F484685

General Info

Members Datasets Scaffolds Average Seq Length
886 261 1772 147

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100006808|Ga0070671_1000068089
Length 179
Sequence MCLDKKVDTPHNRPYHWGLRLLAATQLVRPPKDSLFMRTFVASAKSAGSRWHVIDAKGQVLGRVATLAARLLQGKHKAIYTPFIDTGDHVVVVNAAEVKLTGRKEDQKVYRYHSGFEGGLREERAGVVRKRQPVRLVEEAVRGMLPKTKMGDAMYRKLKVYAGSDHPHAAQQPRKIEVA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
200 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
215 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
216 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 0.34
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 9.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100006808 3300005355 Bacteria 9148
2 ARcpr5yngRDRAFT_c003349 3300000043 Bacteria 1588
3 JGI24746J21847_1002952 3300001977 Bacteria 2677
4 JGI24745J21846_1007836 3300002073 Bacteria 1198
5 JGI24749J21850_1031950 3300002076 Bacteria 757
6 JGI24035J26624_1002635 3300002126 Bacteria 1673
7 JGI24034J26672_10009727 3300002239 Bacteria 1422
8 JGI24751J29686_10052708 3300002459 Unclassified 839
9 JGI24751J29686_10056795 3300002459 Bacteria 806
10 Ga0006778J45830_1074893 3300003162 Bacteria 599
11 JGI25406J46586_10003711 3300003203 Bacteria 7156
12 Ga0007417J51691_1063843 3300003544 Bacteria 949
13 Ga0007416J51690_1056399 3300003577 Unclassified 564
14 Ga0007429J51699_1076987 3300003579 Bacteria 1461
15 Ga0058859_10076617 3300004798 Bacteria 885
16 Ga0058859_10112349 3300004798 Bacteria 1363
17 Ga0058859_11488662 3300004798 Bacteria 666
18 Ga0058859_11663673 3300004798 Bacteria 676
19 Ga0058859_11758504 3300004798 Bacteria 1073
20 Ga0058861_11902789 3300004800 Bacteria 712
21 Ga0058860_10075353 3300004801 Bacteria 1803
22 Ga0058860_10145618 3300004801 Bacteria 615
23 Ga0058860_12002770 3300004801 Unclassified 538
24 Ga0058860_12031273 3300004801 Bacteria 680
25 Ga0058860_12072903 3300004801 Bacteria 1074
26 Ga0058860_12130607 3300004801 Bacteria 596
27 Ga0058862_12268440 3300004803 Bacteria 576
28 Ga0058862_12764431 3300004803 Bacteria 1039
29 Ga0058862_12805714 3300004803 Bacteria 1637
30 Ga0065714_10480246 3300005288 Bacteria 534
31 Ga0065704_10094226 3300005289 Bacteria 2554
32 Ga0065704_10095758 3300005289 Bacteria 2469
33 Ga0065704_10322344 3300005289 Bacteria 851
34 Ga0065704_10438106 3300005289 Bacteria 716
35 Ga0065704_10592871 3300005289 Bacteria 605
36 Ga0065712_10003855 3300005290 Bacteria 5392
37 Ga0065712_10006208 3300005290 Bacteria 4540
38 Ga0065712_10070291 3300005290 Bacteria 6142
39 Ga0065712_10070666 3300005290 Bacteria 5809
40 Ga0065712_10109991 3300005290 Bacteria 1845
41 Ga0065712_10123754 3300005290 Bacteria 1619
42 Ga0065712_10150889 3300005290 Bacteria 1362
43 Ga0065712_10209675 3300005290 Bacteria 1077
44 Ga0065712_10357833 3300005290 Bacteria 761
45 Ga0065712_10392173 3300005290 Bacteria 740
46 Ga0065715_10007986 3300005293 Bacteria 5169
47 Ga0065715_10008080 3300005293 Bacteria 4736
48 Ga0065715_10020916 3300005293 Unclassified 2539
49 Ga0065715_10124133 3300005293 Bacteria 2152
50 Ga0065715_10143316 3300005293 Bacteria 1822
51 Ga0065715_10258766 3300005293 Unclassified 1139
52 Ga0065715_10308589 3300005293 Bacteria 1025
53 Ga0065715_10343181 3300005293 Bacteria 935
54 Ga0065715_10547478 3300005293 Bacteria 733
55 Ga0065715_10728871 3300005293 Bacteria 640
56 Ga0065707_10005263 3300005295 Bacteria 3881
57 Ga0065707_10008765 3300005295 Bacteria 2558
58 Ga0065707_10162045 3300005295 Bacteria 1555
59 Ga0065707_10168664 3300005295 Bacteria 1502
60 Ga0065707_10374092 3300005295 Bacteria 886
61 Ga0070658_10330334 3300005327 Bacteria 1303
62 Ga0070676_10005855 3300005328 Bacteria 6560
63 Ga0070683_100000857 3300005329 Bacteria 22475
64 Ga0070683_100147764 3300005329 Bacteria 2228
65 Ga0070683_100958555 3300005329 Bacteria 821
66 Ga0070683_101170370 3300005329 Bacteria 739
67 Ga0070683_101433725 3300005329 Bacteria 664
68 Ga0070690_100067037 3300005330 Bacteria 2325
69 Ga0070690_100086091 3300005330 Bacteria 2062
70 Ga0070690_100137740 3300005330 Bacteria 1654
71 Ga0070690_100178665 3300005330 Bacteria 1465
72 Ga0070690_100270293 3300005330 Bacteria 1209
73 Ga0070690_100334650 3300005330 Bacteria 1095
74 Ga0070670_100011000 3300005331 Bacteria 7730
75 Ga0070670_100014108 3300005331 Bacteria 6854
76 Ga0070670_100015682 3300005331 Bacteria 6504
77 Ga0070670_100023037 3300005331 Bacteria 5358
78 Ga0070670_100305554 3300005331 Bacteria 1392
79 Ga0070670_100334986 3300005331 Bacteria 1327
80 Ga0070670_100717777 3300005331 Bacteria 899
81 Ga0070670_100841194 3300005331 Bacteria 830
82 Ga0070670_100975161 3300005331 Bacteria 770
83 Ga0070677_10003332 3300005333 Bacteria 5175
84 Ga0070677_10073554 3300005333 Bacteria 1444
85 Ga0070677_10089005 3300005333 Bacteria 1338
86 Ga0070677_10096231 3300005333 Bacteria 1297
87 Ga0070677_10352207 3300005333 Bacteria 763
88 Ga0068869_100006495 3300005334 Bacteria 7421
89 Ga0068869_100025663 3300005334 Bacteria 4094
90 Ga0068869_101219974 3300005334 Bacteria 661
91 Ga0068869_101317000 3300005334 Bacteria 637
92 Ga0068869_101626027 3300005334 Bacteria 576
93 Ga0070666_10003133 3300005335 Bacteria 10048
94 Ga0070666_10161604 3300005335 Bacteria 1566
95 Ga0070666_10205593 3300005335 Bacteria 1386
96 Ga0070666_10250146 3300005335 Bacteria 1255
97 Ga0070666_10433551 3300005335 Bacteria 948
98 Ga0070680_100810944 3300005336 Unclassified 806
99 Ga0070680_101307039 3300005336 Unclassified 628
100 Ga0070682_100388553 3300005337 Bacteria 1052
101 Ga0070682_100545974 3300005337 Unclassified 906
102 Ga0070682_100594422 3300005337 Bacteria 873
103 Ga0068868_100001652 3300005338 Bacteria 15233
104 Ga0068868_100152671 3300005338 Bacteria 1903
105 Ga0068868_100288776 3300005338 Unclassified 1390
106 Ga0068868_100451973 3300005338 Unclassified 1118
107 Ga0068868_100539542 3300005338 Bacteria 1026
108 Ga0070660_100345896 3300005339 Bacteria 1224
109 Ga0070660_100526596 3300005339 Bacteria 985
110 Ga0070660_101044553 3300005339 Bacteria 691
111 Ga0070689_100016249 3300005340 Bacteria 5443
112 Ga0070689_100020129 3300005340 Bacteria 4947
113 Ga0070689_100201197 3300005340 Bacteria 1626
114 Ga0070689_100219026 3300005340 Bacteria 1561
115 Ga0070689_100795014 3300005340 Unclassified 831
116 Ga0070689_101684361 3300005340 Bacteria 577
117 Ga0070691_10166940 3300005341 Bacteria 1138
118 Ga0070691_10404781 3300005341 Unclassified 770
119 Ga0070687_100036278 3300005343 Bacteria 2455
120 Ga0070687_100163315 3300005343 Bacteria 1318
121 Ga0070687_100171046 3300005343 Bacteria 1293
122 Ga0070687_100184043 3300005343 Bacteria 1253
123 Ga0070661_100035459 3300005344 Bacteria 3622
124 Ga0070661_100078927 3300005344 Bacteria 2428
125 Ga0070661_100369630 3300005344 Unclassified 1129
126 Ga0070692_10014680 3300005345 Bacteria 3686
127 Ga0070692_10463503 3300005345 Unclassified 814
128 Ga0070692_10938825 3300005345 Bacteria 601
129 Ga0070668_100104520 3300005347 Bacteria 2248
130 Ga0070668_100172421 3300005347 Bacteria 1762
131 Ga0070668_100205609 3300005347 Bacteria 1618
132 Ga0070668_100256345 3300005347 Bacteria 1453
133 Ga0070668_100306198 3300005347 Bacteria 1334
134 Ga0070668_100389346 3300005347 Bacteria 1188
135 Ga0070668_100861780 3300005347 Unclassified 808
136 Ga0070668_101376199 3300005347 Bacteria 643
137 Ga0070669_100002909 3300005353 Bacteria 12341
138 Ga0070669_100016666 3300005353 Bacteria 5244
139 Ga0070669_100047172 3300005353 Bacteria 3142
140 Ga0070669_100056942 3300005353 Bacteria 2867
141 Ga0070669_100100746 3300005353 Bacteria 2178
142 Ga0070669_100146819 3300005353 Bacteria 1823
143 Ga0070669_100443747 3300005353 Unclassified 1068
144 Ga0070669_100486622 3300005353 Bacteria 1022
145 Ga0070669_101678164 3300005353 Unclassified 554
146 Ga0070669_101805388 3300005353 Unclassified 533
147 Ga0070675_100001125 3300005354 Bacteria 19310
148 Ga0070675_100005228 3300005354 Bacteria 9906
149 Ga0070675_100028311 3300005354 Bacteria 4510
150 Ga0070675_100032755 3300005354 Bacteria 4207
151 Ga0070675_100091376 3300005354 Bacteria 2550
152 Ga0070675_100094782 3300005354 Bacteria 2505
153 Ga0070675_100165116 3300005354 Bacteria 1907
154 Ga0070675_100338965 3300005354 Bacteria 1331
155 Ga0070675_100381199 3300005354 Bacteria 1255
156 Ga0070675_100446940 3300005354 Bacteria 1159
157 Ga0070675_100480712 3300005354 Bacteria 1117
158 Ga0070675_100776735 3300005354 Bacteria 875
159 Ga0070675_100777668 3300005354 Unclassified 874
160 Ga0070675_100825993 3300005354 Bacteria 848
161 Ga0070675_100872889 3300005354 Bacteria 824
162 Ga0070675_101100490 3300005354 Bacteria 731
163 Ga0070675_101317001 3300005354 Unclassified 666
164 Ga0070675_101443451 3300005354 Unclassified 634
165 Ga0070671_100240377 3300005355 Bacteria 1537
166 Ga0070671_100386566 3300005355 Bacteria 1196
167 Ga0070671_100943150 3300005355 Unclassified 755
168 Ga0070671_100960856 3300005355 Bacteria 748
169 Ga0070674_100115425 3300005356 Bacteria 1979
170 Ga0070674_100420442 3300005356 Bacteria 1096
171 Ga0070674_100564244 3300005356 Bacteria 957
172 Ga0070674_100859322 3300005356 Bacteria 787
173 Ga0070673_100004179 3300005364 Bacteria 9107
174 Ga0070673_100017518 3300005364 Bacteria 5098
175 Ga0070673_100044423 3300005364 Bacteria 3440
176 Ga0070673_100083908 3300005364 Bacteria 2589
177 Ga0070673_100228227 3300005364 Bacteria 1614
178 Ga0070673_100232258 3300005364 Bacteria 1600
179 Ga0070673_100341975 3300005364 Bacteria 1326
180 Ga0070673_100345230 3300005364 Bacteria 1320
181 Ga0070673_100346926 3300005364 Bacteria 1317
182 Ga0070673_101188571 3300005364 Unclassified 714
183 Ga0070688_100002351 3300005365 Bacteria 9538
184 Ga0070688_100012388 3300005365 Bacteria 4777
185 Ga0070688_100122548 3300005365 Unclassified 1743
186 Ga0070688_100162894 3300005365 Bacteria 1533
187 Ga0070688_100316767 3300005365 Bacteria 1132
188 Ga0070688_100617472 3300005365 Unclassified 831
189 Ga0070688_101083287 3300005365 Bacteria 640
190 Ga0070659_100062552 3300005366 Bacteria 2943
191 Ga0070659_100077529 3300005366 Bacteria 2651
192 Ga0070659_100251203 3300005366 Bacteria 1466
193 Ga0070659_100289674 3300005366 Bacteria 1363
194 Ga0070667_100022611 3300005367 Bacteria 5213
195 Ga0070667_100073474 3300005367 Bacteria 2916
196 Ga0070667_100183950 3300005367 Bacteria 1849
197 Ga0070667_100381288 3300005367 Bacteria 1281
198 Ga0070667_101029737 3300005367 Bacteria 768
199 Ga0070667_101192663 3300005367 Bacteria 712
200 Ga0070667_101659913 3300005367 Bacteria 601
201 Ga0070701_10003090 3300005438 Bacteria 6523
202 Ga0070701_10004454 3300005438 Bacteria 5679
203 Ga0070701_10006684 3300005438 Bacteria 4868
204 Ga0070701_10010958 3300005438 Bacteria 4030
205 Ga0070701_10037088 3300005438 Bacteria 2460
206 Ga0070701_10149699 3300005438 Bacteria 1343
207 Ga0070701_10181803 3300005438 Bacteria 1231
208 Ga0070701_10199560 3300005438 Bacteria 1182
209 Ga0070701_10536996 3300005438 Unclassified 765
210 Ga0070701_10578838 3300005438 Bacteria 740
211 Ga0070701_10645657 3300005438 Bacteria 706
212 Ga0070705_100000076 3300005440 Bacteria 53948
213 Ga0070705_100009393 3300005440 Bacteria 4862
214 Ga0070705_100977453 3300005440 Bacteria 686
215 Ga0070700_100039578 3300005441 Bacteria 2881
216 Ga0070700_100046665 3300005441 Bacteria 2677
217 Ga0070700_100050416 3300005441 Bacteria 2588
218 Ga0070700_100050950 3300005441 Bacteria 2575
219 Ga0070700_100429066 3300005441 Bacteria 1001
220 Ga0070700_100478196 3300005441 Bacteria 954
221 Ga0070700_100681402 3300005441 Unclassified 815
222 Ga0070700_100910127 3300005441 Unclassified 717
223 Ga0070700_101684940 3300005441 Bacteria 544
224 Ga0070694_100030315 3300005444 Bacteria 3536
225 Ga0070694_100078952 3300005444 Bacteria 2284
226 Ga0070694_100090360 3300005444 Bacteria 2147
227 Ga0070694_100226790 3300005444 Bacteria 1404
228 Ga0070694_100591585 3300005444 Bacteria 892
229 Ga0070708_100261238 3300005445 Bacteria 1628
230 Ga0070708_101453835 3300005445 Unclassified 639
231 Ga0070708_101509066 3300005445 Bacteria 626
232 Ga0070663_100186786 3300005455 Bacteria 1611
233 Ga0070663_100194090 3300005455 Bacteria 1582
234 Ga0070663_100439379 3300005455 Bacteria 1073
235 Ga0070663_100636639 3300005455 Bacteria 900
236 Ga0070678_100074082 3300005456 Bacteria 2557
237 Ga0070678_100090564 3300005456 Bacteria 2345
238 Ga0070678_100221173 3300005456 Bacteria 1574
239 Ga0070678_100305149 3300005456 Bacteria 1354
240 Ga0070678_100331050 3300005456 Bacteria 1303
241 Ga0070678_100365421 3300005456 Bacteria 1244
242 Ga0070678_100393805 3300005456 Bacteria 1202
243 Ga0070678_100434777 3300005456 Bacteria 1146
244 Ga0070678_100529630 3300005456 Bacteria 1043
245 Ga0070662_100012481 3300005457 Bacteria 5634
246 Ga0070662_100135969 3300005457 Bacteria 1900
247 Ga0070662_100316083 3300005457 Unclassified 1272
248 Ga0070662_100356720 3300005457 Bacteria 1199
249 Ga0070662_100379701 3300005457 Bacteria 1163
250 Ga0070681_10005835 3300005458 Bacteria 11920
251 Ga0068867_100000885 3300005459 Bacteria 20261
252 Ga0068867_100004327 3300005459 Bacteria 9996
253 Ga0068867_100040168 3300005459 Bacteria 3412
254 Ga0068867_100053131 3300005459 Bacteria 2992
255 Ga0068867_100121596 3300005459 Bacteria 2019
256 Ga0068867_100520509 3300005459 Bacteria 1026
257 Ga0068867_100528309 3300005459 Bacteria 1018
258 Ga0070685_10045758 3300005466 Bacteria 2510
259 Ga0070685_10155309 3300005466 Bacteria 1454
260 Ga0070685_10239943 3300005466 Bacteria 1196
261 Ga0070685_10325275 3300005466 Bacteria 1043
262 Ga0070706_100106631 3300005467 Bacteria 2607
263 Ga0070706_100140600 3300005467 Bacteria 2254
264 Ga0070706_101887538 3300005467 Bacteria 542
265 Ga0070707_100069308 3300005468 Bacteria 3396
266 Ga0070707_100098727 3300005468 Bacteria 2828
267 Ga0070707_100333848 3300005468 Bacteria 1473
268 Ga0070707_100731026 3300005468 Bacteria 953
269 Ga0070707_101043883 3300005468 Bacteria 783
270 Ga0070698_100001357 3300005471 Bacteria 27226
271 Ga0070698_100006206 3300005471 Bacteria 13013
272 Ga0070698_100015602 3300005471 Bacteria 8023
273 Ga0070698_100428497 3300005471 Bacteria 1257
274 Ga0070698_100532823 3300005471 Bacteria 1113
275 Ga0070698_100758854 3300005471 Bacteria 913
276 Ga0070699_100000371 3300005518 Bacteria 43874
277 Ga0070699_100013938 3300005518 Bacteria 6914
278 Ga0070699_100019404 3300005518 Bacteria 5853
279 Ga0070684_100000384 3300005535 Bacteria 30726
280 Ga0070684_100043653 3300005535 Bacteria 3873
281 Ga0070697_100147002 3300005536 Bacteria 1985
282 Ga0070697_100251053 3300005536 Bacteria 1513
283 Ga0070697_100311290 3300005536 Bacteria 1355
284 Ga0070672_100003923 3300005543 Bacteria 9693
285 Ga0070672_100021515 3300005543 Bacteria 4722
286 Ga0070672_100066892 3300005543 Bacteria 2846
287 Ga0070672_100086226 3300005543 Bacteria 2525
288 Ga0070672_100107450 3300005543 Bacteria 2271
289 Ga0070672_100127690 3300005543 Bacteria 2087
290 Ga0070672_100137817 3300005543 Bacteria 2010
291 Ga0070672_100152982 3300005543 Bacteria 1909
292 Ga0070672_100169632 3300005543 Bacteria 1814
293 Ga0070672_100188530 3300005543 Unclassified 1721
294 Ga0070672_100233593 3300005543 Bacteria 1545
295 Ga0070672_100254807 3300005543 Bacteria 1479
296 Ga0070672_100272396 3300005543 Bacteria 1430
297 Ga0070672_100396882 3300005543 Bacteria 1182
298 Ga0070672_100504618 3300005543 Bacteria 1047
299 Ga0070672_100717698 3300005543 Bacteria 876
300 Ga0070686_100000959 3300005544 Bacteria 16611
301 Ga0070686_100023758 3300005544 Bacteria 3668
302 Ga0070686_100069370 3300005544 Bacteria 2302
303 Ga0070686_100214551 3300005544 Bacteria 1387
304 Ga0070686_100347074 3300005544 Bacteria 1114
305 Ga0070686_100543777 3300005544 Unclassified 907
306 Ga0070686_100963295 3300005544 Bacteria 698
307 Ga0070695_100000627 3300005545 Bacteria 18740
308 Ga0070695_100007666 3300005545 Bacteria 6394
309 Ga0070695_100014109 3300005545 Bacteria 4811
310 Ga0070696_100003302 3300005546 Bacteria 10767
311 Ga0070696_100017615 3300005546 Bacteria 4823
312 Ga0070696_100200752 3300005546 Bacteria 1489
313 Ga0070696_100380015 3300005546 Bacteria 1101
314 Ga0070693_100484268 3300005547 Unclassified 875
315 Ga0070665_100700833 3300005548 Bacteria 1026
316 Ga0070665_101182287 3300005548 Bacteria 776
317 Ga0070704_100002209 3300005549 Bacteria 10848
318 Ga0070704_100116080 3300005549 Bacteria 2046
319 Ga0070704_100134640 3300005549 Bacteria 1921
320 Ga0070704_100350230 3300005549 Bacteria 1246
321 Ga0070704_100356921 3300005549 Bacteria 1236
322 Ga0070704_100380185 3300005549 Bacteria 1199
323 Ga0070704_100481625 3300005549 Bacteria 1074
324 Ga0068855_101115262 3300005563 Bacteria 824
325 Ga0070664_100000442 3300005564 Bacteria 31212
326 Ga0070664_100005905 3300005564 Bacteria 9890
327 Ga0070664_100054873 3300005564 Bacteria 3382
328 Ga0070664_100074820 3300005564 Unclassified 2907
329 Ga0070664_100084187 3300005564 Bacteria 2745
330 Ga0070664_100194747 3300005564 Bacteria 1807
331 Ga0070664_100404980 3300005564 Bacteria 1248
332 Ga0070664_102231043 3300005564 Unclassified 519
333 Ga0068857_100033490 3300005577 Bacteria 4544
334 Ga0068857_100135944 3300005577 Bacteria 2219
335 Ga0068857_100313554 3300005577 Bacteria 1447
336 Ga0068857_100435149 3300005577 Bacteria 1225
337 Ga0068857_100653394 3300005577 Bacteria 997
338 Ga0068857_100814875 3300005577 Bacteria 892
339 Ga0068857_100987340 3300005577 Unclassified 810
340 Ga0068857_101383516 3300005577 Bacteria 684
341 Ga0068854_100022324 3300005578 Bacteria 4308
342 Ga0068854_100250909 3300005578 Bacteria 1413
343 Ga0068854_100427354 3300005578 Bacteria 1102
344 Ga0068856_101586238 3300005614 Unclassified 668
345 Ga0070702_100146441 3300005615 Bacteria 1511
346 Ga0070702_100182026 3300005615 Bacteria 1376
347 Ga0070702_100958674 3300005615 Bacteria 674
348 Ga0070702_101108495 3300005615 Bacteria 633
349 Ga0068852_100464805 3300005616 Bacteria 1255
350 Ga0068852_100951526 3300005616 Unclassified 877
351 Ga0068859_100018030 3300005617 Bacteria 7094
352 Ga0068859_100042321 3300005617 Bacteria 4575
353 Ga0068859_100058899 3300005617 Bacteria 3869
354 Ga0068859_100070054 3300005617 Bacteria 3542
355 Ga0068859_100112648 3300005617 Bacteria 2784
356 Ga0068859_100200258 3300005617 Bacteria 2081
357 Ga0068859_100298806 3300005617 Bacteria 1703
358 Ga0068859_100523525 3300005617 Bacteria 1281
359 Ga0068859_100624742 3300005617 Bacteria 1170
360 Ga0068859_100862757 3300005617 Unclassified 991
361 Ga0068859_101424120 3300005617 Unclassified 764
362 Ga0068859_102284160 3300005617 Bacteria 597
363 Ga0068864_100031425 3300005618 Bacteria 4505
364 Ga0068864_100050967 3300005618 Bacteria 3564
365 Ga0068864_100170387 3300005618 Bacteria 1985
366 Ga0068864_100184609 3300005618 Bacteria 1908
367 Ga0068864_100192204 3300005618 Bacteria 1872
368 Ga0068864_100300623 3300005618 Bacteria 1502
369 Ga0068864_100338360 3300005618 Bacteria 1417
370 Ga0068864_100391150 3300005618 Bacteria 1320
371 Ga0068864_100490152 3300005618 Bacteria 1181
372 Ga0068864_100501380 3300005618 Bacteria 1168
373 Ga0068864_100706926 3300005618 Bacteria 985
374 Ga0068861_100023958 3300005719 Bacteria 4408
375 Ga0068861_100085804 3300005719 Bacteria 2473
376 Ga0068861_100101462 3300005719 Bacteria 2289
377 Ga0068861_100104975 3300005719 Bacteria 2255
378 Ga0068861_100290711 3300005719 Bacteria 1411
379 Ga0068861_100501259 3300005719 Bacteria 1097
380 Ga0068861_100623590 3300005719 Unclassified 993
381 Ga0068861_100895685 3300005719 Unclassified 840
382 Ga0068861_100967561 3300005719 Bacteria 810
383 Ga0068861_102375838 3300005719 Bacteria 533
384 Ga0068851_10450164 3300005834 Bacteria 765
385 Ga0068870_10008497 3300005840 Bacteria 4622
386 Ga0068870_10011633 3300005840 Bacteria 4088
387 Ga0068870_10131662 3300005840 Bacteria 1453
388 Ga0068870_10165695 3300005840 Bacteria 1315
389 Ga0068870_10377189 3300005840 Bacteria 917
390 Ga0068870_10678652 3300005840 Unclassified 709
391 Ga0068863_100006615 3300005841 Bacteria 11377
392 Ga0068863_100118121 3300005841 Bacteria 2527
393 Ga0068863_100209356 3300005841 Bacteria 1877
394 Ga0068863_100390445 3300005841 Bacteria 1360
395 Ga0068863_100432211 3300005841 Bacteria 1290
396 Ga0068863_101326905 3300005841 Bacteria 727
397 Ga0068858_100044197 3300005842 Bacteria 4130
398 Ga0068858_100546172 3300005842 Bacteria 1122
399 Ga0068860_100007521 3300005843 Bacteria 10900
400 Ga0068860_100021507 3300005843 Bacteria 6246
401 Ga0068860_100148866 3300005843 Bacteria 2253
402 Ga0068860_100471103 3300005843 Bacteria 1251
403 Ga0068860_100692914 3300005843 Bacteria 1028
404 Ga0068860_102478101 3300005843 Unclassified 538
405 Ga0068862_100186013 3300005844 Bacteria 1866
406 Ga0068862_100410461 3300005844 Bacteria 1269
407 Ga0081539_10000090 3300005985 Bacteria 212006
408 Ga0081539_10000558 3300005985 Bacteria 77001
409 Ga0081539_10001150 3300005985 Bacteria 47947
410 Ga0081539_10060678 3300005985 Unclassified 2075
411 Ga0075364_10120401 3300006051 Bacteria 1757
412 Ga0075364_10270860 3300006051 Unclassified 1155
413 Ga0075364_10405304 3300006051 Unclassified 931
414 Ga0075364_10629150 3300006051 Bacteria 733
415 Ga0075432_10130958 3300006058 Bacteria 950
416 Ga0075432_10184636 3300006058 Bacteria 818
417 Ga0075432_10384005 3300006058 Unclassified 603
418 Ga0070712_101952649 3300006175 Bacteria 514
419 Ga0075362_10240937 3300006177 Unclassified 888
420 Ga0075366_10171391 3300006195 Bacteria 1317
421 Ga0097621_100030713 3300006237 Bacteria 4257
422 Ga0097621_100037128 3300006237 Unclassified 3901
423 Ga0097621_100070007 3300006237 Bacteria 2897
424 Ga0097621_100112574 3300006237 Bacteria 2301
425 Ga0068871_100052850 3300006358 Bacteria 3291
426 Ga0068871_100081886 3300006358 Bacteria 2675
427 Ga0068871_100241168 3300006358 Bacteria 1571
428 Ga0068871_100259384 3300006358 Bacteria 1516
429 Ga0075428_100000778 3300006844 Bacteria 33262
430 Ga0075428_100001358 3300006844 Bacteria 25978
431 Ga0075428_100012638 3300006844 Bacteria 9387
432 Ga0075428_100174740 3300006844 Bacteria 2327
433 Ga0075428_100197964 3300006844 Bacteria 2173
434 Ga0075428_100217362 3300006844 Bacteria 2064
435 Ga0075428_100338635 3300006844 Bacteria 1616
436 Ga0075428_100341442 3300006844 Bacteria 1608
437 Ga0075428_100344167 3300006844 Bacteria 1601
438 Ga0075428_100490600 3300006844 Bacteria 1314
439 Ga0075428_100520209 3300006844 Bacteria 1273
440 Ga0075428_100547556 3300006844 Bacteria 1237
441 Ga0075428_100726864 3300006844 Bacteria 1057
442 Ga0075430_100000569 3300006846 Bacteria 28027
443 Ga0075430_100002777 3300006846 Bacteria 14635
444 Ga0075430_100003418 3300006846 Bacteria 13271
445 Ga0075430_100006873 3300006846 Bacteria 9594
446 Ga0075430_100012378 3300006846 Bacteria 7256
447 Ga0075430_100018937 3300006846 Bacteria 5857
448 Ga0075430_100390859 3300006846 Unclassified 1148
449 Ga0075431_100003313 3300006847 Bacteria 15598
450 Ga0075431_100004064 3300006847 Bacteria 14265
451 Ga0075431_100009235 3300006847 Bacteria 9896
452 Ga0075431_100028120 3300006847 Bacteria 5773
453 Ga0075431_100063209 3300006847 Bacteria 3820
454 Ga0075431_100116010 3300006847 Bacteria 2764
455 Ga0075431_100190458 3300006847 Bacteria 2102
456 Ga0075431_100275704 3300006847 Bacteria 1703
457 Ga0075431_100301822 3300006847 Bacteria 1617
458 Ga0075431_100316486 3300006847 Bacteria 1574
459 Ga0075431_100504645 3300006847 Bacteria 1200
460 Ga0075431_101282270 3300006847 Unclassified 694
461 Ga0075433_10013717 3300006852 Bacteria 6600
462 Ga0075433_10023108 3300006852 Bacteria 5229
463 Ga0075433_10075217 3300006852 Bacteria 2972
464 Ga0075433_10186706 3300006852 Bacteria 1844
465 Ga0075433_10280248 3300006852 Bacteria 1477
466 Ga0075433_10447489 3300006852 Bacteria 1139
467 Ga0075433_10754485 3300006852 Bacteria 851
468 Ga0075433_11276673 3300006852 Bacteria 636
469 Ga0075433_11401829 3300006852 Bacteria 604
470 Ga0075434_100000096 3300006871 Bacteria 48926
471 Ga0075434_100007147 3300006871 Bacteria 10319
472 Ga0075434_100016254 3300006871 Bacteria 7152
473 Ga0075434_100037300 3300006871 Bacteria 4812
474 Ga0075434_100108898 3300006871 Bacteria 2780
475 Ga0075434_100890634 3300006871 Unclassified 905
476 Ga0075434_101162964 3300006871 Unclassified 784
477 Ga0075434_102086941 3300006871 Bacteria 571
478 Ga0075429_100006960 3300006880 Bacteria 9827
479 Ga0075429_100009492 3300006880 Bacteria 8441
480 Ga0075429_100014249 3300006880 Bacteria 6894
481 Ga0075429_100014471 3300006880 Bacteria 6837
482 Ga0075429_100018543 3300006880 Bacteria 6026
483 Ga0075429_100031433 3300006880 Bacteria 4614
484 Ga0075429_100043782 3300006880 Bacteria 3895
485 Ga0075429_100049016 3300006880 Bacteria 3672
486 Ga0075429_100049050 3300006880 Bacteria 3671
487 Ga0075429_100162042 3300006880 Unclassified 1959
488 Ga0075429_100175669 3300006880 Bacteria 1876
489 Ga0075429_100245880 3300006880 Bacteria 1566
490 Ga0075429_100283142 3300006880 Bacteria 1452
491 Ga0075429_101212611 3300006880 Bacteria 659
492 Ga0075429_101222845 3300006880 Bacteria 656
493 Ga0068865_100013019 3300006881 Bacteria 5245
494 Ga0068865_100040123 3300006881 Bacteria 3179
495 Ga0068865_100192676 3300006881 Bacteria 1578
496 Ga0068865_100193232 3300006881 Bacteria 1575
497 Ga0068865_100534751 3300006881 Unclassified 982
498 Ga0068865_100811933 3300006881 Bacteria 808
499 Ga0068865_101018360 3300006881 Unclassified 726
500 Ga0075436_100320839 3300006914 Bacteria 1113
501 Ga0097620_100018031 3300006931 Bacteria 7094
502 Ga0097620_100042321 3300006931 Bacteria 4575
503 Ga0097620_100058901 3300006931 Bacteria 3869
504 Ga0097620_100070054 3300006931 Bacteria 3542
505 Ga0097620_100112650 3300006931 Bacteria 2784
506 Ga0097620_100200253 3300006931 Bacteria 2081
507 Ga0097620_100298804 3300006931 Bacteria 1703
508 Ga0097620_100523533 3300006931 Bacteria 1281
509 Ga0097620_100562396 3300006931 Bacteria 1235
510 Ga0097620_100624732 3300006931 Bacteria 1170
511 Ga0097620_100862868 3300006931 Unclassified 991
512 Ga0097620_102284161 3300006931 Bacteria 597
513 Ga0075435_100102441 3300007076 Bacteria 2373
514 Ga0075435_100129908 3300007076 Bacteria 2108
515 Ga0075435_100179133 3300007076 Bacteria 1791
516 Ga0075435_100204308 3300007076 Bacteria 1674
517 Ga0075435_100220392 3300007076 Bacteria 1611
518 Ga0105250_10288492 3300009092 Bacteria 707
519 Ga0105250_10326488 3300009092 Bacteria 668
520 Ga0111539_10000311 3300009094 Bacteria 59311
521 Ga0111539_10000556 3300009094 Bacteria 47801
522 Ga0111539_10003416 3300009094 Bacteria 20919
523 Ga0111539_10005129 3300009094 Bacteria 16987
524 Ga0111539_10010487 3300009094 Bacteria 11660
525 Ga0111539_10031982 3300009094 Bacteria 6392
526 Ga0111539_10053659 3300009094 Bacteria 4798
527 Ga0111539_10069197 3300009094 Bacteria 4168
528 Ga0111539_10105561 3300009094 Bacteria 3305
529 Ga0111539_10309025 3300009094 Bacteria 1840
530 Ga0111539_10412745 3300009094 Bacteria 1572
531 Ga0111539_10673101 3300009094 Bacteria 1205
532 Ga0111539_10702662 3300009094 Unclassified 1177
533 Ga0111539_10835677 3300009094 Bacteria 1071
534 Ga0111539_11159067 3300009094 Unclassified 898
535 Ga0111539_11194065 3300009094 Bacteria 884
536 Ga0111539_12337924 3300009094 Unclassified 620
537 Ga0111539_12408846 3300009094 Bacteria 611
538 Ga0111539_12972871 3300009094 Unclassified 548
539 Ga0105245_10293768 3300009098 Bacteria 1592
540 Ga0105245_10429681 3300009098 Bacteria 1325
541 Ga0105245_10498559 3300009098 Bacteria 1233
542 Ga0105245_11926628 3300009098 Bacteria 644
543 Ga0105245_12387346 3300009098 Bacteria 582
544 Ga0105247_10142865 3300009101 Bacteria 1570
545 Ga0105247_10968119 3300009101 Bacteria 662
546 Ga0114129_10000174 3300009147 Bacteria 70648
547 Ga0114129_10000453 3300009147 Bacteria 48900
548 Ga0114129_10001428 3300009147 Bacteria 32267
549 Ga0114129_10001507 3300009147 Bacteria 31514
550 Ga0114129_10006234 3300009147 Bacteria 16903
551 Ga0114129_10008028 3300009147 Bacteria 15034
552 Ga0114129_10014525 3300009147 Bacteria 11222
553 Ga0114129_10039729 3300009147 Bacteria 6636
554 Ga0114129_10042611 3300009147 Bacteria 6390
555 Ga0114129_10045746 3300009147 Bacteria 6151
556 Ga0114129_10051617 3300009147 Bacteria 5773
557 Ga0114129_10097009 3300009147 Bacteria 4081
558 Ga0114129_10122808 3300009147 Bacteria 3573
559 Ga0114129_10134210 3300009147 Bacteria 3397
560 Ga0114129_10232946 3300009147 Bacteria 2479
561 Ga0114129_10465212 3300009147 Bacteria 1657
562 Ga0114129_10519284 3300009147 Bacteria 1553
563 Ga0114129_10572062 3300009147 Bacteria 1467
564 Ga0114129_10832440 3300009147 Unclassified 1175
565 Ga0114129_10887574 3300009147 Bacteria 1131
566 Ga0114129_12313802 3300009147 Bacteria 645
567 Ga0114129_12524181 3300009147 Bacteria 614
568 Ga0105243_10238046 3300009148 Bacteria 1618
569 Ga0105243_10394487 3300009148 Bacteria 1284
570 Ga0105243_10923160 3300009148 Bacteria 870
571 Ga0105243_10935875 3300009148 Bacteria 865
572 Ga0105243_10999925 3300009148 Bacteria 839
573 Ga0105243_12078806 3300009148 Bacteria 603
574 Ga0105241_10798651 3300009174 Bacteria 869
575 Ga0105241_11610686 3300009174 Unclassified 628
576 Ga0105242_10051025 3300009176 Bacteria 3370
577 Ga0105242_10179556 3300009176 Bacteria 1867
578 Ga0105242_10632897 3300009176 Bacteria 1038
579 Ga0105242_10963372 3300009176 Bacteria 858
580 Ga0105242_12029424 3300009176 Unclassified 618
581 Ga0105248_10038996 3300009177 Bacteria 5319
582 Ga0105248_10205821 3300009177 Bacteria 2217
583 Ga0105248_10340135 3300009177 Bacteria 1690
584 Ga0105248_10781889 3300009177 Bacteria 1077
585 Ga0105248_10958158 3300009177 Bacteria 966
586 Ga0105248_11315223 3300009177 Bacteria 818
587 Ga0105237_10440339 3300009545 Bacteria 1309
588 Ga0105238_10037296 3300009551 Bacteria 4941
589 Ga0105249_10001486 3300009553 Bacteria 20547
590 Ga0105249_10007331 3300009553 Bacteria 9615
591 Ga0105249_10494333 3300009553 Bacteria 1268
592 Ga0105249_10786454 3300009553 Bacteria 1015
593 Ga0105249_11545352 3300009553 Bacteria 736
594 Ga0105239_10612212 3300010375 Bacteria 1243
595 Ga0105239_12190408 3300010375 Bacteria 643
596 Ga0105246_10051919 3300011119 Bacteria 2816
597 Ga0105246_10301677 3300011119 Bacteria 1293
598 Ga0105246_10326461 3300011119 Bacteria 1249
599 Ga0105246_10782301 3300011119 Bacteria 845
600 Ga0157374_10164753 3300013296 Bacteria 2160
601 Ga0157374_10208790 3300013296 Bacteria 1914
602 Ga0157374_10217476 3300013296 Bacteria 1874
603 Ga0157374_10236271 3300013296 Bacteria 1796
604 Ga0157374_11488550 3300013296 Unclassified 700
605 Ga0157378_10068524 3300013297 Bacteria 3182
606 Ga0157378_10183746 3300013297 Bacteria 1968
607 Ga0163162_10018956 3300013306 Bacteria 6748
608 Ga0163162_10391958 3300013306 Bacteria 1521
609 Ga0163162_10863479 3300013306 Bacteria 1020
610 Ga0157372_10539206 3300013307 Bacteria 1360
611 Ga0157375_10021929 3300013308 Bacteria 5870
612 Ga0157375_10037412 3300013308 Bacteria 4650
613 Ga0157375_10069408 3300013308 Bacteria 3530
614 Ga0157375_10159205 3300013308 Bacteria 2399
615 Ga0157375_10605409 3300013308 Bacteria 1255
616 Ga0157375_11001763 3300013308 Unclassified 975
617 Ga0157375_11351776 3300013308 Unclassified 838
618 Ga0157375_12450100 3300013308 Bacteria 623
619 Ga0163163_10008652 3300014325 Bacteria 9053
620 Ga0163163_10025072 3300014325 Bacteria 5681
621 Ga0163163_10087359 3300014325 Bacteria 3128
622 Ga0163163_10108874 3300014325 Bacteria 2798
623 Ga0163163_10118733 3300014325 Bacteria 2677
624 Ga0163163_10259333 3300014325 Bacteria 1789
625 Ga0163163_10543879 3300014325 Bacteria 1224
626 Ga0157380_10006529 3300014326 Bacteria 8225
627 Ga0157380_10055548 3300014326 Bacteria 3145
628 Ga0157380_10233281 3300014326 Bacteria 1654
629 Ga0157380_10277324 3300014326 Bacteria 1532
630 Ga0157380_10346212 3300014326 Bacteria 1389
631 Ga0157380_10374277 3300014326 Bacteria 1342
632 Ga0157380_10460398 3300014326 Bacteria 1224
633 Ga0157380_10569399 3300014326 Bacteria 1115
634 Ga0157380_10682695 3300014326 Unclassified 1029
635 Ga0157380_10727466 3300014326 Bacteria 1001
636 Ga0157380_11039992 3300014326 Unclassified 855
637 Ga0157380_11406499 3300014326 Bacteria 748
638 Ga0157380_11689449 3300014326 Bacteria 690
639 Ga0157380_11737267 3300014326 Bacteria 682
640 Ga0182008_10102130 3300014497 Bacteria 1418
641 Ga0157377_10002798 3300014745 Bacteria 7775
642 Ga0157377_10012987 3300014745 Bacteria 4204
643 Ga0157377_10029341 3300014745 Bacteria 2969
644 Ga0157377_10050653 3300014745 Bacteria 2339
645 Ga0157377_10151182 3300014745 Bacteria 1435
646 Ga0157377_10297967 3300014745 Bacteria 1063
647 Ga0157379_10523771 3300014968 Bacteria 1101
648 Ga0157379_10547274 3300014968 Bacteria 1077
649 Ga0157376_10052864 3300014969 Bacteria 3380
650 Ga0157376_10072440 3300014969 Bacteria 2931
651 Ga0157376_10137687 3300014969 Bacteria 2187
652 Ga0157376_10448777 3300014969 Bacteria 1257
653 Ga0157376_10718980 3300014969 Bacteria 1005
654 Ga0157376_10915938 3300014969 Bacteria 895
655 Ga0157376_11648321 3300014969 Unclassified 676
656 Ga0206353_10662909 3300020082 Bacteria 583
657 Ga0207666_1027012 3300025271 Bacteria 867
658 Ga0207673_1003013 3300025290 Bacteria 1953
659 Ga0207697_10001427 3300025315 Bacteria 13067
660 Ga0207697_10043535 3300025315 Bacteria 1846
661 Ga0207656_10018782 3300025321 Bacteria 2726
662 Ga0207682_10041929 3300025893 Bacteria 1869
663 Ga0207710_10343378 3300025900 Bacteria 759
664 Ga0207688_10035561 3300025901 Bacteria 2760
665 Ga0207688_10060015 3300025901 Bacteria 2142
666 Ga0207688_10292524 3300025901 Bacteria 994
667 Ga0207680_10889717 3300025903 Bacteria 638
668 Ga0207645_10006662 3300025907 Bacteria 8248
669 Ga0207645_10008924 3300025907 Bacteria 6964
670 Ga0207643_10001047 3300025908 Bacteria 16402
671 Ga0207643_10061467 3300025908 Bacteria 2145
672 Ga0207662_10024202 3300025918 Bacteria 3494
673 Ga0207657_10247196 3300025919 Bacteria 1423
674 Ga0207649_10012964 3300025920 Bacteria 4645
675 Ga0207652_11457254 3300025921 Unclassified 588
676 Ga0207681_10030741 3300025923 Bacteria 3503
677 Ga0207681_10114257 3300025923 Bacteria 1969
678 Ga0207681_10202214 3300025923 Bacteria 1526
679 Ga0207681_10533164 3300025923 Unclassified 964
680 Ga0207694_10036129 3300025924 Bacteria 3791
681 Ga0207650_10009096 3300025925 Bacteria 6788
682 Ga0207650_10132917 3300025925 Bacteria 1949
683 Ga0207659_10002934 3300025926 Bacteria 10162
684 Ga0207659_10011245 3300025926 Bacteria 5650
685 Ga0207659_10311765 3300025926 Bacteria 1296
686 Ga0207659_10507785 3300025926 Bacteria 1021
687 Ga0207659_11578474 3300025926 Unclassified 560
688 Ga0207644_10028840 3300025931 Bacteria 3846
689 Ga0207644_10030496 3300025931 Bacteria 3751
690 Ga0207690_10327094 3300025932 Bacteria 1206
691 Ga0207706_10505320 3300025933 Bacteria 1043
692 Ga0207686_10136731 3300025934 Bacteria 1688
693 Ga0207709_10032782 3300025935 Bacteria 3045
694 Ga0207670_10191452 3300025936 Bacteria 1548
695 Ga0207669_10227181 3300025937 Bacteria 1374
696 Ga0207669_10364281 3300025937 Bacteria 1121
697 Ga0207704_10002986 3300025938 Bacteria 7651
698 Ga0207691_10219809 3300025940 Bacteria 1648
699 Ga0207691_10313968 3300025940 Bacteria 1345
700 Ga0207661_10793844 3300025944 Bacteria 872
701 Ga0207679_10008779 3300025945 Bacteria 6446
702 Ga0207679_10068698 3300025945 Bacteria 2663
703 Ga0207679_10407993 3300025945 Bacteria 1196
704 Ga0207651_10129112 3300025960 Bacteria 1931
705 Ga0207640_10457498 3300025981 Bacteria 1053
706 Ga0207658_10846678 3300025986 Unclassified 831
707 Ga0207677_10062701 3300026023 Bacteria 2580
708 Ga0207677_10096506 3300026023 Bacteria 2163
709 Ga0207677_10342839 3300026023 Bacteria 1249
710 Ga0207677_10456109 3300026023 Bacteria 1096
711 Ga0207703_10036382 3300026035 Bacteria 3918
712 Ga0207703_10066926 3300026035 Bacteria 2956
713 Ga0207703_10282745 3300026035 Bacteria 1507
714 Ga0207678_10231548 3300026067 Bacteria 1582
715 Ga0207678_10741517 3300026067 Bacteria 866
716 Ga0207708_10000967 3300026075 Bacteria 21533
717 Ga0207702_11432356 3300026078 Unclassified 685
718 Ga0207641_10094459 3300026088 Bacteria 2623
719 Ga0207641_10192213 3300026088 Bacteria 1877
720 Ga0207641_10205734 3300026088 Bacteria 1817
721 Ga0207648_10000077 3300026089 Bacteria 93009
722 Ga0207648_10532672 3300026089 Bacteria 1077
723 Ga0207648_10923613 3300026089 Unclassified 816
724 Ga0207676_11234941 3300026095 Bacteria 741
725 Ga0207674_10024787 3300026116 Bacteria 6403
726 Ga0207674_10382055 3300026116 Bacteria 1361
727 Ga0207674_10860556 3300026116 Unclassified 874
728 Ga0207675_100037149 3300026118 Bacteria 4543
729 Ga0207675_101480982 3300026118 Bacteria 699
730 Ga0207683_10017764 3300026121 Bacteria 6066
731 Ga0207698_12381508 3300026142 Bacteria 541
732 Ga0209999_1111361 3300027543 Bacteria 535
733 Ga0207428_10000902 3300027907 Bacteria 33198
734 Ga0207428_10052520 3300027907 Bacteria 3254
735 Ga0268266_10218629 3300028379 Bacteria 1750
736 Ga0268266_10767080 3300028379 Unclassified 931
737 Ga0268265_10444716 3300028380 Bacteria 1209
738 Ga0268265_10851003 3300028380 Bacteria 892
739 Ga0268265_11137780 3300028380 Unclassified 776
740 Ga0268264_10328976 3300028381 Bacteria 1447
741 Ga0307408_100031040 3300031548 Bacteria 3716
742 Ga0307408_100111627 3300031548 Bacteria 2101
743 Ga0307408_100506923 3300031548 Bacteria 1057
744 Ga0307408_100831316 3300031548 Bacteria 840
745 Ga0307405_10040983 3300031731 Bacteria 2808
746 Ga0307413_10284749 3300031824 Bacteria 1245
747 Ga0307406_10153007 3300031901 Bacteria 1648
748 Ga0307406_10188979 3300031901 Bacteria 1506
749 Ga0307407_10022841 3300031903 Bacteria 3253
750 Ga0307412_10106312 3300031911 Bacteria 1995
751 Ga0307409_100210850 3300031995 Bacteria 1746
752 Ga0307416_100046423 3300032002 Bacteria 3427
753 Ga0307414_11124712 3300032004 Bacteria 726
754 Ga0307411_10121314 3300032005 Bacteria 1892
755 Ga0307411_10384887 3300032005 Bacteria 1155
756 Ga0307411_10869074 3300032005 Bacteria 799
757 Ga0307415_100485718 3300032126 Bacteria 1076
758 Ga0373938_0071501 3300034957 Bacteria 830
759 Ga0373940_0183607 3300035088 Bacteria 681
760 Ga0373945_0030931 3300035116 Bacteria 1889
761 Ga0373943_0132080 3300035170 Bacteria 1337
762 Ga0373947_0270823 3300035725 Bacteria 1127
763 Ga0439447_122132 3300041407 Bacteria 598
764 Ga0451800_1154454 3300041459 Bacteria 1155
765 Ga0451802_0771090 3300041460 Bacteria 538
766 Ga0451849_0193849 3300041505 Bacteria 952
767 Ga0439431_0140285 3300041997 Bacteria 683
768 Ga0439441_019166 3300042001 Bacteria 1242
769 Ga0439441_025980 3300042001 Bacteria 1109
770 Ga0450920_075485 3300042122 Bacteria 688
771 Ga0450896_038705 3300042133 Unclassified 738
772 Ga0439434_0026884 3300042435 Bacteria 1738
773 Ga0439464_0006755 3300042439 Bacteria 2991
774 Ga0439460_0032735 3300042461 Bacteria 1490
775 Ga0451577_0405207 3300042876 Bacteria 1238
776 Ga0453684_0115095 3300044712 Bacteria 3259
777 Ga0453684_0139840 3300044712 Bacteria 2893
778 Ga0496108_0330485 3300048911 Bacteria 1329
779 Ga0501309_022053 3300049129 Bacteria 899
780 Ga0501305_041751 3300049161 Bacteria 748
781 Ga0501307_032624 3300049162 Unclassified 728
782 Ga0501307_038734 3300049162 Bacteria 686
783 Ga0501292_112120 3300049515 Bacteria 550
784 Ga0501303_036006 3300049526 Bacteria 599
785 Ga0501311_017015 3300049527 Bacteria 953
786 Ga0501312_075771 3300049528 Unclassified 602
787 Ga0501031_0941047 3300049568 Bacteria 553
788 Ga0501032_0349300 3300049569 Bacteria 953
789 Ga0501033_0143331 3300049570 Bacteria 1727
790 Ga0501036_0120936 3300049572 Bacteria 2211
791 Ga0501036_0182526 3300049572 Bacteria 1766
792 Ga0501036_0520583 3300049572 Bacteria 989
793 Ga0501037_0120064 3300049573 Bacteria 1891
794 Ga0501037_0313930 3300049573 Bacteria 1086
795 Ga0501038_0045056 3300049574 Bacteria 3830
796 Ga0501038_0161611 3300049574 Bacteria 1820
797 Ga0501039_0099672 3300049575 Bacteria 2267
798 Ga0501039_0301866 3300049575 Bacteria 1259
799 Ga0501040_0003367 3300049576 Bacteria 10320
800 Ga0501040_0153410 3300049576 Bacteria 1626
801 Ga0501040_0192177 3300049576 Bacteria 1449
802 Ga0501041_0047880 3300049577 Bacteria 2603
803 Ga0501042_0017095 3300049578 Bacteria 4997
804 Ga0501042_0413463 3300049578 Bacteria 977
805 Ga0501046_0045279 3300049580 Bacteria 3496
806 Ga0501046_0075123 3300049580 Bacteria 2621
807 Ga0501046_0272021 3300049580 Bacteria 1242
808 Ga0501048_0082570 3300049582 Bacteria 2267
809 Ga0501048_0412529 3300049582 Bacteria 966
810 Ga0501067_0044387 3300049583 Bacteria 2470
811 Ga0501070_1100548 3300049586 Bacteria 613
812 Ga0501071_0083024 3300049587 Bacteria 2347
813 Ga0501071_0143477 3300049587 Bacteria 1779
814 Ga0501071_0157461 3300049587 Bacteria 1696
815 Ga0501072_0003814 3300049588 Bacteria 11378
816 Ga0501072_0067708 3300049588 Bacteria 2817
817 Ga0501072_0345591 3300049588 Bacteria 1181
818 Ga0501073_0001250 3300049589 Bacteria 18592
819 Ga0501073_0191123 3300049589 Bacteria 1417
820 Ga0501073_0298177 3300049589 Bacteria 1112
821 Ga0501074_0635273 3300049590 Bacteria 754
822 Ga0501075_0006533 3300049591 Bacteria 8029
823 Ga0501075_0077998 3300049591 Bacteria 2507
824 Ga0501075_0290496 3300049591 Bacteria 1246
825 Ga0501076_0003582 3300049592 Bacteria 10907
826 Ga0501076_0024714 3300049592 Bacteria 4645
827 Ga0501076_0173490 3300049592 Bacteria 1758
828 Ga0501077_0324411 3300049593 Unclassified 982
829 Ga0501077_0385812 3300049593 Bacteria 895
830 Ga0501224_071644 3300049664 Bacteria 548
831 Ga0501235_124887 3300049669 Unclassified 647
832 Ga0501079_0001657 3300049741 Bacteria 15851
833 Ga0501079_0093481 3300049741 Bacteria 2330
834 Ga0501081_0011708 3300049743 Bacteria 5741
835 Ga0501081_0224772 3300049743 Bacteria 1366
836 Ga0501273_044236 3300049770 Bacteria 666
837 Ga0501035_0137297 3300049822 Bacteria 2128
838 Ga0501035_0238416 3300049822 Bacteria 1548
839 Ga0501035_0421941 3300049822 Bacteria 1107
840 Ga0501045_0022578 3300049824 Bacteria 4506
841 Ga0501045_0047566 3300049824 Bacteria 3125
842 Ga0501045_0180083 3300049824 Bacteria 1575
843 Ga0501045_0891124 3300049824 Bacteria 654
844 nmdc:mga00v17_218374_c1 3300050491 Unclassified 1234
845 nmdc:mga06z11_150720_c1 3300050494 Bacteria 1322
846 nmdc:mga05p37_1640_c1 3300050507 Bacteria 25964
847 nmdc:mga05p37_18511_c1 3300050507 Bacteria 8415
848 nmdc:mga05p37_204_c1 3300050507 Bacteria 59503
849 nmdc:mga05p37_31700_c1 3300050507 Bacteria 6459
850 nmdc:mga05p37_69746_c1 3300050507 Bacteria 4324
851 nmdc:mga09592_16597_c1 3300050508 Bacteria 6026
852 nmdc:mga09592_277015_c1 3300050508 Unclassified 1455
853 nmdc:mga09592_40518_c1 3300050508 Bacteria 3913
854 nmdc:mga09592_43984_c1 3300050508 Bacteria 3757
855 nmdc:mga0qj67_22526_c1 3300050509 Bacteria 4839
856 nmdc:mga0qj67_358348_c1 3300050509 Bacteria 1179
857 nmdc:mga0qj67_8668_c1 3300050509 Bacteria 7549
858 nmdc:mga06r32_147452_c1 3300050510 Bacteria 2331
859 nmdc:mga06r32_267564_c1 3300050510 Bacteria 1697
860 nmdc:mga06r32_34910_c1 3300050510 Bacteria 4744
861 nmdc:mga06r32_54379_c1 3300050510 Bacteria 3839
862 nmdc:mga08y16_1571424_c1 3300050511 Bacteria 616
863 nmdc:mga08y16_2313_c1 3300050511 Bacteria 19509
864 nmdc:mga08y16_44781_c1 3300050511 Bacteria 4638
865 nmdc:mga0n895_204858_c1 3300050512 Bacteria 2003
866 nmdc:mga0n895_385497_c1 3300050512 Bacteria 1418
867 nmdc:mga0n895_81259_c1 3300050512 Bacteria 3230
868 nmdc:mga0n895_865007_c1 3300050512 Bacteria 891
869 nmdc:mga0n895_967716_c1 3300050512 Unclassified 834
870 nmdc:mga0rr50_330446_c1 3300050513 Bacteria 1280
871 nmdc:mga0rr50_85095_c1 3300050513 Bacteria 2450
872 nmdc:mga0rr50_9595_c1 3300050513 Bacteria 6095
873 nmdc:mga0a205_1229035_c1 3300050515 Bacteria 597
874 nmdc:mga0a205_146570_c1 3300050515 Bacteria 2261
875 nmdc:mga0a205_84893_c1 3300050515 Bacteria 3058
876 Ga0501084_0038583 3300054114 Bacteria 3992
877 Ga0590074_000776 3300059423 Bacteria 4895
878 Ga0590075_000438 3300059424 Bacteria 11305
879 Ga0590075_054880 3300059424 Bacteria 1024
880 Ga0590077_002455 3300059426 Bacteria 3966
881 Ga0590077_022383 3300059426 Bacteria 1348
882 Ga0501082_0003745 3300060353 Bacteria 13293
883 Ga0501082_0678110 3300060353 Bacteria 902
884 Ga0501082_0789625 3300060353 Bacteria 831
885 Ga0530510_0036737 3300061734 Bacteria 3530
886 Ga0530510_0257202 3300061734 Bacteria 1302
887 Ga0070671_100006808
888 ARcpr5yngRDRAFT_c003349
889 JGI24746J21847_1002952
890 JGI24745J21846_1007836
891 JGI24749J21850_1031950
892 JGI24035J26624_1002635
893 JGI24034J26672_10009727
894 JGI24751J29686_10052708
895 JGI24751J29686_10056795
896 Ga0006778J45830_1074893
897 JGI25406J46586_10003711
898 Ga0007417J51691_1063843
899 Ga0007416J51690_1056399
900 Ga0007429J51699_1076987
901 Ga0058859_10076617
902 Ga0058859_10112349
903 Ga0058859_11488662
904 Ga0058859_11663673
905 Ga0058859_11758504
906 Ga0058861_11902789
907 Ga0058860_10075353
908 Ga0058860_10145618
909 Ga0058860_12002770
910 Ga0058860_12031273
911 Ga0058860_12072903
912 Ga0058860_12130607
913 Ga0058862_12268440
914 Ga0058862_12764431
915 Ga0058862_12805714
916 Ga0065714_10480246
917 Ga0065704_10094226
918 Ga0065704_10095758
919 Ga0065704_10322344
920 Ga0065704_10438106
921 Ga0065704_10592871
922 Ga0065712_10003855
923 Ga0065712_10006208
924 Ga0065712_10070291
925 Ga0065712_10070666
926 Ga0065712_10109991
927 Ga0065712_10123754
928 Ga0065712_10150889
929 Ga0065712_10209675
930 Ga0065712_10357833
931 Ga0065712_10392173
932 Ga0065715_10007986
933 Ga0065715_10008080
934 Ga0065715_10020916
935 Ga0065715_10124133
936 Ga0065715_10143316
937 Ga0065715_10258766
938 Ga0065715_10308589
939 Ga0065715_10343181
940 Ga0065715_10547478
941 Ga0065715_10728871
942 Ga0065707_10005263
943 Ga0065707_10008765
944 Ga0065707_10162045
945 Ga0065707_10168664
946 Ga0065707_10374092
947 Ga0070658_10330334
948 Ga0070676_10005855
949 Ga0070683_100000857
950 Ga0070683_100147764
951 Ga0070683_100958555
952 Ga0070683_101170370
953 Ga0070683_101433725
954 Ga0070690_100067037
955 Ga0070690_100086091
956 Ga0070690_100137740
957 Ga0070690_100178665
958 Ga0070690_100270293
959 Ga0070690_100334650
960 Ga0070670_100011000
961 Ga0070670_100014108
962 Ga0070670_100015682
963 Ga0070670_100023037
964 Ga0070670_100305554
965 Ga0070670_100334986
966 Ga0070670_100717777
967 Ga0070670_100841194
968 Ga0070670_100975161
969 Ga0070677_10003332
970 Ga0070677_10073554
971 Ga0070677_10089005
972 Ga0070677_10096231
973 Ga0070677_10352207
974 Ga0068869_100006495
975 Ga0068869_100025663
976 Ga0068869_101219974
977 Ga0068869_101317000
978 Ga0068869_101626027
979 Ga0070666_10003133
980 Ga0070666_10161604
981 Ga0070666_10205593
982 Ga0070666_10250146
983 Ga0070666_10433551
984 Ga0070680_100810944
985 Ga0070680_101307039
986 Ga0070682_100388553
987 Ga0070682_100545974
988 Ga0070682_100594422
989 Ga0068868_100001652
990 Ga0068868_100152671
991 Ga0068868_100288776
992 Ga0068868_100451973
993 Ga0068868_100539542
994 Ga0070660_100345896
995 Ga0070660_100526596
996 Ga0070660_101044553
997 Ga0070689_100016249
998 Ga0070689_100020129
999 Ga0070689_100201197
1000 Ga0070689_100219026
1001 Ga0070689_100795014
1002 Ga0070689_101684361
1003 Ga0070691_10166940
1004 Ga0070691_10404781
1005 Ga0070687_100036278
1006 Ga0070687_100163315
1007 Ga0070687_100171046
1008 Ga0070687_100184043
1009 Ga0070661_100035459
1010 Ga0070661_100078927
1011 Ga0070661_100369630
1012 Ga0070692_10014680
1013 Ga0070692_10463503
1014 Ga0070692_10938825
1015 Ga0070668_100104520
1016 Ga0070668_100172421
1017 Ga0070668_100205609
1018 Ga0070668_100256345
1019 Ga0070668_100306198
1020 Ga0070668_100389346
1021 Ga0070668_100861780
1022 Ga0070668_101376199
1023 Ga0070669_100002909
1024 Ga0070669_100016666
1025 Ga0070669_100047172
1026 Ga0070669_100056942
1027 Ga0070669_100100746
1028 Ga0070669_100146819
1029 Ga0070669_100443747
1030 Ga0070669_100486622
1031 Ga0070669_101678164
1032 Ga0070669_101805388
1033 Ga0070675_100001125
1034 Ga0070675_100005228
1035 Ga0070675_100028311
1036 Ga0070675_100032755
1037 Ga0070675_100091376
1038 Ga0070675_100094782
1039 Ga0070675_100165116
1040 Ga0070675_100338965
1041 Ga0070675_100381199
1042 Ga0070675_100446940
1043 Ga0070675_100480712
1044 Ga0070675_100776735
1045 Ga0070675_100777668
1046 Ga0070675_100825993
1047 Ga0070675_100872889
1048 Ga0070675_101100490
1049 Ga0070675_101317001
1050 Ga0070675_101443451
1051 Ga0070671_100240377
1052 Ga0070671_100386566
1053 Ga0070671_100943150
1054 Ga0070671_100960856
1055 Ga0070674_100115425
1056 Ga0070674_100420442
1057 Ga0070674_100564244
1058 Ga0070674_100859322
1059 Ga0070673_100004179
1060 Ga0070673_100017518
1061 Ga0070673_100044423
1062 Ga0070673_100083908
1063 Ga0070673_100228227
1064 Ga0070673_100232258
1065 Ga0070673_100341975
1066 Ga0070673_100345230
1067 Ga0070673_100346926
1068 Ga0070673_101188571
1069 Ga0070688_100002351
1070 Ga0070688_100012388
1071 Ga0070688_100122548
1072 Ga0070688_100162894
1073 Ga0070688_100316767
1074 Ga0070688_100617472
1075 Ga0070688_101083287
1076 Ga0070659_100062552
1077 Ga0070659_100077529
1078 Ga0070659_100251203
1079 Ga0070659_100289674
1080 Ga0070667_100022611
1081 Ga0070667_100073474
1082 Ga0070667_100183950
1083 Ga0070667_100381288
1084 Ga0070667_101029737
1085 Ga0070667_101192663
1086 Ga0070667_101659913
1087 Ga0070701_10003090
1088 Ga0070701_10004454
1089 Ga0070701_10006684
1090 Ga0070701_10010958
1091 Ga0070701_10037088
1092 Ga0070701_10149699
1093 Ga0070701_10181803
1094 Ga0070701_10199560
1095 Ga0070701_10536996
1096 Ga0070701_10578838
1097 Ga0070701_10645657
1098 Ga0070705_100000076
1099 Ga0070705_100009393
1100 Ga0070705_100977453
1101 Ga0070700_100039578
1102 Ga0070700_100046665
1103 Ga0070700_100050416
1104 Ga0070700_100050950
1105 Ga0070700_100429066
1106 Ga0070700_100478196
1107 Ga0070700_100681402
1108 Ga0070700_100910127
1109 Ga0070700_101684940
1110 Ga0070694_100030315
1111 Ga0070694_100078952
1112 Ga0070694_100090360
1113 Ga0070694_100226790
1114 Ga0070694_100591585
1115 Ga0070708_100261238
1116 Ga0070708_101453835
1117 Ga0070708_101509066
1118 Ga0070663_100186786
1119 Ga0070663_100194090
1120 Ga0070663_100439379
1121 Ga0070663_100636639
1122 Ga0070678_100074082
1123 Ga0070678_100090564
1124 Ga0070678_100221173
1125 Ga0070678_100305149
1126 Ga0070678_100331050
1127 Ga0070678_100365421
1128 Ga0070678_100393805
1129 Ga0070678_100434777
1130 Ga0070678_100529630
1131 Ga0070662_100012481
1132 Ga0070662_100135969
1133 Ga0070662_100316083
1134 Ga0070662_100356720
1135 Ga0070662_100379701
1136 Ga0070681_10005835
1137 Ga0068867_100000885
1138 Ga0068867_100004327
1139 Ga0068867_100040168
1140 Ga0068867_100053131
1141 Ga0068867_100121596
1142 Ga0068867_100520509
1143 Ga0068867_100528309
1144 Ga0070685_10045758
1145 Ga0070685_10155309
1146 Ga0070685_10239943
1147 Ga0070685_10325275
1148 Ga0070706_100106631
1149 Ga0070706_100140600
1150 Ga0070706_101887538
1151 Ga0070707_100069308
1152 Ga0070707_100098727
1153 Ga0070707_100333848
1154 Ga0070707_100731026
1155 Ga0070707_101043883
1156 Ga0070698_100001357
1157 Ga0070698_100006206
1158 Ga0070698_100015602
1159 Ga0070698_100428497
1160 Ga0070698_100532823
1161 Ga0070698_100758854
1162 Ga0070699_100000371
1163 Ga0070699_100013938
1164 Ga0070699_100019404
1165 Ga0070684_100000384
1166 Ga0070684_100043653
1167 Ga0070697_100147002
1168 Ga0070697_100251053
1169 Ga0070697_100311290
1170 Ga0070672_100003923
1171 Ga0070672_100021515
1172 Ga0070672_100066892
1173 Ga0070672_100086226
1174 Ga0070672_100107450
1175 Ga0070672_100127690
1176 Ga0070672_100137817
1177 Ga0070672_100152982
1178 Ga0070672_100169632
1179 Ga0070672_100188530
1180 Ga0070672_100233593
1181 Ga0070672_100254807
1182 Ga0070672_100272396
1183 Ga0070672_100396882
1184 Ga0070672_100504618
1185 Ga0070672_100717698
1186 Ga0070686_100000959
1187 Ga0070686_100023758
1188 Ga0070686_100069370
1189 Ga0070686_100214551
1190 Ga0070686_100347074
1191 Ga0070686_100543777
1192 Ga0070686_100963295
1193 Ga0070695_100000627
1194 Ga0070695_100007666
1195 Ga0070695_100014109
1196 Ga0070696_100003302
1197 Ga0070696_100017615
1198 Ga0070696_100200752
1199 Ga0070696_100380015
1200 Ga0070693_100484268
1201 Ga0070665_100700833
1202 Ga0070665_101182287
1203 Ga0070704_100002209
1204 Ga0070704_100116080
1205 Ga0070704_100134640
1206 Ga0070704_100350230
1207 Ga0070704_100356921
1208 Ga0070704_100380185
1209 Ga0070704_100481625
1210 Ga0068855_101115262
1211 Ga0070664_100000442
1212 Ga0070664_100005905
1213 Ga0070664_100054873
1214 Ga0070664_100074820
1215 Ga0070664_100084187
1216 Ga0070664_100194747
1217 Ga0070664_100404980
1218 Ga0070664_102231043
1219 Ga0068857_100033490
1220 Ga0068857_100135944
1221 Ga0068857_100313554
1222 Ga0068857_100435149
1223 Ga0068857_100653394
1224 Ga0068857_100814875
1225 Ga0068857_100987340
1226 Ga0068857_101383516
1227 Ga0068854_100022324
1228 Ga0068854_100250909
1229 Ga0068854_100427354
1230 Ga0068856_101586238
1231 Ga0070702_100146441
1232 Ga0070702_100182026
1233 Ga0070702_100958674
1234 Ga0070702_101108495
1235 Ga0068852_100464805
1236 Ga0068852_100951526
1237 Ga0068859_100018030
1238 Ga0068859_100042321
1239 Ga0068859_100058899
1240 Ga0068859_100070054
1241 Ga0068859_100112648
1242 Ga0068859_100200258
1243 Ga0068859_100298806
1244 Ga0068859_100523525
1245 Ga0068859_100624742
1246 Ga0068859_100862757
1247 Ga0068859_101424120
1248 Ga0068859_102284160
1249 Ga0068864_100031425
1250 Ga0068864_100050967
1251 Ga0068864_100170387
1252 Ga0068864_100184609
1253 Ga0068864_100192204
1254 Ga0068864_100300623
1255 Ga0068864_100338360
1256 Ga0068864_100391150
1257 Ga0068864_100490152
1258 Ga0068864_100501380
1259 Ga0068864_100706926
1260 Ga0068861_100023958
1261 Ga0068861_100085804
1262 Ga0068861_100101462
1263 Ga0068861_100104975
1264 Ga0068861_100290711
1265 Ga0068861_100501259
1266 Ga0068861_100623590
1267 Ga0068861_100895685
1268 Ga0068861_100967561
1269 Ga0068861_102375838
1270 Ga0068851_10450164
1271 Ga0068870_10008497
1272 Ga0068870_10011633
1273 Ga0068870_10131662
1274 Ga0068870_10165695
1275 Ga0068870_10377189
1276 Ga0068870_10678652
1277 Ga0068863_100006615
1278 Ga0068863_100118121
1279 Ga0068863_100209356
1280 Ga0068863_100390445
1281 Ga0068863_100432211
1282 Ga0068863_101326905
1283 Ga0068858_100044197
1284 Ga0068858_100546172
1285 Ga0068860_100007521
1286 Ga0068860_100021507
1287 Ga0068860_100148866
1288 Ga0068860_100471103
1289 Ga0068860_100692914
1290 Ga0068860_102478101
1291 Ga0068862_100186013
1292 Ga0068862_100410461
1293 Ga0081539_10000090
1294 Ga0081539_10000558
1295 Ga0081539_10001150
1296 Ga0081539_10060678
1297 Ga0075364_10120401
1298 Ga0075364_10270860
1299 Ga0075364_10405304
1300 Ga0075364_10629150
1301 Ga0075432_10130958
1302 Ga0075432_10184636
1303 Ga0075432_10384005
1304 Ga0070712_101952649
1305 Ga0075362_10240937
1306 Ga0075366_10171391
1307 Ga0097621_100030713
1308 Ga0097621_100037128
1309 Ga0097621_100070007
1310 Ga0097621_100112574
1311 Ga0068871_100052850
1312 Ga0068871_100081886
1313 Ga0068871_100241168
1314 Ga0068871_100259384
1315 Ga0075428_100000778
1316 Ga0075428_100001358
1317 Ga0075428_100012638
1318 Ga0075428_100174740
1319 Ga0075428_100197964
1320 Ga0075428_100217362
1321 Ga0075428_100338635
1322 Ga0075428_100341442
1323 Ga0075428_100344167
1324 Ga0075428_100490600
1325 Ga0075428_100520209
1326 Ga0075428_100547556
1327 Ga0075428_100726864
1328 Ga0075430_100000569
1329 Ga0075430_100002777
1330 Ga0075430_100003418
1331 Ga0075430_100006873
1332 Ga0075430_100012378
1333 Ga0075430_100018937
1334 Ga0075430_100390859
1335 Ga0075431_100003313
1336 Ga0075431_100004064
1337 Ga0075431_100009235
1338 Ga0075431_100028120
1339 Ga0075431_100063209
1340 Ga0075431_100116010
1341 Ga0075431_100190458
1342 Ga0075431_100275704
1343 Ga0075431_100301822
1344 Ga0075431_100316486
1345 Ga0075431_100504645
1346 Ga0075431_101282270
1347 Ga0075433_10013717
1348 Ga0075433_10023108
1349 Ga0075433_10075217
1350 Ga0075433_10186706
1351 Ga0075433_10280248
1352 Ga0075433_10447489
1353 Ga0075433_10754485
1354 Ga0075433_11276673
1355 Ga0075433_11401829
1356 Ga0075434_100000096
1357 Ga0075434_100007147
1358 Ga0075434_100016254
1359 Ga0075434_100037300
1360 Ga0075434_100108898
1361 Ga0075434_100890634
1362 Ga0075434_101162964
1363 Ga0075434_102086941
1364 Ga0075429_100006960
1365 Ga0075429_100009492
1366 Ga0075429_100014249
1367 Ga0075429_100014471
1368 Ga0075429_100018543
1369 Ga0075429_100031433
1370 Ga0075429_100043782
1371 Ga0075429_100049016
1372 Ga0075429_100049050
1373 Ga0075429_100162042
1374 Ga0075429_100175669
1375 Ga0075429_100245880
1376 Ga0075429_100283142
1377 Ga0075429_101212611
1378 Ga0075429_101222845
1379 Ga0068865_100013019
1380 Ga0068865_100040123
1381 Ga0068865_100192676
1382 Ga0068865_100193232
1383 Ga0068865_100534751
1384 Ga0068865_100811933
1385 Ga0068865_101018360
1386 Ga0075436_100320839
1387 Ga0097620_100018031
1388 Ga0097620_100042321
1389 Ga0097620_100058901
1390 Ga0097620_100070054
1391 Ga0097620_100112650
1392 Ga0097620_100200253
1393 Ga0097620_100298804
1394 Ga0097620_100523533
1395 Ga0097620_100562396
1396 Ga0097620_100624732
1397 Ga0097620_100862868
1398 Ga0097620_102284161
1399 Ga0075435_100102441
1400 Ga0075435_100129908
1401 Ga0075435_100179133
1402 Ga0075435_100204308
1403 Ga0075435_100220392
1404 Ga0105250_10288492
1405 Ga0105250_10326488
1406 Ga0111539_10000311
1407 Ga0111539_10000556
1408 Ga0111539_10003416
1409 Ga0111539_10005129
1410 Ga0111539_10010487
1411 Ga0111539_10031982
1412 Ga0111539_10053659
1413 Ga0111539_10069197
1414 Ga0111539_10105561
1415 Ga0111539_10309025
1416 Ga0111539_10412745
1417 Ga0111539_10673101
1418 Ga0111539_10702662
1419 Ga0111539_10835677
1420 Ga0111539_11159067
1421 Ga0111539_11194065
1422 Ga0111539_12337924
1423 Ga0111539_12408846
1424 Ga0111539_12972871
1425 Ga0105245_10293768
1426 Ga0105245_10429681
1427 Ga0105245_10498559
1428 Ga0105245_11926628
1429 Ga0105245_12387346
1430 Ga0105247_10142865
1431 Ga0105247_10968119
1432 Ga0114129_10000174
1433 Ga0114129_10000453
1434 Ga0114129_10001428
1435 Ga0114129_10001507
1436 Ga0114129_10006234
1437 Ga0114129_10008028
1438 Ga0114129_10014525
1439 Ga0114129_10039729
1440 Ga0114129_10042611
1441 Ga0114129_10045746
1442 Ga0114129_10051617
1443 Ga0114129_10097009
1444 Ga0114129_10122808
1445 Ga0114129_10134210
1446 Ga0114129_10232946
1447 Ga0114129_10465212
1448 Ga0114129_10519284
1449 Ga0114129_10572062
1450 Ga0114129_10832440
1451 Ga0114129_10887574
1452 Ga0114129_12313802
1453 Ga0114129_12524181
1454 Ga0105243_10238046
1455 Ga0105243_10394487
1456 Ga0105243_10923160
1457 Ga0105243_10935875
1458 Ga0105243_10999925
1459 Ga0105243_12078806
1460 Ga0105241_10798651
1461 Ga0105241_11610686
1462 Ga0105242_10051025
1463 Ga0105242_10179556
1464 Ga0105242_10632897
1465 Ga0105242_10963372
1466 Ga0105242_12029424
1467 Ga0105248_10038996
1468 Ga0105248_10205821
1469 Ga0105248_10340135
1470 Ga0105248_10781889
1471 Ga0105248_10958158
1472 Ga0105248_11315223
1473 Ga0105237_10440339
1474 Ga0105238_10037296
1475 Ga0105249_10001486
1476 Ga0105249_10007331
1477 Ga0105249_10494333
1478 Ga0105249_10786454
1479 Ga0105249_11545352
1480 Ga0105239_10612212
1481 Ga0105239_12190408
1482 Ga0105246_10051919
1483 Ga0105246_10301677
1484 Ga0105246_10326461
1485 Ga0105246_10782301
1486 Ga0157374_10164753
1487 Ga0157374_10208790
1488 Ga0157374_10217476
1489 Ga0157374_10236271
1490 Ga0157374_11488550
1491 Ga0157378_10068524
1492 Ga0157378_10183746
1493 Ga0163162_10018956
1494 Ga0163162_10391958
1495 Ga0163162_10863479
1496 Ga0157372_10539206
1497 Ga0157375_10021929
1498 Ga0157375_10037412
1499 Ga0157375_10069408
1500 Ga0157375_10159205
1501 Ga0157375_10605409
1502 Ga0157375_11001763
1503 Ga0157375_11351776
1504 Ga0157375_12450100
1505 Ga0163163_10008652
1506 Ga0163163_10025072
1507 Ga0163163_10087359
1508 Ga0163163_10108874
1509 Ga0163163_10118733
1510 Ga0163163_10259333
1511 Ga0163163_10543879
1512 Ga0157380_10006529
1513 Ga0157380_10055548
1514 Ga0157380_10233281
1515 Ga0157380_10277324
1516 Ga0157380_10346212
1517 Ga0157380_10374277
1518 Ga0157380_10460398
1519 Ga0157380_10569399
1520 Ga0157380_10682695
1521 Ga0157380_10727466
1522 Ga0157380_11039992
1523 Ga0157380_11406499
1524 Ga0157380_11689449
1525 Ga0157380_11737267
1526 Ga0182008_10102130
1527 Ga0157377_10002798
1528 Ga0157377_10012987
1529 Ga0157377_10029341
1530 Ga0157377_10050653
1531 Ga0157377_10151182
1532 Ga0157377_10297967
1533 Ga0157379_10523771
1534 Ga0157379_10547274
1535 Ga0157376_10052864
1536 Ga0157376_10072440
1537 Ga0157376_10137687
1538 Ga0157376_10448777
1539 Ga0157376_10718980
1540 Ga0157376_10915938
1541 Ga0157376_11648321
1542 Ga0206353_10662909
1543 Ga0207666_1027012
1544 Ga0207673_1003013
1545 Ga0207697_10001427
1546 Ga0207697_10043535
1547 Ga0207656_10018782
1548 Ga0207682_10041929
1549 Ga0207710_10343378
1550 Ga0207688_10035561
1551 Ga0207688_10060015
1552 Ga0207688_10292524
1553 Ga0207680_10889717
1554 Ga0207645_10006662
1555 Ga0207645_10008924
1556 Ga0207643_10001047
1557 Ga0207643_10061467
1558 Ga0207662_10024202
1559 Ga0207657_10247196
1560 Ga0207649_10012964
1561 Ga0207652_11457254
1562 Ga0207681_10030741
1563 Ga0207681_10114257
1564 Ga0207681_10202214
1565 Ga0207681_10533164
1566 Ga0207694_10036129
1567 Ga0207650_10009096
1568 Ga0207650_10132917
1569 Ga0207659_10002934
1570 Ga0207659_10011245
1571 Ga0207659_10311765
1572 Ga0207659_10507785
1573 Ga0207659_11578474
1574 Ga0207644_10028840
1575 Ga0207644_10030496
1576 Ga0207690_10327094
1577 Ga0207706_10505320
1578 Ga0207686_10136731
1579 Ga0207709_10032782
1580 Ga0207670_10191452
1581 Ga0207669_10227181
1582 Ga0207669_10364281
1583 Ga0207704_10002986
1584 Ga0207691_10219809
1585 Ga0207691_10313968
1586 Ga0207661_10793844
1587 Ga0207679_10008779
1588 Ga0207679_10068698
1589 Ga0207679_10407993
1590 Ga0207651_10129112
1591 Ga0207640_10457498
1592 Ga0207658_10846678
1593 Ga0207677_10062701
1594 Ga0207677_10096506
1595 Ga0207677_10342839
1596 Ga0207677_10456109
1597 Ga0207703_10036382
1598 Ga0207703_10066926
1599 Ga0207703_10282745
1600 Ga0207678_10231548
1601 Ga0207678_10741517
1602 Ga0207708_10000967
1603 Ga0207702_11432356
1604 Ga0207641_10094459
1605 Ga0207641_10192213
1606 Ga0207641_10205734
1607 Ga0207648_10000077
1608 Ga0207648_10532672
1609 Ga0207648_10923613
1610 Ga0207676_11234941
1611 Ga0207674_10024787
1612 Ga0207674_10382055
1613 Ga0207674_10860556
1614 Ga0207675_100037149
1615 Ga0207675_101480982
1616 Ga0207683_10017764
1617 Ga0207698_12381508
1618 Ga0209999_1111361
1619 Ga0207428_10000902
1620 Ga0207428_10052520
1621 Ga0268266_10218629
1622 Ga0268266_10767080
1623 Ga0268265_10444716
1624 Ga0268265_10851003
1625 Ga0268265_11137780
1626 Ga0268264_10328976
1627 Ga0307408_100031040
1628 Ga0307408_100111627
1629 Ga0307408_100506923
1630 Ga0307408_100831316
1631 Ga0307405_10040983
1632 Ga0307413_10284749
1633 Ga0307406_10153007
1634 Ga0307406_10188979
1635 Ga0307407_10022841
1636 Ga0307412_10106312
1637 Ga0307409_100210850
1638 Ga0307416_100046423
1639 Ga0307414_11124712
1640 Ga0307411_10121314
1641 Ga0307411_10384887
1642 Ga0307411_10869074
1643 Ga0307415_100485718
1644 Ga0373938_0071501
1645 Ga0373940_0183607
1646 Ga0373945_0030931
1647 Ga0373943_0132080
1648 Ga0373947_0270823
1649 Ga0439447_122132
1650 Ga0451800_1154454
1651 Ga0451802_0771090
1652 Ga0451849_0193849
1653 Ga0439431_0140285
1654 Ga0439441_019166
1655 Ga0439441_025980
1656 Ga0450920_075485
1657 Ga0450896_038705
1658 Ga0439434_0026884
1659 Ga0439464_0006755
1660 Ga0439460_0032735
1661 Ga0451577_0405207
1662 Ga0453684_0115095
1663 Ga0453684_0139840
1664 Ga0496108_0330485
1665 Ga0501309_022053
1666 Ga0501305_041751
1667 Ga0501307_032624
1668 Ga0501307_038734
1669 Ga0501292_112120
1670 Ga0501303_036006
1671 Ga0501311_017015
1672 Ga0501312_075771
1673 Ga0501031_0941047
1674 Ga0501032_0349300
1675 Ga0501033_0143331
1676 Ga0501036_0120936
1677 Ga0501036_0182526
1678 Ga0501036_0520583
1679 Ga0501037_0120064
1680 Ga0501037_0313930
1681 Ga0501038_0045056
1682 Ga0501038_0161611
1683 Ga0501039_0099672
1684 Ga0501039_0301866
1685 Ga0501040_0003367
1686 Ga0501040_0153410
1687 Ga0501040_0192177
1688 Ga0501041_0047880
1689 Ga0501042_0017095
1690 Ga0501042_0413463
1691 Ga0501046_0045279
1692 Ga0501046_0075123
1693 Ga0501046_0272021
1694 Ga0501048_0082570
1695 Ga0501048_0412529
1696 Ga0501067_0044387
1697 Ga0501070_1100548
1698 Ga0501071_0083024
1699 Ga0501071_0143477
1700 Ga0501071_0157461
1701 Ga0501072_0003814
1702 Ga0501072_0067708
1703 Ga0501072_0345591
1704 Ga0501073_0001250
1705 Ga0501073_0191123
1706 Ga0501073_0298177
1707 Ga0501074_0635273
1708 Ga0501075_0006533
1709 Ga0501075_0077998
1710 Ga0501075_0290496
1711 Ga0501076_0003582
1712 Ga0501076_0024714
1713 Ga0501076_0173490
1714 Ga0501077_0324411
1715 Ga0501077_0385812
1716 Ga0501224_071644
1717 Ga0501235_124887
1718 Ga0501079_0001657
1719 Ga0501079_0093481
1720 Ga0501081_0011708
1721 Ga0501081_0224772
1722 Ga0501273_044236
1723 Ga0501035_0137297
1724 Ga0501035_0238416
1725 Ga0501035_0421941
1726 Ga0501045_0022578
1727 Ga0501045_0047566
1728 Ga0501045_0180083
1729 Ga0501045_0891124
1730 nmdc:mga00v17_218374_c1
1731 nmdc:mga06z11_150720_c1
1732 nmdc:mga05p37_1640_c1
1733 nmdc:mga05p37_18511_c1
1734 nmdc:mga05p37_204_c1
1735 nmdc:mga05p37_31700_c1
1736 nmdc:mga05p37_69746_c1
1737 nmdc:mga09592_16597_c1
1738 nmdc:mga09592_277015_c1
1739 nmdc:mga09592_40518_c1
1740 nmdc:mga09592_43984_c1
1741 nmdc:mga0qj67_22526_c1
1742 nmdc:mga0qj67_358348_c1
1743 nmdc:mga0qj67_8668_c1
1744 nmdc:mga06r32_147452_c1
1745 nmdc:mga06r32_267564_c1
1746 nmdc:mga06r32_34910_c1
1747 nmdc:mga06r32_54379_c1
1748 nmdc:mga08y16_1571424_c1
1749 nmdc:mga08y16_2313_c1
1750 nmdc:mga08y16_44781_c1
1751 nmdc:mga0n895_204858_c1
1752 nmdc:mga0n895_385497_c1
1753 nmdc:mga0n895_81259_c1
1754 nmdc:mga0n895_865007_c1
1755 nmdc:mga0n895_967716_c1
1756 nmdc:mga0rr50_330446_c1
1757 nmdc:mga0rr50_85095_c1
1758 nmdc:mga0rr50_9595_c1
1759 nmdc:mga0a205_1229035_c1
1760 nmdc:mga0a205_146570_c1
1761 nmdc:mga0a205_84893_c1
1762 Ga0501084_0038583
1763 Ga0590074_000776
1764 Ga0590075_000438
1765 Ga0590075_054880
1766 Ga0590077_002455
1767 Ga0590077_022383
1768 Ga0501082_0003745
1769 Ga0501082_0678110
1770 Ga0501082_0789625
1771 Ga0530510_0036737
1772 Ga0530510_0257202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

49

167

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9508 2 140
8fn2-assembly1.cif.gz_L the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9506 7 140
5xym-assembly1.cif.gz_J large subunit of mycobacterium smegmatis 0.9506 3 143
8cvm-assembly1.cif.gz_i cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9471 3 143
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9467 1 142
ID Description Score Start End Superfamily
af_Q554U7_3_170_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9535 11 135 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9476 1 142 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9455 12 143 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9411 1 142 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9407 12 143 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A6N9F8U1-F1-model_v4 deleted 0.9712 6 139
AF-A0A7C5UBE5-F1-model_v4 Large ribosomal subunit protein uL13 0.9691 7 142 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A512BCP7-F1-model_v4 Large ribosomal subunit protein uL13 0.9684 6 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A3B4X4E0-F1-model_v4 50S ribosomal protein L13 0.9677 11 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A6L6DLT4-F1-model_v4 50S ribosomal protein L13 0.9663 7 140 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Map