 3300046477 | Bacteria | 8886 |
| 628 | Ga0495584_0002032 | 3300046491 | Bacteria | 11632 |
| 629 | Ga0495584_0101416 | 3300046491 | Bacteria | 1455 |
| 630 | Ga0495584_0172046 | 3300046491 | Bacteria | 1101 |
| 631 | Ga0495584_0220918 | 3300046491 | Bacteria | 963 |
| 632 | Ga0495594_0009812 | 3300046499 | Bacteria | 4958 |
| 633 | Ga0495608_0001395 | 3300046511 | Bacteria | 17182 |
| 634 | Ga0495616_0069268 | 3300046513 | Bacteria | 1711 |
| 635 | Ga0495618_0003454 | 3300046514 | Bacteria | 9819 |
| 636 | Ga0495618_0003686 | 3300046514 | Bacteria | 9495 |
| 637 | Ga0495620_0117376 | 3300046515 | Bacteria | 1051 |
| 638 | Ga0495628_0001448 | 3300046516 | Bacteria | 21780 |
| 639 | Ga0495628_0039987 | 3300046516 | Bacteria | 3749 |
| 640 | Ga0495630_0171583 | 3300046517 | Bacteria | 1652 |
| 641 | Ga0495631_0029682 | 3300046518 | Bacteria | 2485 |
| 642 | Ga0495644_0001111 | 3300046523 | Bacteria | 11068 |
| 643 | Ga0495663_0015124 | 3300046525 | Bacteria | 2171 |
| 644 | Ga0495666_0037519 | 3300046526 | Bacteria | 2356 |
| 645 | Ga0495666_0086318 | 3300046526 | Bacteria | 1482 |
| 646 | Ga0495652_0031667 | 3300046529 | Bacteria | 4629 |
| 647 | Ga0495652_0044415 | 3300046529 | Bacteria | 3826 |
| 648 | Ga0495652_0307055 | 3300046529 | Bacteria | 1151 |
| 649 | Ga0495665_0028522 | 3300046531 | Bacteria | 2992 |
| 650 | Ga0495640_0006845 | 3300046533 | Bacteria | 8982 |
| 651 | Ga0495640_0211126 | 3300046533 | Bacteria | 1227 |
| 652 | Ga0495586_0002551 | 3300046535 | Bacteria | 9858 |
| 653 | Ga0495586_0015879 | 3300046535 | Bacteria | 4005 |
| 654 | Ga0495587_0002720 | 3300046536 | Bacteria | 11797 |
| 655 | Ga0495587_0015317 | 3300046536 | Bacteria | 4790 |
| 656 | Ga0495598_0023250 | 3300046537 | Bacteria | 1667 |
| 657 | Ga0495645_0007248 | 3300046543 | Bacteria | 7719 |
| 658 | Ga0495622_0001697 | 3300046557 | Bacteria | 10892 |
| 659 | Ga0495667_0002931 | 3300046559 | Bacteria | 11450 |
| 660 | Ga0495667_0003212 | 3300046559 | Bacteria | 10961 |
| 661 | Ga0495667_0260993 | 3300046559 | Bacteria | 1102 |
| 662 | Ga0495656_0000325 | 3300046615 | Bacteria | 16325 |
| 663 | Ga0495634_0012378 | 3300046642 | Bacteria | 6176 |
| 664 | Ga0495634_0238943 | 3300046642 | Bacteria | 1115 |
| 665 | Ga0495611_0006562 | 3300046648 | Bacteria | 4958 |
| 666 | Ga0495611_0067570 | 3300046648 | Bacteria | 1631 |
| 667 | Ga0495635_0001359 | 3300046663 | Bacteria | 16270 |
| 668 | Ga0495635_0002911 | 3300046663 | Bacteria | 11761 |
| 669 | Ga0495635_0145138 | 3300046663 | Bacteria | 1616 |
| 670 | Ga0495659_0005068 | 3300046664 | Bacteria | 4137 |
| 671 | Ga0495661_0014707 | 3300046665 | Bacteria | 5240 |
| 672 | Ga0495661_0154332 | 3300046665 | Bacteria | 1238 |
| 673 | Ga0495588_0005566 | 3300046674 | Bacteria | 5614 |
| 674 | Ga0495588_0012037 | 3300046674 | Bacteria | 4078 |
| 675 | Ga0495588_0217943 | 3300046674 | Bacteria | 1007 |
| 676 | Ga0495657_0002130 | 3300046675 | Bacteria | 16809 |
| 677 | Ga0495599_0015050 | 3300046678 | Bacteria | 4795 |
| 678 | Ga0495623_0004297 | 3300046679 | Bacteria | 9377 |
| 679 | Ga0495646_0006963 | 3300046680 | Bacteria | 7178 |
| 680 | Ga0495646_0035272 | 3300046680 | Bacteria | 3103 |
| 681 | Ga0495646_0164311 | 3300046680 | Bacteria | 1227 |
| 682 | Ga0495647_0013280 | 3300046681 | Bacteria | 2850 |
| 683 | Ga0495647_0063919 | 3300046681 | Bacteria | 1458 |
| 684 | Ga0495658_0000489 | 3300046683 | Bacteria | 21697 |
| 685 | Ga0495658_0010135 | 3300046683 | Bacteria | 4708 |
| 686 | Ga0495613_0018093 | 3300046689 | Bacteria | 5250 |
| 687 | Ga0495613_0037508 | 3300046689 | Bacteria | 3593 |
| 688 | Ga0495613_0039554 | 3300046689 | Bacteria | 3496 |
| 689 | Ga0495613_0231722 | 3300046689 | Bacteria | 1294 |
| 690 | Ga0495624_0074287 | 3300046690 | Bacteria | 2112 |
| 691 | Ga0495670_0005583 | 3300046691 | Bacteria | 6172 |
| 692 | Ga0495600_0001998 | 3300046809 | Bacteria | 11466 |
| 693 | Ga0495600_0008547 | 3300046809 | Bacteria | 6296 |
| 694 | Ga0495581_0025400 | 3300047315 | Bacteria | 3434 |
| 695 | Ga0495604_0255508 | 3300047317 | Bacteria | 1193 |
| 696 | Ga0495636_0099168 | 3300047318 | Bacteria | 1272 |
| 697 | Ga0495674_0010239 | 3300047319 | Bacteria | 8878 |
| 698 | Ga0495674_0062606 | 3300047319 | Bacteria | 3238 |
| 699 | Ga0495674_0384462 | 3300047319 | Bacteria | 1135 |
| 700 | Ga0495674_0414005 | 3300047319 | Bacteria | 1087 |
| 701 | Ga0495676_0098617 | 3300047321 | Bacteria | 2167 |
| 702 | Ga0495676_0134456 | 3300047321 | Bacteria | 1780 |
| 703 | Ga0495680_0001491 | 3300047322 | Bacteria | 25179 |
| 704 | Ga0495680_0007295 | 3300047322 | Bacteria | 10175 |
| 705 | Ga0495680_0012171 | 3300047322 | Bacteria | 7589 |
| 706 | Ga0495675_0000657 | 3300047444 | Bacteria | 21846 |
| 707 | Ga0495679_036343 | 3300047446 | Bacteria | 1556 |
| 708 | Ga0495679_042681 | 3300047446 | Bacteria | 1398 |
| 709 | Ga0495684_0000711 | 3300047471 | Bacteria | 26762 |
| 710 | Ga0495593_0000309 | 3300047673 | Bacteria | 26737 |
| 711 | Ga0495593_0002786 | 3300047673 | Bacteria | 10528 |
| 712 | Ga0495593_0066009 | 3300047673 | Bacteria | 1886 |
| 713 | Ga0495602_0014126 | 3300048088 | Bacteria | 8119 |
| 714 | Ga0495602_0079734 | 3300048088 | Bacteria | 2760 |
| 715 | Ga0495614_0016353 | 3300048089 | Bacteria | 3229 |
| 716 | Ga0496100_0000203 | 3300048903 | Bacteria | 32744 |
| 717 | Ga0496100_0009604 | 3300048903 | Bacteria | 5438 |
| 718 | Ga0496100_0019163 | 3300048903 | Bacteria | 4076 |
| 719 | Ga0496100_0091882 | 3300048903 | Bacteria | 2073 |
| 720 | Ga0496100_0093060 | 3300048903 | Bacteria | 2061 |
| 721 | Ga0496101_0004542 | 3300048904 | Bacteria | 8765 |
| 722 | Ga0496101_0014742 | 3300048904 | Bacteria | 5258 |
| 723 | Ga0496101_0023507 | 3300048904 | Bacteria | 4259 |
| 724 | Ga0496101_0102124 | 3300048904 | Bacteria | 2148 |
| 725 | Ga0496101_0105784 | 3300048904 | Bacteria | 2112 |
| 726 | Ga0496101_0129443 | 3300048904 | Bacteria | 1915 |
| 727 | Ga0496101_0217872 | 3300048904 | Bacteria | 1480 |
| 728 | Ga0496102_0004838 | 3300048905 | Bacteria | 11387 |
| 729 | Ga0496102_0011960 | 3300048905 | Bacteria | 7495 |
| 730 | Ga0496102_0087503 | 3300048905 | Bacteria | 2878 |
| 731 | Ga0496102_0123366 | 3300048905 | Bacteria | 2420 |
| 732 | Ga0496102_0137917 | 3300048905 | Bacteria | 2286 |
| 733 | Ga0496102_0170979 | 3300048905 | Bacteria | 2046 |
| 734 | Ga0496102_0177429 | 3300048905 | Bacteria | 2006 |
| 735 | Ga0496102_0186465 | 3300048905 | Bacteria | 1955 |
| 736 | Ga0496102_0604571 | 3300048905 | Bacteria | 1019 |
| 737 | Ga0496103_0003298 | 3300048906 | Bacteria | 9877 |
| 738 | Ga0496103_0006837 | 3300048906 | Bacteria | 6808 |
| 739 | Ga0496103_0169529 | 3300048906 | Bacteria | 1401 |
| 740 | Ga0496104_0025868 | 3300048907 | Bacteria | 5412 |
| 741 | Ga0496104_0035607 | 3300048907 | Bacteria | 4648 |
| 742 | Ga0496104_0076516 | 3300048907 | Bacteria | 3188 |
| 743 | Ga0496104_0227228 | 3300048907 | Bacteria | 1778 |
| 744 | Ga0496104_0525332 | 3300048907 | Bacteria | 1094 |
| 745 | Ga0496105_0003270 | 3300048908 | Bacteria | 11950 |
| 746 | Ga0496105_0008071 | 3300048908 | Bacteria | 8183 |
| 747 | Ga0496105_0035620 | 3300048908 | Bacteria | 4096 |
| 748 | Ga0496105_0086794 | 3300048908 | Bacteria | 2586 |
| 749 | Ga0496105_0092267 | 3300048908 | Bacteria | 2500 |
| 750 | Ga0496105_0269770 | 3300048908 | Bacteria | 1374 |
| 751 | Ga0496106_0007673 | 3300048909 | Bacteria | 7981 |
| 752 | Ga0496106_0024918 | 3300048909 | Bacteria | 4448 |
| 753 | Ga0496106_0031302 | 3300048909 | Bacteria | 3964 |
| 754 | Ga0496106_0036714 | 3300048909 | Bacteria | 3665 |
| 755 | Ga0496106_0113195 | 3300048909 | Bacteria | 2115 |
| 756 | Ga0496107_0000268 | 3300048910 | Bacteria | 27611 |
| 757 | Ga0496107_0013083 | 3300048910 | Bacteria | 5797 |
| 758 | Ga0496107_0020058 | 3300048910 | Bacteria | 4720 |
| 759 | Ga0496107_0020818 | 3300048910 | Bacteria | 4635 |
| 760 | Ga0496107_0041684 | 3300048910 | Bacteria | 3297 |
| 761 | Ga0496108_0006255 | 3300048911 | Bacteria | 9644 |
| 762 | Ga0496108_0030073 | 3300048911 | Bacteria | 4502 |
| 763 | Ga0496108_0042610 | 3300048911 | Bacteria | 3789 |
| 764 | Ga0496108_0157354 | 3300048911 | Bacteria | 1962 |
| 765 | Ga0496108_0418410 | 3300048911 | Bacteria | 1170 |
| 766 | Ga0496108_0456467 | 3300048911 | Bacteria | 1116 |
| 767 | Ga0496109_0007775 | 3300048912 | Bacteria | 9077 |
| 768 | Ga0496109_0014079 | 3300048912 | Bacteria | 6953 |
| 769 | Ga0496109_0017745 | 3300048912 | Bacteria | 6243 |
| 770 | Ga0496109_0030999 | 3300048912 | Bacteria | 4794 |
| 771 | Ga0496109_0056632 | 3300048912 | Bacteria | 3577 |
| 772 | Ga0496110_0007566 | 3300048913 | Bacteria | 8678 |
| 773 | Ga0496110_0237524 | 3300048913 | Bacteria | 1658 |
| 774 | Ga0496111_0003386 | 3300048914 | Bacteria | 9856 |
| 775 | Ga0496111_0036621 | 3300048914 | Bacteria | 3509 |
| 776 | Ga0496111_0077988 | 3300048914 | Bacteria | 2416 |
| 777 | Ga0496111_0081631 | 3300048914 | Bacteria | 2360 |
| 778 | Ga0496111_0098699 | 3300048914 | Bacteria | 2144 |
| 779 | Ga0496112_0015561 | 3300048915 | Bacteria | 7104 |
| 780 | Ga0496112_0050082 | 3300048915 | Bacteria | 4095 |
| 781 | Ga0496112_0542228 | 3300048915 | Bacteria | 1097 |
| 782 | Ga0496113_0004591 | 3300048916 | Bacteria | 8516 |
| 783 | Ga0496113_0012044 | 3300048916 | Bacteria | 5800 |
| 784 | Ga0496113_0013238 | 3300048916 | Bacteria | 5580 |
| 785 | Ga0496113_0081277 | 3300048916 | Bacteria | 2483 |
| 786 | Ga0496114_0006070 | 3300048917 | Bacteria | 9508 |
| 787 | Ga0496114_0013910 | 3300048917 | Bacteria | 6451 |
| 788 | Ga0496114_0054999 | 3300048917 | Bacteria | 3318 |
| 789 | Ga0496114_0078890 | 3300048917 | Bacteria | 2778 |
| 790 | Ga0496114_0159467 | 3300048917 | Bacteria | 1960 |
| 791 | Ga0496115_0007708 | 3300048918 | Bacteria | 7940 |
| 792 | Ga0496115_0023532 | 3300048918 | Bacteria | 4780 |
| 793 | Ga0496115_0044766 | 3300048918 | Bacteria | 3532 |
| 794 | Ga0496115_0057330 | 3300048918 | Bacteria | 3133 |
| 795 | Ga0496115_0068127 | 3300048918 | Bacteria | 2880 |
| 796 | Ga0496115_0079541 | 3300048918 | Bacteria | 2668 |
| 797 | Ga0496115_0116473 | 3300048918 | Bacteria | 2198 |
| 798 | Ga0496115_0147581 | 3300048918 | Bacteria | 1942 |
| 799 | Ga0501032_0246083 | 3300049569 | Bacteria | 1161 |
| 800 | Ga0501047_0013111 | 3300049581 | Bacteria | 7851 |
| 801 | Ga0501047_0020566 | 3300049581 | Bacteria | 6337 |
| 802 | Ga0501048_0001027 | 3300049582 | Bacteria | 20871 |
| 803 | Ga0501067_0133151 | 3300049583 | Bacteria | 1384 |
| 804 | Ga0501071_0305155 | 3300049587 | Bacteria | 1207 |
| 805 | Ga0501073_0011617 | 3300049589 | Bacteria | 6434 |
| 806 | Ga0501073_0029589 | 3300049589 | Bacteria | 3913 |
| 807 | Ga0501073_0092884 | 3300049589 | Bacteria | 2097 |
| 808 | Ga0501073_0115376 | 3300049589 | Bacteria | 1861 |
| 809 | Ga0501074_0120577 | 3300049590 | Bacteria | 1876 |
| 810 | Ga0501074_0133430 | 3300049590 | Bacteria | 1776 |
| 811 | Ga0501074_0166265 | 3300049590 | Bacteria | 1575 |
| 812 | Ga0501075_0140129 | 3300049591 | Bacteria | 1843 |
| 813 | Ga0501076_0064664 | 3300049592 | Bacteria | 2916 |
| 814 | Ga0501076_0257551 | 3300049592 | Bacteria | 1428 |
| 815 | Ga0501079_0093957 | 3300049741 | Bacteria | 2324 |
| 816 | Ga0501083_0008341 | 3300049744 | Bacteria | 7323 |
| 817 | Ga0501083_0087378 | 3300049744 | Bacteria | 2061 |
| 818 | Ga0501083_0098808 | 3300049744 | Bacteria | 1925 |
| 819 | Ga0501044_0337958 | 3300049823 | Bacteria | 1427 |
| 820 | nmdc:mga0yw44_123894_c1 | 3300050492 | Bacteria | 1247 |
| 821 | nmdc:mga0yw44_71989_c1 | 3300050492 | Bacteria | 2147 |
| 822 | nmdc:mga06z11_113322_c1 | 3300050494 | Bacteria | 1504 |
| 823 | nmdc:mga06z11_150234_c1 | 3300050494 | Bacteria | 1323 |
| 824 | nmdc:mga04h51_72047_c1 | 3300050495 | Bacteria | 1208 |
| 825 | nmdc:mga07m45_200735_c1 | 3300050496 | Bacteria | 1160 |
| 826 | nmdc:mga05p37_17539_c1 | 3300050507 | Bacteria | 8643 |
| 827 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 828 | nmdc:mga05p37_37783_c1 | 3300050507 | Bacteria | 5923 |
| 829 | nmdc:mga05p37_7011_c1 | 3300050507 | Bacteria | 13281 |
| 830 | nmdc:mga09592_17661_c1 | 3300050508 | Bacteria | 5848 |
| 831 | nmdc:mga0qj67_1044_c1 | 3300050509 | Bacteria | 19172 |
| 832 | nmdc:mga0qj67_168_c1 | 3300050509 | Bacteria | 43793 |
| 833 | nmdc:mga06r32_27457_c1 | 3300050510 | Bacteria | 5317 |
| 834 | nmdc:mga06r32_6359_c1 | 3300050510 | Bacteria | 10614 |
| 835 | nmdc:mga08y16_145757_c1 | 3300050511 | Bacteria | 2461 |
| 836 | nmdc:mga08y16_2238_c1 | 3300050511 | Bacteria | 19836 |
| 837 | nmdc:mga08y16_25498_c1 | 3300050511 | Bacteria | 6237 |
| 838 | nmdc:mga08y16_338550_c1 | 3300050511 | Bacteria | 1547 |
| 839 | nmdc:mga0n895_157336_c1 | 3300050512 | Bacteria | 2303 |
| 840 | nmdc:mga0n895_332273_c1 | 3300050512 | Bacteria | 1540 |
| 841 | nmdc:mga0n895_35212_c1 | 3300050512 | Bacteria | 4825 |
| 842 | nmdc:mga0n895_422521_c1 | 3300050512 | Bacteria | 1347 |
| 843 | nmdc:mga0n895_547_c1 | 3300050512 | Bacteria | 25755 |
| 844 | nmdc:mga0n895_56841_c1 | 3300050512 | Bacteria | 3856 |
| 845 | nmdc:mga0n895_80383_c1 | 3300050512 | Bacteria | 3248 |
| 846 | nmdc:mga0rr50_129543_c1 | 3300050513 | Unclassified | 2018 |
| 847 | nmdc:mga0rr50_21635_c1 | 3300050513 | Bacteria | 4395 |
| 848 | nmdc:mga0rr50_230052_c1 | 3300050513 | Bacteria | 1534 |
| 849 | nmdc:mga0rr50_36146_c1 | 3300050513 | Bacteria | 3554 |
| 850 | nmdc:mga0rr50_4724_c1 | 3300050513 | Bacteria | 8031 |
| 851 | nmdc:mga08x19_277418_c1 | 3300050514 | Bacteria | 1161 |
| 852 | nmdc:mga08x19_62097_c1 | 3300050514 | Bacteria | 2422 |
| 853 | nmdc:mga0a205_49524_c1 | 3300050515 | Bacteria | 4055 |
| 854 | nmdc:mga0a205_51888_c1 | 3300050515 | Bacteria | 3959 |
| 855 | nmdc:mga0a205_6205_c1 | 3300050515 | Bacteria | 10788 |
| 856 | nmdc:mga0a205_629_c1 | 3300050515 | Bacteria | 28029 |
| 857 | Ga0495601_0011745 | 3300053077 | Bacteria | 5250 |
| 858 | Ga0495601_0099638 | 3300053077 | Bacteria | 1876 |
| 859 | Ga0495601_0244195 | 3300053077 | Bacteria | 1172 |
| 860 | Ga0495612_0001070 | 3300053078 | Bacteria | 11208 |
| 861 | Ga0495612_0003633 | 3300053078 | Bacteria | 6395 |
| 862 | Ga0495595_0002111 | 3300053084 | Bacteria | 7717 |
| 863 | Ga0495595_0004363 | 3300053084 | Bacteria | 5694 |
| 864 | Ga0495595_0080399 | 3300053084 | Bacteria | 1552 |
| 865 | Ga0495619_0000670 | 3300053085 | Bacteria | 22463 |
| 866 | Ga0495619_0048969 | 3300053085 | Bacteria | 2785 |
| 867 | Ga0500643_002023 | 3300053087 | Bacteria | 10898 |
| 868 | Ga0500644_0005103 | 3300053088 | Bacteria | 3308 |
| 869 | Ga0500651_0019316 | 3300053093 | Bacteria | 4233 |
| 870 | Ga0500566_0020233 | 3300053094 | Bacteria | 3910 |
| 871 | Ga0500641_0032914 | 3300053096 | Bacteria | 2054 |
| 872 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 873 | Ga0500652_000017 | 3300053131 | Bacteria | 121760 |
| 874 | Ga0500652_007720 | 3300053131 | Bacteria | 3540 |
| 875 | Ga0500658_0033235 | 3300053134 | Bacteria | 2027 |
| 876 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 877 | Ga0500636_0045514 | 3300053177 | Bacteria | 2588 |
| 878 | Ga0500645_000051 | 3300053730 | Bacteria | 98521 |
| 879 | Ga0500609_020253 | 3300053731 | Bacteria | 907 |
| 880 | Ga0501084_0203638 | 3300054114 | Bacteria | 1670 |
| 881 | Ga0501084_0467401 | 3300054114 | Bacteria | 1066 |
| 882 | Ga0501084_0536530 | 3300054114 | Bacteria | 989 |
| 883 | Ga0501082_0215258 | 3300060353 | Bacteria | 1671 |
| 884 | Ga0501082_0385196 | 3300060353 | Bacteria | 1223 |
| 885 | Ga0501082_0572265 | 3300060353 | Bacteria | 988 |
| 886 | Ga0530510_0049936 | 3300061734 | Bacteria | 3022 |
| 887 | 2883296527 | 2883291878 | Bacteria | 5894118 |
| 888 | 2883359233 | 2883354860 | Bacteria | 5865246 |
| 889 | Ga0373947_0090137 | |||
| 890 | 2214789669 | |||
| 891 | ARcpr5oldR_c000760 | |||
| 892 | ARSoilYngRDRAFT_c00482 | |||
| 893 | ARcpr5yngRDRAFT_c000072 | |||
| 894 | ARcpr5yngRDRAFT_c000237 | |||
| 895 | ARSoilOldRDRAFT_c001406 | |||
| 896 | ARCol0oldRDRAFT_c00533 | |||
| 897 | ARCol0yngRDRAFT_1000004 | |||
| 898 | JGI24746J21847_1001076 | |||
| 899 | JGI24747J21853_1000546 | |||
| 900 | JGI24739J22299_10007126 | |||
| 901 | JGI24737J22298_10006063 | |||
| 902 | JGI24750J21931_1000974 | |||
| 903 | JGI24745J21846_1000518 | |||
| 904 | JGI24749J21850_1000223 | |||
| 905 | JGI24034J26672_10001177 | |||
| 906 | JGI24742J22300_10000106 | |||
| 907 | JGI24751J29686_10004363 | |||
| 908 | Ga0065717_1003477 | |||
| 909 | Ga0065712_10068434 | |||
| 910 | Ga0065715_10000492 | |||
| 911 | Ga0065715_10001897 | |||
| 912 | Ga0070658_10030728 | |||
| 913 | Ga0070658_10049324 | |||
| 914 | Ga0070658_10256565 | |||
| 915 | Ga0070676_10063757 | |||
| 916 | Ga0070683_100001872 | |||
| 917 | Ga0070683_100163774 | |||
| 918 | Ga0070683_100243024 | |||
| 919 | Ga0070683_100620404 | |||
| 920 | Ga0070690_100000911 | |||
| 921 | Ga0070670_100006702 | |||
| 922 | Ga0070670_100043677 | |||
| 923 | Ga0070670_100044390 | |||
| 924 | Ga0070677_10000405 | |||
| 925 | Ga0068869_100031332 | |||
| 926 | Ga0070666_10018290 | |||
| 927 | Ga0070680_100002868 | |||
| 928 | Ga0070680_100022191 | |||
| 929 | Ga0070680_100191558 | |||
| 930 | Ga0070680_100363206 | |||
| 931 | Ga0070682_100000695 | |||
| 932 | Ga0070682_100044513 | |||
| 933 | Ga0070682_100147125 | |||
| 934 | Ga0068868_100004530 | |||
| 935 | Ga0070660_100001014 | |||
| 936 | Ga0070660_100037141 | |||
| 937 | Ga0070689_100002731 | |||
| 938 | Ga0070689_100006121 | |||
| 939 | Ga0070689_100019191 | |||
| 940 | Ga0070689_100031956 | |||
| 941 | Ga0070689_100320092 | |||
| 942 | Ga0070691_10004905 | |||
| 943 | Ga0070687_100005586 | |||
| 944 | Ga0070687_100025195 | |||
| 945 | Ga0070692_10004599 | |||
| 946 | Ga0070692_10006234 | |||
| 947 | Ga0070692_10251618 | |||
| 948 | Ga0070669_100009769 | |||
| 949 | Ga0070669_100010358 | |||
| 950 | Ga0070675_100000240 | |||
| 951 | Ga0070671_100001756 | |||
| 952 | Ga0070671_100021816 | |||
| 953 | Ga0070671_100123712 | |||
| 954 | Ga0070674_100175210 | |||
| 955 | Ga0070673_100001384 | |||
| 956 | Ga0070688_100002036 | |||
| 957 | Ga0070688_100008370 | |||
| 958 | Ga0070659_100006064 | |||
| 959 | Ga0070659_100042499 | |||
| 960 | Ga0070659_100531933 | |||
| 961 | Ga0070667_100007621 | |||
| 962 | Ga0070667_100028211 | |||
| 963 | Ga0070703_10005641 | |||
| 964 | Ga0070709_10043512 | |||
| 965 | Ga0070714_100077502 | |||
| 966 | Ga0070714_100268757 | |||
| 967 | Ga0070713_100000381 | |||
| 968 | Ga0070713_100036624 | |||
| 969 | Ga0070710_10004837 | |||
| 970 | Ga0070710_10032016 | |||
| 971 | Ga0070710_10048727 | |||
| 972 | Ga0070710_10230763 | |||
| 973 | Ga0070701_10113421 | |||
| 974 | Ga0070711_100019336 | |||
| 975 | Ga0070711_100025003 | |||
| 976 | Ga0070705_100000923 | |||
| 977 | Ga0070705_100098831 | |||
| 978 | Ga0070700_100017352 | |||
| 979 | Ga0070700_100306708 | |||
| 980 | Ga0070708_100183979 | |||
| 981 | Ga0070708_100398795 | |||
| 982 | Ga0070663_100004180 | |||
| 983 | Ga0070663_100008652 | |||
| 984 | Ga0070678_100000466 | |||
| 985 | Ga0070678_100167204 | |||
| 986 | Ga0070662_100062896 | |||
| 987 | Ga0070681_10011001 | |||
| 988 | Ga0070681_10106851 | |||
| 989 | Ga0070681_10126041 | |||
| 990 | Ga0070681_10554664 | |||
| 991 | Ga0068867_100008852 | |||
| 992 | Ga0068867_100501005 | |||
| 993 | Ga0070685_10003702 | |||
| 994 | Ga0070685_10007939 | |||
| 995 | Ga0070707_100271315 | |||
| 996 | Ga0070699_100039662 | |||
| 997 | Ga0070699_100199130 | |||
| 998 | Ga0070679_100047818 | |||
| 999 | Ga0070679_100054789 | |||
| 1000 | Ga0070679_100078235 | |||
| 1001 | Ga0070679_100410570 | |||
| 1002 | Ga0070684_100004983 | |||
| 1003 | Ga0070684_100035555 | |||
| 1004 | Ga0070684_100042900 | |||
| 1005 | Ga0070684_100212578 | |||
| 1006 | Ga0070697_100188942 | |||
| 1007 | Ga0068853_100007526 | |||
| 1008 | Ga0068853_100049924 | |||
| 1009 | Ga0070672_100001488 | |||
| 1010 | Ga0070686_100002467 | |||
| 1011 | Ga0070686_100049777 | |||
| 1012 | Ga0070686_100217258 | |||
| 1013 | Ga0070695_100002425 | |||
| 1014 | Ga0070695_100007070 | |||
| 1015 | Ga0070695_100021352 | |||
| 1016 | Ga0070695_100339197 | |||
| 1017 | Ga0070696_100308908 | |||
| 1018 | Ga0070693_100005725 | |||
| 1019 | Ga0070665_100070199 | |||
| 1020 | Ga0070704_100026993 | |||
| 1021 | Ga0070704_100038609 | |||
| 1022 | Ga0068855_100054238 | |||
| 1023 | Ga0068855_100070252 | |||
| 1024 | Ga0068855_100102169 | |||
| 1025 | Ga0068855_100426530 | |||
| 1026 | Ga0070664_100028233 | |||
| 1027 | Ga0070664_100131947 | |||
| 1028 | Ga0070664_100364403 | |||
| 1029 | Ga0068857_100008023 | |||
| 1030 | Ga0068857_100118687 | |||
| 1031 | Ga0068854_100012212 | |||
| 1032 | Ga0068854_100129421 | |||
| 1033 | Ga0068854_100222927 | |||
| 1034 | Ga0068854_100345320 | |||
| 1035 | Ga0068856_100024347 | |||
| 1036 | Ga0068856_100065975 | |||
| 1037 | Ga0068856_100273572 | |||
| 1038 | Ga0068852_100171370 | |||
| 1039 | Ga0068852_100275419 | |||
| 1040 | Ga0068859_100011206 | |||
| 1041 | Ga0068866_10004547 | |||
| 1042 | Ga0068866_10117479 | |||
| 1043 | Ga0068866_10215576 | |||
| 1044 | Ga0068866_10241705 | |||
| 1045 | Ga0068861_100006386 | |||
| 1046 | Ga0068861_100095061 | |||
| 1047 | Ga0068861_100157745 | |||
| 1048 | Ga0068870_10000332 | |||
| 1049 | Ga0068870_10039943 | |||
| 1050 | Ga0068863_100000674 | |||
| 1051 | Ga0068863_100649037 | |||
| 1052 | Ga0068858_100007301 | |||
| 1053 | Ga0068858_100036109 | |||
| 1054 | Ga0068858_100085564 | |||
| 1055 | Ga0068858_100271730 | |||
| 1056 | Ga0068858_100282438 | |||
| 1057 | Ga0068860_100013916 | |||
| 1058 | Ga0068860_100103831 | |||
| 1059 | Ga0068860_100197954 | |||
| 1060 | Ga0068860_100231325 | |||
| 1061 | Ga0068860_100428076 | |||
| 1062 | Ga0068862_100218992 | |||
| 1063 | Ga0081455_10000059 | |||
| 1064 | Ga0081455_10000678 | |||
| 1065 | Ga0081455_10001419 | |||
| 1066 | Ga0081540_1000234 | |||
| 1067 | Ga0081540_1013934 | |||
| 1068 | Ga0081539_10125547 | |||
| 1069 | Ga0070717_10000564 | |||
| 1070 | Ga0070717_10022047 | |||
| 1071 | Ga0075368_10038232 | |||
| 1072 | Ga0075368_10054891 | |||
| 1073 | Ga0075432_10002448 | |||
| 1074 | Ga0070715_10000587 | |||
| 1075 | Ga0070715_10009322 | |||
| 1076 | Ga0070716_100009907 | |||
| 1077 | Ga0070716_100017891 | |||
| 1078 | Ga0070716_100135543 | |||
| 1079 | Ga0075367_10050959 | |||
| 1080 | Ga0075369_10065810 | |||
| 1081 | Ga0075369_10114476 | |||
| 1082 | Ga0097621_100000521 | |||
| 1083 | Ga0097621_100193656 | |||
| 1084 | Ga0068871_100001830 | |||
| 1085 | Ga0068871_100024340 | |||
| 1086 | Ga0068871_100037205 | |||
| 1087 | Ga0075428_100001505 | |||
| 1088 | Ga0075430_100000015 | |||
| 1089 | Ga0075430_100000070 | |||
| 1090 | Ga0075430_100147466 | |||
| 1091 | Ga0075431_100009121 | |||
| 1092 | Ga0075431_100347929 | |||
| 1093 | Ga0075433_10000820 | |||
| 1094 | Ga0075433_10050839 | |||
| 1095 | Ga0075433_10168764 | |||
| 1096 | Ga0075434_100009003 | |||
| 1097 | Ga0075434_100055731 | |||
| 1098 | Ga0075434_100070192 | |||
| 1099 | Ga0075434_100166100 | |||
| 1100 | Ga0075434_100296697 | |||
| 1101 | Ga0075434_100378363 | |||
| 1102 | Ga0075429_100001029 | |||
| 1103 | Ga0068865_100013146 | |||
| 1104 | Ga0068865_100052429 | |||
| 1105 | Ga0068865_100443188 | |||
| 1106 | Ga0075436_100012357 | |||
| 1107 | Ga0097620_100011206 | |||
| 1108 | Ga0075435_100003677 | |||
| 1109 | Ga0075435_100022284 | |||
| 1110 | Ga0075435_100205153 | |||
| 1111 | Ga0075435_100403091 | |||
| 1112 | Ga0099795_10025308 | |||
| 1113 | Ga0105244_10053800 | |||
| 1114 | Ga0105250_10063540 | |||
| 1115 | Ga0105240_10039973 | |||
| 1116 | Ga0105240_10234796 | |||
| 1117 | Ga0111539_10000138 | |||
| 1118 | Ga0111539_10004385 | |||
| 1119 | Ga0111539_10077827 | |||
| 1120 | Ga0111539_10190840 | |||
| 1121 | Ga0111539_10401252 | |||
| 1122 | Ga0105245_10006547 | |||
| 1123 | Ga0105245_10051521 | |||
| 1124 | Ga0105245_10214712 | |||
| 1125 | Ga0105245_10292879 | |||
| 1126 | Ga0105245_10393445 | |||
| 1127 | Ga0105247_10196694 | |||
| 1128 | Ga0114129_10002312 | |||
| 1129 | Ga0114129_10003950 | |||
| 1130 | Ga0114129_10005495 | |||
| 1131 | Ga0105243_10009075 | |||
| 1132 | Ga0105243_10033868 | |||
| 1133 | Ga0105243_10261720 | |||
| 1134 | Ga0105243_10343123 | |||
| 1135 | Ga0105241_10008372 | |||
| 1136 | Ga0105241_10047193 | |||
| 1137 | Ga0105242_10026910 | |||
| 1138 | Ga0105242_10068220 | |||
| 1139 | Ga0105242_10778744 | |||
| 1140 | Ga0105248_10006279 | |||
| 1141 | Ga0105248_10136791 | |||
| 1142 | Ga0105248_11155777 | |||
| 1143 | Ga0105237_10046611 | |||
| 1144 | Ga0105237_10151147 | |||
| 1145 | Ga0105238_10082779 | |||
| 1146 | Ga0105238_10307616 | |||
| 1147 | Ga0105249_10001029 | |||
| 1148 | Ga0105249_10033885 | |||
| 1149 | Ga0105249_10497450 | |||
| 1150 | Ga0099796_10005416 | |||
| 1151 | Ga0105239_10079079 | |||
| 1152 | Ga0105239_10177750 | |||
| 1153 | Ga0105239_10239161 | |||
| 1154 | Ga0105246_10000702 | |||
| 1155 | Ga0105246_10344240 | |||
| 1156 | Ga0105246_10471846 | |||
| 1157 | Ga0157371_10005592 | |||
| 1158 | Ga0157371_10138019 | |||
| 1159 | Ga0157369_10229282 | |||
| 1160 | Ga0157374_10007209 | |||
| 1161 | Ga0157374_10083463 | |||
| 1162 | Ga0157374_10417733 | |||
| 1163 | Ga0157378_10016518 | |||
| 1164 | Ga0157378_10531083 | |||
| 1165 | Ga0157378_10576074 | |||
| 1166 | Ga0163162_10065860 | |||
| 1167 | Ga0163162_10068737 | |||
| 1168 | Ga0157372_10051950 | |||
| 1169 | Ga0157372_10271185 | |||
| 1170 | Ga0157375_10002908 | |||
| 1171 | Ga0157375_10228668 | |||
| 1172 | Ga0157375_10602895 | |||
| 1173 | Ga0163163_10005259 | |||
| 1174 | Ga0163163_10011735 | |||
| 1175 | Ga0163163_10096637 | |||
| 1176 | Ga0157380_10203809 | |||
| 1177 | Ga0157380_10320205 | |||
| 1178 | Ga0157377_10000729 | |||
| 1179 | Ga0157377_10058600 | |||
| 1180 | Ga0157379_10000345 | |||
| 1181 | Ga0157379_10015335 | |||
| 1182 | Ga0157379_10025251 | |||
| 1183 | Ga0157379_10158270 | |||
| 1184 | Ga0157376_10006980 | |||
| 1185 | Ga0157376_10177905 | |||
| 1186 | Ga0163161_10013155 | |||
| 1187 | Ga0163161_10067363 | |||
| 1188 | Ga0206354_11627161 | |||
| 1189 | Ga0206353_10148134 | |||
| 1190 | Ga0207673_1000178 | |||
| 1191 | Ga0207697_10000390 | |||
| 1192 | Ga0207697_10040619 | |||
| 1193 | Ga0207692_10034254 | |||
| 1194 | Ga0207692_10038818 | |||
| 1195 | Ga0207692_10339042 | |||
| 1196 | Ga0207642_10001144 | |||
| 1197 | Ga0207642_10045637 | |||
| 1198 | Ga0207688_10008150 | |||
| 1199 | Ga0207680_10015890 | |||
| 1200 | Ga0207680_10383427 | |||
| 1201 | Ga0207647_10006274 | |||
| 1202 | Ga0207647_10147925 | |||
| 1203 | Ga0207685_10000901 | |||
| 1204 | Ga0207685_10027329 | |||
| 1205 | Ga0207699_10003447 | |||
| 1206 | Ga0207699_10014956 | |||
| 1207 | Ga0207645_10065712 | |||
| 1208 | Ga0207645_10251147 | |||
| 1209 | Ga0207643_10000581 | |||
| 1210 | Ga0207643_10066405 | |||
| 1211 | Ga0207705_10013986 | |||
| 1212 | Ga0207705_10030571 | |||
| 1213 | Ga0207684_10048056 | |||
| 1214 | Ga0207654_10006384 | |||
| 1215 | Ga0207654_10461652 | |||
| 1216 | Ga0207707_10008318 | |||
| 1217 | Ga0207671_10022282 | |||
| 1218 | Ga0207671_10094714 | |||
| 1219 | Ga0207671_10476581 | |||
| 1220 | Ga0207693_10008185 | |||
| 1221 | Ga0207693_10038451 | |||
| 1222 | Ga0207693_10157254 | |||
| 1223 | Ga0207663_10003382 | |||
| 1224 | Ga0207663_10029839 | |||
| 1225 | Ga0207663_10371908 | |||
| 1226 | Ga0207660_10000192 | |||
| 1227 | Ga0207660_10016157 | |||
| 1228 | Ga0207660_10119745 | |||
| 1229 | Ga0207660_10355688 | |||
| 1230 | Ga0207660_10458661 | |||
| 1231 | Ga0207662_10000647 | |||
| 1232 | Ga0207662_10008193 | |||
| 1233 | Ga0207662_10048450 | |||
| 1234 | Ga0207662_10395756 | |||
| 1235 | Ga0207657_10001253 | |||
| 1236 | Ga0207657_10065825 | |||
| 1237 | Ga0207657_10077686 | |||
| 1238 | Ga0207657_10114675 | |||
| 1239 | Ga0207657_10294179 | |||
| 1240 | Ga0207649_10000141 | |||
| 1241 | Ga0207649_10285093 | |||
| 1242 | Ga0207652_10004519 | |||
| 1243 | Ga0207652_10082941 | |||
| 1244 | Ga0207652_10115475 | |||
| 1245 | Ga0207652_10207330 | |||
| 1246 | Ga0207652_10225421 | |||
| 1247 | Ga0207652_10565398 | |||
| 1248 | Ga0207646_10411200 | |||
| 1249 | Ga0207681_10000359 | |||
| 1250 | Ga0207681_10057667 | |||
| 1251 | Ga0207694_10051993 | |||
| 1252 | Ga0207694_10366860 | |||
| 1253 | Ga0207650_10004111 | |||
| 1254 | Ga0207650_10004220 | |||
| 1255 | Ga0207650_10092260 | |||
| 1256 | Ga0207650_10471072 | |||
| 1257 | Ga0207659_10000052 | |||
| 1258 | Ga0207659_10223150 | |||
| 1259 | Ga0207659_10283527 | |||
| 1260 | Ga0207687_10000097 | |||
| 1261 | Ga0207687_10023847 | |||
| 1262 | Ga0207687_10076872 | |||
| 1263 | Ga0207687_10417384 | |||
| 1264 | Ga0207700_10003441 | |||
| 1265 | Ga0207700_10024798 | |||
| 1266 | Ga0207700_10064766 | |||
| 1267 | Ga0207664_10053374 | |||
| 1268 | Ga0207664_10286291 | |||
| 1269 | Ga0207644_10000666 | |||
| 1270 | Ga0207644_10022774 | |||
| 1271 | Ga0207644_10070179 | |||
| 1272 | Ga0207644_10077270 | |||
| 1273 | Ga0207690_10000278 | |||
| 1274 | Ga0207690_10121410 | |||
| 1275 | Ga0207690_10605311 | |||
| 1276 | Ga0207706_10010711 | |||
| 1277 | Ga0207706_10022229 | |||
| 1278 | Ga0207706_10475002 | |||
| 1279 | Ga0207686_10000870 | |||
| 1280 | Ga0207686_10296490 | |||
| 1281 | Ga0207709_10000987 | |||
| 1282 | Ga0207709_10071846 | |||
| 1283 | Ga0207670_10000781 | |||
| 1284 | Ga0207670_10003950 | |||
| 1285 | Ga0207670_10063716 | |||
| 1286 | Ga0207669_10000206 | |||
| 1287 | Ga0207669_10075757 | |||
| 1288 | Ga0207704_10007001 | |||
| 1289 | Ga0207704_10085700 | |||
| 1290 | Ga0207665_10000248 | |||
| 1291 | Ga0207665_10023525 | |||
| 1292 | Ga0207691_10000798 | |||
| 1293 | Ga0207691_10156003 | |||
| 1294 | Ga0207711_10004870 | |||
| 1295 | Ga0207711_10100639 | |||
| 1296 | Ga0207711_10188767 | |||
| 1297 | Ga0207689_10003457 | |||
| 1298 | Ga0207689_10035132 | |||
| 1299 | Ga0207661_10000143 | |||
| 1300 | Ga0207661_10216528 | |||
| 1301 | Ga0207667_10060669 | |||
| 1302 | Ga0207667_10089201 | |||
| 1303 | Ga0207651_10000080 | |||
| 1304 | Ga0207651_10154666 | |||
| 1305 | Ga0207712_10001232 | |||
| 1306 | Ga0207712_10022172 | |||
| 1307 | Ga0207640_10003188 | |||
| 1308 | Ga0207677_10001118 | |||
| 1309 | Ga0207703_10004276 | |||
| 1310 | Ga0207703_10024313 | |||
| 1311 | Ga0207703_10124122 | |||
| 1312 | Ga0207703_10141321 | |||
| 1313 | Ga0207639_10039795 | |||
| 1314 | Ga0207639_10048506 | |||
| 1315 | Ga0207678_10143586 | |||
| 1316 | Ga0207708_10001889 | |||
| 1317 | Ga0207708_10014799 | |||
| 1318 | Ga0207708_10025692 | |||
| 1319 | Ga0207708_10075489 | |||
| 1320 | Ga0207708_10231923 | |||
| 1321 | Ga0207708_10406267 | |||
| 1322 | Ga0207702_10012711 | |||
| 1323 | Ga0207702_10040456 | |||
| 1324 | Ga0207702_10065063 | |||
| 1325 | Ga0207702_10169152 | |||
| 1326 | Ga0207702_10776052 | |||
| 1327 | Ga0207641_10003756 | |||
| 1328 | Ga0207641_10352123 | |||
| 1329 | Ga0207648_10005438 | |||
| 1330 | Ga0207648_10019818 | |||
| 1331 | Ga0207648_10038614 | |||
| 1332 | Ga0207648_10079549 | |||
| 1333 | Ga0207676_10000689 | |||
| 1334 | Ga0207676_10036233 | |||
| 1335 | Ga0207676_10315366 | |||
| 1336 | Ga0207674_10002206 | |||
| 1337 | Ga0207674_10140086 | |||
| 1338 | Ga0207675_100002223 | |||
| 1339 | Ga0207675_100003721 | |||
| 1340 | Ga0207675_100088531 | |||
| 1341 | Ga0207683_10003030 | |||
| 1342 | Ga0207683_10003691 | |||
| 1343 | Ga0207683_10029878 | |||
| 1344 | Ga0207683_10041266 | |||
| 1345 | Ga0207683_10058000 | |||
| 1346 | Ga0207698_10005996 | |||
| 1347 | Ga0207698_10228811 | |||
| 1348 | Ga0207698_10257739 | |||
| 1349 | Ga0210002_1000850 | |||
| 1350 | Ga0209971_1003247 | |||
| 1351 | Ga0209974_10002220 | |||
| 1352 | Ga0207428_10000075 | |||
| 1353 | Ga0207428_10000973 | |||
| 1354 | Ga0207428_10001396 | |||
| 1355 | Ga0207428_10259154 | |||
| 1356 | Ga0268266_10073750 | |||
| 1357 | Ga0268266_10104349 | |||
| 1358 | Ga0268266_10306085 | |||
| 1359 | Ga0268266_10455937 | |||
| 1360 | Ga0268265_10008836 | |||
| 1361 | Ga0268265_10138283 | |||
| 1362 | Ga0268265_10844594 | |||
| 1363 | Ga0268264_10006787 | |||
| 1364 | Ga0268264_10023177 | |||
| 1365 | Ga0268264_10070794 | |||
| 1366 | Ga0265337_1000182 | |||
| 1367 | Ga0265338_10117750 | |||
| 1368 | Ga0265325_10000034 | |||
| 1369 | Ga0265325_10001553 | |||
| 1370 | Ga0265325_10082028 | |||
| 1371 | Ga0265325_10091863 | |||
| 1372 | Ga0265340_10008869 | |||
| 1373 | Ga0265340_10031716 | |||
| 1374 | Ga0265316_10006848 | |||
| 1375 | Ga0265316_10132179 | |||
| 1376 | Ga0307513_10078656 | |||
| 1377 | Ga0265313_10000345 | |||
| 1378 | Ga0265313_10007339 | |||
| 1379 | Ga0265313_10010794 | |||
| 1380 | Ga0316575_10029767 | |||
| 1381 | Ga0265314_10003737 | |||
| 1382 | Ga0265342_10000203 | |||
| 1383 | Ga0307406_10494243 | |||
| 1384 | Ga0316583_10000327 | |||
| 1385 | Ga0373930_0003033 | |||
| 1386 | Ga0373930_0003586 | |||
| 1387 | Ga0373930_0004152 | |||
| 1388 | Ga0373948_0000065 | |||
| 1389 | Ga0373948_0012614 | |||
| 1390 | Ga0373950_0002667 | |||
| 1391 | Ga0373958_0000282 | |||
| 1392 | Ga0373958_0002218 | |||
| 1393 | Ga0373959_0005381 | |||
| 1394 | Ga0373938_0000612 | |||
| 1395 | Ga0373938_0000777 | |||
| 1396 | Ga0373928_0014501 | |||
| 1397 | Ga0373929_0004079 | |||
| 1398 | Ga0373929_0006738 | |||
| 1399 | Ga0373929_0008717 | |||
| 1400 | Ga0373934_0003795 | |||
| 1401 | Ga0373934_0152088 | |||
| 1402 | Ga0373940_0001606 | |||
| 1403 | Ga0373940_0002487 | |||
| 1404 | Ga0373940_0016256 | |||
| 1405 | Ga0373944_0000062 | |||
| 1406 | Ga0373944_0013006 | |||
| 1407 | Ga0373949_0001405 | |||
| 1408 | Ga0373949_0002166 | |||
| 1409 | Ga0373951_0003414 | |||
| 1410 | Ga0373951_0012434 | |||
| 1411 | Ga0373952_0000544 | |||
| 1412 | Ga0373952_0001537 | |||
| 1413 | Ga0373952_0002894 | |||
| 1414 | Ga0373952_0033419 | |||
| 1415 | Ga0373923_0000277 | |||
| 1416 | Ga0373923_0026713 | |||
| 1417 | Ga0373932_0001652 | |||
| 1418 | Ga0373932_0002120 | |||
| 1419 | Ga0373936_0000954 | |||
| 1420 | Ga0373936_0032970 | |||
| 1421 | Ga0373939_0003012 | |||
| 1422 | Ga0373941_0000106 | |||
| 1423 | Ga0373941_0001163 | |||
| 1424 | Ga0373941_0005867 | |||
| 1425 | Ga0373941_0040362 | |||
| 1426 | Ga0373945_0000385 | |||
| 1427 | Ga0373945_0101268 | |||
| 1428 | Ga0373953_0000952 | |||
| 1429 | Ga0373953_0053216 | |||
| 1430 | Ga0373954_0002467 | |||
| 1431 | Ga0373954_0003174 | |||
| 1432 | Ga0373954_0056309 | |||
| 1433 | Ga0373956_0004014 | |||
| 1434 | Ga0373956_0011075 | |||
| 1435 | Ga0373956_0043960 | |||
| 1436 | Ga0373957_0007623 | |||
| 1437 | Ga0373943_0013449 | |||
| 1438 | Ga0373946_0005016 | |||
| 1439 | Ga0373946_0010105 | |||
| 1440 | Ga0373946_0014082 | |||
| 1441 | Ga0373946_0026768 | |||
| 1442 | Ga0373955_0000366 | |||
| 1443 | Ga0373955_0007406 | |||
| 1444 | Ga0373955_0037956 | |||
| 1445 | Ga0373955_0046423 | |||
| 1446 | Ga0373942_0002044 | |||
| 1447 | Ga0373942_0004697 | |||
| 1448 | Ga0373961_0004557 | |||
| 1449 | Ga0373962_0001666 | |||
| 1450 | Ga0373962_0001945 | |||
| 1451 | Ga0373962_0008630 | |||
| 1452 | Ga0373931_0005024 | |||
| 1453 | Ga0373935_0005061 | |||
| 1454 | Ga0373935_0105347 | |||
| 1455 | Ga0373935_0119567 | |||
| 1456 | Ga0373935_0132262 | |||
| 1457 | Ga0373927_0005034 | |||
| 1458 | Ga0373927_0042727 | |||
| 1459 | Ga0373933_0002080 | |||
| 1460 | Ga0373933_0007702 | |||
| 1461 | Ga0373933_0023393 | |||
| 1462 | Ga0373947_0001101 | |||
| 1463 | Ga0373937_0000037 | |||
| 1464 | Ga0373937_0011894 | |||
| 1465 | Ga0373937_0030460 | |||
| 1466 | Ga0373937_0091598 | |||
| 1467 | Ga0373925_0014949 | |||
| 1468 | Ga0373925_0077188 | |||
| 1469 | Ga0373925_0081872 | |||
| 1470 | Ga0373925_0433904 | |||
| 1471 | Ga0395900_0002100 | |||
| 1472 | Ga0395898_0043461 | |||
| 1473 | Ga0395898_0092471 | |||
| 1474 | Ga0395901_0009830 | |||
| 1475 | Ga0395901_0134825 | |||
| 1476 | Ga0436365_1503001 | |||
| 1477 | Ga0436361_0048384 | |||
| 1478 | Ga0439450_034830 | |||
| 1479 | Ga0439435_0006979 | |||
| 1480 | Ga0439460_0032314 | |||
| 1481 | Ga0451577_0116320 | |||
| 1482 | Ga0466963_0137693 | |||
| 1483 | Ga0466963_0310491 | |||
| 1484 | Ga0453684_0169863 | |||
| 1485 | Ga0466957_0222280 | |||
| 1486 | Ga0451576_0033902 | |||
| 1487 | Ga0466958_0102981 | |||
| 1488 | Ga0466967_0405348 | |||
| 1489 | Ga0466967_0667466 | |||
| 1490 | Ga0495617_011839 | |||
| 1491 | Ga0495592_0004523 | |||
| 1492 | Ga0495592_0056649 | |||
| 1493 | Ga0495603_0041113 | |||
| 1494 | Ga0495603_0174759 | |||
| 1495 | Ga0495603_0184854 | |||
| 1496 | Ga0495591_035103 | |||
| 1497 | Ga0495629_0004868 | |||
| 1498 | Ga0495629_0063721 | |||
| 1499 | Ga0495638_0010559 | |||
| 1500 | Ga0495641_0002386 | |||
| 1501 | Ga0495641_0031917 | |||
| 1502 | Ga0495641_0088136 | |||
| 1503 | Ga0495651_0001150 | |||
| 1504 | Ga0495651_0022942 | |||
| 1505 | Ga0495651_0156626 | |||
| 1506 | Ga0495653_0001957 | |||
| 1507 | Ga0495653_0005444 | |||
| 1508 | Ga0495580_0001416 | |||
| 1509 | Ga0495580_0227135 | |||
| 1510 | Ga0495582_0010346 | |||
| 1511 | Ga0495582_0011084 | |||
| 1512 | Ga0495639_0000835 | |||
| 1513 | Ga0495662_0006875 | |||
| 1514 | Ga0495664_0000178 | |||
| 1515 | Ga0495664_0003202 | |||
| 1516 | Ga0495584_0002032 | |||
| 1517 | Ga0495584_0101416 | |||
| 1518 | Ga0495584_0172046 | |||
| 1519 | Ga0495584_0220918 | |||
| 1520 | Ga0495594_0009812 | |||
| 1521 | Ga0495608_0001395 | |||
| 1522 | Ga0495616_0069268 | |||
| 1523 | Ga0495618_0003454 | |||
| 1524 | Ga0495618_0003686 | |||
| 1525 | Ga0495620_0117376 | |||
| 1526 | Ga0495628_0001448 | |||
| 1527 | Ga0495628_0039987 | |||
| 1528 | Ga0495630_0171583 | |||
| 1529 | Ga0495631_0029682 | |||
| 1530 | Ga0495644_0001111 | |||
| 1531 | Ga0495663_0015124 | |||
| 1532 | Ga0495666_0037519 | |||
| 1533 | Ga0495666_0086318 | |||
| 1534 | Ga0495652_0031667 | |||
| 1535 | Ga0495652_0044415 | |||
| 1536 | Ga0495652_0307055 | |||
| 1537 | Ga0495665_0028522 | |||
| 1538 | Ga0495640_0006845 | |||
| 1539 | Ga0495640_0211126 | |||
| 1540 | Ga0495586_0002551 | |||
| 1541 | Ga0495586_0015879 | |||
| 1542 | Ga0495587_0002720 | |||
| 1543 | Ga0495587_0015317 | |||
| 1544 | Ga0495598_0023250 | |||
| 1545 | Ga0495645_0007248 | |||
| 1546 | Ga0495622_0001697 | |||
| 1547 | Ga0495667_0002931 | |||
| 1548 | Ga0495667_0003212 | |||
| 1549 | Ga0495667_0260993 | |||
| 1550 | Ga0495656_0000325 | |||
| 1551 | Ga0495634_0012378 | |||
| 1552 | Ga0495634_0238943 | |||
| 1553 | Ga0495611_0006562 | |||
| 1554 | Ga0495611_0067570 | |||
| 1555 | Ga0495635_0001359 | |||
| 1556 | Ga0495635_0002911 | |||
| 1557 | Ga0495635_0145138 | |||
| 1558 | Ga0495659_0005068 | |||
| 1559 | Ga0495661_0014707 | |||
| 1560 | Ga0495661_0154332 | |||
| 1561 | Ga0495588_0005566 | |||
| 1562 | Ga0495588_0012037 | |||
| 1563 | Ga0495588_0217943 | |||
| 1564 | Ga0495657_0002130 | |||
| 1565 | Ga0495599_0015050 | |||
| 1566 | Ga0495623_0004297 | |||
| 1567 | Ga0495646_0006963 | |||
| 1568 | Ga0495646_0035272 | |||
| 1569 | Ga0495646_0164311 | |||
| 1570 | Ga0495647_0013280 | |||
| 1571 | Ga0495647_0063919 | |||
| 1572 | Ga0495658_0000489 | |||
| 1573 | Ga0495658_0010135 | |||
| 1574 | Ga0495613_0018093 | |||
| 1575 | Ga0495613_0037508 | |||
| 1576 | Ga0495613_0039554 | |||
| 1577 | Ga0495613_0231722 | |||
| 1578 | Ga0495624_0074287 | |||
| 1579 | Ga0495670_0005583 | |||
| 1580 | Ga0495600_0001998 | |||
| 1581 | Ga0495600_0008547 | |||
| 1582 | Ga0495581_0025400 | |||
| 1583 | Ga0495604_0255508 | |||
| 1584 | Ga0495636_0099168 | |||
| 1585 | Ga0495674_0010239 | |||
| 1586 | Ga0495674_0062606 | |||
| 1587 | Ga0495674_0384462 | |||
| 1588 | Ga0495674_0414005 | |||
| 1589 | Ga0495676_0098617 | |||
| 1590 | Ga0495676_0134456 | |||
| 1591 | Ga0495680_0001491 | |||
| 1592 | Ga0495680_0007295 | |||
| 1593 | Ga0495680_0012171 | |||
| 1594 | Ga0495675_0000657 | |||
| 1595 | Ga0495679_036343 | |||
| 1596 | Ga0495679_042681 | |||
| 1597 | Ga0495684_0000711 | |||
| 1598 | Ga0495593_0000309 | |||
| 1599 | Ga0495593_0002786 | |||
| 1600 | Ga0495593_0066009 | |||
| 1601 | Ga0495602_0014126 | |||
| 1602 | Ga0495602_0079734 | |||
| 1603 | Ga0495614_0016353 | |||
| 1604 | Ga0496100_0000203 | |||
| 1605 | Ga0496100_0009604 | |||
| 1606 | Ga0496100_0019163 | |||
| 1607 | Ga0496100_0091882 | |||
| 1608 | Ga0496100_0093060 | |||
| 1609 | Ga0496101_0004542 | |||
| 1610 | Ga0496101_0014742 | |||
| 1611 | Ga0496101_0023507 | |||
| 1612 | Ga0496101_0102124 | |||
| 1613 | Ga0496101_0105784 | |||
| 1614 | Ga0496101_0129443 | |||
| 1615 | Ga0496101_0217872 | |||
| 1616 | Ga0496102_0004838 | |||
| 1617 | Ga0496102_0011960 | |||
| 1618 | Ga0496102_0087503 | |||
| 1619 | Ga0496102_0123366 | |||
| 1620 | Ga0496102_0137917 | |||
| 1621 | Ga0496102_0170979 | |||
| 1622 | Ga0496102_0177429 | |||
| 1623 | Ga0496102_0186465 | |||
| 1624 | Ga0496102_0604571 | |||
| 1625 | Ga0496103_0003298 | |||
| 1626 | Ga0496103_0006837 | |||
| 1627 | Ga0496103_0169529 | |||
| 1628 | Ga0496104_0025868 | |||
| 1629 | Ga0496104_0035607 | |||
| 1630 | Ga0496104_0076516 | |||
| 1631 | Ga0496104_0227228 | |||
| 1632 | Ga0496104_0525332 | |||
| 1633 | Ga0496105_0003270 | |||
| 1634 | Ga0496105_0008071 | |||
| 1635 | Ga0496105_0035620 | |||
| 1636 | Ga0496105_0086794 | |||
| 1637 | Ga0496105_0092267 | |||
| 1638 | Ga0496105_0269770 | |||
| 1639 | Ga0496106_0007673 | |||
| 1640 | Ga0496106_0024918 | |||
| 1641 | Ga0496106_0031302 | |||
| 1642 | Ga0496106_0036714 | |||
| 1643 | Ga0496106_0113195 | |||
| 1644 | Ga0496107_0000268 | |||
| 1645 | Ga0496107_0013083 | |||
| 1646 | Ga0496107_0020058 | |||
| 1647 | Ga0496107_0020818 | |||
| 1648 | Ga0496107_0041684 | |||
| 1649 | Ga0496108_0006255 | |||
| 1650 | Ga0496108_0030073 | |||
| 1651 | Ga0496108_0042610 | |||
| 1652 | Ga0496108_0157354 | |||
| 1653 | Ga0496108_0418410 | |||
| 1654 | Ga0496108_0456467 | |||
| 1655 | Ga0496109_0007775 | |||
| 1656 | Ga0496109_0014079 | |||
| 1657 | Ga0496109_0017745 | |||
| 1658 | Ga0496109_0030999 | |||
| 1659 | Ga0496109_0056632 | |||
| 1660 | Ga0496110_0007566 | |||
| 1661 | Ga0496110_0237524 | |||
| 1662 | Ga0496111_0003386 | |||
| 1663 | Ga0496111_0036621 | |||
| 1664 | Ga0496111_0077988 | |||
| 1665 | Ga0496111_0081631 | |||
| 1666 | Ga0496111_0098699 | |||
| 1667 | Ga0496112_0015561 | |||
| 1668 | Ga0496112_0050082 | |||
| 1669 | Ga0496112_0542228 | |||
| 1670 | Ga0496113_0004591 | |||
| 1671 | Ga0496113_0012044 | |||
| 1672 | Ga0496113_0013238 | |||
| 1673 | Ga0496113_0081277 | |||
| 1674 | Ga0496114_0006070 | |||
| 1675 | Ga0496114_0013910 | |||
| 1676 | Ga0496114_0054999 | |||
| 1677 | Ga0496114_0078890 | |||
| 1678 | Ga0496114_0159467 | |||
| 1679 | Ga0496115_0007708 | |||
| 1680 | Ga0496115_0023532 | |||
| 1681 | Ga0496115_0044766 | |||
| 1682 | Ga0496115_0057330 | |||
| 1683 | Ga0496115_0068127 | |||
| 1684 | Ga0496115_0079541 | |||
| 1685 | Ga0496115_0116473 | |||
| 1686 | Ga0496115_0147581 | |||
| 1687 | Ga0501032_0246083 | |||
| 1688 | Ga0501047_0013111 | |||
| 1689 | Ga0501047_0020566 | |||
| 1690 | Ga0501048_0001027 | |||
| 1691 | Ga0501067_0133151 | |||
| 1692 | Ga0501071_0305155 | |||
| 1693 | Ga0501073_0011617 | |||
| 1694 | Ga0501073_0029589 | |||
| 1695 | Ga0501073_0092884 | |||
| 1696 | Ga0501073_0115376 | |||
| 1697 | Ga0501074_0120577 | |||
| 1698 | Ga0501074_0133430 | |||
| 1699 | Ga0501074_0166265 | |||
| 1700 | Ga0501075_0140129 | |||
| 1701 | Ga0501076_0064664 | |||
| 1702 | Ga0501076_0257551 | |||
| 1703 | Ga0501079_0093957 | |||
| 1704 | Ga0501083_0008341 | |||
| 1705 | Ga0501083_0087378 | |||
| 1706 | Ga0501083_0098808 | |||
| 1707 | Ga0501044_0337958 | |||
| 1708 | nmdc:mga0yw44_123894_c1 | |||
| 1709 | nmdc:mga0yw44_71989_c1 | |||
| 1710 | nmdc:mga06z11_113322_c1 | |||
| 1711 | nmdc:mga06z11_150234_c1 | |||
| 1712 | nmdc:mga04h51_72047_c1 | |||
| 1713 | nmdc:mga07m45_200735_c1 | |||
| 1714 | nmdc:mga05p37_17539_c1 | |||
| 1715 | nmdc:mga05p37_32_c1 | |||
| 1716 | nmdc:mga05p37_37783_c1 | |||
| 1717 | nmdc:mga05p37_7011_c1 | |||
| 1718 | nmdc:mga09592_17661_c1 | |||
| 1719 | nmdc:mga0qj67_1044_c1 | |||
| 1720 | nmdc:mga0qj67_168_c1 | |||
| 1721 | nmdc:mga06r32_27457_c1 | |||
| 1722 | nmdc:mga06r32_6359_c1 | |||
| 1723 | nmdc:mga08y16_145757_c1 | |||
| 1724 | nmdc:mga08y16_2238_c1 | |||
| 1725 | nmdc:mga08y16_25498_c1 | |||
| 1726 | nmdc:mga08y16_338550_c1 | |||
| 1727 | nmdc:mga0n895_157336_c1 | |||
| 1728 | nmdc:mga0n895_332273_c1 | |||
| 1729 | nmdc:mga0n895_35212_c1 | |||
| 1730 | nmdc:mga0n895_422521_c1 | |||
| 1731 | nmdc:mga0n895_547_c1 | |||
| 1732 | nmdc:mga0n895_56841_c1 | |||
| 1733 | nmdc:mga0n895_80383_c1 | |||
| 1734 | nmdc:mga0rr50_129543_c1 | |||
| 1735 | nmdc:mga0rr50_21635_c1 | |||
| 1736 | nmdc:mga0rr50_230052_c1 | |||
| 1737 | nmdc:mga0rr50_36146_c1 | |||
| 1738 | nmdc:mga0rr50_4724_c1 | |||
| 1739 | nmdc:mga08x19_277418_c1 | |||
| 1740 | nmdc:mga08x19_62097_c1 | |||
| 1741 | nmdc:mga0a205_49524_c1 | |||
| 1742 | nmdc:mga0a205_51888_c1 | |||
| 1743 | nmdc:mga0a205_6205_c1 | |||
| 1744 | nmdc:mga0a205_629_c1 | |||
| 1745 | Ga0495601_0011745 | |||
| 1746 | Ga0495601_0099638 | |||
| 1747 | Ga0495601_0244195 | |||
| 1748 | Ga0495612_0001070 | |||
| 1749 | Ga0495612_0003633 | |||
| 1750 | Ga0495595_0002111 | |||
| 1751 | Ga0495595_0004363 | |||
| 1752 | Ga0495595_0080399 | |||
| 1753 | Ga0495619_0000670 | |||
| 1754 | Ga0495619_0048969 | |||
| 1755 | Ga0500643_002023 | |||
| 1756 | Ga0500644_0005103 | |||
| 1757 | Ga0500651_0019316 | |||
| 1758 | Ga0500566_0020233 | |||
| 1759 | Ga0500641_0032914 | |||
| 1760 | Ga0500595_000010 | |||
| 1761 | Ga0500652_000017 | |||
| 1762 | Ga0500652_007720 | |||
| 1763 | Ga0500658_0033235 | |||
| 1764 | Ga0500616_0000001 | |||
| 1765 | Ga0500636_0045514 | |||
| 1766 | Ga0500645_000051 | |||
| 1767 | Ga0500609_020253 | |||
| 1768 | Ga0501084_0203638 | |||
| 1769 | Ga0501084_0467401 | |||
| 1770 | Ga0501084_0536530 | |||
| 1771 | Ga0501082_0215258 | |||
| 1772 | Ga0501082_0385196 | |||
| 1773 | Ga0501082_0572265 | |||
| 1774 | Ga0530510_0049936 | |||
| 1775 | 2883296527 | |||
| 1776 | 2883359233 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5y8b-assembly1.cif.gz_A | periplasmic heme-binding protein rhut from roseiflexus sp. rs-1 in apo form | 0.8621 | 5 | 260 |
| 2r79-assembly1.cif.gz_A | crystal structure of a periplasmic heme binding protein from pseudomonas aeruginosa | 0.8586 | 4 | 258 |
| 4m7o-assembly1.cif.gz_A | the crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228. | 0.8582 | 3 | 256 |
| 5m29-assembly2.cif.gz_B | structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli | 0.8535 | 3 | 258 |
| 5m3b-assembly1.cif.gz_A | structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli | 0.8534 | 6 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r79A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9289 | 4 | 121 | 3.40.50.1980 |
| af_Q2G0F6_19_140_3.40.50.1980 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9169 | 5 | 121 | 3.40.50.1980 |
| 2rg7D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.911 | 5 | 121 | 3.40.50.1980 |
| 3pshA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9049 | 5 | 121 | 3.40.50.1980 |
| 5y8bA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.903 | 5 | 121 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q8M1G8-F1-model_v4 | Cobalamin-binding protein | 0.9949 | 2 | 260 |
GO:0071281
|
| AF-A0A4Q6GJA2-F1-model_v4 | Cobalamin-binding protein | 0.9947 | 140 | 266 |
|
| AF-A0A643FJS1-F1-model_v4 | ABC transporter substrate-binding protein | 0.9935 | 4 | 263 |
|
| AF-A0A2V8DVZ8-F1-model_v4 | Cobalamin-binding protein | 0.9921 | 2 | 258 |
|
| AF-A0A2N1WM62-F1-model_v4 | deleted | 0.9919 | 3 | 224 |
|