F484335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 875 | 574 | 643 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0141930|Ga0501032_0141930_370_1494 |
| Length | 374 |
| Sequence | MTGPTKATGPLRGVRVVEFAGIGPGPFAAMLLSDMGAEVVTIARPGKGKQDARNFVARGRKVVELDLKKPEHVAQALDLIGAADILIEGFRPKVMERLGLGPDEALKRNPRLVYGRMTGWGQDGPLAQAAGHDINYIAITGALDSFRSPHGDPVSPLNLVGDYGGGALFLVVGVLAALTEARSSGKGQVVDAAMCDGVSSMLTMFHAMKAMGRWTDQPRTNMLDGGAHFYRTYRCKDGGYMAIGAIEPQFYAELRERAGLHDAAFDKQLSRGDWPALQERMTDIFKTKTRDEWAKLLEGTDACAAAVVGLFEAPSHPHLAARQTFVTHDGYVQPAPAPRFSRTPSAIQGTAAVEPVDAAELVRQWSNTPSLKLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 29 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 35 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 36 | 2791355199 | |||
| 37 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 38 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 39 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 40 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 41 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 42 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 43 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 44 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 47 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 48 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 49 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 50 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 51 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 52 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 53 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 54 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 55 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 56 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 57 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 58 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 59 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 60 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 61 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 62 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 63 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 64 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 65 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 66 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 67 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 68 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 69 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 70 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 71 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 72 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 73 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 74 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 75 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 76 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 77 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 78 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 79 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 80 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 81 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 86 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 90 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 91 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 92 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 93 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 94 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 95 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 96 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 97 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 98 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 99 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 100 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 101 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 102 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 103 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 104 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 105 | 2904699407 | |||
| 106 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 107 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 108 | 2906610324 | |||
| 109 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 110 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 111 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 112 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 113 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 114 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 115 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 116 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 117 | 2922368715 | |||
| 118 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 119 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 120 | 2922425934 | |||
| 121 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 122 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 123 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 124 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 125 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 126 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 127 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 128 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 129 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 130 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 131 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 132 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 133 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 134 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 135 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 136 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 137 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 138 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 139 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 140 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 141 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 142 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 143 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 144 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 145 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 146 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 147 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 148 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 149 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 150 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 151 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 152 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 153 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 154 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 155 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 156 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 157 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 158 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 159 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 160 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 161 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 162 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 163 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 164 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 165 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 166 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 167 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 168 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 169 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 170 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 171 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 172 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 173 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 174 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 175 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 176 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 177 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 178 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 179 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 180 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 181 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 182 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 183 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 184 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 185 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 186 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 187 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 188 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 189 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 190 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 191 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 192 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 193 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 194 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 195 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 196 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 197 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 198 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 199 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 200 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 201 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 202 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 203 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 204 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 209 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 210 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 215 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 217 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 218 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 219 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 222 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 223 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 224 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 225 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 226 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 227 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 228 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 229 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 230 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 231 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 232 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 233 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 234 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 235 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 236 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 237 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 238 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 239 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 241 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 243 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 244 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 245 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 246 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 248 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 249 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 250 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 254 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 269 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 270 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 271 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 272 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 273 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 274 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 275 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 276 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 281 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 283 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 285 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 329 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 330 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 331 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 332 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 336 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 337 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 338 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 339 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 340 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 341 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 342 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 343 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 344 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 345 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 346 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 347 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 348 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 349 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 350 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 351 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 352 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 353 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 354 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 355 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 356 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 357 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 358 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 359 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 360 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 361 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 362 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 363 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 364 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 365 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 366 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 367 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 368 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 369 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 370 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 371 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 372 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 373 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 374 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 375 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 376 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 377 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 378 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 379 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 380 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 381 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 382 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 383 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 384 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 385 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 386 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 387 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 388 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 389 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 390 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 391 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 392 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 393 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 394 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 395 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 396 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 397 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 398 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 399 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 400 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 460 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 462 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 463 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 464 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 465 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 466 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 468 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 469 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 470 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 471 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 472 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 473 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 474 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 475 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 476 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 477 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 478 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 479 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 480 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 481 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 482 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 483 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 485 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 499 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 502 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 503 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 505 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 506 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 507 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 508 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 509 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 511 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 512 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 513 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 514 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 515 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 516 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 517 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 520 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 521 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 522 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 523 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 524 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 525 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 526 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 528 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 529 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 531 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 532 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 533 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 535 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 536 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 537 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 538 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 539 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 540 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 541 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 542 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 543 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 544 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 545 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 546 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 547 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 548 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 549 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 550 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 551 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 552 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 553 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 554 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 555 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 556 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 557 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 558 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 559 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 560 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 561 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 562 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 563 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 564 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 565 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 566 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 567 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 568 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 569 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 570 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 571 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 572 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 573 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 574 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.79 |
| Metatranscriptomes | 0.11 |
| Isolates | 26.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.51 |
| Nodule | 21.6 |
| Rhizoplane | 6.74 |
| Rhizosphere | 46.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001506 | 3300001979 | Bacteria | 10702 |
| 2 | JGI24737J22298_10000974 | 3300001990 | Bacteria | 10160 |
| 3 | JGI25151J46595_10002341 | 3300003187 | Bacteria | 11527 |
| 4 | JGI25406J46586_10000887 | 3300003203 | Bacteria | 14075 |
| 5 | JGI25153J46596_10001684 | 3300003215 | Bacteria | 13110 |
| 6 | JGI25153J46596_10003279 | 3300003215 | Bacteria | 9094 |
| 7 | JGI25153J46596_10004047 | 3300003215 | Bacteria | 7991 |
| 8 | JGI25160J50197_1022859 | 3300003354 | Bacteria | 1823 |
| 9 | Ga0055531_10012840 | 3300003794 | Bacteria | 3905 |
| 10 | Ga0055543_1001860 | 3300004625 | Bacteria | 7683 |
| 11 | Ga0065165_1001256 | 3300005262 | Bacteria | 28720 |
| 12 | Ga0065165_1001882 | 3300005262 | Bacteria | 20268 |
| 13 | Ga0065165_1005779 | 3300005262 | Bacteria | 6766 |
| 14 | Ga0070683_100006785 | 3300005329 | Bacteria | 9622 |
| 15 | Ga0070683_100063089 | 3300005329 | Bacteria | 3446 |
| 16 | Ga0070680_100072406 | 3300005336 | Bacteria | 2832 |
| 17 | Ga0070680_100115183 | 3300005336 | Bacteria | 2240 |
| 18 | Ga0068868_100020206 | 3300005338 | Bacteria | 5000 |
| 19 | Ga0070668_100035262 | 3300005347 | Bacteria | 3814 |
| 20 | Ga0070668_100039201 | 3300005347 | Bacteria | 3623 |
| 21 | Ga0070671_100107399 | 3300005355 | Bacteria | 2343 |
| 22 | Ga0070709_10013398 | 3300005434 | Bacteria | 4609 |
| 23 | Ga0070709_10191243 | 3300005434 | Bacteria | 1444 |
| 24 | Ga0070714_100025747 | 3300005435 | Bacteria | 4858 |
| 25 | Ga0070714_100085240 | 3300005435 | Bacteria | 2759 |
| 26 | Ga0070713_100045763 | 3300005436 | Bacteria | 3588 |
| 27 | Ga0070713_100114123 | 3300005436 | Bacteria | 2360 |
| 28 | Ga0070713_100146201 | 3300005436 | Bacteria | 2099 |
| 29 | Ga0070710_10058677 | 3300005437 | Bacteria | 2183 |
| 30 | Ga0070710_10105335 | 3300005437 | Bacteria | 1686 |
| 31 | Ga0070710_10146031 | 3300005437 | Bacteria | 1455 |
| 32 | Ga0070711_100009658 | 3300005439 | Bacteria | 5946 |
| 33 | Ga0070711_100029579 | 3300005439 | Bacteria | 3617 |
| 34 | Ga0070711_100072221 | 3300005439 | Bacteria | 2434 |
| 35 | Ga0070663_100064496 | 3300005455 | Bacteria | 2647 |
| 36 | Ga0070678_100163761 | 3300005456 | Bacteria | 1804 |
| 37 | Ga0070678_100225553 | 3300005456 | Bacteria | 1559 |
| 38 | Ga0070662_100079169 | 3300005457 | Bacteria | 2443 |
| 39 | Ga0070681_10007785 | 3300005458 | Bacteria | 10475 |
| 40 | Ga0070681_10025960 | 3300005458 | Bacteria | 5889 |
| 41 | Ga0070681_10067612 | 3300005458 | Bacteria | 3541 |
| 42 | Ga0070707_100145721 | 3300005468 | Bacteria | 2305 |
| 43 | Ga0070679_100029510 | 3300005530 | Bacteria | 5412 |
| 44 | Ga0070684_100039474 | 3300005535 | Bacteria | 4060 |
| 45 | Ga0070684_100043666 | 3300005535 | Bacteria | 3872 |
| 46 | Ga0068853_100030486 | 3300005539 | Bacteria | 4555 |
| 47 | Ga0068853_100249969 | 3300005539 | Bacteria | 1627 |
| 48 | Ga0070693_100139979 | 3300005547 | Bacteria | 1522 |
| 49 | Ga0070665_100060033 | 3300005548 | Bacteria | 3812 |
| 50 | Ga0070665_100069146 | 3300005548 | Bacteria | 3539 |
| 51 | Ga0070665_100112120 | 3300005548 | Bacteria | 2730 |
| 52 | Ga0070665_100269092 | 3300005548 | Bacteria | 1706 |
| 53 | Ga0070665_100473897 | 3300005548 | Bacteria | 1262 |
| 54 | Ga0068855_100076020 | 3300005563 | Bacteria | 3898 |
| 55 | Ga0068857_100192075 | 3300005577 | Bacteria | 1860 |
| 56 | Ga0068857_100357271 | 3300005577 | Bacteria | 1354 |
| 57 | Ga0068854_100066395 | 3300005578 | Bacteria | 2626 |
| 58 | Ga0068856_100040360 | 3300005614 | Bacteria | 4584 |
| 59 | Ga0068852_100022654 | 3300005616 | Bacteria | 5042 |
| 60 | Ga0068852_100048996 | 3300005616 | Bacteria | 3612 |
| 61 | Ga0068852_100104079 | 3300005616 | Bacteria | 2568 |
| 62 | Ga0068852_100355931 | 3300005616 | Bacteria | 1431 |
| 63 | Ga0068859_100162321 | 3300005617 | Bacteria | 2314 |
| 64 | Ga0068859_100182179 | 3300005617 | Bacteria | 2183 |
| 65 | Ga0068864_100055046 | 3300005618 | Bacteria | 3434 |
| 66 | Ga0068861_100176935 | 3300005719 | Bacteria | 1772 |
| 67 | Ga0068851_10001130 | 3300005834 | Bacteria | 11574 |
| 68 | Ga0068851_10129240 | 3300005834 | Bacteria | 1365 |
| 69 | Ga0068851_10133862 | 3300005834 | Bacteria | 1342 |
| 70 | Ga0068858_100115869 | 3300005842 | Bacteria | 2504 |
| 71 | Ga0068860_100001721 | 3300005843 | Bacteria | 23342 |
| 72 | Ga0068862_100172427 | 3300005844 | Bacteria | 1937 |
| 73 | Ga0081455_10054586 | 3300005937 | Bacteria | 3404 |
| 74 | Ga0081455_10058556 | 3300005937 | Bacteria | 3259 |
| 75 | Ga0081538_10083948 | 3300005981 | Bacteria | 1681 |
| 76 | Ga0081540_1001535 | 3300005983 | Bacteria | 19829 |
| 77 | Ga0081540_1004268 | 3300005983 | Bacteria | 10964 |
| 78 | Ga0081540_1005331 | 3300005983 | Bacteria | 9623 |
| 79 | Ga0081540_1007746 | 3300005983 | Bacteria | 7605 |
| 80 | Ga0081540_1010624 | 3300005983 | Bacteria | 6215 |
| 81 | Ga0081540_1014693 | 3300005983 | Bacteria | 5001 |
| 82 | Ga0081540_1017259 | 3300005983 | Bacteria | 4476 |
| 83 | Ga0081540_1028412 | 3300005983 | Bacteria | 3142 |
| 84 | Ga0081540_1032770 | 3300005983 | Bacteria | 2831 |
| 85 | Ga0081540_1054173 | 3300005983 | Bacteria | 1962 |
| 86 | Ga0081539_10000879 | 3300005985 | Bacteria | 57604 |
| 87 | Ga0081539_10026237 | 3300005985 | Bacteria | 3724 |
| 88 | Ga0075363_100011489 | 3300006048 | Bacteria | 4242 |
| 89 | Ga0075363_100041314 | 3300006048 | Bacteria | 2432 |
| 90 | Ga0075364_10026100 | 3300006051 | Bacteria | 3724 |
| 91 | Ga0075364_10114175 | 3300006051 | Bacteria | 1804 |
| 92 | Ga0070712_100029439 | 3300006175 | Bacteria | 3680 |
| 93 | Ga0075366_10014528 | 3300006195 | Bacteria | 4497 |
| 94 | Ga0097621_100301261 | 3300006237 | Bacteria | 1416 |
| 95 | Ga0075370_10029278 | 3300006353 | Bacteria | 3067 |
| 96 | Ga0075428_100211505 | 3300006844 | Bacteria | 2096 |
| 97 | Ga0075434_100015658 | 3300006871 | Bacteria | 7278 |
| 98 | Ga0068865_100090243 | 3300006881 | Bacteria | 2221 |
| 99 | Ga0097620_100162325 | 3300006931 | Bacteria | 2314 |
| 100 | Ga0097620_100182157 | 3300006931 | Bacteria | 2183 |
| 101 | Ga0099825_1036210 | 3300006941 | Bacteria | 1713 |
| 102 | Ga0099824_1006343 | 3300006942 | Bacteria | 16282 |
| 103 | Ga0099824_1012896 | 3300006942 | Bacteria | 8903 |
| 104 | Ga0099822_1024801 | 3300006943 | Bacteria | 5314 |
| 105 | Ga0099822_1043035 | 3300006943 | Bacteria | 2318 |
| 106 | Ga0105240_10128815 | 3300009093 | Bacteria | 3038 |
| 107 | Ga0105240_10246338 | 3300009093 | Bacteria | 2069 |
| 108 | Ga0105240_10348452 | 3300009093 | Bacteria | 1681 |
| 109 | Ga0111539_10119914 | 3300009094 | Bacteria | 3082 |
| 110 | Ga0105245_10027097 | 3300009098 | Bacteria | 5049 |
| 111 | Ga0105245_10157004 | 3300009098 | Bacteria | 2155 |
| 112 | Ga0105247_10056060 | 3300009101 | Bacteria | 2433 |
| 113 | Ga0105241_10006358 | 3300009174 | Bacteria | 8708 |
| 114 | Ga0105241_10050885 | 3300009174 | Bacteria | 3158 |
| 115 | Ga0105248_10046836 | 3300009177 | Bacteria | 4848 |
| 116 | Ga0105248_10448268 | 3300009177 | Bacteria | 1454 |
| 117 | Ga0105237_10037317 | 3300009545 | Bacteria | 4913 |
| 118 | Ga0105237_10040511 | 3300009545 | Bacteria | 4697 |
| 119 | Ga0105237_10070896 | 3300009545 | Bacteria | 3480 |
| 120 | Ga0105237_10073153 | 3300009545 | Bacteria | 3420 |
| 121 | Ga0105237_10138669 | 3300009545 | Bacteria | 2427 |
| 122 | Ga0105238_10291869 | 3300009551 | Bacteria | 1613 |
| 123 | Ga0105239_10131238 | 3300010375 | Bacteria | 2787 |
| 124 | Ga0105239_10131733 | 3300010375 | Bacteria | 2782 |
| 125 | Ga0105246_10023203 | 3300011119 | Bacteria | 4012 |
| 126 | Ga0157370_10125102 | 3300013104 | Bacteria | 2400 |
| 127 | Ga0157370_10203604 | 3300013104 | Bacteria | 1836 |
| 128 | Ga0157369_10012061 | 3300013105 | Bacteria | 9815 |
| 129 | Ga0157369_10037979 | 3300013105 | Bacteria | 5268 |
| 130 | Ga0157369_10345636 | 3300013105 | Bacteria | 1545 |
| 131 | Ga0163162_10051075 | 3300013306 | Bacteria | 4147 |
| 132 | Ga0157375_10049447 | 3300013308 | Bacteria | 4120 |
| 133 | Ga0157375_10545022 | 3300013308 | Bacteria | 1322 |
| 134 | Ga0163163_10062000 | 3300014325 | Bacteria | 3705 |
| 135 | Ga0163163_10110182 | 3300014325 | Bacteria | 2781 |
| 136 | Ga0163163_10206656 | 3300014325 | Bacteria | 2012 |
| 137 | Ga0163163_10456233 | 3300014325 | Bacteria | 1338 |
| 138 | Ga0157379_10094448 | 3300014968 | Bacteria | 2683 |
| 139 | Ga0157379_10208802 | 3300014968 | Bacteria | 1767 |
| 140 | Ga0157376_10239466 | 3300014969 | Bacteria | 1690 |
| 141 | Ga0163161_10091232 | 3300017792 | Bacteria | 2254 |
| 142 | Ga0214544_1000344 | 3300021320 | Bacteria | 81005 |
| 143 | Ga0214544_1021169 | 3300021320 | Bacteria | 4337 |
| 144 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 145 | Ga0214542_1020533 | 3300021321 | Bacteria | 4817 |
| 146 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 147 | Ga0214545_1017688 | 3300021324 | Bacteria | 6794 |
| 148 | Ga0214543_1000037 | 3300021327 | Bacteria | 182113 |
| 149 | Ga0214543_1031463 | 3300021327 | Bacteria | 2111 |
| 150 | Ga0213873_10006576 | 3300021358 | Bacteria | 2294 |
| 151 | Ga0213874_10020579 | 3300021377 | Bacteria | 1810 |
| 152 | Ga0213876_10027975 | 3300021384 | Bacteria | 2973 |
| 153 | Ga0213876_10047628 | 3300021384 | Bacteria | 2266 |
| 154 | Ga0224712_10014285 | 3300022467 | Bacteria | 2552 |
| 155 | Ga0209563_100900 | 3300025230 | Bacteria | 8805 |
| 156 | Ga0209677_100589 | 3300025253 | Bacteria | 19782 |
| 157 | Ga0209677_100686 | 3300025253 | Bacteria | 17323 |
| 158 | Ga0209148_1000192 | 3300025254 | Bacteria | 115724 |
| 159 | Ga0209148_1015780 | 3300025254 | Bacteria | 1312 |
| 160 | Ga0209233_1007220 | 3300025261 | Bacteria | 3534 |
| 161 | Ga0209455_1000892 | 3300025272 | Bacteria | 15629 |
| 162 | Ga0209455_1008942 | 3300025272 | Bacteria | 2671 |
| 163 | Ga0209455_1010792 | 3300025272 | Bacteria | 2297 |
| 164 | Ga0209025_1000034 | 3300025294 | Bacteria | 413205 |
| 165 | Ga0209564_1002767 | 3300025295 | Bacteria | 13171 |
| 166 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 167 | Ga0209758_1000963 | 3300025297 | Bacteria | 38837 |
| 168 | Ga0209758_1001374 | 3300025297 | Bacteria | 29041 |
| 169 | Ga0209758_1002540 | 3300025297 | Bacteria | 18393 |
| 170 | Ga0209758_1002971 | 3300025297 | Bacteria | 16255 |
| 171 | Ga0209758_1006840 | 3300025297 | Bacteria | 7988 |
| 172 | Ga0209758_1021842 | 3300025297 | Bacteria | 2964 |
| 173 | Ga0209758_1026572 | 3300025297 | Bacteria | 2500 |
| 174 | Ga0209256_1007102 | 3300025299 | Bacteria | 5650 |
| 175 | Ga0207426_1001611 | 3300025302 | Bacteria | 17898 |
| 176 | Ga0207426_1002230 | 3300025302 | Bacteria | 12929 |
| 177 | Ga0209257_1000778 | 3300025304 | Bacteria | 47189 |
| 178 | Ga0207656_10032185 | 3300025321 | Bacteria | 2177 |
| 179 | Ga0207656_10106012 | 3300025321 | Bacteria | 1294 |
| 180 | Ga0207692_10064080 | 3300025898 | Bacteria | 1912 |
| 181 | Ga0207688_10076931 | 3300025901 | Bacteria | 1901 |
| 182 | Ga0207647_10002062 | 3300025904 | Bacteria | 15355 |
| 183 | Ga0207647_10039838 | 3300025904 | Bacteria | 2962 |
| 184 | Ga0207685_10017833 | 3300025905 | Bacteria | 2306 |
| 185 | Ga0207699_10024107 | 3300025906 | Bacteria | 3322 |
| 186 | Ga0207705_10028807 | 3300025909 | Bacteria | 3958 |
| 187 | Ga0207684_10067768 | 3300025910 | Bacteria | 3033 |
| 188 | Ga0207654_10000152 | 3300025911 | Bacteria | 43823 |
| 189 | Ga0207654_10018076 | 3300025911 | Bacteria | 3696 |
| 190 | Ga0207654_10047597 | 3300025911 | Bacteria | 2451 |
| 191 | Ga0207707_10001578 | 3300025912 | Bacteria | 20995 |
| 192 | Ga0207707_10119841 | 3300025912 | Bacteria | 2300 |
| 193 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 194 | Ga0207695_10009228 | 3300025913 | Bacteria | 12223 |
| 195 | Ga0207695_10032161 | 3300025913 | Bacteria | 5744 |
| 196 | Ga0207671_10031638 | 3300025914 | Bacteria | 3943 |
| 197 | Ga0207671_10043870 | 3300025914 | Bacteria | 3306 |
| 198 | Ga0207671_10100387 | 3300025914 | Bacteria | 2191 |
| 199 | Ga0207671_10240098 | 3300025914 | Bacteria | 1423 |
| 200 | Ga0207693_10035603 | 3300025915 | Bacteria | 3924 |
| 201 | Ga0207693_10071069 | 3300025915 | Bacteria | 2723 |
| 202 | Ga0207663_10022968 | 3300025916 | Bacteria | 3572 |
| 203 | Ga0207660_10025124 | 3300025917 | Bacteria | 4042 |
| 204 | Ga0207657_10003352 | 3300025919 | Bacteria | 17135 |
| 205 | Ga0207652_10185062 | 3300025921 | Bacteria | 1873 |
| 206 | Ga0207694_10000106 | 3300025924 | Bacteria | 88467 |
| 207 | Ga0207687_10015988 | 3300025927 | Bacteria | 4923 |
| 208 | Ga0207687_10127767 | 3300025927 | Bacteria | 1911 |
| 209 | Ga0207687_10232942 | 3300025927 | Bacteria | 1456 |
| 210 | Ga0207700_10037283 | 3300025928 | Bacteria | 3519 |
| 211 | Ga0207700_10044600 | 3300025928 | Bacteria | 3265 |
| 212 | Ga0207664_10278062 | 3300025929 | Bacteria | 1468 |
| 213 | Ga0207690_10117365 | 3300025932 | Bacteria | 1926 |
| 214 | Ga0207706_10033116 | 3300025933 | Bacteria | 4600 |
| 215 | Ga0207706_10147618 | 3300025933 | Bacteria | 2069 |
| 216 | Ga0207706_10208319 | 3300025933 | Bacteria | 1714 |
| 217 | Ga0207709_10182366 | 3300025935 | Bacteria | 1484 |
| 218 | Ga0207665_10181823 | 3300025939 | Bacteria | 1523 |
| 219 | Ga0207711_10093621 | 3300025941 | Bacteria | 2647 |
| 220 | Ga0207711_10352338 | 3300025941 | Bacteria | 1363 |
| 221 | Ga0207689_10138006 | 3300025942 | Bacteria | 2008 |
| 222 | Ga0207661_10001342 | 3300025944 | Bacteria | 16514 |
| 223 | Ga0207661_10061223 | 3300025944 | Bacteria | 3040 |
| 224 | Ga0207679_10164670 | 3300025945 | Bacteria | 1819 |
| 225 | Ga0207640_10052250 | 3300025981 | Bacteria | 2661 |
| 226 | Ga0207640_10101287 | 3300025981 | Bacteria | 2020 |
| 227 | Ga0207658_10045657 | 3300025986 | Bacteria | 3195 |
| 228 | Ga0207677_10022538 | 3300026023 | Bacteria | 3873 |
| 229 | Ga0207703_10182084 | 3300026035 | Bacteria | 1855 |
| 230 | Ga0207703_10275308 | 3300026035 | Bacteria | 1526 |
| 231 | Ga0207639_10132669 | 3300026041 | Bacteria | 2064 |
| 232 | Ga0207678_10056281 | 3300026067 | Bacteria | 3386 |
| 233 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 234 | Ga0207702_10000589 | 3300026078 | Bacteria | 40161 |
| 235 | Ga0207702_10021167 | 3300026078 | Bacteria | 5382 |
| 236 | Ga0207641_10065105 | 3300026088 | Bacteria | 3117 |
| 237 | Ga0207674_10063655 | 3300026116 | Bacteria | 3723 |
| 238 | Ga0207674_10144467 | 3300026116 | Bacteria | 2338 |
| 239 | Ga0207674_10147136 | 3300026116 | Bacteria | 2314 |
| 240 | Ga0207675_100083006 | 3300026118 | Bacteria | 3005 |
| 241 | Ga0207675_100201581 | 3300026118 | Bacteria | 1911 |
| 242 | Ga0207683_10069852 | 3300026121 | Bacteria | 3102 |
| 243 | Ga0207698_10075416 | 3300026142 | Bacteria | 2695 |
| 244 | Ga0207698_10163306 | 3300026142 | Bacteria | 1951 |
| 245 | Ga0209389_1000064 | 3300027296 | Bacteria | 102177 |
| 246 | Ga0209389_1000104 | 3300027296 | Bacteria | 75132 |
| 247 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 248 | Ga0209589_1000159 | 3300027357 | Bacteria | 75132 |
| 249 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 250 | Ga0209489_100194 | 3300027361 | Bacteria | 97679 |
| 251 | Ga0209489_104884 | 3300027361 | Bacteria | 24104 |
| 252 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 253 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 254 | Ga0268266_10003301 | 3300028379 | Bacteria | 16212 |
| 255 | Ga0268266_10004550 | 3300028379 | Bacteria | 13252 |
| 256 | Ga0268266_10009757 | 3300028379 | Bacteria | 8445 |
| 257 | Ga0268266_10047642 | 3300028379 | Bacteria | 3673 |
| 258 | Ga0268266_10123600 | 3300028379 | Bacteria | 2306 |
| 259 | Ga0268266_10189197 | 3300028379 | Bacteria | 1878 |
| 260 | Ga0268266_10305926 | 3300028379 | Bacteria | 1484 |
| 261 | Ga0268265_10197456 | 3300028380 | Bacteria | 1742 |
| 262 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 263 | Ga0268264_10146383 | 3300028381 | Bacteria | 2113 |
| 264 | Ga0265319_1001409 | 3300028563 | Bacteria | 14410 |
| 265 | Ga0265334_10001624 | 3300028573 | Bacteria | 10806 |
| 266 | Ga0265334_10025996 | 3300028573 | Bacteria | 2366 |
| 267 | Ga0265323_10000684 | 3300028653 | Bacteria | 18453 |
| 268 | Ga0265336_10000459 | 3300028666 | Bacteria | 24631 |
| 269 | Ga0307517_10002574 | 3300028786 | Bacteria | 28885 |
| 270 | Ga0307515_10027983 | 3300028794 | Bacteria | 9602 |
| 271 | Ga0265338_10002741 | 3300028800 | Bacteria | 25847 |
| 272 | Ga0265324_10002054 | 3300029957 | Bacteria | 10690 |
| 273 | Ga0265330_10003717 | 3300031235 | Bacteria | 7899 |
| 274 | Ga0265332_10096871 | 3300031238 | Bacteria | 1246 |
| 275 | Ga0265325_10004205 | 3300031241 | Bacteria | 9143 |
| 276 | Ga0265340_10047370 | 3300031247 | Bacteria | 2094 |
| 277 | Ga0265339_10000343 | 3300031249 | Bacteria | 37462 |
| 278 | Ga0265339_10014756 | 3300031249 | Bacteria | 4703 |
| 279 | Ga0265331_10009516 | 3300031250 | Bacteria | 5450 |
| 280 | Ga0265331_10031235 | 3300031250 | Bacteria | 2647 |
| 281 | Ga0307513_10129649 | 3300031456 | Bacteria | 2470 |
| 282 | Ga0307509_10035847 | 3300031507 | Bacteria | 5439 |
| 283 | Ga0307509_10042195 | 3300031507 | Bacteria | 4945 |
| 284 | Ga0265313_10056176 | 3300031595 | Bacteria | 1862 |
| 285 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 286 | Ga0307508_10020956 | 3300031616 | Bacteria | 5941 |
| 287 | Ga0265314_10007141 | 3300031711 | Bacteria | 9733 |
| 288 | Ga0265314_10024387 | 3300031711 | Bacteria | 4587 |
| 289 | Ga0307516_10006998 | 3300031730 | Bacteria | 13079 |
| 290 | Ga0307516_10080619 | 3300031730 | Bacteria | 3099 |
| 291 | Ga0307405_10065596 | 3300031731 | Bacteria | 2312 |
| 292 | Ga0307412_10063995 | 3300031911 | Bacteria | 2484 |
| 293 | Ga0307411_10059356 | 3300032005 | Bacteria | 2536 |
| 294 | Ga0307415_100035272 | 3300032126 | Bacteria | 3266 |
| 295 | Ga0307415_100262554 | 3300032126 | Bacteria | 1410 |
| 296 | Ga0307510_10002191 | 3300033180 | Bacteria | 22082 |
| 297 | Ga0307510_10014423 | 3300033180 | Bacteria | 9354 |
| 298 | Ga0307510_10073938 | 3300033180 | Bacteria | 3372 |
| 299 | Ga0307510_10093620 | 3300033180 | Bacteria | 2835 |
| 300 | Ga0315911_1000048 | 3300033442 | Bacteria | 39245 |
| 301 | Ga0373923_0016103 | 3300035111 | Bacteria | 2833 |
| 302 | Ga0373932_0033681 | 3300035112 | Bacteria | 1440 |
| 303 | Ga0373936_0003688 | 3300035113 | Bacteria | 5750 |
| 304 | Ga0373941_0037501 | 3300035115 | Bacteria | 1479 |
| 305 | Ga0373953_0007388 | 3300035117 | Bacteria | 3677 |
| 306 | Ga0373954_0000308 | 3300035118 | Bacteria | 17778 |
| 307 | Ga0373956_0004549 | 3300035119 | Bacteria | 5535 |
| 308 | Ga0373957_0008118 | 3300035120 | Bacteria | 3389 |
| 309 | Ga0373943_0006410 | 3300035170 | Bacteria | 5282 |
| 310 | Ga0373946_0029352 | 3300035171 | Bacteria | 2188 |
| 311 | Ga0373955_0000479 | 3300035172 | Bacteria | 16897 |
| 312 | Ga0373955_0020868 | 3300035172 | Bacteria | 3298 |
| 313 | Ga0373924_0003769 | 3300035410 | Bacteria | 5241 |
| 314 | Ga0373931_0004987 | 3300035691 | Bacteria | 6106 |
| 315 | Ga0373935_0000119 | 3300035692 | Bacteria | 35716 |
| 316 | Ga0373935_0032120 | 3300035692 | Bacteria | 3261 |
| 317 | Ga0373935_0181812 | 3300035692 | Bacteria | 1444 |
| 318 | Ga0373927_0000965 | 3300035695 | Bacteria | 21865 |
| 319 | Ga0373927_0003633 | 3300035695 | Bacteria | 11005 |
| 320 | Ga0373927_0015399 | 3300035695 | Bacteria | 5054 |
| 321 | Ga0373927_0030573 | 3300035695 | Bacteria | 3513 |
| 322 | Ga0373933_0050571 | 3300035724 | Bacteria | 2481 |
| 323 | Ga0373947_0001785 | 3300035725 | Bacteria | 13162 |
| 324 | Ga0373947_0007763 | 3300035725 | Bacteria | 6199 |
| 325 | Ga0373947_0105965 | 3300035725 | Bacteria | 1771 |
| 326 | Ga0373937_0005638 | 3300036401 | Bacteria | 10748 |
| 327 | Ga0373925_0053272 | 3300037068 | Bacteria | 3024 |
| 328 | Ga0373925_0091624 | 3300037068 | Bacteria | 2324 |
| 329 | Ga0373925_0175657 | 3300037068 | Bacteria | 1693 |
| 330 | Ga0395899_0040702 | 3300037312 | Bacteria | 3475 |
| 331 | Ga0395900_0015618 | 3300037418 | Bacteria | 7740 |
| 332 | Ga0395900_0456718 | 3300037418 | Bacteria | 1233 |
| 333 | Ga0395898_0002946 | 3300037466 | Bacteria | 19369 |
| 334 | Ga0395898_0009257 | 3300037466 | Bacteria | 10358 |
| 335 | Ga0395898_0082873 | 3300037466 | Bacteria | 3091 |
| 336 | Ga0395898_0083383 | 3300037466 | Bacteria | 3081 |
| 337 | Ga0395898_0138484 | 3300037466 | Bacteria | 2330 |
| 338 | Ga0395905_0003015 | 3300037471 | Bacteria | 18245 |
| 339 | Ga0395905_0211709 | 3300037471 | Bacteria | 1816 |
| 340 | Ga0436364_1382509 | 3300037853 | Bacteria | 6764 |
| 341 | Ga0436364_1512892 | 3300037853 | Bacteria | 3232 |
| 342 | Ga0395901_0124917 | 3300038443 | Bacteria | 2704 |
| 343 | Ga0395901_0151820 | 3300038443 | Bacteria | 2434 |
| 344 | Ga0395901_0265344 | 3300038443 | Bacteria | 1786 |
| 345 | Ga0436365_0697893 | 3300039437 | Bacteria | 2599 |
| 346 | Ga0436365_1141460 | 3300039437 | Bacteria | 3527 |
| 347 | Ga0436365_1777612 | 3300039437 | Bacteria | 1907 |
| 348 | Ga0436360_1291699 | 3300039438 | Bacteria | 1512 |
| 349 | Ga0436361_0471583 | 3300039447 | Bacteria | 1936 |
| 350 | Ga0436361_0907816 | 3300039447 | Bacteria | 1991 |
| 351 | Ga0436363_0668067 | 3300039450 | Bacteria | 2345 |
| 352 | Ga0436363_1460349 | 3300039450 | Bacteria | 10788 |
| 353 | Ga0436362_0510213 | 3300039453 | Bacteria | 2827 |
| 354 | Ga0466972_0000286 | 3300044658 | Bacteria | 31359 |
| 355 | Ga0466966_0005407 | 3300044684 | Bacteria | 8394 |
| 356 | Ga0466961_0000446 | 3300044693 | Bacteria | 26385 |
| 357 | Ga0466963_0005316 | 3300044694 | Bacteria | 7528 |
| 358 | Ga0453684_0094548 | 3300044712 | Bacteria | 3676 |
| 359 | Ga0466968_0106923 | 3300044735 | Bacteria | 1255 |
| 360 | Ga0466957_0149870 | 3300044842 | Bacteria | 1508 |
| 361 | Ga0451576_0057030 | 3300045051 | Bacteria | 4083 |
| 362 | Ga0466967_0018622 | 3300045976 | Bacteria | 5556 |
| 363 | Ga0466967_0053723 | 3300045976 | Bacteria | 3542 |
| 364 | Ga0466967_0090278 | 3300045976 | Bacteria | 2783 |
| 365 | Ga0495592_0001710 | 3300046454 | Bacteria | 15422 |
| 366 | Ga0495592_0002892 | 3300046454 | Bacteria | 12210 |
| 367 | Ga0495603_0001895 | 3300046455 | Bacteria | 12342 |
| 368 | Ga0495629_0000348 | 3300046459 | Bacteria | 39364 |
| 369 | Ga0495629_0000353 | 3300046459 | Bacteria | 39092 |
| 370 | Ga0495638_0008632 | 3300046460 | Bacteria | 7207 |
| 371 | Ga0495641_0000972 | 3300046461 | Bacteria | 24598 |
| 372 | Ga0495651_0005720 | 3300046462 | Bacteria | 9474 |
| 373 | Ga0495651_0023259 | 3300046462 | Bacteria | 4820 |
| 374 | Ga0495653_0009258 | 3300046463 | Bacteria | 8057 |
| 375 | Ga0495653_0074094 | 3300046463 | Bacteria | 2538 |
| 376 | Ga0495653_0117196 | 3300046463 | Bacteria | 1903 |
| 377 | Ga0495580_0004944 | 3300046472 | Bacteria | 11142 |
| 378 | Ga0495580_0120636 | 3300046472 | Bacteria | 1820 |
| 379 | Ga0495582_0000444 | 3300046473 | Bacteria | 22534 |
| 380 | Ga0495582_0079158 | 3300046473 | Bacteria | 1824 |
| 381 | Ga0495639_0000177 | 3300046475 | Bacteria | 33573 |
| 382 | Ga0495639_0014881 | 3300046475 | Bacteria | 3371 |
| 383 | Ga0495662_0011228 | 3300046476 | Bacteria | 4378 |
| 384 | Ga0495664_0007231 | 3300046477 | Bacteria | 6158 |
| 385 | Ga0495664_0025870 | 3300046477 | Bacteria | 3417 |
| 386 | Ga0495664_0062816 | 3300046477 | Bacteria | 2212 |
| 387 | Ga0495664_0083223 | 3300046477 | Bacteria | 1920 |
| 388 | Ga0495585_0060854 | 3300046492 | Bacteria | 2077 |
| 389 | Ga0495594_0000079 | 3300046499 | Bacteria | 42880 |
| 390 | Ga0495583_0055014 | 3300046506 | Bacteria | 1800 |
| 391 | Ga0495606_0000901 | 3300046507 | Bacteria | 44189 |
| 392 | Ga0495608_0000368 | 3300046511 | Bacteria | 31510 |
| 393 | Ga0495608_0014344 | 3300046511 | Bacteria | 5499 |
| 394 | Ga0495610_0000019 | 3300046512 | Bacteria | 351524 |
| 395 | Ga0495620_0075482 | 3300046515 | Bacteria | 1371 |
| 396 | Ga0495628_0003575 | 3300046516 | Bacteria | 13912 |
| 397 | Ga0495628_0053632 | 3300046516 | Bacteria | 3181 |
| 398 | Ga0495628_0055589 | 3300046516 | Bacteria | 3117 |
| 399 | Ga0495628_0072261 | 3300046516 | Bacteria | 2688 |
| 400 | Ga0495630_0011873 | 3300046517 | Bacteria | 6315 |
| 401 | Ga0495630_0140714 | 3300046517 | Bacteria | 1835 |
| 402 | Ga0495648_0050416 | 3300046524 | Bacteria | 2543 |
| 403 | Ga0495666_0018810 | 3300046526 | Bacteria | 3432 |
| 404 | Ga0495652_0003538 | 3300046529 | Bacteria | 15351 |
| 405 | Ga0495665_0000570 | 3300046531 | Bacteria | 18750 |
| 406 | Ga0495640_0008034 | 3300046533 | Bacteria | 8288 |
| 407 | Ga0495640_0021203 | 3300046533 | Bacteria | 4772 |
| 408 | Ga0495640_0029702 | 3300046533 | Bacteria | 3921 |
| 409 | Ga0495587_0010725 | 3300046536 | Bacteria | 5818 |
| 410 | Ga0495587_0053316 | 3300046536 | Bacteria | 2384 |
| 411 | Ga0495598_0001754 | 3300046537 | Bacteria | 4354 |
| 412 | Ga0495598_0013621 | 3300046537 | Bacteria | 2020 |
| 413 | Ga0495645_0004492 | 3300046543 | Bacteria | 9524 |
| 414 | Ga0495645_0023317 | 3300046543 | Bacteria | 4481 |
| 415 | Ga0495645_0142379 | 3300046543 | Bacteria | 1672 |
| 416 | Ga0495622_0000888 | 3300046557 | Bacteria | 16299 |
| 417 | Ga0495622_0013293 | 3300046557 | Bacteria | 3819 |
| 418 | Ga0495667_0006624 | 3300046559 | Bacteria | 7864 |
| 419 | Ga0495667_0007023 | 3300046559 | Bacteria | 7640 |
| 420 | Ga0495656_0001212 | 3300046615 | Bacteria | 8399 |
| 421 | Ga0495634_0000334 | 3300046642 | Bacteria | 45432 |
| 422 | Ga0495634_0004641 | 3300046642 | Bacteria | 10705 |
| 423 | Ga0495625_0045332 | 3300046660 | Bacteria | 3179 |
| 424 | Ga0495625_0195401 | 3300046660 | Bacteria | 1338 |
| 425 | Ga0495635_0000372 | 3300046663 | Bacteria | 28497 |
| 426 | Ga0495635_0035680 | 3300046663 | Bacteria | 3447 |
| 427 | Ga0495635_0062948 | 3300046663 | Bacteria | 2547 |
| 428 | Ga0495635_0132037 | 3300046663 | Bacteria | 1702 |
| 429 | Ga0495635_0248920 | 3300046663 | Bacteria | 1198 |
| 430 | Ga0495659_0007020 | 3300046664 | Bacteria | 3566 |
| 431 | Ga0495588_0017434 | 3300046674 | Bacteria | 3488 |
| 432 | Ga0495657_0006148 | 3300046675 | Bacteria | 9409 |
| 433 | Ga0495657_0010390 | 3300046675 | Bacteria | 7007 |
| 434 | Ga0495657_0044452 | 3300046675 | Bacteria | 3021 |
| 435 | Ga0495599_0009058 | 3300046678 | Bacteria | 6065 |
| 436 | Ga0495599_0014706 | 3300046678 | Bacteria | 4846 |
| 437 | Ga0495623_0073399 | 3300046679 | Bacteria | 2126 |
| 438 | Ga0495623_0079436 | 3300046679 | Bacteria | 2032 |
| 439 | Ga0495646_0003761 | 3300046680 | Bacteria | 9487 |
| 440 | Ga0495646_0017020 | 3300046680 | Bacteria | 4615 |
| 441 | Ga0495647_0000894 | 3300046681 | Bacteria | 8932 |
| 442 | Ga0495658_0000416 | 3300046683 | Bacteria | 23941 |
| 443 | Ga0495613_0013379 | 3300046689 | Bacteria | 6095 |
| 444 | Ga0495613_0043461 | 3300046689 | Bacteria | 3324 |
| 445 | Ga0495624_0003210 | 3300046690 | Bacteria | 12180 |
| 446 | Ga0495600_0001217 | 3300046809 | Bacteria | 14087 |
| 447 | Ga0495600_0004048 | 3300046809 | Bacteria | 8715 |
| 448 | Ga0495600_0039333 | 3300046809 | Bacteria | 3080 |
| 449 | Ga0495581_0000426 | 3300047315 | Bacteria | 21399 |
| 450 | Ga0495581_0174638 | 3300047315 | Bacteria | 1256 |
| 451 | Ga0495604_0005876 | 3300047317 | Bacteria | 9727 |
| 452 | Ga0495604_0010461 | 3300047317 | Bacteria | 7352 |
| 453 | Ga0495604_0012415 | 3300047317 | Bacteria | 6772 |
| 454 | Ga0495604_0138076 | 3300047317 | Bacteria | 1745 |
| 455 | Ga0495636_0075605 | 3300047318 | Bacteria | 1444 |
| 456 | Ga0495674_0000533 | 3300047319 | Bacteria | 35160 |
| 457 | Ga0495674_0018626 | 3300047319 | Bacteria | 6462 |
| 458 | Ga0495674_0018661 | 3300047319 | Bacteria | 6454 |
| 459 | Ga0495674_0024836 | 3300047319 | Bacteria | 5501 |
| 460 | Ga0495676_0056064 | 3300047321 | Bacteria | 3119 |
| 461 | Ga0495680_0002856 | 3300047322 | Bacteria | 17361 |
| 462 | Ga0495680_0007925 | 3300047322 | Bacteria | 9687 |
| 463 | Ga0495680_0076618 | 3300047322 | Bacteria | 2535 |
| 464 | Ga0495675_0003518 | 3300047444 | Bacteria | 9440 |
| 465 | Ga0495675_0094781 | 3300047444 | Bacteria | 1871 |
| 466 | Ga0495675_0153681 | 3300047444 | Bacteria | 1420 |
| 467 | Ga0495673_0019403 | 3300047469 | Bacteria | 3407 |
| 468 | Ga0495684_0001014 | 3300047471 | Bacteria | 22867 |
| 469 | Ga0495686_0028879 | 3300047472 | Bacteria | 3610 |
| 470 | Ga0495593_0004444 | 3300047673 | Bacteria | 8330 |
| 471 | Ga0495602_0005816 | 3300048088 | Bacteria | 12942 |
| 472 | Ga0495602_0010096 | 3300048088 | Bacteria | 9800 |
| 473 | Ga0495602_0281441 | 3300048088 | Bacteria | 1225 |
| 474 | Ga0495614_0038997 | 3300048089 | Bacteria | 2039 |
| 475 | Ga0496100_0072280 | 3300048903 | Bacteria | 2305 |
| 476 | Ga0496100_0106717 | 3300048903 | Bacteria | 1939 |
| 477 | Ga0496100_0205035 | 3300048903 | Bacteria | 1439 |
| 478 | Ga0496101_0003771 | 3300048904 | Bacteria | 9467 |
| 479 | Ga0496101_0263915 | 3300048904 | Bacteria | 1343 |
| 480 | Ga0496102_0005218 | 3300048905 | Bacteria | 11031 |
| 481 | Ga0496102_0066931 | 3300048905 | Bacteria | 3294 |
| 482 | Ga0496102_0167530 | 3300048905 | Bacteria | 2068 |
| 483 | Ga0496102_0326701 | 3300048905 | Bacteria | 1445 |
| 484 | Ga0496103_0001945 | 3300048906 | Bacteria | 13352 |
| 485 | Ga0496103_0196965 | 3300048906 | Bacteria | 1295 |
| 486 | Ga0496104_0001811 | 3300048907 | Bacteria | 18534 |
| 487 | Ga0496104_0016231 | 3300048907 | Bacteria | 6762 |
| 488 | Ga0496104_0022194 | 3300048907 | Bacteria | 5830 |
| 489 | Ga0496104_0093971 | 3300048907 | Bacteria | 2868 |
| 490 | Ga0496104_0098594 | 3300048907 | Bacteria | 2797 |
| 491 | Ga0496104_0217238 | 3300048907 | Bacteria | 1824 |
| 492 | Ga0496105_0005991 | 3300048908 | Bacteria | 9282 |
| 493 | Ga0496105_0019070 | 3300048908 | Bacteria | 5528 |
| 494 | Ga0496105_0029405 | 3300048908 | Bacteria | 4498 |
| 495 | Ga0496105_0051296 | 3300048908 | Bacteria | 3408 |
| 496 | Ga0496107_0003550 | 3300048910 | Bacteria | 10446 |
| 497 | Ga0496107_0035584 | 3300048910 | Bacteria | 3570 |
| 498 | Ga0496107_0246505 | 3300048910 | Bacteria | 1329 |
| 499 | Ga0496108_0002680 | 3300048911 | Bacteria | 14261 |
| 500 | Ga0496108_0010972 | 3300048911 | Bacteria | 7358 |
| 501 | Ga0496108_0022679 | 3300048911 | Bacteria | 5163 |
| 502 | Ga0496109_0002643 | 3300048912 | Bacteria | 15023 |
| 503 | Ga0496109_0011126 | 3300048912 | Bacteria | 7717 |
| 504 | Ga0496109_0073228 | 3300048912 | Bacteria | 3148 |
| 505 | Ga0496109_0073804 | 3300048912 | Bacteria | 3135 |
| 506 | Ga0496109_0093698 | 3300048912 | Bacteria | 2779 |
| 507 | Ga0496109_0287308 | 3300048912 | Bacteria | 1550 |
| 508 | Ga0496110_0007857 | 3300048913 | Bacteria | 8545 |
| 509 | Ga0496110_0068203 | 3300048913 | Bacteria | 3148 |
| 510 | Ga0496110_0126387 | 3300048913 | Bacteria | 2307 |
| 511 | Ga0496110_0204272 | 3300048913 | Bacteria | 1795 |
| 512 | Ga0496111_0047714 | 3300048914 | Bacteria | 3084 |
| 513 | Ga0496111_0071439 | 3300048914 | Bacteria | 2526 |
| 514 | Ga0496112_0056475 | 3300048915 | Bacteria | 3863 |
| 515 | Ga0496112_0083898 | 3300048915 | Bacteria | 3151 |
| 516 | Ga0496112_0134483 | 3300048915 | Bacteria | 2443 |
| 517 | Ga0496112_0360592 | 3300048915 | Bacteria | 1395 |
| 518 | Ga0496112_0382484 | 3300048915 | Bacteria | 1348 |
| 519 | Ga0496113_0006395 | 3300048916 | Bacteria | 7460 |
| 520 | Ga0496113_0035172 | 3300048916 | Bacteria | 3662 |
| 521 | Ga0496113_0067749 | 3300048916 | Bacteria | 2707 |
| 522 | Ga0496113_0137080 | 3300048916 | Bacteria | 1923 |
| 523 | Ga0496114_0030213 | 3300048917 | Bacteria | 4457 |
| 524 | Ga0496114_0075310 | 3300048917 | Bacteria | 2842 |
| 525 | Ga0496114_0080809 | 3300048917 | Bacteria | 2745 |
| 526 | Ga0496115_0002700 | 3300048918 | Bacteria | 12739 |
| 527 | Ga0496115_0006372 | 3300048918 | Bacteria | 8646 |
| 528 | Ga0496115_0029230 | 3300048918 | Bacteria | 4327 |
| 529 | Ga0496115_0045620 | 3300048918 | Bacteria | 3500 |
| 530 | Ga0496115_0057962 | 3300048918 | Bacteria | 3116 |
| 531 | Ga0496115_0093853 | 3300048918 | Bacteria | 2454 |
| 532 | Ga0496115_0255972 | 3300048918 | Bacteria | 1440 |
| 533 | Ga0496117_0054649 | 3300048920 | Bacteria | 2796 |
| 534 | Ga0496117_0112018 | 3300048920 | Bacteria | 1698 |
| 535 | Ga0496118_0005790 | 3300048921 | Bacteria | 13871 |
| 536 | Ga0496118_0013973 | 3300048921 | Bacteria | 7546 |
| 537 | Ga0496118_0190073 | 3300048921 | Bacteria | 1229 |
| 538 | Ga0496119_0033766 | 3300048922 | Bacteria | 3385 |
| 539 | Ga0496119_0075898 | 3300048922 | Bacteria | 1951 |
| 540 | Ga0496120_0041545 | 3300048923 | Bacteria | 2692 |
| 541 | Ga0496120_0106933 | 3300048923 | Bacteria | 1468 |
| 542 | Ga0496120_0144660 | 3300048923 | Bacteria | 1202 |
| 543 | Ga0496121_0000194 | 3300048924 | Bacteria | 136324 |
| 544 | Ga0496121_0001272 | 3300048924 | Bacteria | 43421 |
| 545 | Ga0496121_0017298 | 3300048924 | Bacteria | 7374 |
| 546 | Ga0496121_0020252 | 3300048924 | Bacteria | 6596 |
| 547 | Ga0496121_0125503 | 3300048924 | Bacteria | 1930 |
| 548 | Ga0496121_0157641 | 3300048924 | Bacteria | 1664 |
| 549 | Ga0496121_0255556 | 3300048924 | Bacteria | 1213 |
| 550 | Ga0496123_0080063 | 3300048926 | Bacteria | 1993 |
| 551 | Ga0496124_0001012 | 3300048927 | Bacteria | 44554 |
| 552 | Ga0496124_0115552 | 3300048927 | Bacteria | 2153 |
| 553 | Ga0496124_0205458 | 3300048927 | Bacteria | 1494 |
| 554 | Ga0496125_0000420 | 3300048928 | Bacteria | 78930 |
| 555 | Ga0496125_0001161 | 3300048928 | Bacteria | 39899 |
| 556 | Ga0496125_0034253 | 3300048928 | Bacteria | 4479 |
| 557 | Ga0496125_0037965 | 3300048928 | Bacteria | 4179 |
| 558 | Ga0496125_0137389 | 3300048928 | Bacteria | 1707 |
| 559 | Ga0496125_0198570 | 3300048928 | Bacteria | 1316 |
| 560 | Ga0496126_0003575 | 3300048929 | Bacteria | 19498 |
| 561 | Ga0496126_0007151 | 3300048929 | Bacteria | 12291 |
| 562 | Ga0496126_0027937 | 3300048929 | Bacteria | 5380 |
| 563 | Ga0496126_0037272 | 3300048929 | Bacteria | 4539 |
| 564 | Ga0496126_0047051 | 3300048929 | Bacteria | 3951 |
| 565 | Ga0496126_0048014 | 3300048929 | Bacteria | 3905 |
| 566 | Ga0496126_0099199 | 3300048929 | Bacteria | 2551 |
| 567 | Ga0496126_0108539 | 3300048929 | Bacteria | 2420 |
| 568 | Ga0496126_0131325 | 3300048929 | Bacteria | 2164 |
| 569 | Ga0496126_0149804 | 3300048929 | Bacteria | 2000 |
| 570 | Ga0496126_0371795 | 3300048929 | Bacteria | 1165 |
| 571 | Ga0501032_0141930 | 3300049569 | Bacteria | 1582 |
| 572 | Ga0501033_0128637 | 3300049570 | Bacteria | 1835 |
| 573 | Ga0501033_0157019 | 3300049570 | Bacteria | 1639 |
| 574 | Ga0501036_0092289 | 3300049572 | Bacteria | 2558 |
| 575 | Ga0501043_0035870 | 3300049579 | Bacteria | 3902 |
| 576 | Ga0501046_0045107 | 3300049580 | Bacteria | 3504 |
| 577 | Ga0501047_0048177 | 3300049581 | Bacteria | 4115 |
| 578 | Ga0501047_0181987 | 3300049581 | Bacteria | 1968 |
| 579 | Ga0501067_0125022 | 3300049583 | Bacteria | 1431 |
| 580 | Ga0501069_0097565 | 3300049585 | Bacteria | 1666 |
| 581 | Ga0501070_0011799 | 3300049586 | Bacteria | 7381 |
| 582 | Ga0501074_0043112 | 3300049590 | Bacteria | 3265 |
| 583 | Ga0501044_0043051 | 3300049823 | Bacteria | 4692 |
| 584 | Ga0501044_0087964 | 3300049823 | Bacteria | 3137 |
| 585 | Ga0501044_0091454 | 3300049823 | Bacteria | 3069 |
| 586 | nmdc:mga03n38_4951_c1 | 3300050490 | Bacteria | 4476 |
| 587 | nmdc:mga03n38_5383_c1 | 3300050490 | Bacteria | 4352 |
| 588 | nmdc:mga07m45_11152_c1 | 3300050496 | Bacteria | 4716 |
| 589 | nmdc:mga07m45_24236_c1 | 3300050496 | Bacteria | 3322 |
| 590 | nmdc:mga07m45_4399_c1 | 3300050496 | Bacteria | 6896 |
| 591 | nmdc:mga0n895_4662_c1 | 3300050512 | Bacteria | 11308 |
| 592 | Ga0495601_0019123 | 3300053077 | Bacteria | 4175 |
| 593 | Ga0495601_0139632 | 3300053077 | Bacteria | 1580 |
| 594 | Ga0500635_0006999 | 3300053080 | Bacteria | 3039 |
| 595 | Ga0500635_0048824 | 3300053080 | Bacteria | 1442 |
| 596 | Ga0495595_0002712 | 3300053084 | Bacteria | 6944 |
| 597 | Ga0495619_0005683 | 3300053085 | Bacteria | 7908 |
| 598 | Ga0500578_0089271 | 3300053086 | Bacteria | 1957 |
| 599 | Ga0500643_000270 | 3300053087 | Bacteria | 45829 |
| 600 | Ga0500566_0000022 | 3300053094 | Bacteria | 81784 |
| 601 | Ga0500566_0005084 | 3300053094 | Bacteria | 7841 |
| 602 | Ga0500640_011905 | 3300053095 | Bacteria | 3558 |
| 603 | Ga0500641_0002387 | 3300053096 | Bacteria | 6661 |
| 604 | Ga0500641_0002665 | 3300053096 | Bacteria | 6302 |
| 605 | Ga0500650_0059284 | 3300053098 | Bacteria | 1786 |
| 606 | Ga0500554_002353 | 3300053102 | Bacteria | 3708 |
| 607 | Ga0500555_002818 | 3300053103 | Bacteria | 4985 |
| 608 | Ga0500556_0000306 | 3300053104 | Bacteria | 37363 |
| 609 | Ga0500557_000026 | 3300053105 | Bacteria | 81867 |
| 610 | Ga0500569_046832 | 3300053109 | Bacteria | 1290 |
| 611 | Ga0500572_001109 | 3300053111 | Bacteria | 7863 |
| 612 | Ga0500572_021422 | 3300053111 | Bacteria | 1711 |
| 613 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 614 | Ga0500595_005768 | 3300053119 | Bacteria | 5352 |
| 615 | Ga0500595_006420 | 3300053119 | Bacteria | 4990 |
| 616 | Ga0500608_008047 | 3300053122 | Bacteria | 4405 |
| 617 | Ga0500614_002834 | 3300053123 | Bacteria | 3809 |
| 618 | Ga0500642_0000091 | 3300053130 | Bacteria | 45704 |
| 619 | Ga0500559_0000219 | 3300053136 | Bacteria | 45843 |
| 620 | Ga0500559_0002476 | 3300053136 | Bacteria | 9527 |
| 621 | Ga0500568_0011063 | 3300053139 | Bacteria | 4203 |
| 622 | Ga0500568_0045000 | 3300053139 | Bacteria | 1758 |
| 623 | Ga0500573_0095248 | 3300053140 | Bacteria | 1678 |
| 624 | Ga0500590_016900 | 3300053148 | Bacteria | 3772 |
| 625 | Ga0500603_000192 | 3300053150 | Bacteria | 15937 |
| 626 | Ga0500603_000199 | 3300053150 | Bacteria | 15731 |
| 627 | Ga0500604_0039195 | 3300053151 | Bacteria | 1424 |
| 628 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 629 | Ga0500616_0021691 | 3300053153 | Bacteria | 3597 |
| 630 | Ga0500620_030897 | 3300053155 | Bacteria | 1694 |
| 631 | Ga0500622_0006911 | 3300053156 | Bacteria | 6508 |
| 632 | Ga0500627_0050982 | 3300053158 | Bacteria | 1804 |
| 633 | Ga0500638_030072 | 3300053162 | Bacteria | 2613 |
| 634 | Ga0500639_029184 | 3300053163 | Bacteria | 2915 |
| 635 | Ga0500636_0009769 | 3300053177 | Bacteria | 5588 |
| 636 | Ga0500636_0015595 | 3300053177 | Bacteria | 4479 |
| 637 | Ga0500636_0018270 | 3300053177 | Bacteria | 4146 |
| 638 | Ga0500637_0016091 | 3300053178 | Bacteria | 3981 |
| 639 | Ga0500576_084736 | 3300053725 | Bacteria | 1330 |
| 640 | Ga0500625_003257 | 3300053729 | Bacteria | 6367 |
| 641 | Ga0500645_013287 | 3300053730 | Bacteria | 2646 |
| 642 | Ga0500645_023810 | 3300053730 | Bacteria | 1875 |
| 643 | Ga0500601_006231 | 3300053737 | Bacteria | 1313 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1005331 | Ga0081540_10053317 | 284 |
| 2 | 3300048906 | Ga0496103_0196965 | Ga0496103_0196965_187_1263 | 335 |
| 3 | iso_pu_bacteria | 8019687851 | 8019695935 | 342 |
| 4 | 3300031911 | Ga0307412_10063995 | Ga0307412_100639953 | 344 |
| 5 | 3300025933 | Ga0207706_10033116 | Ga0207706_100331164 | 347 |
| 6 | 3300047321 | Ga0495676_0056064 | Ga0495676_0056064_1035_2159 | 351 |
| 7 | 3300048907 | Ga0496104_0001811 | Ga0496104_0001811_15882_17006 | 351 |
| 8 | 3300048907 | Ga0496104_0217238 | Ga0496104_0217238_531_1655 | 351 |
| 9 | 3300048913 | Ga0496110_0204272 | Ga0496110_0204272_611_1735 | 351 |
| 10 | 3300048916 | Ga0496113_0067749 | Ga0496113_0067749_1099_2223 | 351 |
| 11 | 3300048918 | Ga0496115_0029230 | Ga0496115_0029230_1486_2610 | 351 |
| 12 | 3300006048 | Ga0075363_100011489 | Ga0075363_1000114893 | 352 |
| 13 | 3300050490 | nmdc:mga03n38_4951_c1 | nmdc:mga03n38_4951_c1_2315_3439 | 352 |
| 14 | 3300006942 | Ga0099824_1006343 | Ga0099824_100634312 | 353 |
| 15 | 3300006943 | Ga0099822_1043035 | Ga0099822_10430351 | 353 |
| 16 | 3300027296 | Ga0209389_1000104 | Ga0209389_100010421 | 353 |
| 17 | 3300027357 | Ga0209589_1000159 | Ga0209589_100015945 | 353 |
| 18 | 3300027361 | Ga0209489_100194 | Ga0209489_10019445 | 353 |
| 19 | iso_pu_bacteria | 8016530956 | 8016539499 | 353 |
| 20 | iso_pu_bacteria | 8019547302 | 8019549808 | 353 |
| 21 | 3300037418 | Ga0395900_0456718 | Ga0395900_0456718_116_1180 | 354 |
| 22 | 3300037466 | Ga0395898_0009257 | Ga0395898_0009257_5254_6318 | 354 |
| 23 | 3300048918 | Ga0496115_0093853 | Ga0496115_0093853_47_1111 | 354 |
| 24 | 3300048924 | Ga0496121_0000194 | Ga0496121_0000194_110673_111737 | 354 |
| 25 | 3300048929 | Ga0496126_0027937 | Ga0496126_0027937_2707_3771 | 354 |
| 26 | 3300025919 | Ga0207657_10003352 | Ga0207657_1000335213 | 355 |
| 27 | 3300005548 | Ga0070665_100269092 | Ga0070665_1002690922 | 356 |
| 28 | 3300013104 | Ga0157370_10203604 | Ga0157370_102036042 | 356 |
| 29 | 3300048905 | Ga0496102_0066931 | Ga0496102_0066931_1998_3236 | 356 |
| 30 | 3300005548 | Ga0070665_100112120 | Ga0070665_1001121204 | 357 |
| 31 | 3300014325 | Ga0163163_10206656 | Ga0163163_102066562 | 357 |
| 32 | 3300037853 | Ga0436364_1382509 | Ga0436364_1382509_2303_3445 | 357 |
| 33 | 3300044712 | Ga0453684_0094548 | Ga0453684_0094548_1510_2649 | 357 |
| 34 | 3300045051 | Ga0451576_0057030 | Ga0451576_0057030_2684_3823 | 357 |
| 35 | 3300046512 | Ga0495610_0000019 | Ga0495610_0000019_176677_177771 | 359 |
| 36 | 3300046515 | Ga0495620_0075482 | Ga0495620_0075482_91_1185 | 359 |
| 37 | 3300048918 | Ga0496115_0045620 | Ga0496115_0045620_927_2012 | 360 |
| 38 | iso_pu_bacteria | 2643221651 | 2644290527 | 360 |
| 39 | iso_pu_bacteria | 2874620515 | 2874623033 | 360 |
| 40 | iso_pu_bacteria | 2904666416 | 2904666655 | 360 |
| 41 | 3300009545 | Ga0105237_10070896 | Ga0105237_100708962 | 361 |
| 42 | 3300044842 | Ga0466957_0149870 | Ga0466957_0149870_88_1188 | 361 |
| 43 | 3300049569 | Ga0501032_0141930 | Ga0501032_0141930_370_1494 | 361 |
| 44 | 3300049570 | Ga0501033_0157019 | Ga0501033_0157019_439_1563 | 361 |
| 45 | 3300049572 | Ga0501036_0092289 | Ga0501036_0092289_630_1754 | 361 |
| 46 | 3300049581 | Ga0501047_0048177 | Ga0501047_0048177_1786_2910 | 361 |
| 47 | 3300049823 | Ga0501044_0087964 | Ga0501044_0087964_428_1552 | 361 |
| 48 | 3300053104 | Ga0500556_0000306 | Ga0500556_0000306_26278_27384 | 361 |
| 49 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_273991_275115 | 361 |
| 50 | 3300039437 | Ga0436365_0697893 | Ga0436365_0697893_792_1892 | 362 |
| 51 | 3300039438 | Ga0436360_1291699 | Ga0436360_1291699_66_1166 | 362 |
| 52 | 3300049581 | Ga0501047_0181987 | Ga0501047_0181987_670_1779 | 362 |
| 53 | iso_pu_bacteria | 2849076700 | 2849083325 | 362 |
| 54 | iso_pu_bacteria | 2884298095 | 2884299630 | 363 |
| 55 | 3300031250 | Ga0265331_10031235 | Ga0265331_100312353 | 364 |
| 56 | 3300044658 | Ga0466972_0000286 | Ga0466972_0000286_16362_17468 | 364 |
| 57 | 3300048928 | Ga0496125_0001161 | Ga0496125_0001161_11012_12142 | 364 |
| 58 | 3300048929 | Ga0496126_0048014 | Ga0496126_0048014_1907_3037 | 364 |
| 59 | iso_pu_bacteria | 2511231028 | 2511397659 | 364 |
| 60 | iso_pu_bacteria | 2513237098 | 2513671766 | 364 |
| 61 | iso_pu_bacteria | 2513237139 | 2513879322 | 364 |
| 62 | iso_pu_bacteria | 2513237141 | 2513895150 | 364 |
| 63 | iso_pu_bacteria | 2513237161 | 2514016858 | 364 |
| 64 | iso_pu_bacteria | 2517093001 | 2517107938 | 364 |
| 65 | iso_pu_bacteria | 2524023205 | 2524442001 | 364 |
| 66 | iso_pu_bacteria | 2524023210 | 2524470147 | 364 |
| 67 | iso_pu_bacteria | 2617270735 | 2617353668 | 364 |
| 68 | iso_pu_bacteria | 2643221609 | 2644062003 | 364 |
| 69 | iso_pu_bacteria | 2721755755 | 2723841926 | 364 |
| 70 | iso_pu_bacteria | 2744054633 | 2745082381 | 364 |
| 71 | iso_pu_bacteria | 2791355196 | 2793065671 | 364 |
| 72 | iso_pu_bacteria | 2791355199 | 2793079144 | 364 |
| 73 | iso_pu_bacteria | 2802429603 | 2805921531 | 364 |
| 74 | iso_pu_bacteria | 2824661429 | 2824668577 | 364 |
| 75 | iso_pu_bacteria | 2824671348 | 2824675358 | 364 |
| 76 | iso_pu_bacteria | 2824679649 | 2824684681 | 364 |
| 77 | iso_pu_bacteria | 2824687955 | 2824691576 | 364 |
| 78 | iso_pu_bacteria | 2824696289 | 2824700509 | 364 |
| 79 | iso_pu_bacteria | 2824704595 | 2824707347 | 364 |
| 80 | iso_pu_bacteria | 2824753945 | 2824758729 | 364 |
| 81 | iso_pu_bacteria | 2824763712 | 2824769199 | 364 |
| 82 | iso_pu_bacteria | 2824773399 | 2824777438 | 364 |
| 83 | iso_pu_bacteria | 2838122688 | 2838130204 | 364 |
| 84 | iso_pu_bacteria | 2841941048 | 2841947881 | 364 |
| 85 | iso_pu_bacteria | 2841949485 | 2841956942 | 364 |
| 86 | iso_pu_bacteria | 2841966195 | 2841972707 | 364 |
| 87 | iso_pu_bacteria | 2841974524 | 2841977439 | 364 |
| 88 | iso_pu_bacteria | 2841974524 | 2841980682 | 364 |
| 89 | iso_pu_bacteria | 2841983080 | 2841990663 | 364 |
| 90 | iso_pu_bacteria | 2847939898 | 2847942461 | 364 |
| 91 | iso_pu_bacteria | 2874604998 | 2874610475 | 364 |
| 92 | iso_pu_bacteria | 2876761206 | 2876763728 | 364 |
| 93 | iso_pu_bacteria | 2879099564 | 2879106787 | 364 |
| 94 | iso_pu_bacteria | 2881364244 | 2881365454 | 364 |
| 95 | iso_pu_bacteria | 2885366525 | 2885368599 | 364 |
| 96 | iso_pu_bacteria | 2885383462 | 2885390205 | 364 |
| 97 | iso_pu_bacteria | 2888388044 | 2888390394 | 364 |
| 98 | iso_pu_bacteria | 2889033259 | 2889035154 | 364 |
| 99 | iso_pu_bacteria | 2903768456 | 2903775310 | 364 |
| 100 | iso_pu_bacteria | 2904711408 | 2904714076 | 364 |
| 101 | iso_pu_bacteria | 2922368715 | 2922369043 | 364 |
| 102 | iso_pu_bacteria | 2922386360 | 2922388763 | 364 |
| 103 | iso_pu_bacteria | 2922393267 | 2922394702 | 364 |
| 104 | iso_pu_bacteria | 2929615660 | 2929618912 | 364 |
| 105 | iso_pu_bacteria | 2929624759 | 2929630989 | 364 |
| 106 | iso_pu_bacteria | 2932784394 | 2932788958 | 364 |
| 107 | iso_pu_bacteria | 2932809354 | 2932814398 | 364 |
| 108 | iso_pu_bacteria | 2932818245 | 2932820524 | 364 |
| 109 | iso_pu_bacteria | 2932828146 | 2932834563 | 364 |
| 110 | iso_pu_bacteria | 2933577622 | 2933580378 | 364 |
| 111 | iso_pu_bacteria | 2935616580 | 2935624425 | 364 |
| 112 | iso_pu_bacteria | 2935638405 | 2935645935 | 364 |
| 113 | iso_pu_bacteria | 2935665750 | 2935674478 | 364 |
| 114 | iso_pu_bacteria | 2935675223 | 2935682679 | 364 |
| 115 | iso_pu_bacteria | 2935684952 | 2935686710 | 364 |
| 116 | iso_pu_bacteria | 2935694250 | 2935701614 | 364 |
| 117 | iso_pu_bacteria | 2935703347 | 2935710410 | 364 |
| 118 | iso_pu_bacteria | 2935713505 | 2935716398 | 364 |
| 119 | iso_pu_bacteria | 2935722832 | 2935723477 | 364 |
| 120 | iso_pu_bacteria | 2935732158 | 2935735033 | 364 |
| 121 | iso_pu_bacteria | 2935741537 | 2935744176 | 364 |
| 122 | iso_pu_bacteria | 2935750917 | 2935752676 | 364 |
| 123 | iso_pu_bacteria | 2935760218 | 2935764896 | 364 |
| 124 | iso_pu_bacteria | 2935801545 | 2935806064 | 364 |
| 125 | iso_pu_bacteria | 2935810662 | 2935816874 | 364 |
| 126 | iso_pu_bacteria | 2935827899 | 2935835164 | 364 |
| 127 | iso_pu_bacteria | 2935837841 | 2935841455 | 364 |
| 128 | iso_pu_bacteria | 2935855204 | 2935863144 | 364 |
| 129 | iso_pu_bacteria | 2935864058 | 2935873099 | 364 |
| 130 | iso_pu_bacteria | 2935873716 | 2935880148 | 364 |
| 131 | iso_pu_bacteria | 2935992306 | 2936000850 | 364 |
| 132 | iso_pu_bacteria | 2936002035 | 2936010353 | 364 |
| 133 | iso_pu_bacteria | 2936037263 | 2936043865 | 364 |
| 134 | iso_pu_bacteria | 2940556831 | 2940558589 | 364 |
| 135 | iso_pu_bacteria | 2941538514 | 2941543681 | 364 |
| 136 | iso_pu_bacteria | 3005483717 | 3005489258 | 364 |
| 137 | iso_pu_bacteria | 3005718088 | 3005718596 | 364 |
| 138 | iso_pu_bacteria | 8006984368 | 8006988421 | 364 |
| 139 | iso_pu_bacteria | 8016511872 | 8016517847 | 364 |
| 140 | iso_pu_bacteria | 8017057580 | 8017058786 | 364 |
| 141 | iso_pu_bacteria | 8019576017 | 8019576866 | 364 |
| 142 | iso_pu_bacteria | 8019586578 | 8019594923 | 364 |
| 143 | iso_pu_bacteria | 8019597564 | 8019606817 | 364 |
| 144 | iso_pu_bacteria | 8019608314 | 8019611690 | 364 |
| 145 | iso_pu_bacteria | 8019648815 | 8019652081 | 364 |
| 146 | iso_pu_bacteria | 8055742211 | 8055742761 | 364 |
| 147 | iso_pu_bacteria | 8056681323 | 8056689384 | 364 |
| 148 | 3300003203 | JGI25406J46586_10000887 | JGI25406J46586_100008874 | 365 |
| 149 | 3300003215 | JGI25153J46596_10004047 | JGI25153J46596_100040473 | 365 |
| 150 | 3300005347 | Ga0070668_100035262 | Ga0070668_1000352622 | 365 |
| 151 | 3300005347 | Ga0070668_100039201 | Ga0070668_1000392013 | 365 |
| 152 | 3300005437 | Ga0070710_10105335 | Ga0070710_101053351 | 365 |
| 153 | 3300005439 | Ga0070711_100009658 | Ga0070711_1000096583 | 365 |
| 154 | 3300005455 | Ga0070663_100064496 | Ga0070663_1000644962 | 365 |
| 155 | 3300005456 | Ga0070678_100163761 | Ga0070678_1001637611 | 365 |
| 156 | 3300005548 | Ga0070665_100060033 | Ga0070665_1000600332 | 365 |
| 157 | 3300005548 | Ga0070665_100069146 | Ga0070665_1000691463 | 365 |
| 158 | 3300005577 | Ga0068857_100357271 | Ga0068857_1003572711 | 365 |
| 159 | 3300005614 | Ga0068856_100040360 | Ga0068856_1000403603 | 365 |
| 160 | 3300005616 | Ga0068852_100104079 | Ga0068852_1001040792 | 365 |
| 161 | 3300005616 | Ga0068852_100355931 | Ga0068852_1003559311 | 365 |
| 162 | 3300005834 | Ga0068851_10129240 | Ga0068851_101292402 | 365 |
| 163 | 3300005844 | Ga0068862_100172427 | Ga0068862_1001724272 | 365 |
| 164 | 3300005937 | Ga0081455_10054586 | Ga0081455_100545862 | 365 |
| 165 | 3300005937 | Ga0081455_10058556 | Ga0081455_100585562 | 365 |
| 166 | 3300005983 | Ga0081540_1001535 | Ga0081540_100153518 | 365 |
| 167 | 3300005983 | Ga0081540_1004268 | Ga0081540_10042683 | 365 |
| 168 | 3300005983 | Ga0081540_1007746 | Ga0081540_10077463 | 365 |
| 169 | 3300005983 | Ga0081540_1010624 | Ga0081540_10106246 | 365 |
| 170 | 3300005983 | Ga0081540_1017259 | Ga0081540_10172593 | 365 |
| 171 | 3300005983 | Ga0081540_1028412 | Ga0081540_10284122 | 365 |
| 172 | 3300005985 | Ga0081539_10000879 | Ga0081539_1000087935 | 365 |
| 173 | 3300005985 | Ga0081539_10026237 | Ga0081539_100262373 | 365 |
| 174 | 3300006051 | Ga0075364_10026100 | Ga0075364_100261004 | 365 |
| 175 | 3300006051 | Ga0075364_10114175 | Ga0075364_101141752 | 365 |
| 176 | 3300006195 | Ga0075366_10014528 | Ga0075366_100145283 | 365 |
| 177 | 3300006353 | Ga0075370_10029278 | Ga0075370_100292782 | 365 |
| 178 | 3300006844 | Ga0075428_100211505 | Ga0075428_1002115052 | 365 |
| 179 | 3300006881 | Ga0068865_100090243 | Ga0068865_1000902431 | 365 |
| 180 | 3300009093 | Ga0105240_10128815 | Ga0105240_101288152 | 365 |
| 181 | 3300009093 | Ga0105240_10348452 | Ga0105240_103484521 | 365 |
| 182 | 3300009094 | Ga0111539_10119914 | Ga0111539_101199143 | 365 |
| 183 | 3300009098 | Ga0105245_10157004 | Ga0105245_101570042 | 365 |
| 184 | 3300009101 | Ga0105247_10056060 | Ga0105247_100560601 | 365 |
| 185 | 3300009174 | Ga0105241_10050885 | Ga0105241_100508853 | 365 |
| 186 | 3300009545 | Ga0105237_10073153 | Ga0105237_100731532 | 365 |
| 187 | 3300009545 | Ga0105237_10138669 | Ga0105237_101386693 | 365 |
| 188 | 3300010375 | Ga0105239_10131238 | Ga0105239_101312382 | 365 |
| 189 | 3300011119 | Ga0105246_10023203 | Ga0105246_100232033 | 365 |
| 190 | 3300013105 | Ga0157369_10012061 | Ga0157369_100120615 | 365 |
| 191 | 3300013308 | Ga0157375_10545022 | Ga0157375_105450221 | 365 |
| 192 | 3300014325 | Ga0163163_10456233 | Ga0163163_104562332 | 365 |
| 193 | 3300014969 | Ga0157376_10239466 | Ga0157376_102394661 | 365 |
| 194 | 3300021320 | Ga0214544_1021169 | Ga0214544_10211692 | 365 |
| 195 | 3300021321 | Ga0214542_1020533 | Ga0214542_10205333 | 365 |
| 196 | 3300021324 | Ga0214545_1017688 | Ga0214545_10176883 | 365 |
| 197 | 3300021327 | Ga0214543_1031463 | Ga0214543_10314632 | 365 |
| 198 | 3300021358 | Ga0213873_10006576 | Ga0213873_100065761 | 365 |
| 199 | 3300021377 | Ga0213874_10020579 | Ga0213874_100205791 | 365 |
| 200 | 3300021384 | Ga0213876_10027975 | Ga0213876_100279753 | 365 |
| 201 | 3300021384 | Ga0213876_10047628 | Ga0213876_100476282 | 365 |
| 202 | 3300022467 | Ga0224712_10014285 | Ga0224712_100142851 | 365 |
| 203 | 3300025230 | Ga0209563_100900 | Ga0209563_1009001 | 365 |
| 204 | 3300025253 | Ga0209677_100686 | Ga0209677_1006865 | 365 |
| 205 | 3300025297 | Ga0209758_1000963 | Ga0209758_10009633 | 365 |
| 206 | 3300025297 | Ga0209758_1002540 | Ga0209758_10025403 | 365 |
| 207 | 3300025297 | Ga0209758_1021842 | Ga0209758_10218422 | 365 |
| 208 | 3300025297 | Ga0209758_1026572 | Ga0209758_10265722 | 365 |
| 209 | 3300025911 | Ga0207654_10047597 | Ga0207654_100475973 | 365 |
| 210 | 3300025913 | Ga0207695_10000059 | Ga0207695_10000059328 | 365 |
| 211 | 3300025913 | Ga0207695_10032161 | Ga0207695_100321616 | 365 |
| 212 | 3300025914 | Ga0207671_10031638 | Ga0207671_100316382 | 365 |
| 213 | 3300025914 | Ga0207671_10100387 | Ga0207671_101003871 | 365 |
| 214 | 3300025914 | Ga0207671_10240098 | Ga0207671_102400981 | 365 |
| 215 | 3300025915 | Ga0207693_10071069 | Ga0207693_100710692 | 365 |
| 216 | 3300025916 | Ga0207663_10022968 | Ga0207663_100229682 | 365 |
| 217 | 3300025927 | Ga0207687_10127767 | Ga0207687_101277672 | 365 |
| 218 | 3300025927 | Ga0207687_10232942 | Ga0207687_102329422 | 365 |
| 219 | 3300025929 | Ga0207664_10278062 | Ga0207664_102780622 | 365 |
| 220 | 3300025933 | Ga0207706_10147618 | Ga0207706_101476182 | 365 |
| 221 | 3300025933 | Ga0207706_10208319 | Ga0207706_102083192 | 365 |
| 222 | 3300025935 | Ga0207709_10182366 | Ga0207709_101823662 | 365 |
| 223 | 3300025941 | Ga0207711_10352338 | Ga0207711_103523381 | 365 |
| 224 | 3300025981 | Ga0207640_10101287 | Ga0207640_101012872 | 365 |
| 225 | 3300025986 | Ga0207658_10045657 | Ga0207658_100456573 | 365 |
| 226 | 3300026067 | Ga0207678_10056281 | Ga0207678_100562813 | 365 |
| 227 | 3300026088 | Ga0207641_10065105 | Ga0207641_100651051 | 365 |
| 228 | 3300026116 | Ga0207674_10144467 | Ga0207674_101444672 | 365 |
| 229 | 3300026116 | Ga0207674_10147136 | Ga0207674_101471361 | 365 |
| 230 | 3300026118 | Ga0207675_100083006 | Ga0207675_1000830062 | 365 |
| 231 | 3300026142 | Ga0207698_10075416 | Ga0207698_100754163 | 365 |
| 232 | 3300026142 | Ga0207698_10163306 | Ga0207698_101633061 | 365 |
| 233 | 3300028379 | Ga0268266_10003301 | Ga0268266_1000330113 | 365 |
| 234 | 3300028379 | Ga0268266_10009757 | Ga0268266_100097573 | 365 |
| 235 | 3300028379 | Ga0268266_10047642 | Ga0268266_100476423 | 365 |
| 236 | 3300028379 | Ga0268266_10189197 | Ga0268266_101891972 | 365 |
| 237 | 3300028379 | Ga0268266_10305926 | Ga0268266_103059261 | 365 |
| 238 | 3300028380 | Ga0268265_10197456 | Ga0268265_101974561 | 365 |
| 239 | 3300028381 | Ga0268264_10146383 | Ga0268264_101463831 | 365 |
| 240 | 3300028573 | Ga0265334_10025996 | Ga0265334_100259962 | 365 |
| 241 | 3300031235 | Ga0265330_10003717 | Ga0265330_100037174 | 365 |
| 242 | 3300031238 | Ga0265332_10096871 | Ga0265332_100968712 | 365 |
| 243 | 3300031241 | Ga0265325_10004205 | Ga0265325_100042055 | 365 |
| 244 | 3300031595 | Ga0265313_10056176 | Ga0265313_100561762 | 365 |
| 245 | 3300032005 | Ga0307411_10059356 | Ga0307411_100593562 | 365 |
| 246 | 3300032126 | Ga0307415_100035272 | Ga0307415_1000352722 | 365 |
| 247 | 3300032126 | Ga0307415_100262554 | Ga0307415_1002625541 | 365 |
| 248 | 3300033180 | Ga0307510_10002191 | Ga0307510_1000219116 | 365 |
| 249 | 3300035111 | Ga0373923_0016103 | Ga0373923_0016103_498_1610 | 365 |
| 250 | 3300035117 | Ga0373953_0007388 | Ga0373953_0007388_942_2054 | 365 |
| 251 | 3300035118 | Ga0373954_0000308 | Ga0373954_0000308_7972_9084 | 365 |
| 252 | 3300035119 | Ga0373956_0004549 | Ga0373956_0004549_3469_4581 | 365 |
| 253 | 3300035120 | Ga0373957_0008118 | Ga0373957_0008118_1440_2552 | 365 |
| 254 | 3300035172 | Ga0373955_0000479 | Ga0373955_0000479_4008_5120 | 365 |
| 255 | 3300035410 | Ga0373924_0003769 | Ga0373924_0003769_1333_2445 | 365 |
| 256 | 3300035724 | Ga0373933_0050571 | Ga0373933_0050571_666_1778 | 365 |
| 257 | 3300036401 | Ga0373937_0005638 | Ga0373937_0005638_8568_9680 | 365 |
| 258 | 3300037418 | Ga0395900_0015618 | Ga0395900_0015618_74_1300 | 365 |
| 259 | 3300037466 | Ga0395898_0002946 | Ga0395898_0002946_17185_18411 | 365 |
| 260 | 3300037466 | Ga0395898_0082873 | Ga0395898_0082873_1215_2453 | 365 |
| 261 | 3300037471 | Ga0395905_0003015 | Ga0395905_0003015_3215_4333 | 365 |
| 262 | 3300038443 | Ga0395901_0151820 | Ga0395901_0151820_405_1631 | 365 |
| 263 | 3300039437 | Ga0436365_1141460 | Ga0436365_1141460_1677_2783 | 365 |
| 264 | 3300039450 | Ga0436363_0668067 | Ga0436363_0668067_796_1932 | 365 |
| 265 | 3300039453 | Ga0436362_0510213 | Ga0436362_0510213_942_2051 | 365 |
| 266 | 3300045976 | Ga0466967_0090278 | Ga0466967_0090278_1639_2739 | 365 |
| 267 | 3300046454 | Ga0495592_0001710 | Ga0495592_0001710_6041_7153 | 365 |
| 268 | 3300046454 | Ga0495592_0002892 | Ga0495592_0002892_8633_9763 | 365 |
| 269 | 3300046459 | Ga0495629_0000348 | Ga0495629_0000348_24627_25739 | 365 |
| 270 | 3300046462 | Ga0495651_0005720 | Ga0495651_0005720_4219_5331 | 365 |
| 271 | 3300046463 | Ga0495653_0009258 | Ga0495653_0009258_5338_6450 | 365 |
| 272 | 3300046477 | Ga0495664_0025870 | Ga0495664_0025870_34_1164 | 365 |
| 273 | 3300046506 | Ga0495583_0055014 | Ga0495583_0055014_576_1682 | 365 |
| 274 | 3300046511 | Ga0495608_0000368 | Ga0495608_0000368_22383_23495 | 365 |
| 275 | 3300046511 | Ga0495608_0014344 | Ga0495608_0014344_3117_4247 | 365 |
| 276 | 3300046516 | Ga0495628_0003575 | Ga0495628_0003575_6041_7171 | 365 |
| 277 | 3300046516 | Ga0495628_0055589 | Ga0495628_0055589_1695_2807 | 365 |
| 278 | 3300046517 | Ga0495630_0140714 | Ga0495630_0140714_167_1297 | 365 |
| 279 | 3300046524 | Ga0495648_0050416 | Ga0495648_0050416_261_1412 | 365 |
| 280 | 3300046529 | Ga0495652_0003538 | Ga0495652_0003538_10073_11185 | 365 |
| 281 | 3300046533 | Ga0495640_0008034 | Ga0495640_0008034_1928_3040 | 365 |
| 282 | 3300046533 | Ga0495640_0029702 | Ga0495640_0029702_1670_2776 | 365 |
| 283 | 3300046536 | Ga0495587_0010725 | Ga0495587_0010725_1029_2159 | 365 |
| 284 | 3300046536 | Ga0495587_0053316 | Ga0495587_0053316_311_1423 | 365 |
| 285 | 3300046543 | Ga0495645_0023317 | Ga0495645_0023317_1224_2336 | 365 |
| 286 | 3300046557 | Ga0495622_0013293 | Ga0495622_0013293_203_1321 | 365 |
| 287 | 3300046559 | Ga0495667_0006624 | Ga0495667_0006624_2999_4129 | 365 |
| 288 | 3300046559 | Ga0495667_0007023 | Ga0495667_0007023_5722_6834 | 365 |
| 289 | 3300046642 | Ga0495634_0004641 | Ga0495634_0004641_5905_7017 | 365 |
| 290 | 3300046660 | Ga0495625_0195401 | Ga0495625_0195401_66_1217 | 365 |
| 291 | 3300046663 | Ga0495635_0000372 | Ga0495635_0000372_19300_20412 | 365 |
| 292 | 3300046663 | Ga0495635_0132037 | Ga0495635_0132037_130_1260 | 365 |
| 293 | 3300046674 | Ga0495588_0017434 | Ga0495588_0017434_2000_3163 | 365 |
| 294 | 3300046675 | Ga0495657_0006148 | Ga0495657_0006148_6517_7629 | 365 |
| 295 | 3300046678 | Ga0495599_0009058 | Ga0495599_0009058_1771_2901 | 365 |
| 296 | 3300046678 | Ga0495599_0014706 | Ga0495599_0014706_3139_4251 | 365 |
| 297 | 3300046679 | Ga0495623_0073399 | Ga0495623_0073399_704_1816 | 365 |
| 298 | 3300046680 | Ga0495646_0003761 | Ga0495646_0003761_326_1438 | 365 |
| 299 | 3300046680 | Ga0495646_0017020 | Ga0495646_0017020_2077_3207 | 365 |
| 300 | 3300046689 | Ga0495613_0013379 | Ga0495613_0013379_4112_5224 | 365 |
| 301 | 3300046689 | Ga0495613_0043461 | Ga0495613_0043461_829_1959 | 365 |
| 302 | 3300046809 | Ga0495600_0001217 | Ga0495600_0001217_4890_6002 | 365 |
| 303 | 3300046809 | Ga0495600_0004048 | Ga0495600_0004048_5259_6389 | 365 |
| 304 | 3300047317 | Ga0495604_0005876 | Ga0495604_0005876_7568_8698 | 365 |
| 305 | 3300047317 | Ga0495604_0012415 | Ga0495604_0012415_4347_5459 | 365 |
| 306 | 3300047319 | Ga0495674_0018626 | Ga0495674_0018626_1362_2474 | 365 |
| 307 | 3300047319 | Ga0495674_0024836 | Ga0495674_0024836_2334_3464 | 365 |
| 308 | 3300047322 | Ga0495680_0002856 | Ga0495680_0002856_2440_3570 | 365 |
| 309 | 3300047322 | Ga0495680_0007925 | Ga0495680_0007925_972_2084 | 365 |
| 310 | 3300047444 | Ga0495675_0003518 | Ga0495675_0003518_918_2030 | 365 |
| 311 | 3300047444 | Ga0495675_0153681 | Ga0495675_0153681_253_1383 | 365 |
| 312 | 3300047471 | Ga0495684_0001014 | Ga0495684_0001014_13867_14979 | 365 |
| 313 | 3300047673 | Ga0495593_0004444 | Ga0495593_0004444_7194_8306 | 365 |
| 314 | 3300048088 | Ga0495602_0005816 | Ga0495602_0005816_8040_9152 | 365 |
| 315 | 3300048088 | Ga0495602_0010096 | Ga0495602_0010096_3412_4542 | 365 |
| 316 | 3300048903 | Ga0496100_0205035 | Ga0496100_0205035_271_1422 | 365 |
| 317 | 3300048906 | Ga0496103_0001945 | Ga0496103_0001945_12088_13194 | 365 |
| 318 | 3300048907 | Ga0496104_0098594 | Ga0496104_0098594_1093_2256 | 365 |
| 319 | 3300048908 | Ga0496105_0029405 | Ga0496105_0029405_1247_2410 | 365 |
| 320 | 3300048908 | Ga0496105_0051296 | Ga0496105_0051296_235_1386 | 365 |
| 321 | 3300048910 | Ga0496107_0035584 | Ga0496107_0035584_2309_3472 | 365 |
| 322 | 3300048911 | Ga0496108_0010972 | Ga0496108_0010972_3714_4865 | 365 |
| 323 | 3300048912 | Ga0496109_0073228 | Ga0496109_0073228_1056_2207 | 365 |
| 324 | 3300048912 | Ga0496109_0287308 | Ga0496109_0287308_282_1388 | 365 |
| 325 | 3300048913 | Ga0496110_0068203 | Ga0496110_0068203_755_1918 | 365 |
| 326 | 3300048915 | Ga0496112_0134483 | Ga0496112_0134483_1304_2410 | 365 |
| 327 | 3300048915 | Ga0496112_0382484 | Ga0496112_0382484_128_1291 | 365 |
| 328 | 3300048917 | Ga0496114_0030213 | Ga0496114_0030213_2524_3642 | 365 |
| 329 | 3300048921 | Ga0496118_0013973 | Ga0496118_0013973_932_2083 | 365 |
| 330 | 3300048922 | Ga0496119_0033766 | Ga0496119_0033766_501_1607 | 365 |
| 331 | 3300048923 | Ga0496120_0041545 | Ga0496120_0041545_716_1822 | 365 |
| 332 | 3300048923 | Ga0496120_0106933 | Ga0496120_0106933_230_1336 | 365 |
| 333 | 3300048924 | Ga0496121_0017298 | Ga0496121_0017298_14_1132 | 365 |
| 334 | 3300048928 | Ga0496125_0000420 | Ga0496125_0000420_52588_53706 | 365 |
| 335 | 3300048929 | Ga0496126_0099199 | Ga0496126_0099199_1183_2289 | 365 |
| 336 | 3300048929 | Ga0496126_0149804 | Ga0496126_0149804_191_1297 | 365 |
| 337 | 3300049583 | Ga0501067_0125022 | Ga0501067_0125022_25_1131 | 365 |
| 338 | 3300050496 | nmdc:mga07m45_4399_c1 | nmdc:mga07m45_4399_c1_2437_3543 | 365 |
| 339 | 3300053077 | Ga0495601_0019123 | Ga0495601_0019123_620_1732 | 365 |
| 340 | 3300053084 | Ga0495595_0002712 | Ga0495595_0002712_4467_5579 | 365 |
| 341 | 3300053085 | Ga0495619_0005683 | Ga0495619_0005683_6486_7598 | 365 |
| 342 | 3300053087 | Ga0500643_000270 | Ga0500643_000270_3853_4959 | 365 |
| 343 | 3300053094 | Ga0500566_0005084 | Ga0500566_0005084_143_1270 | 365 |
| 344 | 3300053096 | Ga0500641_0002387 | Ga0500641_0002387_5454_6629 | 365 |
| 345 | 3300053096 | Ga0500641_0002665 | Ga0500641_0002665_3247_4353 | 365 |
| 346 | 3300053098 | Ga0500650_0059284 | Ga0500650_0059284_56_1162 | 365 |
| 347 | 3300053103 | Ga0500555_002818 | Ga0500555_002818_1149_2255 | 365 |
| 348 | 3300053119 | Ga0500595_006420 | Ga0500595_006420_521_1627 | 365 |
| 349 | 3300053130 | Ga0500642_0000091 | Ga0500642_0000091_6279_7385 | 365 |
| 350 | 3300053139 | Ga0500568_0011063 | Ga0500568_0011063_1351_2457 | 365 |
| 351 | 3300053151 | Ga0500604_0039195 | Ga0500604_0039195_157_1263 | 365 |
| 352 | 3300053158 | Ga0500627_0050982 | Ga0500627_0050982_169_1275 | 365 |
| 353 | 3300053737 | Ga0500601_006231 | Ga0500601_006231_169_1275 | 365 |
| 354 | iso_pu_bacteria | 2508501009 | 2508539435 | 365 |
| 355 | iso_pu_bacteria | 2513237092 | 2513624795 | 365 |
| 356 | iso_pu_bacteria | 2513237094 | 2513642338 | 365 |
| 357 | iso_pu_bacteria | 2513237101 | 2513695011 | 365 |
| 358 | iso_pu_bacteria | 2824600985 | 2824603005 | 365 |
| 359 | iso_pu_bacteria | 2824609381 | 2824615477 | 365 |
| 360 | iso_pu_bacteria | 2824653114 | 2824660316 | 365 |
| 361 | iso_pu_bacteria | 2844315083 | 2844315768 | 365 |
| 362 | iso_pu_bacteria | 2857509624 | 2857516483 | 365 |
| 363 | iso_pu_bacteria | 2874612657 | 2874619070 | 365 |
| 364 | iso_pu_bacteria | 2881665667 | 2881671504 | 365 |
| 365 | iso_pu_bacteria | 2888419890 | 2888419960 | 365 |
| 366 | iso_pu_bacteria | 2903727486 | 2903730933 | 365 |
| 367 | iso_pu_bacteria | 2906602504 | 2906603755 | 365 |
| 368 | iso_pu_bacteria | 2935608549 | 2935614616 | 365 |
| 369 | iso_pu_bacteria | 2935648319 | 2935654778 | 365 |
| 370 | iso_pu_bacteria | 2935656913 | 2935663658 | 365 |
| 371 | iso_pu_bacteria | 2935819856 | 2935826352 | 365 |
| 372 | iso_pu_bacteria | 2935847175 | 2935853839 | 365 |
| 373 | iso_pu_bacteria | 2935908558 | 2935915386 | 365 |
| 374 | iso_pu_bacteria | 2935916978 | 2935925138 | 365 |
| 375 | iso_pu_bacteria | 2935926038 | 2935933281 | 365 |
| 376 | iso_pu_bacteria | 2935934488 | 2935941373 | 365 |
| 377 | iso_pu_bacteria | 2935942939 | 2935949568 | 365 |
| 378 | iso_pu_bacteria | 2935951376 | 2935958257 | 365 |
| 379 | iso_pu_bacteria | 2935959822 | 2935966504 | 365 |
| 380 | iso_pu_bacteria | 2935967501 | 2935974845 | 365 |
| 381 | iso_pu_bacteria | 2936011229 | 2936017814 | 365 |
| 382 | iso_pu_bacteria | 2936019824 | 2936026317 | 365 |
| 383 | iso_pu_bacteria | 2936028420 | 2936035064 | 365 |
| 384 | iso_pu_bacteria | 2936046547 | 2936053179 | 365 |
| 385 | iso_pu_bacteria | 2936055302 | 2936056970 | 365 |
| 386 | iso_pu_bacteria | 3005587118 | 3005592288 | 365 |
| 387 | iso_pu_bacteria | 3005594810 | 3005595355 | 365 |
| 388 | iso_pu_bacteria | 8006926726 | 8006932663 | 365 |
| 389 | iso_pu_bacteria | 8016630954 | 8016635310 | 365 |
| 390 | iso_pu_bacteria | 8056673599 | 8056678562 | 365 |
| 391 | 3300003187 | JGI25151J46595_10002341 | JGI25151J46595_100023419 | 366 |
| 392 | 3300003215 | JGI25153J46596_10001684 | JGI25153J46596_100016843 | 366 |
| 393 | 3300003215 | JGI25153J46596_10003279 | JGI25153J46596_100032799 | 366 |
| 394 | 3300003794 | Ga0055531_10012840 | Ga0055531_100128402 | 366 |
| 395 | 3300005262 | Ga0065165_1005779 | Ga0065165_10057793 | 366 |
| 396 | 3300005456 | Ga0070678_100225553 | Ga0070678_1002255532 | 366 |
| 397 | 3300005468 | Ga0070707_100145721 | Ga0070707_1001457212 | 366 |
| 398 | 3300005617 | Ga0068859_100182179 | Ga0068859_1001821792 | 366 |
| 399 | 3300005719 | Ga0068861_100176935 | Ga0068861_1001769351 | 366 |
| 400 | 3300005983 | Ga0081540_1014693 | Ga0081540_10146933 | 366 |
| 401 | 3300006931 | Ga0097620_100182157 | Ga0097620_1001821572 | 366 |
| 402 | 3300009551 | Ga0105238_10291869 | Ga0105238_102918691 | 366 |
| 403 | 3300025294 | Ga0209025_1000034 | Ga0209025_100003492 | 366 |
| 404 | 3300025295 | Ga0209564_1002767 | Ga0209564_100276713 | 366 |
| 405 | 3300025297 | Ga0209758_1000030 | Ga0209758_100003095 | 366 |
| 406 | 3300025297 | Ga0209758_1001374 | Ga0209758_100137419 | 366 |
| 407 | 3300025297 | Ga0209758_1002971 | Ga0209758_100297111 | 366 |
| 408 | 3300025299 | Ga0209256_1007102 | Ga0209256_10071023 | 366 |
| 409 | 3300025302 | Ga0207426_1001611 | Ga0207426_10016119 | 366 |
| 410 | 3300025304 | Ga0209257_1000778 | Ga0209257_10007783 | 366 |
| 411 | 3300025904 | Ga0207647_10039838 | Ga0207647_100398381 | 366 |
| 412 | 3300026118 | Ga0207675_100201581 | Ga0207675_1002015812 | 366 |
| 413 | 3300031616 | Ga0307508_10000154 | Ga0307508_1000015415 | 366 |
| 414 | 3300037068 | Ga0373925_0053272 | Ga0373925_0053272_1618_2739 | 366 |
| 415 | 3300037068 | Ga0373925_0175657 | Ga0373925_0175657_53_1162 | 366 |
| 416 | 3300037312 | Ga0395899_0040702 | Ga0395899_0040702_603_1736 | 366 |
| 417 | 3300037466 | Ga0395898_0138484 | Ga0395898_0138484_578_1711 | 366 |
| 418 | 3300038443 | Ga0395901_0265344 | Ga0395901_0265344_232_1365 | 366 |
| 419 | 3300039447 | Ga0436361_0471583 | Ga0436361_0471583_720_1829 | 366 |
| 420 | 3300044684 | Ga0466966_0005407 | Ga0466966_0005407_3834_4970 | 366 |
| 421 | 3300044693 | Ga0466961_0000446 | Ga0466961_0000446_10891_12027 | 366 |
| 422 | 3300044694 | Ga0466963_0005316 | Ga0466963_0005316_1065_2186 | 366 |
| 423 | 3300045976 | Ga0466967_0018622 | Ga0466967_0018622_3976_5097 | 366 |
| 424 | 3300046526 | Ga0495666_0018810 | Ga0495666_0018810_2013_3122 | 366 |
| 425 | 3300046537 | Ga0495598_0013621 | Ga0495598_0013621_634_1743 | 366 |
| 426 | 3300046664 | Ga0495659_0007020 | Ga0495659_0007020_1747_2856 | 366 |
| 427 | 3300048912 | Ga0496109_0073804 | Ga0496109_0073804_1907_3022 | 366 |
| 428 | 3300048913 | Ga0496110_0126387 | Ga0496110_0126387_1031_2146 | 366 |
| 429 | 3300048915 | Ga0496112_0083898 | Ga0496112_0083898_2006_3121 | 366 |
| 430 | 3300048916 | Ga0496113_0035172 | Ga0496113_0035172_208_1323 | 366 |
| 431 | 3300048927 | Ga0496124_0115552 | Ga0496124_0115552_75_1184 | 366 |
| 432 | 3300048928 | Ga0496125_0137389 | Ga0496125_0137389_253_1362 | 366 |
| 433 | 3300048929 | Ga0496126_0371795 | Ga0496126_0371795_34_1143 | 366 |
| 434 | 3300049570 | Ga0501033_0128637 | Ga0501033_0128637_673_1806 | 366 |
| 435 | 3300049579 | Ga0501043_0035870 | Ga0501043_0035870_722_1855 | 366 |
| 436 | 3300049585 | Ga0501069_0097565 | Ga0501069_0097565_239_1369 | 366 |
| 437 | 3300049823 | Ga0501044_0043051 | Ga0501044_0043051_344_1477 | 366 |
| 438 | 3300049823 | Ga0501044_0091454 | Ga0501044_0091454_872_2005 | 366 |
| 439 | 3300053148 | Ga0500590_016900 | Ga0500590_016900_140_1261 | 366 |
| 440 | iso_pu_bacteria | 2507262055 | 2507505557 | 366 |
| 441 | iso_pu_bacteria | 2508501042 | 2508695774 | 366 |
| 442 | iso_pu_bacteria | 2508501128 | 2509152535 | 366 |
| 443 | iso_pu_bacteria | 2513237095 | 2513652566 | 366 |
| 444 | iso_pu_bacteria | 2513237096 | 2513658094 | 366 |
| 445 | iso_pu_bacteria | 2513237102 | 2513704839 | 366 |
| 446 | iso_pu_bacteria | 2513237104 | 2513721869 | 366 |
| 447 | iso_pu_bacteria | 2513237145 | 2513922932 | 366 |
| 448 | iso_pu_bacteria | 2515154112 | 2515630147 | 366 |
| 449 | iso_pu_bacteria | 2517572143 | 2517889163 | 366 |
| 450 | iso_pu_bacteria | 2524023228 | 2524536585 | 366 |
| 451 | iso_pu_bacteria | 2617270741 | 2617377360 | 366 |
| 452 | iso_pu_bacteria | 2667528175 | 2671121555 | 366 |
| 453 | iso_pu_bacteria | 2728368998 | 2728753676 | 366 |
| 454 | iso_pu_bacteria | 2791355197 | 2793072591 | 366 |
| 455 | iso_pu_bacteria | 2816332527 | 2818239072 | 366 |
| 456 | iso_pu_bacteria | 2824617872 | 2824623927 | 366 |
| 457 | iso_pu_bacteria | 2824626560 | 2824632594 | 366 |
| 458 | iso_pu_bacteria | 2824635225 | 2824639452 | 366 |
| 459 | iso_pu_bacteria | 2824644064 | 2824649450 | 366 |
| 460 | iso_pu_bacteria | 2824714736 | 2824719332 | 366 |
| 461 | iso_pu_bacteria | 2824723954 | 2824727962 | 366 |
| 462 | iso_pu_bacteria | 2824732956 | 2824736172 | 366 |
| 463 | iso_pu_bacteria | 2824746037 | 2824750243 | 366 |
| 464 | iso_pu_bacteria | 2842038055 | 2842041289 | 366 |
| 465 | iso_pu_bacteria | 2842045827 | 2842049331 | 366 |
| 466 | iso_pu_bacteria | 2874590934 | 2874592632 | 366 |
| 467 | iso_pu_bacteria | 2874628541 | 2874636838 | 366 |
| 468 | iso_pu_bacteria | 2874645413 | 2874647456 | 366 |
| 469 | iso_pu_bacteria | 2876771140 | 2876772756 | 366 |
| 470 | iso_pu_bacteria | 2876808645 | 2876817426 | 366 |
| 471 | iso_pu_bacteria | 2876818435 | 2876820089 | 366 |
| 472 | iso_pu_bacteria | 2879074833 | 2879076594 | 366 |
| 473 | iso_pu_bacteria | 2879110137 | 2879115117 | 366 |
| 474 | iso_pu_bacteria | 2879127579 | 2879129227 | 366 |
| 475 | iso_pu_bacteria | 2879142872 | 2879144866 | 366 |
| 476 | iso_pu_bacteria | 2885374607 | 2885376103 | 366 |
| 477 | iso_pu_bacteria | 2888378607 | 2888379275 | 366 |
| 478 | iso_pu_bacteria | 2903748898 | 2903751179 | 366 |
| 479 | iso_pu_bacteria | 2904690495 | 2904690893 | 366 |
| 480 | iso_pu_bacteria | 2904699407 | 2904708978 | 366 |
| 481 | iso_pu_bacteria | 2906610324 | 2906613446 | 366 |
| 482 | iso_pu_bacteria | 2906635258 | 2906636160 | 366 |
| 483 | iso_pu_bacteria | 2906660503 | 2906668477 | 366 |
| 484 | iso_pu_bacteria | 2908739725 | 2908747771 | 366 |
| 485 | iso_pu_bacteria | 2908756301 | 2908756949 | 366 |
| 486 | iso_pu_bacteria | 2908775508 | 2908775880 | 366 |
| 487 | iso_pu_bacteria | 2922361189 | 2922363416 | 366 |
| 488 | iso_pu_bacteria | 2922425934 | 2922433883 | 366 |
| 489 | iso_pu_bacteria | 2932794094 | 2932799993 | 366 |
| 490 | iso_pu_bacteria | 2932801729 | 2932809004 | 366 |
| 491 | iso_pu_bacteria | 2935630451 | 2935634912 | 366 |
| 492 | iso_pu_bacteria | 2935769743 | 2935774184 | 366 |
| 493 | iso_pu_bacteria | 2935777560 | 2935782359 | 366 |
| 494 | iso_pu_bacteria | 2935785616 | 2935789100 | 366 |
| 495 | iso_pu_bacteria | 2935793552 | 2935796850 | 366 |
| 496 | iso_pu_bacteria | 2935883170 | 2935888205 | 366 |
| 497 | iso_pu_bacteria | 2935975950 | 2935983106 | 366 |
| 498 | iso_pu_bacteria | 2935984226 | 2935985268 | 366 |
| 499 | iso_pu_bacteria | 2941507105 | 2941514300 | 366 |
| 500 | iso_pu_bacteria | 2941515067 | 2941522261 | 366 |
| 501 | iso_pu_bacteria | 2941523033 | 2941530132 | 366 |
| 502 | iso_pu_bacteria | 2941531003 | 2941537990 | 366 |
| 503 | iso_pu_bacteria | 3005474847 | 3005475396 | 366 |
| 504 | iso_pu_bacteria | 3005506211 | 3005511501 | 366 |
| 505 | iso_pu_bacteria | 3005710791 | 3005711316 | 366 |
| 506 | iso_pu_bacteria | 8006933436 | 8006935888 | 366 |
| 507 | iso_pu_bacteria | 8006964411 | 8006969376 | 366 |
| 508 | iso_pu_bacteria | 8006973647 | 8006975995 | 366 |
| 509 | iso_pu_bacteria | 8006994254 | 8007000669 | 366 |
| 510 | iso_pu_bacteria | 8016522445 | 8016525896 | 366 |
| 511 | iso_pu_bacteria | 8016548790 | 8016549507 | 366 |
| 512 | iso_pu_bacteria | 8016557553 | 8016557929 | 366 |
| 513 | iso_pu_bacteria | 8016566248 | 8016569188 | 366 |
| 514 | iso_pu_bacteria | 8016575299 | 8016581829 | 366 |
| 515 | iso_pu_bacteria | 8016595262 | 8016595949 | 366 |
| 516 | iso_pu_bacteria | 8016603502 | 8016606819 | 366 |
| 517 | iso_pu_bacteria | 8016622563 | 8016622805 | 366 |
| 518 | iso_pu_bacteria | 8019530166 | 8019530778 | 366 |
| 519 | iso_pu_bacteria | 8019538911 | 8019540806 | 366 |
| 520 | iso_pu_bacteria | 8019555841 | 8019562790 | 366 |
| 521 | iso_pu_bacteria | 8019565922 | 8019572867 | 366 |
| 522 | iso_pu_bacteria | 8019619141 | 8019623282 | 366 |
| 523 | iso_pu_bacteria | 8019629233 | 8019629811 | 366 |
| 524 | iso_pu_bacteria | 8019659431 | 8019666651 | 366 |
| 525 | iso_pu_bacteria | 8019668869 | 8019676413 | 366 |
| 526 | iso_pu_bacteria | 8019678201 | 8019679578 | 366 |
| 527 | iso_pu_bacteria | 8056689827 | 8056691918 | 366 |
| 528 | iso_pu_bacteria | 8056967851 | 8056975741 | 366 |
| 529 | 3300003354 | JGI25160J50197_1022859 | JGI25160J50197_10228592 | 367 |
| 530 | 3300004625 | Ga0055543_1001860 | Ga0055543_10018605 | 367 |
| 531 | 3300005262 | Ga0065165_1001256 | Ga0065165_10012565 | 367 |
| 532 | 3300005262 | Ga0065165_1001882 | Ga0065165_10018826 | 367 |
| 533 | 3300005329 | Ga0070683_100006785 | Ga0070683_1000067858 | 367 |
| 534 | 3300005329 | Ga0070683_100063089 | Ga0070683_1000630891 | 367 |
| 535 | 3300005336 | Ga0070680_100072406 | Ga0070680_1000724062 | 367 |
| 536 | 3300005336 | Ga0070680_100115183 | Ga0070680_1001151831 | 367 |
| 537 | 3300005338 | Ga0068868_100020206 | Ga0068868_1000202063 | 367 |
| 538 | 3300005355 | Ga0070671_100107399 | Ga0070671_1001073992 | 367 |
| 539 | 3300005434 | Ga0070709_10013398 | Ga0070709_100133982 | 367 |
| 540 | 3300005434 | Ga0070709_10191243 | Ga0070709_101912431 | 367 |
| 541 | 3300005435 | Ga0070714_100025747 | Ga0070714_1000257475 | 367 |
| 542 | 3300005435 | Ga0070714_100085240 | Ga0070714_1000852402 | 367 |
| 543 | 3300005436 | Ga0070713_100045763 | Ga0070713_1000457633 | 367 |
| 544 | 3300005436 | Ga0070713_100114123 | Ga0070713_1001141232 | 367 |
| 545 | 3300005436 | Ga0070713_100146201 | Ga0070713_1001462011 | 367 |
| 546 | 3300005437 | Ga0070710_10058677 | Ga0070710_100586772 | 367 |
| 547 | 3300005437 | Ga0070710_10146031 | Ga0070710_101460311 | 367 |
| 548 | 3300005439 | Ga0070711_100029579 | Ga0070711_1000295794 | 367 |
| 549 | 3300005439 | Ga0070711_100072221 | Ga0070711_1000722212 | 367 |
| 550 | 3300005458 | Ga0070681_10007785 | Ga0070681_100077855 | 367 |
| 551 | 3300005458 | Ga0070681_10025960 | Ga0070681_100259602 | 367 |
| 552 | 3300005458 | Ga0070681_10067612 | Ga0070681_100676123 | 367 |
| 553 | 3300005530 | Ga0070679_100029510 | Ga0070679_1000295103 | 367 |
| 554 | 3300005535 | Ga0070684_100039474 | Ga0070684_1000394741 | 367 |
| 555 | 3300005535 | Ga0070684_100043666 | Ga0070684_1000436661 | 367 |
| 556 | 3300005539 | Ga0068853_100249969 | Ga0068853_1002499692 | 367 |
| 557 | 3300005547 | Ga0070693_100139979 | Ga0070693_1001399791 | 367 |
| 558 | 3300005548 | Ga0070665_100473897 | Ga0070665_1004738971 | 367 |
| 559 | 3300005563 | Ga0068855_100076020 | Ga0068855_1000760203 | 367 |
| 560 | 3300005577 | Ga0068857_100192075 | Ga0068857_1001920752 | 367 |
| 561 | 3300005578 | Ga0068854_100066395 | Ga0068854_1000663952 | 367 |
| 562 | 3300005616 | Ga0068852_100048996 | Ga0068852_1000489963 | 367 |
| 563 | 3300005617 | Ga0068859_100162321 | Ga0068859_1001623212 | 367 |
| 564 | 3300005618 | Ga0068864_100055046 | Ga0068864_1000550463 | 367 |
| 565 | 3300005834 | Ga0068851_10133862 | Ga0068851_101338621 | 367 |
| 566 | 3300005842 | Ga0068858_100115869 | Ga0068858_1001158693 | 367 |
| 567 | 3300005843 | Ga0068860_100001721 | Ga0068860_1000017214 | 367 |
| 568 | 3300005981 | Ga0081538_10083948 | Ga0081538_100839482 | 367 |
| 569 | 3300005983 | Ga0081540_1032770 | Ga0081540_10327702 | 367 |
| 570 | 3300005983 | Ga0081540_1054173 | Ga0081540_10541732 | 367 |
| 571 | 3300006048 | Ga0075363_100041314 | Ga0075363_1000413143 | 367 |
| 572 | 3300006175 | Ga0070712_100029439 | Ga0070712_1000294392 | 367 |
| 573 | 3300006237 | Ga0097621_100301261 | Ga0097621_1003012611 | 367 |
| 574 | 3300006871 | Ga0075434_100015658 | Ga0075434_1000156584 | 367 |
| 575 | 3300006931 | Ga0097620_100162325 | Ga0097620_1001623252 | 367 |
| 576 | 3300006941 | Ga0099825_1036210 | Ga0099825_10362101 | 367 |
| 577 | 3300006942 | Ga0099824_1012896 | Ga0099824_10128961 | 367 |
| 578 | 3300006943 | Ga0099822_1024801 | Ga0099822_10248011 | 367 |
| 579 | 3300009093 | Ga0105240_10246338 | Ga0105240_102463381 | 367 |
| 580 | 3300009098 | Ga0105245_10027097 | Ga0105245_100270972 | 367 |
| 581 | 3300009177 | Ga0105248_10046836 | Ga0105248_100468365 | 367 |
| 582 | 3300009177 | Ga0105248_10448268 | Ga0105248_104482682 | 367 |
| 583 | 3300009545 | Ga0105237_10037317 | Ga0105237_100373172 | 367 |
| 584 | 3300009545 | Ga0105237_10040511 | Ga0105237_100405114 | 367 |
| 585 | 3300010375 | Ga0105239_10131733 | Ga0105239_101317333 | 367 |
| 586 | 3300013104 | Ga0157370_10125102 | Ga0157370_101251022 | 367 |
| 587 | 3300013105 | Ga0157369_10037979 | Ga0157369_100379795 | 367 |
| 588 | 3300013105 | Ga0157369_10345636 | Ga0157369_103456362 | 367 |
| 589 | 3300013306 | Ga0163162_10051075 | Ga0163162_100510754 | 367 |
| 590 | 3300013308 | Ga0157375_10049447 | Ga0157375_100494472 | 367 |
| 591 | 3300014325 | Ga0163163_10062000 | Ga0163163_100620002 | 367 |
| 592 | 3300014325 | Ga0163163_10110182 | Ga0163163_101101823 | 367 |
| 593 | 3300014968 | Ga0157379_10094448 | Ga0157379_100944482 | 367 |
| 594 | 3300014968 | Ga0157379_10208802 | Ga0157379_102088022 | 367 |
| 595 | 3300017792 | Ga0163161_10091232 | Ga0163161_100912322 | 367 |
| 596 | 3300021320 | Ga0214544_1000344 | Ga0214544_100034456 | 367 |
| 597 | 3300021321 | Ga0214542_1000018 | Ga0214542_100001856 | 367 |
| 598 | 3300021324 | Ga0214545_1000009 | Ga0214545_1000009127 | 367 |
| 599 | 3300021327 | Ga0214543_1000037 | Ga0214543_100003748 | 367 |
| 600 | 3300025253 | Ga0209677_100589 | Ga0209677_1005898 | 367 |
| 601 | 3300025254 | Ga0209148_1000192 | Ga0209148_100019284 | 367 |
| 602 | 3300025254 | Ga0209148_1015780 | Ga0209148_10157802 | 367 |
| 603 | 3300025261 | Ga0209233_1007220 | Ga0209233_10072201 | 367 |
| 604 | 3300025272 | Ga0209455_1000892 | Ga0209455_10008925 | 367 |
| 605 | 3300025272 | Ga0209455_1008942 | Ga0209455_10089423 | 367 |
| 606 | 3300025272 | Ga0209455_1010792 | Ga0209455_10107921 | 367 |
| 607 | 3300025297 | Ga0209758_1006840 | Ga0209758_10068406 | 367 |
| 608 | 3300025302 | Ga0207426_1002230 | Ga0207426_100223013 | 367 |
| 609 | 3300025321 | Ga0207656_10106012 | Ga0207656_101060121 | 367 |
| 610 | 3300025898 | Ga0207692_10064080 | Ga0207692_100640802 | 367 |
| 611 | 3300025901 | Ga0207688_10076931 | Ga0207688_100769312 | 367 |
| 612 | 3300025905 | Ga0207685_10017833 | Ga0207685_100178332 | 367 |
| 613 | 3300025906 | Ga0207699_10024107 | Ga0207699_100241073 | 367 |
| 614 | 3300025909 | Ga0207705_10028807 | Ga0207705_100288072 | 367 |
| 615 | 3300025910 | Ga0207684_10067768 | Ga0207684_100677682 | 367 |
| 616 | 3300025911 | Ga0207654_10018076 | Ga0207654_100180763 | 367 |
| 617 | 3300025912 | Ga0207707_10001578 | Ga0207707_1000157811 | 367 |
| 618 | 3300025912 | Ga0207707_10119841 | Ga0207707_101198412 | 367 |
| 619 | 3300025915 | Ga0207693_10035603 | Ga0207693_100356035 | 367 |
| 620 | 3300025917 | Ga0207660_10025124 | Ga0207660_100251243 | 367 |
| 621 | 3300025921 | Ga0207652_10185062 | Ga0207652_101850622 | 367 |
| 622 | 3300025927 | Ga0207687_10015988 | Ga0207687_100159883 | 367 |
| 623 | 3300025928 | Ga0207700_10037283 | Ga0207700_100372832 | 367 |
| 624 | 3300025928 | Ga0207700_10044600 | Ga0207700_100446002 | 367 |
| 625 | 3300025932 | Ga0207690_10117365 | Ga0207690_101173653 | 367 |
| 626 | 3300025939 | Ga0207665_10181823 | Ga0207665_101818232 | 367 |
| 627 | 3300025941 | Ga0207711_10093621 | Ga0207711_100936212 | 367 |
| 628 | 3300025942 | Ga0207689_10138006 | Ga0207689_101380062 | 367 |
| 629 | 3300025944 | Ga0207661_10001342 | Ga0207661_100013422 | 367 |
| 630 | 3300025944 | Ga0207661_10061223 | Ga0207661_100612232 | 367 |
| 631 | 3300025945 | Ga0207679_10164670 | Ga0207679_101646702 | 367 |
| 632 | 3300025981 | Ga0207640_10052250 | Ga0207640_100522502 | 367 |
| 633 | 3300026023 | Ga0207677_10022538 | Ga0207677_100225382 | 367 |
| 634 | 3300026035 | Ga0207703_10182084 | Ga0207703_101820842 | 367 |
| 635 | 3300026035 | Ga0207703_10275308 | Ga0207703_102753081 | 367 |
| 636 | 3300026041 | Ga0207639_10132669 | Ga0207639_101326692 | 367 |
| 637 | 3300026078 | Ga0207702_10000589 | Ga0207702_1000058922 | 367 |
| 638 | 3300026116 | Ga0207674_10063655 | Ga0207674_100636553 | 367 |
| 639 | 3300026121 | Ga0207683_10069852 | Ga0207683_100698522 | 367 |
| 640 | 3300027296 | Ga0209389_1000064 | Ga0209389_100006478 | 367 |
| 641 | 3300027357 | Ga0209589_1000017 | Ga0209589_10000171 | 367 |
| 642 | 3300027361 | Ga0209489_100018 | Ga0209489_1000181 | 367 |
| 643 | 3300027361 | Ga0209489_104884 | Ga0209489_10488412 | 367 |
| 644 | 3300027363 | Ga0209700_100014 | Ga0209700_100014202 | 367 |
| 645 | 3300027363 | Ga0209700_100028 | Ga0209700_1000281 | 367 |
| 646 | 3300028379 | Ga0268266_10004550 | Ga0268266_100045501 | 367 |
| 647 | 3300028379 | Ga0268266_10123600 | Ga0268266_101236002 | 367 |
| 648 | 3300028381 | Ga0268264_10000107 | Ga0268264_10000107135 | 367 |
| 649 | 3300028563 | Ga0265319_1001409 | Ga0265319_100140912 | 367 |
| 650 | 3300028573 | Ga0265334_10001624 | Ga0265334_100016247 | 367 |
| 651 | 3300028653 | Ga0265323_10000684 | Ga0265323_100006849 | 367 |
| 652 | 3300028666 | Ga0265336_10000459 | Ga0265336_1000045912 | 367 |
| 653 | 3300028786 | Ga0307517_10002574 | Ga0307517_100025748 | 367 |
| 654 | 3300028794 | Ga0307515_10027983 | Ga0307515_100279832 | 367 |
| 655 | 3300028800 | Ga0265338_10002741 | Ga0265338_1000274111 | 367 |
| 656 | 3300029957 | Ga0265324_10002054 | Ga0265324_100020546 | 367 |
| 657 | 3300031247 | Ga0265340_10047370 | Ga0265340_100473702 | 367 |
| 658 | 3300031249 | Ga0265339_10000343 | Ga0265339_1000034327 | 367 |
| 659 | 3300031249 | Ga0265339_10014756 | Ga0265339_100147563 | 367 |
| 660 | 3300031250 | Ga0265331_10009516 | Ga0265331_100095161 | 367 |
| 661 | 3300031456 | Ga0307513_10129649 | Ga0307513_101296493 | 367 |
| 662 | 3300031507 | Ga0307509_10035847 | Ga0307509_100358476 | 367 |
| 663 | 3300031507 | Ga0307509_10042195 | Ga0307509_100421953 | 367 |
| 664 | 3300031616 | Ga0307508_10020956 | Ga0307508_100209565 | 367 |
| 665 | 3300031711 | Ga0265314_10007141 | Ga0265314_100071413 | 367 |
| 666 | 3300031711 | Ga0265314_10024387 | Ga0265314_100243873 | 367 |
| 667 | 3300031730 | Ga0307516_10006998 | Ga0307516_100069983 | 367 |
| 668 | 3300031730 | Ga0307516_10080619 | Ga0307516_100806192 | 367 |
| 669 | 3300031731 | Ga0307405_10065596 | Ga0307405_100655962 | 367 |
| 670 | 3300033180 | Ga0307510_10014423 | Ga0307510_100144237 | 367 |
| 671 | 3300033180 | Ga0307510_10073938 | Ga0307510_100739383 | 367 |
| 672 | 3300033180 | Ga0307510_10093620 | Ga0307510_100936202 | 367 |
| 673 | 3300033442 | Ga0315911_1000048 | Ga0315911_100004817 | 367 |
| 674 | 3300035112 | Ga0373932_0033681 | Ga0373932_0033681_280_1392 | 367 |
| 675 | 3300035113 | Ga0373936_0003688 | Ga0373936_0003688_1492_2604 | 367 |
| 676 | 3300035115 | Ga0373941_0037501 | Ga0373941_0037501_129_1241 | 367 |
| 677 | 3300035170 | Ga0373943_0006410 | Ga0373943_0006410_932_2044 | 367 |
| 678 | 3300035171 | Ga0373946_0029352 | Ga0373946_0029352_673_1785 | 367 |
| 679 | 3300035172 | Ga0373955_0020868 | Ga0373955_0020868_1411_2523 | 367 |
| 680 | 3300035691 | Ga0373931_0004987 | Ga0373931_0004987_2133_3245 | 367 |
| 681 | 3300035692 | Ga0373935_0000119 | Ga0373935_0000119_19121_20233 | 367 |
| 682 | 3300035692 | Ga0373935_0032120 | Ga0373935_0032120_1152_2264 | 367 |
| 683 | 3300035692 | Ga0373935_0181812 | Ga0373935_0181812_41_1153 | 367 |
| 684 | 3300035695 | Ga0373927_0000965 | Ga0373927_0000965_729_1841 | 367 |
| 685 | 3300035695 | Ga0373927_0003633 | Ga0373927_0003633_2233_3351 | 367 |
| 686 | 3300035695 | Ga0373927_0015399 | Ga0373927_0015399_2367_3479 | 367 |
| 687 | 3300035695 | Ga0373927_0030573 | Ga0373927_0030573_969_2081 | 367 |
| 688 | 3300035725 | Ga0373947_0001785 | Ga0373947_0001785_3140_4252 | 367 |
| 689 | 3300035725 | Ga0373947_0007763 | Ga0373947_0007763_3321_4439 | 367 |
| 690 | 3300035725 | Ga0373947_0105965 | Ga0373947_0105965_542_1654 | 367 |
| 691 | 3300037068 | Ga0373925_0091624 | Ga0373925_0091624_93_1205 | 367 |
| 692 | 3300037466 | Ga0395898_0083383 | Ga0395898_0083383_1131_2243 | 367 |
| 693 | 3300037471 | Ga0395905_0211709 | Ga0395905_0211709_35_1147 | 367 |
| 694 | 3300037853 | Ga0436364_1512892 | Ga0436364_1512892_266_1378 | 367 |
| 695 | 3300038443 | Ga0395901_0124917 | Ga0395901_0124917_890_2002 | 367 |
| 696 | 3300039437 | Ga0436365_1777612 | Ga0436365_1777612_703_1815 | 367 |
| 697 | 3300039447 | Ga0436361_0907816 | Ga0436361_0907816_141_1253 | 367 |
| 698 | 3300039450 | Ga0436363_1460349 | Ga0436363_1460349_9621_10733 | 367 |
| 699 | 3300044735 | Ga0466968_0106923 | Ga0466968_0106923_49_1161 | 367 |
| 700 | 3300045976 | Ga0466967_0053723 | Ga0466967_0053723_95_1207 | 367 |
| 701 | 3300046455 | Ga0495603_0001895 | Ga0495603_0001895_3159_4271 | 367 |
| 702 | 3300046459 | Ga0495629_0000353 | Ga0495629_0000353_15086_16198 | 367 |
| 703 | 3300046460 | Ga0495638_0008632 | Ga0495638_0008632_5443_6555 | 367 |
| 704 | 3300046461 | Ga0495641_0000972 | Ga0495641_0000972_8593_9705 | 367 |
| 705 | 3300046462 | Ga0495651_0023259 | Ga0495651_0023259_2519_3631 | 367 |
| 706 | 3300046463 | Ga0495653_0074094 | Ga0495653_0074094_224_1336 | 367 |
| 707 | 3300046463 | Ga0495653_0117196 | Ga0495653_0117196_332_1444 | 367 |
| 708 | 3300046472 | Ga0495580_0004944 | Ga0495580_0004944_1119_2231 | 367 |
| 709 | 3300046472 | Ga0495580_0120636 | Ga0495580_0120636_523_1635 | 367 |
| 710 | 3300046473 | Ga0495582_0000444 | Ga0495582_0000444_14195_15307 | 367 |
| 711 | 3300046473 | Ga0495582_0079158 | Ga0495582_0079158_624_1736 | 367 |
| 712 | 3300046475 | Ga0495639_0000177 | Ga0495639_0000177_22895_24007 | 367 |
| 713 | 3300046475 | Ga0495639_0014881 | Ga0495639_0014881_1422_2534 | 367 |
| 714 | 3300046476 | Ga0495662_0011228 | Ga0495662_0011228_2073_3185 | 367 |
| 715 | 3300046477 | Ga0495664_0007231 | Ga0495664_0007231_1949_3061 | 367 |
| 716 | 3300046477 | Ga0495664_0062816 | Ga0495664_0062816_569_1681 | 367 |
| 717 | 3300046477 | Ga0495664_0083223 | Ga0495664_0083223_761_1873 | 367 |
| 718 | 3300046492 | Ga0495585_0060854 | Ga0495585_0060854_129_1241 | 367 |
| 719 | 3300046499 | Ga0495594_0000079 | Ga0495594_0000079_14504_15616 | 367 |
| 720 | 3300046507 | Ga0495606_0000901 | Ga0495606_0000901_10131_11258 | 367 |
| 721 | 3300046516 | Ga0495628_0053632 | Ga0495628_0053632_783_1895 | 367 |
| 722 | 3300046516 | Ga0495628_0072261 | Ga0495628_0072261_325_1437 | 367 |
| 723 | 3300046517 | Ga0495630_0011873 | Ga0495630_0011873_4466_5578 | 367 |
| 724 | 3300046531 | Ga0495665_0000570 | Ga0495665_0000570_2796_3908 | 367 |
| 725 | 3300046533 | Ga0495640_0021203 | Ga0495640_0021203_1076_2188 | 367 |
| 726 | 3300046537 | Ga0495598_0001754 | Ga0495598_0001754_1893_3005 | 367 |
| 727 | 3300046543 | Ga0495645_0004492 | Ga0495645_0004492_6580_7692 | 367 |
| 728 | 3300046543 | Ga0495645_0142379 | Ga0495645_0142379_171_1283 | 367 |
| 729 | 3300046557 | Ga0495622_0000888 | Ga0495622_0000888_14609_15721 | 367 |
| 730 | 3300046615 | Ga0495656_0001212 | Ga0495656_0001212_1816_2928 | 367 |
| 731 | 3300046642 | Ga0495634_0000334 | Ga0495634_0000334_20436_21548 | 367 |
| 732 | 3300046660 | Ga0495625_0045332 | Ga0495625_0045332_1117_2229 | 367 |
| 733 | 3300046663 | Ga0495635_0035680 | Ga0495635_0035680_1973_3085 | 367 |
| 734 | 3300046663 | Ga0495635_0062948 | Ga0495635_0062948_630_1787 | 367 |
| 735 | 3300046663 | Ga0495635_0248920 | Ga0495635_0248920_26_1138 | 367 |
| 736 | 3300046675 | Ga0495657_0010390 | Ga0495657_0010390_74_1186 | 367 |
| 737 | 3300046675 | Ga0495657_0044452 | Ga0495657_0044452_1240_2352 | 367 |
| 738 | 3300046679 | Ga0495623_0079436 | Ga0495623_0079436_460_1572 | 367 |
| 739 | 3300046681 | Ga0495647_0000894 | Ga0495647_0000894_721_1833 | 367 |
| 740 | 3300046683 | Ga0495658_0000416 | Ga0495658_0000416_3798_4910 | 367 |
| 741 | 3300046690 | Ga0495624_0003210 | Ga0495624_0003210_3960_5072 | 367 |
| 742 | 3300046809 | Ga0495600_0039333 | Ga0495600_0039333_869_1981 | 367 |
| 743 | 3300047315 | Ga0495581_0000426 | Ga0495581_0000426_5309_6421 | 367 |
| 744 | 3300047315 | Ga0495581_0174638 | Ga0495581_0174638_45_1157 | 367 |
| 745 | 3300047317 | Ga0495604_0010461 | Ga0495604_0010461_4827_5984 | 367 |
| 746 | 3300047317 | Ga0495604_0138076 | Ga0495604_0138076_65_1321 | 367 |
| 747 | 3300047318 | Ga0495636_0075605 | Ga0495636_0075605_311_1423 | 367 |
| 748 | 3300047319 | Ga0495674_0000533 | Ga0495674_0000533_19497_20609 | 367 |
| 749 | 3300047319 | Ga0495674_0018661 | Ga0495674_0018661_1292_2404 | 367 |
| 750 | 3300047322 | Ga0495680_0076618 | Ga0495680_0076618_1360_2472 | 367 |
| 751 | 3300047444 | Ga0495675_0094781 | Ga0495675_0094781_191_1303 | 367 |
| 752 | 3300047469 | Ga0495673_0019403 | Ga0495673_0019403_1953_3065 | 367 |
| 753 | 3300047472 | Ga0495686_0028879 | Ga0495686_0028879_1162_2379 | 367 |
| 754 | 3300048088 | Ga0495602_0281441 | Ga0495602_0281441_83_1195 | 367 |
| 755 | 3300048089 | Ga0495614_0038997 | Ga0495614_0038997_681_1793 | 367 |
| 756 | 3300048903 | Ga0496100_0072280 | Ga0496100_0072280_150_1262 | 367 |
| 757 | 3300048903 | Ga0496100_0106717 | Ga0496100_0106717_291_1403 | 367 |
| 758 | 3300048904 | Ga0496101_0003771 | Ga0496101_0003771_297_1409 | 367 |
| 759 | 3300048904 | Ga0496101_0263915 | Ga0496101_0263915_164_1276 | 367 |
| 760 | 3300048905 | Ga0496102_0005218 | Ga0496102_0005218_6366_7478 | 367 |
| 761 | 3300048905 | Ga0496102_0167530 | Ga0496102_0167530_112_1224 | 367 |
| 762 | 3300048905 | Ga0496102_0326701 | Ga0496102_0326701_255_1367 | 367 |
| 763 | 3300048907 | Ga0496104_0016231 | Ga0496104_0016231_3581_4693 | 367 |
| 764 | 3300048907 | Ga0496104_0022194 | Ga0496104_0022194_1035_2147 | 367 |
| 765 | 3300048907 | Ga0496104_0093971 | Ga0496104_0093971_1381_2493 | 367 |
| 766 | 3300048908 | Ga0496105_0019070 | Ga0496105_0019070_2070_3182 | 367 |
| 767 | 3300048910 | Ga0496107_0003550 | Ga0496107_0003550_7034_8146 | 367 |
| 768 | 3300048910 | Ga0496107_0246505 | Ga0496107_0246505_48_1160 | 367 |
| 769 | 3300048911 | Ga0496108_0022679 | Ga0496108_0022679_2673_3785 | 367 |
| 770 | 3300048912 | Ga0496109_0011126 | Ga0496109_0011126_5305_6417 | 367 |
| 771 | 3300048912 | Ga0496109_0093698 | Ga0496109_0093698_254_1366 | 367 |
| 772 | 3300048913 | Ga0496110_0007857 | Ga0496110_0007857_2070_3182 | 367 |
| 773 | 3300048914 | Ga0496111_0047714 | Ga0496111_0047714_729_1841 | 367 |
| 774 | 3300048914 | Ga0496111_0071439 | Ga0496111_0071439_520_1632 | 367 |
| 775 | 3300048915 | Ga0496112_0056475 | Ga0496112_0056475_985_2097 | 367 |
| 776 | 3300048915 | Ga0496112_0360592 | Ga0496112_0360592_120_1277 | 367 |
| 777 | 3300048916 | Ga0496113_0006395 | Ga0496113_0006395_363_1475 | 367 |
| 778 | 3300048916 | Ga0496113_0137080 | Ga0496113_0137080_234_1346 | 367 |
| 779 | 3300048917 | Ga0496114_0075310 | Ga0496114_0075310_208_1320 | 367 |
| 780 | 3300048917 | Ga0496114_0080809 | Ga0496114_0080809_264_1376 | 367 |
| 781 | 3300048918 | Ga0496115_0002700 | Ga0496115_0002700_6028_7140 | 367 |
| 782 | 3300048918 | Ga0496115_0006372 | Ga0496115_0006372_192_1304 | 367 |
| 783 | 3300048918 | Ga0496115_0057962 | Ga0496115_0057962_984_2096 | 367 |
| 784 | 3300048918 | Ga0496115_0255972 | Ga0496115_0255972_195_1307 | 367 |
| 785 | 3300048920 | Ga0496117_0054649 | Ga0496117_0054649_343_1467 | 367 |
| 786 | 3300048920 | Ga0496117_0112018 | Ga0496117_0112018_81_1193 | 367 |
| 787 | 3300048921 | Ga0496118_0005790 | Ga0496118_0005790_8894_10018 | 367 |
| 788 | 3300048921 | Ga0496118_0190073 | Ga0496118_0190073_38_1150 | 367 |
| 789 | 3300048922 | Ga0496119_0075898 | Ga0496119_0075898_774_1886 | 367 |
| 790 | 3300048923 | Ga0496120_0144660 | Ga0496120_0144660_37_1149 | 367 |
| 791 | 3300048924 | Ga0496121_0001272 | Ga0496121_0001272_39391_40515 | 367 |
| 792 | 3300048924 | Ga0496121_0020252 | Ga0496121_0020252_1936_3093 | 367 |
| 793 | 3300048924 | Ga0496121_0125503 | Ga0496121_0125503_621_1733 | 367 |
| 794 | 3300048924 | Ga0496121_0157641 | Ga0496121_0157641_119_1231 | 367 |
| 795 | 3300048924 | Ga0496121_0255556 | Ga0496121_0255556_66_1178 | 367 |
| 796 | 3300048926 | Ga0496123_0080063 | Ga0496123_0080063_663_1775 | 367 |
| 797 | 3300048927 | Ga0496124_0001012 | Ga0496124_0001012_27555_28679 | 367 |
| 798 | 3300048927 | Ga0496124_0205458 | Ga0496124_0205458_68_1180 | 367 |
| 799 | 3300048928 | Ga0496125_0034253 | Ga0496125_0034253_3082_4206 | 367 |
| 800 | 3300048928 | Ga0496125_0037965 | Ga0496125_0037965_220_1332 | 367 |
| 801 | 3300048928 | Ga0496125_0198570 | Ga0496125_0198570_105_1217 | 367 |
| 802 | 3300048929 | Ga0496126_0003575 | Ga0496126_0003575_9146_10258 | 367 |
| 803 | 3300048929 | Ga0496126_0007151 | Ga0496126_0007151_1641_2753 | 367 |
| 804 | 3300048929 | Ga0496126_0037272 | Ga0496126_0037272_1276_2388 | 367 |
| 805 | 3300048929 | Ga0496126_0047051 | Ga0496126_0047051_1413_2582 | 367 |
| 806 | 3300048929 | Ga0496126_0108539 | Ga0496126_0108539_904_2016 | 367 |
| 807 | 3300048929 | Ga0496126_0131325 | Ga0496126_0131325_632_1744 | 367 |
| 808 | 3300049580 | Ga0501046_0045107 | Ga0501046_0045107_1823_2935 | 367 |
| 809 | 3300049586 | Ga0501070_0011799 | Ga0501070_0011799_5029_6141 | 367 |
| 810 | 3300049590 | Ga0501074_0043112 | Ga0501074_0043112_455_1567 | 367 |
| 811 | 3300050490 | nmdc:mga03n38_5383_c1 | nmdc:mga03n38_5383_c1_3180_4292 | 367 |
| 812 | 3300050496 | nmdc:mga07m45_11152_c1 | nmdc:mga07m45_11152_c1_604_1716 | 367 |
| 813 | 3300050496 | nmdc:mga07m45_24236_c1 | nmdc:mga07m45_24236_c1_2173_3285 | 367 |
| 814 | 3300050512 | nmdc:mga0n895_4662_c1 | nmdc:mga0n895_4662_c1_7875_8990 | 367 |
| 815 | 3300053077 | Ga0495601_0139632 | Ga0495601_0139632_146_1258 | 367 |
| 816 | 3300053080 | Ga0500635_0006999 | Ga0500635_0006999_1569_2681 | 367 |
| 817 | 3300053080 | Ga0500635_0048824 | Ga0500635_0048824_44_1156 | 367 |
| 818 | 3300053086 | Ga0500578_0089271 | Ga0500578_0089271_236_1393 | 367 |
| 819 | 3300053094 | Ga0500566_0000022 | Ga0500566_0000022_40448_41560 | 367 |
| 820 | 3300053095 | Ga0500640_011905 | Ga0500640_011905_2357_3469 | 367 |
| 821 | 3300053102 | Ga0500554_002353 | Ga0500554_002353_2505_3617 | 367 |
| 822 | 3300053105 | Ga0500557_000026 | Ga0500557_000026_38264_39376 | 367 |
| 823 | 3300053109 | Ga0500569_046832 | Ga0500569_046832_23_1180 | 367 |
| 824 | 3300053111 | Ga0500572_001109 | Ga0500572_001109_6500_7612 | 367 |
| 825 | 3300053111 | Ga0500572_021422 | Ga0500572_021422_97_1209 | 367 |
| 826 | 3300053119 | Ga0500595_000095 | Ga0500595_000095_2180_3415 | 367 |
| 827 | 3300053119 | Ga0500595_005768 | Ga0500595_005768_53_1165 | 367 |
| 828 | 3300053122 | Ga0500608_008047 | Ga0500608_008047_1381_2493 | 367 |
| 829 | 3300053123 | Ga0500614_002834 | Ga0500614_002834_1644_2756 | 367 |
| 830 | 3300053136 | Ga0500559_0000219 | Ga0500559_0000219_29950_31062 | 367 |
| 831 | 3300053136 | Ga0500559_0002476 | Ga0500559_0002476_126_1238 | 367 |
| 832 | 3300053139 | Ga0500568_0045000 | Ga0500568_0045000_558_1670 | 367 |
| 833 | 3300053150 | Ga0500603_000192 | Ga0500603_000192_409_1521 | 367 |
| 834 | 3300053150 | Ga0500603_000199 | Ga0500603_000199_2888_4000 | 367 |
| 835 | 3300053153 | Ga0500616_0021691 | Ga0500616_0021691_699_1811 | 367 |
| 836 | 3300053155 | Ga0500620_030897 | Ga0500620_030897_238_1395 | 367 |
| 837 | 3300053156 | Ga0500622_0006911 | Ga0500622_0006911_3324_4436 | 367 |
| 838 | 3300053162 | Ga0500638_030072 | Ga0500638_030072_906_2141 | 367 |
| 839 | 3300053163 | Ga0500639_029184 | Ga0500639_029184_845_1957 | 367 |
| 840 | 3300053177 | Ga0500636_0009769 | Ga0500636_0009769_4396_5553 | 367 |
| 841 | 3300053177 | Ga0500636_0018270 | Ga0500636_0018270_1988_3145 | 367 |
| 842 | 3300053178 | Ga0500637_0016091 | Ga0500637_0016091_1645_2757 | 367 |
| 843 | 3300053725 | Ga0500576_084736 | Ga0500576_084736_191_1303 | 367 |
| 844 | 3300053729 | Ga0500625_003257 | Ga0500625_003257_168_1280 | 367 |
| 845 | 3300053730 | Ga0500645_013287 | Ga0500645_013287_613_1725 | 367 |
| 846 | 3300053730 | Ga0500645_023810 | Ga0500645_023810_168_1280 | 367 |
| 847 | iso_pu_bacteria | 2513237137 | 2513863836 | 367 |
| 848 | iso_pu_bacteria | 2528768022 | 2528851849 | 367 |
| 849 | iso_pu_bacteria | 2841957949 | 2841965069 | 367 |
| 850 | iso_pu_bacteria | 2847930680 | 2847931368 | 367 |
| 851 | iso_pu_bacteria | 2879083081 | 2879087595 | 367 |
| 852 | iso_pu_bacteria | 2885409591 | 2885417692 | 367 |
| 853 | iso_pu_bacteria | 2906626472 | 2906629106 | 367 |
| 854 | iso_pu_bacteria | 2906643746 | 2906650509 | 367 |
| 855 | iso_pu_bacteria | 8016583857 | 8016586026 | 367 |
| 856 | 3300053140 | Ga0500573_0095248 | Ga0500573_0095248_294_1430 | 369 |
| 857 | 3300053177 | Ga0500636_0015595 | Ga0500636_0015595_3294_4430 | 369 |
| 858 | 3300001979 | JGI24740J21852_10001506 | JGI24740J21852_100015063 | 371 |
| 859 | 3300001990 | JGI24737J22298_10000974 | JGI24737J22298_100009745 | 371 |
| 860 | 3300005457 | Ga0070662_100079169 | Ga0070662_1000791691 | 371 |
| 861 | 3300005539 | Ga0068853_100030486 | Ga0068853_1000304863 | 371 |
| 862 | 3300005616 | Ga0068852_100022654 | Ga0068852_1000226543 | 371 |
| 863 | 3300005834 | Ga0068851_10001130 | Ga0068851_100011306 | 371 |
| 864 | 3300009174 | Ga0105241_10006358 | Ga0105241_100063583 | 371 |
| 865 | 3300025321 | Ga0207656_10032185 | Ga0207656_100321852 | 371 |
| 866 | 3300025904 | Ga0207647_10002062 | Ga0207647_100020626 | 371 |
| 867 | 3300025911 | Ga0207654_10000152 | Ga0207654_100001524 | 371 |
| 868 | 3300025913 | Ga0207695_10009228 | Ga0207695_100092288 | 371 |
| 869 | 3300025914 | Ga0207671_10043870 | Ga0207671_100438703 | 371 |
| 870 | 3300025924 | Ga0207694_10000106 | Ga0207694_1000010637 | 371 |
| 871 | 3300026078 | Ga0207702_10000004 | Ga0207702_1000000437 | 371 |
| 872 | 3300026078 | Ga0207702_10021167 | Ga0207702_100211673 | 371 |
| 873 | 3300048908 | Ga0496105_0005991 | Ga0496105_0005991_4071_5324 | 371 |
| 874 | 3300048911 | Ga0496108_0002680 | Ga0496108_0002680_9714_10967 | 371 |
| 875 | 3300048912 | Ga0496109_0002643 | Ga0496109_0002643_9526_10779 | 371 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gd0-assembly1.cif.gz_A | the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety | 0.9367 | 15 | 368 |
| 2yim-assembly2.cif.gz_C | the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue | 0.9358 | 15 | 368 |
| 2gd0-assembly1.cif.gz_A | the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety | 0.9316 | 15 | 368 |
| 2yim-assembly2.cif.gz_C | the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue | 0.9307 | 15 | 368 |
| 2g04-assembly2.cif.gz_D | crystal structure of fatty acid-coa racemase from mycobacterium tuberculosis h37rv | 0.9254 | 16 | 359 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x74A04 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9468 | 222 | 312 | 3.30.1540.10 |
| af_Q9VIK0_212_295_3.30.1540.10 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9448 | 229 | 313 | 3.30.1540.10 |
| 1x74D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9397 | 21 | 195 | 3.40.50.10540 |
| 1x74A04 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9369 | 222 | 312 | 3.30.1540.10 |
| af_O06543_1_217_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9309 | 15 | 226 | 3.40.50.10540 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D8WUT7-F1-model_v4 | Carnitine dehydratase | 0.9492 | 13 | 127 |
GO:0003824
|
| AF-A0A2S8WC69-F1-model_v4 | Carnitine dehydratase | 0.9452 | 27 | 356 |
GO:0003824
|
| AF-W3RIM7-F1-model_v4 | Carnitine dehydratase | 0.9406 | 8 | 369 |
GO:0003824
|
| AF-A0A0L8NHC7-F1-model_v4 | deleted | 0.9404 | 21 | 342 |
|
| AF-A0A3A9TT03-F1-model_v4 | deleted | 0.9395 | 14 | 367 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar