F484335

General Info

Members Datasets Scaffolds Average Seq Length
875 574 643 371

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0141930|Ga0501032_0141930_370_1494
Length 374
Sequence MTGPTKATGPLRGVRVVEFAGIGPGPFAAMLLSDMGAEVVTIARPGKGKQDARNFVARGRKVVELDLKKPEHVAQALDLIGAADILIEGFRPKVMERLGLGPDEALKRNPRLVYGRMTGWGQDGPLAQAAGHDINYIAITGALDSFRSPHGDPVSPLNLVGDYGGGALFLVVGVLAALTEARSSGKGQVVDAAMCDGVSSMLTMFHAMKAMGRWTDQPRTNMLDGGAHFYRTYRCKDGGYMAIGAIEPQFYAELRERAGLHDAAFDKQLSRGDWPALQERMTDIFKTKTRDEWAKLLEGTDACAAAVVGLFEAPSHPHLAARQTFVTHDGYVQPAPAPRFSRTPSAIQGTAAVEPVDAAELVRQWSNTPSLKLA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221609 Acidovorax sp. Root217 Isolate Unclassified
29 2643221651 Afipia sp. Root123D2 Isolate Unclassified
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
35 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
36 2791355199
37 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
38 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
39 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
40 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
41 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
42 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
43 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
44 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
47 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
48 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
49 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
50 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
51 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
52 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
53 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
54 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
55 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
56 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
57 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
58 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
59 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
60 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
61 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
62 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
63 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
64 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
65 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
66 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
67 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
68 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
69 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
70 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
71 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
72 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
92 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
93 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
94 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
95 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
96 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
97 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
98 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
99 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
100 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
105 2904699407
106 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
107 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
108 2906610324
109 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
110 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
111 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
112 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
113 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
114 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
115 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
116 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
117 2922368715
118 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
119 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
120 2922425934
121 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
122 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
123 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
124 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
125 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
126 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
127 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
128 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
129 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
130 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
131 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
134 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
135 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
136 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
137 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
138 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
139 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
140 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
141 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
142 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
143 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
144 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
145 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
146 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
147 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
148 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
149 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
150 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
151 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
152 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
153 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
154 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
155 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
156 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
157 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
158 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
159 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
160 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
161 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
164 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
165 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
166 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
167 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
168 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
169 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
170 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
171 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
172 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
173 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
174 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
175 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
176 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
177 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
178 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
179 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
180 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
181 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
182 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
183 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
184 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
185 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
186 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
187 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
188 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
189 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
190 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
191 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
192 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
193 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
194 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
195 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
196 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
197 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
198 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
199 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
202 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
205 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
206 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
207 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
208 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
209 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
210 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
211 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
212 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
213 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
214 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
215 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
216 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
217 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
218 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
219 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
220 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
221 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
222 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
223 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
224 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
225 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
226 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
227 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
228 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
229 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
230 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
231 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
232 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
238 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
239 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
240 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
241 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
244 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
245 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
246 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
247 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
248 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
249 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
250 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
251 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
252 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
253 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
254 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
255 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
256 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
257 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
258 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
259 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
260 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
261 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
262 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
263 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
264 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
265 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
266 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
267 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
268 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
269 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
270 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
271 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
272 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
273 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
274 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
275 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
276 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
280 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
282 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
283 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
284 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
286 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
329 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
330 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
331 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
332 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
336 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
337 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
338 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
339 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
340 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
341 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
342 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
343 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
344 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
345 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
346 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
347 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
348 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
349 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
350 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
351 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
352 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
353 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
354 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
355 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
356 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
357 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
358 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
359 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
360 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
361 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
362 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
363 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
364 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
365 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
366 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
367 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
368 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
369 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
370 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
371 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
372 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
373 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
374 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
375 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
376 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
377 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
378 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
380 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
381 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
382 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
383 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
384 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
385 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
386 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
387 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
388 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
389 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
390 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
391 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
392 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
393 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
394 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
395 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
396 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
397 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
398 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
399 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
400 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
401 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
402 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
403 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
404 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
405 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
406 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
407 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
408 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
409 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
410 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
411 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
412 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
413 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
414 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
415 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
416 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
417 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
418 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
419 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
420 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
421 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
422 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
423 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
424 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
425 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
426 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
427 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
428 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
429 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
430 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
431 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
432 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
433 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
434 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
435 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
436 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
437 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
438 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
439 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
440 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
441 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
442 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
443 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
444 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
445 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
446 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
447 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
448 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
449 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
450 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
451 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
452 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
453 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
454 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
455 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
456 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
457 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
458 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
459 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
460 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
461 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
462 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
463 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
464 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
465 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
466 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
467 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
468 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
469 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
470 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
471 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
472 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
473 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
474 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
475 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
476 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
477 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
480 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
481 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
482 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
483 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
490 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
491 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
492 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
493 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
494 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
495 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
496 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
497 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
498 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
499 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
500 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
501 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
502 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
505 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
506 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
507 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
508 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
509 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
510 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
511 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
512 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
513 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
514 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
515 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
516 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
517 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
518 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
519 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
520 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
521 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
522 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
523 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
524 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
525 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
526 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
527 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
528 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
529 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
530 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
531 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
532 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
535 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
536 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
537 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
538 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
539 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
540 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
541 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
542 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
543 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
544 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
545 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
546 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
547 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
548 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
549 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
550 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
551 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
552 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
553 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
554 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
555 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
556 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
557 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
558 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
559 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
560 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
561 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
562 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
563 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
564 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
565 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
566 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
567 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
568 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
569 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
570 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
571 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
572 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
573 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
574 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.79
Metatranscriptomes 0.11
Isolates 26.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.51
Nodule 21.6
Rhizoplane 6.74
Rhizosphere 46.97
Stem 0
Stem Tuber 0
Unclassified 14.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001506 3300001979 Bacteria 10702
2 JGI24737J22298_10000974 3300001990 Bacteria 10160
3 JGI25151J46595_10002341 3300003187 Bacteria 11527
4 JGI25406J46586_10000887 3300003203 Bacteria 14075
5 JGI25153J46596_10001684 3300003215 Bacteria 13110
6 JGI25153J46596_10003279 3300003215 Bacteria 9094
7 JGI25153J46596_10004047 3300003215 Bacteria 7991
8 JGI25160J50197_1022859 3300003354 Bacteria 1823
9 Ga0055531_10012840 3300003794 Bacteria 3905
10 Ga0055543_1001860 3300004625 Bacteria 7683
11 Ga0065165_1001256 3300005262 Bacteria 28720
12 Ga0065165_1001882 3300005262 Bacteria 20268
13 Ga0065165_1005779 3300005262 Bacteria 6766
14 Ga0070683_100006785 3300005329 Bacteria 9622
15 Ga0070683_100063089 3300005329 Bacteria 3446
16 Ga0070680_100072406 3300005336 Bacteria 2832
17 Ga0070680_100115183 3300005336 Bacteria 2240
18 Ga0068868_100020206 3300005338 Bacteria 5000
19 Ga0070668_100035262 3300005347 Bacteria 3814
20 Ga0070668_100039201 3300005347 Bacteria 3623
21 Ga0070671_100107399 3300005355 Bacteria 2343
22 Ga0070709_10013398 3300005434 Bacteria 4609
23 Ga0070709_10191243 3300005434 Bacteria 1444
24 Ga0070714_100025747 3300005435 Bacteria 4858
25 Ga0070714_100085240 3300005435 Bacteria 2759
26 Ga0070713_100045763 3300005436 Bacteria 3588
27 Ga0070713_100114123 3300005436 Bacteria 2360
28 Ga0070713_100146201 3300005436 Bacteria 2099
29 Ga0070710_10058677 3300005437 Bacteria 2183
30 Ga0070710_10105335 3300005437 Bacteria 1686
31 Ga0070710_10146031 3300005437 Bacteria 1455
32 Ga0070711_100009658 3300005439 Bacteria 5946
33 Ga0070711_100029579 3300005439 Bacteria 3617
34 Ga0070711_100072221 3300005439 Bacteria 2434
35 Ga0070663_100064496 3300005455 Bacteria 2647
36 Ga0070678_100163761 3300005456 Bacteria 1804
37 Ga0070678_100225553 3300005456 Bacteria 1559
38 Ga0070662_100079169 3300005457 Bacteria 2443
39 Ga0070681_10007785 3300005458 Bacteria 10475
40 Ga0070681_10025960 3300005458 Bacteria 5889
41 Ga0070681_10067612 3300005458 Bacteria 3541
42 Ga0070707_100145721 3300005468 Bacteria 2305
43 Ga0070679_100029510 3300005530 Bacteria 5412
44 Ga0070684_100039474 3300005535 Bacteria 4060
45 Ga0070684_100043666 3300005535 Bacteria 3872
46 Ga0068853_100030486 3300005539 Bacteria 4555
47 Ga0068853_100249969 3300005539 Bacteria 1627
48 Ga0070693_100139979 3300005547 Bacteria 1522
49 Ga0070665_100060033 3300005548 Bacteria 3812
50 Ga0070665_100069146 3300005548 Bacteria 3539
51 Ga0070665_100112120 3300005548 Bacteria 2730
52 Ga0070665_100269092 3300005548 Bacteria 1706
53 Ga0070665_100473897 3300005548 Bacteria 1262
54 Ga0068855_100076020 3300005563 Bacteria 3898
55 Ga0068857_100192075 3300005577 Bacteria 1860
56 Ga0068857_100357271 3300005577 Bacteria 1354
57 Ga0068854_100066395 3300005578 Bacteria 2626
58 Ga0068856_100040360 3300005614 Bacteria 4584
59 Ga0068852_100022654 3300005616 Bacteria 5042
60 Ga0068852_100048996 3300005616 Bacteria 3612
61 Ga0068852_100104079 3300005616 Bacteria 2568
62 Ga0068852_100355931 3300005616 Bacteria 1431
63 Ga0068859_100162321 3300005617 Bacteria 2314
64 Ga0068859_100182179 3300005617 Bacteria 2183
65 Ga0068864_100055046 3300005618 Bacteria 3434
66 Ga0068861_100176935 3300005719 Bacteria 1772
67 Ga0068851_10001130 3300005834 Bacteria 11574
68 Ga0068851_10129240 3300005834 Bacteria 1365
69 Ga0068851_10133862 3300005834 Bacteria 1342
70 Ga0068858_100115869 3300005842 Bacteria 2504
71 Ga0068860_100001721 3300005843 Bacteria 23342
72 Ga0068862_100172427 3300005844 Bacteria 1937
73 Ga0081455_10054586 3300005937 Bacteria 3404
74 Ga0081455_10058556 3300005937 Bacteria 3259
75 Ga0081538_10083948 3300005981 Bacteria 1681
76 Ga0081540_1001535 3300005983 Bacteria 19829
77 Ga0081540_1004268 3300005983 Bacteria 10964
78 Ga0081540_1005331 3300005983 Bacteria 9623
79 Ga0081540_1007746 3300005983 Bacteria 7605
80 Ga0081540_1010624 3300005983 Bacteria 6215
81 Ga0081540_1014693 3300005983 Bacteria 5001
82 Ga0081540_1017259 3300005983 Bacteria 4476
83 Ga0081540_1028412 3300005983 Bacteria 3142
84 Ga0081540_1032770 3300005983 Bacteria 2831
85 Ga0081540_1054173 3300005983 Bacteria 1962
86 Ga0081539_10000879 3300005985 Bacteria 57604
87 Ga0081539_10026237 3300005985 Bacteria 3724
88 Ga0075363_100011489 3300006048 Bacteria 4242
89 Ga0075363_100041314 3300006048 Bacteria 2432
90 Ga0075364_10026100 3300006051 Bacteria 3724
91 Ga0075364_10114175 3300006051 Bacteria 1804
92 Ga0070712_100029439 3300006175 Bacteria 3680
93 Ga0075366_10014528 3300006195 Bacteria 4497
94 Ga0097621_100301261 3300006237 Bacteria 1416
95 Ga0075370_10029278 3300006353 Bacteria 3067
96 Ga0075428_100211505 3300006844 Bacteria 2096
97 Ga0075434_100015658 3300006871 Bacteria 7278
98 Ga0068865_100090243 3300006881 Bacteria 2221
99 Ga0097620_100162325 3300006931 Bacteria 2314
100 Ga0097620_100182157 3300006931 Bacteria 2183
101 Ga0099825_1036210 3300006941 Bacteria 1713
102 Ga0099824_1006343 3300006942 Bacteria 16282
103 Ga0099824_1012896 3300006942 Bacteria 8903
104 Ga0099822_1024801 3300006943 Bacteria 5314
105 Ga0099822_1043035 3300006943 Bacteria 2318
106 Ga0105240_10128815 3300009093 Bacteria 3038
107 Ga0105240_10246338 3300009093 Bacteria 2069
108 Ga0105240_10348452 3300009093 Bacteria 1681
109 Ga0111539_10119914 3300009094 Bacteria 3082
110 Ga0105245_10027097 3300009098 Bacteria 5049
111 Ga0105245_10157004 3300009098 Bacteria 2155
112 Ga0105247_10056060 3300009101 Bacteria 2433
113 Ga0105241_10006358 3300009174 Bacteria 8708
114 Ga0105241_10050885 3300009174 Bacteria 3158
115 Ga0105248_10046836 3300009177 Bacteria 4848
116 Ga0105248_10448268 3300009177 Bacteria 1454
117 Ga0105237_10037317 3300009545 Bacteria 4913
118 Ga0105237_10040511 3300009545 Bacteria 4697
119 Ga0105237_10070896 3300009545 Bacteria 3480
120 Ga0105237_10073153 3300009545 Bacteria 3420
121 Ga0105237_10138669 3300009545 Bacteria 2427
122 Ga0105238_10291869 3300009551 Bacteria 1613
123 Ga0105239_10131238 3300010375 Bacteria 2787
124 Ga0105239_10131733 3300010375 Bacteria 2782
125 Ga0105246_10023203 3300011119 Bacteria 4012
126 Ga0157370_10125102 3300013104 Bacteria 2400
127 Ga0157370_10203604 3300013104 Bacteria 1836
128 Ga0157369_10012061 3300013105 Bacteria 9815
129 Ga0157369_10037979 3300013105 Bacteria 5268
130 Ga0157369_10345636 3300013105 Bacteria 1545
131 Ga0163162_10051075 3300013306 Bacteria 4147
132 Ga0157375_10049447 3300013308 Bacteria 4120
133 Ga0157375_10545022 3300013308 Bacteria 1322
134 Ga0163163_10062000 3300014325 Bacteria 3705
135 Ga0163163_10110182 3300014325 Bacteria 2781
136 Ga0163163_10206656 3300014325 Bacteria 2012
137 Ga0163163_10456233 3300014325 Bacteria 1338
138 Ga0157379_10094448 3300014968 Bacteria 2683
139 Ga0157379_10208802 3300014968 Bacteria 1767
140 Ga0157376_10239466 3300014969 Bacteria 1690
141 Ga0163161_10091232 3300017792 Bacteria 2254
142 Ga0214544_1000344 3300021320 Bacteria 81005
143 Ga0214544_1021169 3300021320 Bacteria 4337
144 Ga0214542_1000018 3300021321 Bacteria 202226
145 Ga0214542_1020533 3300021321 Bacteria 4817
146 Ga0214545_1000009 3300021324 Bacteria 202915
147 Ga0214545_1017688 3300021324 Bacteria 6794
148 Ga0214543_1000037 3300021327 Bacteria 182113
149 Ga0214543_1031463 3300021327 Bacteria 2111
150 Ga0213873_10006576 3300021358 Bacteria 2294
151 Ga0213874_10020579 3300021377 Bacteria 1810
152 Ga0213876_10027975 3300021384 Bacteria 2973
153 Ga0213876_10047628 3300021384 Bacteria 2266
154 Ga0224712_10014285 3300022467 Bacteria 2552
155 Ga0209563_100900 3300025230 Bacteria 8805
156 Ga0209677_100589 3300025253 Bacteria 19782
157 Ga0209677_100686 3300025253 Bacteria 17323
158 Ga0209148_1000192 3300025254 Bacteria 115724
159 Ga0209148_1015780 3300025254 Bacteria 1312
160 Ga0209233_1007220 3300025261 Bacteria 3534
161 Ga0209455_1000892 3300025272 Bacteria 15629
162 Ga0209455_1008942 3300025272 Bacteria 2671
163 Ga0209455_1010792 3300025272 Bacteria 2297
164 Ga0209025_1000034 3300025294 Bacteria 413205
165 Ga0209564_1002767 3300025295 Bacteria 13171
166 Ga0209758_1000030 3300025297 Bacteria 509217
167 Ga0209758_1000963 3300025297 Bacteria 38837
168 Ga0209758_1001374 3300025297 Bacteria 29041
169 Ga0209758_1002540 3300025297 Bacteria 18393
170 Ga0209758_1002971 3300025297 Bacteria 16255
171 Ga0209758_1006840 3300025297 Bacteria 7988
172 Ga0209758_1021842 3300025297 Bacteria 2964
173 Ga0209758_1026572 3300025297 Bacteria 2500
174 Ga0209256_1007102 3300025299 Bacteria 5650
175 Ga0207426_1001611 3300025302 Bacteria 17898
176 Ga0207426_1002230 3300025302 Bacteria 12929
177 Ga0209257_1000778 3300025304 Bacteria 47189
178 Ga0207656_10032185 3300025321 Bacteria 2177
179 Ga0207656_10106012 3300025321 Bacteria 1294
180 Ga0207692_10064080 3300025898 Bacteria 1912
181 Ga0207688_10076931 3300025901 Bacteria 1901
182 Ga0207647_10002062 3300025904 Bacteria 15355
183 Ga0207647_10039838 3300025904 Bacteria 2962
184 Ga0207685_10017833 3300025905 Bacteria 2306
185 Ga0207699_10024107 3300025906 Bacteria 3322
186 Ga0207705_10028807 3300025909 Bacteria 3958
187 Ga0207684_10067768 3300025910 Bacteria 3033
188 Ga0207654_10000152 3300025911 Bacteria 43823
189 Ga0207654_10018076 3300025911 Bacteria 3696
190 Ga0207654_10047597 3300025911 Bacteria 2451
191 Ga0207707_10001578 3300025912 Bacteria 20995
192 Ga0207707_10119841 3300025912 Bacteria 2300
193 Ga0207695_10000059 3300025913 Bacteria 363920
194 Ga0207695_10009228 3300025913 Bacteria 12223
195 Ga0207695_10032161 3300025913 Bacteria 5744
196 Ga0207671_10031638 3300025914 Bacteria 3943
197 Ga0207671_10043870 3300025914 Bacteria 3306
198 Ga0207671_10100387 3300025914 Bacteria 2191
199 Ga0207671_10240098 3300025914 Bacteria 1423
200 Ga0207693_10035603 3300025915 Bacteria 3924
201 Ga0207693_10071069 3300025915 Bacteria 2723
202 Ga0207663_10022968 3300025916 Bacteria 3572
203 Ga0207660_10025124 3300025917 Bacteria 4042
204 Ga0207657_10003352 3300025919 Bacteria 17135
205 Ga0207652_10185062 3300025921 Bacteria 1873
206 Ga0207694_10000106 3300025924 Bacteria 88467
207 Ga0207687_10015988 3300025927 Bacteria 4923
208 Ga0207687_10127767 3300025927 Bacteria 1911
209 Ga0207687_10232942 3300025927 Bacteria 1456
210 Ga0207700_10037283 3300025928 Bacteria 3519
211 Ga0207700_10044600 3300025928 Bacteria 3265
212 Ga0207664_10278062 3300025929 Bacteria 1468
213 Ga0207690_10117365 3300025932 Bacteria 1926
214 Ga0207706_10033116 3300025933 Bacteria 4600
215 Ga0207706_10147618 3300025933 Bacteria 2069
216 Ga0207706_10208319 3300025933 Bacteria 1714
217 Ga0207709_10182366 3300025935 Bacteria 1484
218 Ga0207665_10181823 3300025939 Bacteria 1523
219 Ga0207711_10093621 3300025941 Bacteria 2647
220 Ga0207711_10352338 3300025941 Bacteria 1363
221 Ga0207689_10138006 3300025942 Bacteria 2008
222 Ga0207661_10001342 3300025944 Bacteria 16514
223 Ga0207661_10061223 3300025944 Bacteria 3040
224 Ga0207679_10164670 3300025945 Bacteria 1819
225 Ga0207640_10052250 3300025981 Bacteria 2661
226 Ga0207640_10101287 3300025981 Bacteria 2020
227 Ga0207658_10045657 3300025986 Bacteria 3195
228 Ga0207677_10022538 3300026023 Bacteria 3873
229 Ga0207703_10182084 3300026035 Bacteria 1855
230 Ga0207703_10275308 3300026035 Bacteria 1526
231 Ga0207639_10132669 3300026041 Bacteria 2064
232 Ga0207678_10056281 3300026067 Bacteria 3386
233 Ga0207702_10000004 3300026078 Bacteria 422182
234 Ga0207702_10000589 3300026078 Bacteria 40161
235 Ga0207702_10021167 3300026078 Bacteria 5382
236 Ga0207641_10065105 3300026088 Bacteria 3117
237 Ga0207674_10063655 3300026116 Bacteria 3723
238 Ga0207674_10144467 3300026116 Bacteria 2338
239 Ga0207674_10147136 3300026116 Bacteria 2314
240 Ga0207675_100083006 3300026118 Bacteria 3005
241 Ga0207675_100201581 3300026118 Bacteria 1911
242 Ga0207683_10069852 3300026121 Bacteria 3102
243 Ga0207698_10075416 3300026142 Bacteria 2695
244 Ga0207698_10163306 3300026142 Bacteria 1951
245 Ga0209389_1000064 3300027296 Bacteria 102177
246 Ga0209389_1000104 3300027296 Bacteria 75132
247 Ga0209589_1000017 3300027357 Bacteria 215546
248 Ga0209589_1000159 3300027357 Bacteria 75132
249 Ga0209489_100018 3300027361 Bacteria 215546
250 Ga0209489_100194 3300027361 Bacteria 97679
251 Ga0209489_104884 3300027361 Bacteria 24104
252 Ga0209700_100014 3300027363 Bacteria 299349
253 Ga0209700_100028 3300027363 Bacteria 215546
254 Ga0268266_10003301 3300028379 Bacteria 16212
255 Ga0268266_10004550 3300028379 Bacteria 13252
256 Ga0268266_10009757 3300028379 Bacteria 8445
257 Ga0268266_10047642 3300028379 Bacteria 3673
258 Ga0268266_10123600 3300028379 Bacteria 2306
259 Ga0268266_10189197 3300028379 Bacteria 1878
260 Ga0268266_10305926 3300028379 Bacteria 1484
261 Ga0268265_10197456 3300028380 Bacteria 1742
262 Ga0268264_10000107 3300028381 Bacteria 209105
263 Ga0268264_10146383 3300028381 Bacteria 2113
264 Ga0265319_1001409 3300028563 Bacteria 14410
265 Ga0265334_10001624 3300028573 Bacteria 10806
266 Ga0265334_10025996 3300028573 Bacteria 2366
267 Ga0265323_10000684 3300028653 Bacteria 18453
268 Ga0265336_10000459 3300028666 Bacteria 24631
269 Ga0307517_10002574 3300028786 Bacteria 28885
270 Ga0307515_10027983 3300028794 Bacteria 9602
271 Ga0265338_10002741 3300028800 Bacteria 25847
272 Ga0265324_10002054 3300029957 Bacteria 10690
273 Ga0265330_10003717 3300031235 Bacteria 7899
274 Ga0265332_10096871 3300031238 Bacteria 1246
275 Ga0265325_10004205 3300031241 Bacteria 9143
276 Ga0265340_10047370 3300031247 Bacteria 2094
277 Ga0265339_10000343 3300031249 Bacteria 37462
278 Ga0265339_10014756 3300031249 Bacteria 4703
279 Ga0265331_10009516 3300031250 Bacteria 5450
280 Ga0265331_10031235 3300031250 Bacteria 2647
281 Ga0307513_10129649 3300031456 Bacteria 2470
282 Ga0307509_10035847 3300031507 Bacteria 5439
283 Ga0307509_10042195 3300031507 Bacteria 4945
284 Ga0265313_10056176 3300031595 Bacteria 1862
285 Ga0307508_10000154 3300031616 Bacteria 82824
286 Ga0307508_10020956 3300031616 Bacteria 5941
287 Ga0265314_10007141 3300031711 Bacteria 9733
288 Ga0265314_10024387 3300031711 Bacteria 4587
289 Ga0307516_10006998 3300031730 Bacteria 13079
290 Ga0307516_10080619 3300031730 Bacteria 3099
291 Ga0307405_10065596 3300031731 Bacteria 2312
292 Ga0307412_10063995 3300031911 Bacteria 2484
293 Ga0307411_10059356 3300032005 Bacteria 2536
294 Ga0307415_100035272 3300032126 Bacteria 3266
295 Ga0307415_100262554 3300032126 Bacteria 1410
296 Ga0307510_10002191 3300033180 Bacteria 22082
297 Ga0307510_10014423 3300033180 Bacteria 9354
298 Ga0307510_10073938 3300033180 Bacteria 3372
299 Ga0307510_10093620 3300033180 Bacteria 2835
300 Ga0315911_1000048 3300033442 Bacteria 39245
301 Ga0373923_0016103 3300035111 Bacteria 2833
302 Ga0373932_0033681 3300035112 Bacteria 1440
303 Ga0373936_0003688 3300035113 Bacteria 5750
304 Ga0373941_0037501 3300035115 Bacteria 1479
305 Ga0373953_0007388 3300035117 Bacteria 3677
306 Ga0373954_0000308 3300035118 Bacteria 17778
307 Ga0373956_0004549 3300035119 Bacteria 5535
308 Ga0373957_0008118 3300035120 Bacteria 3389
309 Ga0373943_0006410 3300035170 Bacteria 5282
310 Ga0373946_0029352 3300035171 Bacteria 2188
311 Ga0373955_0000479 3300035172 Bacteria 16897
312 Ga0373955_0020868 3300035172 Bacteria 3298
313 Ga0373924_0003769 3300035410 Bacteria 5241
314 Ga0373931_0004987 3300035691 Bacteria 6106
315 Ga0373935_0000119 3300035692 Bacteria 35716
316 Ga0373935_0032120 3300035692 Bacteria 3261
317 Ga0373935_0181812 3300035692 Bacteria 1444
318 Ga0373927_0000965 3300035695 Bacteria 21865
319 Ga0373927_0003633 3300035695 Bacteria 11005
320 Ga0373927_0015399 3300035695 Bacteria 5054
321 Ga0373927_0030573 3300035695 Bacteria 3513
322 Ga0373933_0050571 3300035724 Bacteria 2481
323 Ga0373947_0001785 3300035725 Bacteria 13162
324 Ga0373947_0007763 3300035725 Bacteria 6199
325 Ga0373947_0105965 3300035725 Bacteria 1771
326 Ga0373937_0005638 3300036401 Bacteria 10748
327 Ga0373925_0053272 3300037068 Bacteria 3024
328 Ga0373925_0091624 3300037068 Bacteria 2324
329 Ga0373925_0175657 3300037068 Bacteria 1693
330 Ga0395899_0040702 3300037312 Bacteria 3475
331 Ga0395900_0015618 3300037418 Bacteria 7740
332 Ga0395900_0456718 3300037418 Bacteria 1233
333 Ga0395898_0002946 3300037466 Bacteria 19369
334 Ga0395898_0009257 3300037466 Bacteria 10358
335 Ga0395898_0082873 3300037466 Bacteria 3091
336 Ga0395898_0083383 3300037466 Bacteria 3081
337 Ga0395898_0138484 3300037466 Bacteria 2330
338 Ga0395905_0003015 3300037471 Bacteria 18245
339 Ga0395905_0211709 3300037471 Bacteria 1816
340 Ga0436364_1382509 3300037853 Bacteria 6764
341 Ga0436364_1512892 3300037853 Bacteria 3232
342 Ga0395901_0124917 3300038443 Bacteria 2704
343 Ga0395901_0151820 3300038443 Bacteria 2434
344 Ga0395901_0265344 3300038443 Bacteria 1786
345 Ga0436365_0697893 3300039437 Bacteria 2599
346 Ga0436365_1141460 3300039437 Bacteria 3527
347 Ga0436365_1777612 3300039437 Bacteria 1907
348 Ga0436360_1291699 3300039438 Bacteria 1512
349 Ga0436361_0471583 3300039447 Bacteria 1936
350 Ga0436361_0907816 3300039447 Bacteria 1991
351 Ga0436363_0668067 3300039450 Bacteria 2345
352 Ga0436363_1460349 3300039450 Bacteria 10788
353 Ga0436362_0510213 3300039453 Bacteria 2827
354 Ga0466972_0000286 3300044658 Bacteria 31359
355 Ga0466966_0005407 3300044684 Bacteria 8394
356 Ga0466961_0000446 3300044693 Bacteria 26385
357 Ga0466963_0005316 3300044694 Bacteria 7528
358 Ga0453684_0094548 3300044712 Bacteria 3676
359 Ga0466968_0106923 3300044735 Bacteria 1255
360 Ga0466957_0149870 3300044842 Bacteria 1508
361 Ga0451576_0057030 3300045051 Bacteria 4083
362 Ga0466967_0018622 3300045976 Bacteria 5556
363 Ga0466967_0053723 3300045976 Bacteria 3542
364 Ga0466967_0090278 3300045976 Bacteria 2783
365 Ga0495592_0001710 3300046454 Bacteria 15422
366 Ga0495592_0002892 3300046454 Bacteria 12210
367 Ga0495603_0001895 3300046455 Bacteria 12342
368 Ga0495629_0000348 3300046459 Bacteria 39364
369 Ga0495629_0000353 3300046459 Bacteria 39092
370 Ga0495638_0008632 3300046460 Bacteria 7207
371 Ga0495641_0000972 3300046461 Bacteria 24598
372 Ga0495651_0005720 3300046462 Bacteria 9474
373 Ga0495651_0023259 3300046462 Bacteria 4820
374 Ga0495653_0009258 3300046463 Bacteria 8057
375 Ga0495653_0074094 3300046463 Bacteria 2538
376 Ga0495653_0117196 3300046463 Bacteria 1903
377 Ga0495580_0004944 3300046472 Bacteria 11142
378 Ga0495580_0120636 3300046472 Bacteria 1820
379 Ga0495582_0000444 3300046473 Bacteria 22534
380 Ga0495582_0079158 3300046473 Bacteria 1824
381 Ga0495639_0000177 3300046475 Bacteria 33573
382 Ga0495639_0014881 3300046475 Bacteria 3371
383 Ga0495662_0011228 3300046476 Bacteria 4378
384 Ga0495664_0007231 3300046477 Bacteria 6158
385 Ga0495664_0025870 3300046477 Bacteria 3417
386 Ga0495664_0062816 3300046477 Bacteria 2212
387 Ga0495664_0083223 3300046477 Bacteria 1920
388 Ga0495585_0060854 3300046492 Bacteria 2077
389 Ga0495594_0000079 3300046499 Bacteria 42880
390 Ga0495583_0055014 3300046506 Bacteria 1800
391 Ga0495606_0000901 3300046507 Bacteria 44189
392 Ga0495608_0000368 3300046511 Bacteria 31510
393 Ga0495608_0014344 3300046511 Bacteria 5499
394 Ga0495610_0000019 3300046512 Bacteria 351524
395 Ga0495620_0075482 3300046515 Bacteria 1371
396 Ga0495628_0003575 3300046516 Bacteria 13912
397 Ga0495628_0053632 3300046516 Bacteria 3181
398 Ga0495628_0055589 3300046516 Bacteria 3117
399 Ga0495628_0072261 3300046516 Bacteria 2688
400 Ga0495630_0011873 3300046517 Bacteria 6315
401 Ga0495630_0140714 3300046517 Bacteria 1835
402 Ga0495648_0050416 3300046524 Bacteria 2543
403 Ga0495666_0018810 3300046526 Bacteria 3432
404 Ga0495652_0003538 3300046529 Bacteria 15351
405 Ga0495665_0000570 3300046531 Bacteria 18750
406 Ga0495640_0008034 3300046533 Bacteria 8288
407 Ga0495640_0021203 3300046533 Bacteria 4772
408 Ga0495640_0029702 3300046533 Bacteria 3921
409 Ga0495587_0010725 3300046536 Bacteria 5818
410 Ga0495587_0053316 3300046536 Bacteria 2384
411 Ga0495598_0001754 3300046537 Bacteria 4354
412 Ga0495598_0013621 3300046537 Bacteria 2020
413 Ga0495645_0004492 3300046543 Bacteria 9524
414 Ga0495645_0023317 3300046543 Bacteria 4481
415 Ga0495645_0142379 3300046543 Bacteria 1672
416 Ga0495622_0000888 3300046557 Bacteria 16299
417 Ga0495622_0013293 3300046557 Bacteria 3819
418 Ga0495667_0006624 3300046559 Bacteria 7864
419 Ga0495667_0007023 3300046559 Bacteria 7640
420 Ga0495656_0001212 3300046615 Bacteria 8399
421 Ga0495634_0000334 3300046642 Bacteria 45432
422 Ga0495634_0004641 3300046642 Bacteria 10705
423 Ga0495625_0045332 3300046660 Bacteria 3179
424 Ga0495625_0195401 3300046660 Bacteria 1338
425 Ga0495635_0000372 3300046663 Bacteria 28497
426 Ga0495635_0035680 3300046663 Bacteria 3447
427 Ga0495635_0062948 3300046663 Bacteria 2547
428 Ga0495635_0132037 3300046663 Bacteria 1702
429 Ga0495635_0248920 3300046663 Bacteria 1198
430 Ga0495659_0007020 3300046664 Bacteria 3566
431 Ga0495588_0017434 3300046674 Bacteria 3488
432 Ga0495657_0006148 3300046675 Bacteria 9409
433 Ga0495657_0010390 3300046675 Bacteria 7007
434 Ga0495657_0044452 3300046675 Bacteria 3021
435 Ga0495599_0009058 3300046678 Bacteria 6065
436 Ga0495599_0014706 3300046678 Bacteria 4846
437 Ga0495623_0073399 3300046679 Bacteria 2126
438 Ga0495623_0079436 3300046679 Bacteria 2032
439 Ga0495646_0003761 3300046680 Bacteria 9487
440 Ga0495646_0017020 3300046680 Bacteria 4615
441 Ga0495647_0000894 3300046681 Bacteria 8932
442 Ga0495658_0000416 3300046683 Bacteria 23941
443 Ga0495613_0013379 3300046689 Bacteria 6095
444 Ga0495613_0043461 3300046689 Bacteria 3324
445 Ga0495624_0003210 3300046690 Bacteria 12180
446 Ga0495600_0001217 3300046809 Bacteria 14087
447 Ga0495600_0004048 3300046809 Bacteria 8715
448 Ga0495600_0039333 3300046809 Bacteria 3080
449 Ga0495581_0000426 3300047315 Bacteria 21399
450 Ga0495581_0174638 3300047315 Bacteria 1256
451 Ga0495604_0005876 3300047317 Bacteria 9727
452 Ga0495604_0010461 3300047317 Bacteria 7352
453 Ga0495604_0012415 3300047317 Bacteria 6772
454 Ga0495604_0138076 3300047317 Bacteria 1745
455 Ga0495636_0075605 3300047318 Bacteria 1444
456 Ga0495674_0000533 3300047319 Bacteria 35160
457 Ga0495674_0018626 3300047319 Bacteria 6462
458 Ga0495674_0018661 3300047319 Bacteria 6454
459 Ga0495674_0024836 3300047319 Bacteria 5501
460 Ga0495676_0056064 3300047321 Bacteria 3119
461 Ga0495680_0002856 3300047322 Bacteria 17361
462 Ga0495680_0007925 3300047322 Bacteria 9687
463 Ga0495680_0076618 3300047322 Bacteria 2535
464 Ga0495675_0003518 3300047444 Bacteria 9440
465 Ga0495675_0094781 3300047444 Bacteria 1871
466 Ga0495675_0153681 3300047444 Bacteria 1420
467 Ga0495673_0019403 3300047469 Bacteria 3407
468 Ga0495684_0001014 3300047471 Bacteria 22867
469 Ga0495686_0028879 3300047472 Bacteria 3610
470 Ga0495593_0004444 3300047673 Bacteria 8330
471 Ga0495602_0005816 3300048088 Bacteria 12942
472 Ga0495602_0010096 3300048088 Bacteria 9800
473 Ga0495602_0281441 3300048088 Bacteria 1225
474 Ga0495614_0038997 3300048089 Bacteria 2039
475 Ga0496100_0072280 3300048903 Bacteria 2305
476 Ga0496100_0106717 3300048903 Bacteria 1939
477 Ga0496100_0205035 3300048903 Bacteria 1439
478 Ga0496101_0003771 3300048904 Bacteria 9467
479 Ga0496101_0263915 3300048904 Bacteria 1343
480 Ga0496102_0005218 3300048905 Bacteria 11031
481 Ga0496102_0066931 3300048905 Bacteria 3294
482 Ga0496102_0167530 3300048905 Bacteria 2068
483 Ga0496102_0326701 3300048905 Bacteria 1445
484 Ga0496103_0001945 3300048906 Bacteria 13352
485 Ga0496103_0196965 3300048906 Bacteria 1295
486 Ga0496104_0001811 3300048907 Bacteria 18534
487 Ga0496104_0016231 3300048907 Bacteria 6762
488 Ga0496104_0022194 3300048907 Bacteria 5830
489 Ga0496104_0093971 3300048907 Bacteria 2868
490 Ga0496104_0098594 3300048907 Bacteria 2797
491 Ga0496104_0217238 3300048907 Bacteria 1824
492 Ga0496105_0005991 3300048908 Bacteria 9282
493 Ga0496105_0019070 3300048908 Bacteria 5528
494 Ga0496105_0029405 3300048908 Bacteria 4498
495 Ga0496105_0051296 3300048908 Bacteria 3408
496 Ga0496107_0003550 3300048910 Bacteria 10446
497 Ga0496107_0035584 3300048910 Bacteria 3570
498 Ga0496107_0246505 3300048910 Bacteria 1329
499 Ga0496108_0002680 3300048911 Bacteria 14261
500 Ga0496108_0010972 3300048911 Bacteria 7358
501 Ga0496108_0022679 3300048911 Bacteria 5163
502 Ga0496109_0002643 3300048912 Bacteria 15023
503 Ga0496109_0011126 3300048912 Bacteria 7717
504 Ga0496109_0073228 3300048912 Bacteria 3148
505 Ga0496109_0073804 3300048912 Bacteria 3135
506 Ga0496109_0093698 3300048912 Bacteria 2779
507 Ga0496109_0287308 3300048912 Bacteria 1550
508 Ga0496110_0007857 3300048913 Bacteria 8545
509 Ga0496110_0068203 3300048913 Bacteria 3148
510 Ga0496110_0126387 3300048913 Bacteria 2307
511 Ga0496110_0204272 3300048913 Bacteria 1795
512 Ga0496111_0047714 3300048914 Bacteria 3084
513 Ga0496111_0071439 3300048914 Bacteria 2526
514 Ga0496112_0056475 3300048915 Bacteria 3863
515 Ga0496112_0083898 3300048915 Bacteria 3151
516 Ga0496112_0134483 3300048915 Bacteria 2443
517 Ga0496112_0360592 3300048915 Bacteria 1395
518 Ga0496112_0382484 3300048915 Bacteria 1348
519 Ga0496113_0006395 3300048916 Bacteria 7460
520 Ga0496113_0035172 3300048916 Bacteria 3662
521 Ga0496113_0067749 3300048916 Bacteria 2707
522 Ga0496113_0137080 3300048916 Bacteria 1923
523 Ga0496114_0030213 3300048917 Bacteria 4457
524 Ga0496114_0075310 3300048917 Bacteria 2842
525 Ga0496114_0080809 3300048917 Bacteria 2745
526 Ga0496115_0002700 3300048918 Bacteria 12739
527 Ga0496115_0006372 3300048918 Bacteria 8646
528 Ga0496115_0029230 3300048918 Bacteria 4327
529 Ga0496115_0045620 3300048918 Bacteria 3500
530 Ga0496115_0057962 3300048918 Bacteria 3116
531 Ga0496115_0093853 3300048918 Bacteria 2454
532 Ga0496115_0255972 3300048918 Bacteria 1440
533 Ga0496117_0054649 3300048920 Bacteria 2796
534 Ga0496117_0112018 3300048920 Bacteria 1698
535 Ga0496118_0005790 3300048921 Bacteria 13871
536 Ga0496118_0013973 3300048921 Bacteria 7546
537 Ga0496118_0190073 3300048921 Bacteria 1229
538 Ga0496119_0033766 3300048922 Bacteria 3385
539 Ga0496119_0075898 3300048922 Bacteria 1951
540 Ga0496120_0041545 3300048923 Bacteria 2692
541 Ga0496120_0106933 3300048923 Bacteria 1468
542 Ga0496120_0144660 3300048923 Bacteria 1202
543 Ga0496121_0000194 3300048924 Bacteria 136324
544 Ga0496121_0001272 3300048924 Bacteria 43421
545 Ga0496121_0017298 3300048924 Bacteria 7374
546 Ga0496121_0020252 3300048924 Bacteria 6596
547 Ga0496121_0125503 3300048924 Bacteria 1930
548 Ga0496121_0157641 3300048924 Bacteria 1664
549 Ga0496121_0255556 3300048924 Bacteria 1213
550 Ga0496123_0080063 3300048926 Bacteria 1993
551 Ga0496124_0001012 3300048927 Bacteria 44554
552 Ga0496124_0115552 3300048927 Bacteria 2153
553 Ga0496124_0205458 3300048927 Bacteria 1494
554 Ga0496125_0000420 3300048928 Bacteria 78930
555 Ga0496125_0001161 3300048928 Bacteria 39899
556 Ga0496125_0034253 3300048928 Bacteria 4479
557 Ga0496125_0037965 3300048928 Bacteria 4179
558 Ga0496125_0137389 3300048928 Bacteria 1707
559 Ga0496125_0198570 3300048928 Bacteria 1316
560 Ga0496126_0003575 3300048929 Bacteria 19498
561 Ga0496126_0007151 3300048929 Bacteria 12291
562 Ga0496126_0027937 3300048929 Bacteria 5380
563 Ga0496126_0037272 3300048929 Bacteria 4539
564 Ga0496126_0047051 3300048929 Bacteria 3951
565 Ga0496126_0048014 3300048929 Bacteria 3905
566 Ga0496126_0099199 3300048929 Bacteria 2551
567 Ga0496126_0108539 3300048929 Bacteria 2420
568 Ga0496126_0131325 3300048929 Bacteria 2164
569 Ga0496126_0149804 3300048929 Bacteria 2000
570 Ga0496126_0371795 3300048929 Bacteria 1165
571 Ga0501032_0141930 3300049569 Bacteria 1582
572 Ga0501033_0128637 3300049570 Bacteria 1835
573 Ga0501033_0157019 3300049570 Bacteria 1639
574 Ga0501036_0092289 3300049572 Bacteria 2558
575 Ga0501043_0035870 3300049579 Bacteria 3902
576 Ga0501046_0045107 3300049580 Bacteria 3504
577 Ga0501047_0048177 3300049581 Bacteria 4115
578 Ga0501047_0181987 3300049581 Bacteria 1968
579 Ga0501067_0125022 3300049583 Bacteria 1431
580 Ga0501069_0097565 3300049585 Bacteria 1666
581 Ga0501070_0011799 3300049586 Bacteria 7381
582 Ga0501074_0043112 3300049590 Bacteria 3265
583 Ga0501044_0043051 3300049823 Bacteria 4692
584 Ga0501044_0087964 3300049823 Bacteria 3137
585 Ga0501044_0091454 3300049823 Bacteria 3069
586 nmdc:mga03n38_4951_c1 3300050490 Bacteria 4476
587 nmdc:mga03n38_5383_c1 3300050490 Bacteria 4352
588 nmdc:mga07m45_11152_c1 3300050496 Bacteria 4716
589 nmdc:mga07m45_24236_c1 3300050496 Bacteria 3322
590 nmdc:mga07m45_4399_c1 3300050496 Bacteria 6896
591 nmdc:mga0n895_4662_c1 3300050512 Bacteria 11308
592 Ga0495601_0019123 3300053077 Bacteria 4175
593 Ga0495601_0139632 3300053077 Bacteria 1580
594 Ga0500635_0006999 3300053080 Bacteria 3039
595 Ga0500635_0048824 3300053080 Bacteria 1442
596 Ga0495595_0002712 3300053084 Bacteria 6944
597 Ga0495619_0005683 3300053085 Bacteria 7908
598 Ga0500578_0089271 3300053086 Bacteria 1957
599 Ga0500643_000270 3300053087 Bacteria 45829
600 Ga0500566_0000022 3300053094 Bacteria 81784
601 Ga0500566_0005084 3300053094 Bacteria 7841
602 Ga0500640_011905 3300053095 Bacteria 3558
603 Ga0500641_0002387 3300053096 Bacteria 6661
604 Ga0500641_0002665 3300053096 Bacteria 6302
605 Ga0500650_0059284 3300053098 Bacteria 1786
606 Ga0500554_002353 3300053102 Bacteria 3708
607 Ga0500555_002818 3300053103 Bacteria 4985
608 Ga0500556_0000306 3300053104 Bacteria 37363
609 Ga0500557_000026 3300053105 Bacteria 81867
610 Ga0500569_046832 3300053109 Bacteria 1290
611 Ga0500572_001109 3300053111 Bacteria 7863
612 Ga0500572_021422 3300053111 Bacteria 1711
613 Ga0500595_000095 3300053119 Bacteria 61248
614 Ga0500595_005768 3300053119 Bacteria 5352
615 Ga0500595_006420 3300053119 Bacteria 4990
616 Ga0500608_008047 3300053122 Bacteria 4405
617 Ga0500614_002834 3300053123 Bacteria 3809
618 Ga0500642_0000091 3300053130 Bacteria 45704
619 Ga0500559_0000219 3300053136 Bacteria 45843
620 Ga0500559_0002476 3300053136 Bacteria 9527
621 Ga0500568_0011063 3300053139 Bacteria 4203
622 Ga0500568_0045000 3300053139 Bacteria 1758
623 Ga0500573_0095248 3300053140 Bacteria 1678
624 Ga0500590_016900 3300053148 Bacteria 3772
625 Ga0500603_000192 3300053150 Bacteria 15937
626 Ga0500603_000199 3300053150 Bacteria 15731
627 Ga0500604_0039195 3300053151 Bacteria 1424
628 Ga0500616_0000038 3300053153 Bacteria 386801
629 Ga0500616_0021691 3300053153 Bacteria 3597
630 Ga0500620_030897 3300053155 Bacteria 1694
631 Ga0500622_0006911 3300053156 Bacteria 6508
632 Ga0500627_0050982 3300053158 Bacteria 1804
633 Ga0500638_030072 3300053162 Bacteria 2613
634 Ga0500639_029184 3300053163 Bacteria 2915
635 Ga0500636_0009769 3300053177 Bacteria 5588
636 Ga0500636_0015595 3300053177 Bacteria 4479
637 Ga0500636_0018270 3300053177 Bacteria 4146
638 Ga0500637_0016091 3300053178 Bacteria 3981
639 Ga0500576_084736 3300053725 Bacteria 1330
640 Ga0500625_003257 3300053729 Bacteria 6367
641 Ga0500645_013287 3300053730 Bacteria 2646
642 Ga0500645_023810 3300053730 Bacteria 1875
643 Ga0500601_006231 3300053737 Bacteria 1313

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1005331 Ga0081540_10053317 284
2 3300048906 Ga0496103_0196965 Ga0496103_0196965_187_1263 335
3 iso_pu_bacteria 8019687851 8019695935 342
4 3300031911 Ga0307412_10063995 Ga0307412_100639953 344
5 3300025933 Ga0207706_10033116 Ga0207706_100331164 347
6 3300047321 Ga0495676_0056064 Ga0495676_0056064_1035_2159 351
7 3300048907 Ga0496104_0001811 Ga0496104_0001811_15882_17006 351
8 3300048907 Ga0496104_0217238 Ga0496104_0217238_531_1655 351
9 3300048913 Ga0496110_0204272 Ga0496110_0204272_611_1735 351
10 3300048916 Ga0496113_0067749 Ga0496113_0067749_1099_2223 351
11 3300048918 Ga0496115_0029230 Ga0496115_0029230_1486_2610 351
12 3300006048 Ga0075363_100011489 Ga0075363_1000114893 352
13 3300050490 nmdc:mga03n38_4951_c1 nmdc:mga03n38_4951_c1_2315_3439 352
14 3300006942 Ga0099824_1006343 Ga0099824_100634312 353
15 3300006943 Ga0099822_1043035 Ga0099822_10430351 353
16 3300027296 Ga0209389_1000104 Ga0209389_100010421 353
17 3300027357 Ga0209589_1000159 Ga0209589_100015945 353
18 3300027361 Ga0209489_100194 Ga0209489_10019445 353
19 iso_pu_bacteria 8016530956 8016539499 353
20 iso_pu_bacteria 8019547302 8019549808 353
21 3300037418 Ga0395900_0456718 Ga0395900_0456718_116_1180 354
22 3300037466 Ga0395898_0009257 Ga0395898_0009257_5254_6318 354
23 3300048918 Ga0496115_0093853 Ga0496115_0093853_47_1111 354
24 3300048924 Ga0496121_0000194 Ga0496121_0000194_110673_111737 354
25 3300048929 Ga0496126_0027937 Ga0496126_0027937_2707_3771 354
26 3300025919 Ga0207657_10003352 Ga0207657_1000335213 355
27 3300005548 Ga0070665_100269092 Ga0070665_1002690922 356
28 3300013104 Ga0157370_10203604 Ga0157370_102036042 356
29 3300048905 Ga0496102_0066931 Ga0496102_0066931_1998_3236 356
30 3300005548 Ga0070665_100112120 Ga0070665_1001121204 357
31 3300014325 Ga0163163_10206656 Ga0163163_102066562 357
32 3300037853 Ga0436364_1382509 Ga0436364_1382509_2303_3445 357
33 3300044712 Ga0453684_0094548 Ga0453684_0094548_1510_2649 357
34 3300045051 Ga0451576_0057030 Ga0451576_0057030_2684_3823 357
35 3300046512 Ga0495610_0000019 Ga0495610_0000019_176677_177771 359
36 3300046515 Ga0495620_0075482 Ga0495620_0075482_91_1185 359
37 3300048918 Ga0496115_0045620 Ga0496115_0045620_927_2012 360
38 iso_pu_bacteria 2643221651 2644290527 360
39 iso_pu_bacteria 2874620515 2874623033 360
40 iso_pu_bacteria 2904666416 2904666655 360
41 3300009545 Ga0105237_10070896 Ga0105237_100708962 361
42 3300044842 Ga0466957_0149870 Ga0466957_0149870_88_1188 361
43 3300049569 Ga0501032_0141930 Ga0501032_0141930_370_1494 361
44 3300049570 Ga0501033_0157019 Ga0501033_0157019_439_1563 361
45 3300049572 Ga0501036_0092289 Ga0501036_0092289_630_1754 361
46 3300049581 Ga0501047_0048177 Ga0501047_0048177_1786_2910 361
47 3300049823 Ga0501044_0087964 Ga0501044_0087964_428_1552 361
48 3300053104 Ga0500556_0000306 Ga0500556_0000306_26278_27384 361
49 3300053153 Ga0500616_0000038 Ga0500616_0000038_273991_275115 361
50 3300039437 Ga0436365_0697893 Ga0436365_0697893_792_1892 362
51 3300039438 Ga0436360_1291699 Ga0436360_1291699_66_1166 362
52 3300049581 Ga0501047_0181987 Ga0501047_0181987_670_1779 362
53 iso_pu_bacteria 2849076700 2849083325 362
54 iso_pu_bacteria 2884298095 2884299630 363
55 3300031250 Ga0265331_10031235 Ga0265331_100312353 364
56 3300044658 Ga0466972_0000286 Ga0466972_0000286_16362_17468 364
57 3300048928 Ga0496125_0001161 Ga0496125_0001161_11012_12142 364
58 3300048929 Ga0496126_0048014 Ga0496126_0048014_1907_3037 364
59 iso_pu_bacteria 2511231028 2511397659 364
60 iso_pu_bacteria 2513237098 2513671766 364
61 iso_pu_bacteria 2513237139 2513879322 364
62 iso_pu_bacteria 2513237141 2513895150 364
63 iso_pu_bacteria 2513237161 2514016858 364
64 iso_pu_bacteria 2517093001 2517107938 364
65 iso_pu_bacteria 2524023205 2524442001 364
66 iso_pu_bacteria 2524023210 2524470147 364
67 iso_pu_bacteria 2617270735 2617353668 364
68 iso_pu_bacteria 2643221609 2644062003 364
69 iso_pu_bacteria 2721755755 2723841926 364
70 iso_pu_bacteria 2744054633 2745082381 364
71 iso_pu_bacteria 2791355196 2793065671 364
72 iso_pu_bacteria 2791355199 2793079144 364
73 iso_pu_bacteria 2802429603 2805921531 364
74 iso_pu_bacteria 2824661429 2824668577 364
75 iso_pu_bacteria 2824671348 2824675358 364
76 iso_pu_bacteria 2824679649 2824684681 364
77 iso_pu_bacteria 2824687955 2824691576 364
78 iso_pu_bacteria 2824696289 2824700509 364
79 iso_pu_bacteria 2824704595 2824707347 364
80 iso_pu_bacteria 2824753945 2824758729 364
81 iso_pu_bacteria 2824763712 2824769199 364
82 iso_pu_bacteria 2824773399 2824777438 364
83 iso_pu_bacteria 2838122688 2838130204 364
84 iso_pu_bacteria 2841941048 2841947881 364
85 iso_pu_bacteria 2841949485 2841956942 364
86 iso_pu_bacteria 2841966195 2841972707 364
87 iso_pu_bacteria 2841974524 2841977439 364
88 iso_pu_bacteria 2841974524 2841980682 364
89 iso_pu_bacteria 2841983080 2841990663 364
90 iso_pu_bacteria 2847939898 2847942461 364
91 iso_pu_bacteria 2874604998 2874610475 364
92 iso_pu_bacteria 2876761206 2876763728 364
93 iso_pu_bacteria 2879099564 2879106787 364
94 iso_pu_bacteria 2881364244 2881365454 364
95 iso_pu_bacteria 2885366525 2885368599 364
96 iso_pu_bacteria 2885383462 2885390205 364
97 iso_pu_bacteria 2888388044 2888390394 364
98 iso_pu_bacteria 2889033259 2889035154 364
99 iso_pu_bacteria 2903768456 2903775310 364
100 iso_pu_bacteria 2904711408 2904714076 364
101 iso_pu_bacteria 2922368715 2922369043 364
102 iso_pu_bacteria 2922386360 2922388763 364
103 iso_pu_bacteria 2922393267 2922394702 364
104 iso_pu_bacteria 2929615660 2929618912 364
105 iso_pu_bacteria 2929624759 2929630989 364
106 iso_pu_bacteria 2932784394 2932788958 364
107 iso_pu_bacteria 2932809354 2932814398 364
108 iso_pu_bacteria 2932818245 2932820524 364
109 iso_pu_bacteria 2932828146 2932834563 364
110 iso_pu_bacteria 2933577622 2933580378 364
111 iso_pu_bacteria 2935616580 2935624425 364
112 iso_pu_bacteria 2935638405 2935645935 364
113 iso_pu_bacteria 2935665750 2935674478 364
114 iso_pu_bacteria 2935675223 2935682679 364
115 iso_pu_bacteria 2935684952 2935686710 364
116 iso_pu_bacteria 2935694250 2935701614 364
117 iso_pu_bacteria 2935703347 2935710410 364
118 iso_pu_bacteria 2935713505 2935716398 364
119 iso_pu_bacteria 2935722832 2935723477 364
120 iso_pu_bacteria 2935732158 2935735033 364
121 iso_pu_bacteria 2935741537 2935744176 364
122 iso_pu_bacteria 2935750917 2935752676 364
123 iso_pu_bacteria 2935760218 2935764896 364
124 iso_pu_bacteria 2935801545 2935806064 364
125 iso_pu_bacteria 2935810662 2935816874 364
126 iso_pu_bacteria 2935827899 2935835164 364
127 iso_pu_bacteria 2935837841 2935841455 364
128 iso_pu_bacteria 2935855204 2935863144 364
129 iso_pu_bacteria 2935864058 2935873099 364
130 iso_pu_bacteria 2935873716 2935880148 364
131 iso_pu_bacteria 2935992306 2936000850 364
132 iso_pu_bacteria 2936002035 2936010353 364
133 iso_pu_bacteria 2936037263 2936043865 364
134 iso_pu_bacteria 2940556831 2940558589 364
135 iso_pu_bacteria 2941538514 2941543681 364
136 iso_pu_bacteria 3005483717 3005489258 364
137 iso_pu_bacteria 3005718088 3005718596 364
138 iso_pu_bacteria 8006984368 8006988421 364
139 iso_pu_bacteria 8016511872 8016517847 364
140 iso_pu_bacteria 8017057580 8017058786 364
141 iso_pu_bacteria 8019576017 8019576866 364
142 iso_pu_bacteria 8019586578 8019594923 364
143 iso_pu_bacteria 8019597564 8019606817 364
144 iso_pu_bacteria 8019608314 8019611690 364
145 iso_pu_bacteria 8019648815 8019652081 364
146 iso_pu_bacteria 8055742211 8055742761 364
147 iso_pu_bacteria 8056681323 8056689384 364
148 3300003203 JGI25406J46586_10000887 JGI25406J46586_100008874 365
149 3300003215 JGI25153J46596_10004047 JGI25153J46596_100040473 365
150 3300005347 Ga0070668_100035262 Ga0070668_1000352622 365
151 3300005347 Ga0070668_100039201 Ga0070668_1000392013 365
152 3300005437 Ga0070710_10105335 Ga0070710_101053351 365
153 3300005439 Ga0070711_100009658 Ga0070711_1000096583 365
154 3300005455 Ga0070663_100064496 Ga0070663_1000644962 365
155 3300005456 Ga0070678_100163761 Ga0070678_1001637611 365
156 3300005548 Ga0070665_100060033 Ga0070665_1000600332 365
157 3300005548 Ga0070665_100069146 Ga0070665_1000691463 365
158 3300005577 Ga0068857_100357271 Ga0068857_1003572711 365
159 3300005614 Ga0068856_100040360 Ga0068856_1000403603 365
160 3300005616 Ga0068852_100104079 Ga0068852_1001040792 365
161 3300005616 Ga0068852_100355931 Ga0068852_1003559311 365
162 3300005834 Ga0068851_10129240 Ga0068851_101292402 365
163 3300005844 Ga0068862_100172427 Ga0068862_1001724272 365
164 3300005937 Ga0081455_10054586 Ga0081455_100545862 365
165 3300005937 Ga0081455_10058556 Ga0081455_100585562 365
166 3300005983 Ga0081540_1001535 Ga0081540_100153518 365
167 3300005983 Ga0081540_1004268 Ga0081540_10042683 365
168 3300005983 Ga0081540_1007746 Ga0081540_10077463 365
169 3300005983 Ga0081540_1010624 Ga0081540_10106246 365
170 3300005983 Ga0081540_1017259 Ga0081540_10172593 365
171 3300005983 Ga0081540_1028412 Ga0081540_10284122 365
172 3300005985 Ga0081539_10000879 Ga0081539_1000087935 365
173 3300005985 Ga0081539_10026237 Ga0081539_100262373 365
174 3300006051 Ga0075364_10026100 Ga0075364_100261004 365
175 3300006051 Ga0075364_10114175 Ga0075364_101141752 365
176 3300006195 Ga0075366_10014528 Ga0075366_100145283 365
177 3300006353 Ga0075370_10029278 Ga0075370_100292782 365
178 3300006844 Ga0075428_100211505 Ga0075428_1002115052 365
179 3300006881 Ga0068865_100090243 Ga0068865_1000902431 365
180 3300009093 Ga0105240_10128815 Ga0105240_101288152 365
181 3300009093 Ga0105240_10348452 Ga0105240_103484521 365
182 3300009094 Ga0111539_10119914 Ga0111539_101199143 365
183 3300009098 Ga0105245_10157004 Ga0105245_101570042 365
184 3300009101 Ga0105247_10056060 Ga0105247_100560601 365
185 3300009174 Ga0105241_10050885 Ga0105241_100508853 365
186 3300009545 Ga0105237_10073153 Ga0105237_100731532 365
187 3300009545 Ga0105237_10138669 Ga0105237_101386693 365
188 3300010375 Ga0105239_10131238 Ga0105239_101312382 365
189 3300011119 Ga0105246_10023203 Ga0105246_100232033 365
190 3300013105 Ga0157369_10012061 Ga0157369_100120615 365
191 3300013308 Ga0157375_10545022 Ga0157375_105450221 365
192 3300014325 Ga0163163_10456233 Ga0163163_104562332 365
193 3300014969 Ga0157376_10239466 Ga0157376_102394661 365
194 3300021320 Ga0214544_1021169 Ga0214544_10211692 365
195 3300021321 Ga0214542_1020533 Ga0214542_10205333 365
196 3300021324 Ga0214545_1017688 Ga0214545_10176883 365
197 3300021327 Ga0214543_1031463 Ga0214543_10314632 365
198 3300021358 Ga0213873_10006576 Ga0213873_100065761 365
199 3300021377 Ga0213874_10020579 Ga0213874_100205791 365
200 3300021384 Ga0213876_10027975 Ga0213876_100279753 365
201 3300021384 Ga0213876_10047628 Ga0213876_100476282 365
202 3300022467 Ga0224712_10014285 Ga0224712_100142851 365
203 3300025230 Ga0209563_100900 Ga0209563_1009001 365
204 3300025253 Ga0209677_100686 Ga0209677_1006865 365
205 3300025297 Ga0209758_1000963 Ga0209758_10009633 365
206 3300025297 Ga0209758_1002540 Ga0209758_10025403 365
207 3300025297 Ga0209758_1021842 Ga0209758_10218422 365
208 3300025297 Ga0209758_1026572 Ga0209758_10265722 365
209 3300025911 Ga0207654_10047597 Ga0207654_100475973 365
210 3300025913 Ga0207695_10000059 Ga0207695_10000059328 365
211 3300025913 Ga0207695_10032161 Ga0207695_100321616 365
212 3300025914 Ga0207671_10031638 Ga0207671_100316382 365
213 3300025914 Ga0207671_10100387 Ga0207671_101003871 365
214 3300025914 Ga0207671_10240098 Ga0207671_102400981 365
215 3300025915 Ga0207693_10071069 Ga0207693_100710692 365
216 3300025916 Ga0207663_10022968 Ga0207663_100229682 365
217 3300025927 Ga0207687_10127767 Ga0207687_101277672 365
218 3300025927 Ga0207687_10232942 Ga0207687_102329422 365
219 3300025929 Ga0207664_10278062 Ga0207664_102780622 365
220 3300025933 Ga0207706_10147618 Ga0207706_101476182 365
221 3300025933 Ga0207706_10208319 Ga0207706_102083192 365
222 3300025935 Ga0207709_10182366 Ga0207709_101823662 365
223 3300025941 Ga0207711_10352338 Ga0207711_103523381 365
224 3300025981 Ga0207640_10101287 Ga0207640_101012872 365
225 3300025986 Ga0207658_10045657 Ga0207658_100456573 365
226 3300026067 Ga0207678_10056281 Ga0207678_100562813 365
227 3300026088 Ga0207641_10065105 Ga0207641_100651051 365
228 3300026116 Ga0207674_10144467 Ga0207674_101444672 365
229 3300026116 Ga0207674_10147136 Ga0207674_101471361 365
230 3300026118 Ga0207675_100083006 Ga0207675_1000830062 365
231 3300026142 Ga0207698_10075416 Ga0207698_100754163 365
232 3300026142 Ga0207698_10163306 Ga0207698_101633061 365
233 3300028379 Ga0268266_10003301 Ga0268266_1000330113 365
234 3300028379 Ga0268266_10009757 Ga0268266_100097573 365
235 3300028379 Ga0268266_10047642 Ga0268266_100476423 365
236 3300028379 Ga0268266_10189197 Ga0268266_101891972 365
237 3300028379 Ga0268266_10305926 Ga0268266_103059261 365
238 3300028380 Ga0268265_10197456 Ga0268265_101974561 365
239 3300028381 Ga0268264_10146383 Ga0268264_101463831 365
240 3300028573 Ga0265334_10025996 Ga0265334_100259962 365
241 3300031235 Ga0265330_10003717 Ga0265330_100037174 365
242 3300031238 Ga0265332_10096871 Ga0265332_100968712 365
243 3300031241 Ga0265325_10004205 Ga0265325_100042055 365
244 3300031595 Ga0265313_10056176 Ga0265313_100561762 365
245 3300032005 Ga0307411_10059356 Ga0307411_100593562 365
246 3300032126 Ga0307415_100035272 Ga0307415_1000352722 365
247 3300032126 Ga0307415_100262554 Ga0307415_1002625541 365
248 3300033180 Ga0307510_10002191 Ga0307510_1000219116 365
249 3300035111 Ga0373923_0016103 Ga0373923_0016103_498_1610 365
250 3300035117 Ga0373953_0007388 Ga0373953_0007388_942_2054 365
251 3300035118 Ga0373954_0000308 Ga0373954_0000308_7972_9084 365
252 3300035119 Ga0373956_0004549 Ga0373956_0004549_3469_4581 365
253 3300035120 Ga0373957_0008118 Ga0373957_0008118_1440_2552 365
254 3300035172 Ga0373955_0000479 Ga0373955_0000479_4008_5120 365
255 3300035410 Ga0373924_0003769 Ga0373924_0003769_1333_2445 365
256 3300035724 Ga0373933_0050571 Ga0373933_0050571_666_1778 365
257 3300036401 Ga0373937_0005638 Ga0373937_0005638_8568_9680 365
258 3300037418 Ga0395900_0015618 Ga0395900_0015618_74_1300 365
259 3300037466 Ga0395898_0002946 Ga0395898_0002946_17185_18411 365
260 3300037466 Ga0395898_0082873 Ga0395898_0082873_1215_2453 365
261 3300037471 Ga0395905_0003015 Ga0395905_0003015_3215_4333 365
262 3300038443 Ga0395901_0151820 Ga0395901_0151820_405_1631 365
263 3300039437 Ga0436365_1141460 Ga0436365_1141460_1677_2783 365
264 3300039450 Ga0436363_0668067 Ga0436363_0668067_796_1932 365
265 3300039453 Ga0436362_0510213 Ga0436362_0510213_942_2051 365
266 3300045976 Ga0466967_0090278 Ga0466967_0090278_1639_2739 365
267 3300046454 Ga0495592_0001710 Ga0495592_0001710_6041_7153 365
268 3300046454 Ga0495592_0002892 Ga0495592_0002892_8633_9763 365
269 3300046459 Ga0495629_0000348 Ga0495629_0000348_24627_25739 365
270 3300046462 Ga0495651_0005720 Ga0495651_0005720_4219_5331 365
271 3300046463 Ga0495653_0009258 Ga0495653_0009258_5338_6450 365
272 3300046477 Ga0495664_0025870 Ga0495664_0025870_34_1164 365
273 3300046506 Ga0495583_0055014 Ga0495583_0055014_576_1682 365
274 3300046511 Ga0495608_0000368 Ga0495608_0000368_22383_23495 365
275 3300046511 Ga0495608_0014344 Ga0495608_0014344_3117_4247 365
276 3300046516 Ga0495628_0003575 Ga0495628_0003575_6041_7171 365
277 3300046516 Ga0495628_0055589 Ga0495628_0055589_1695_2807 365
278 3300046517 Ga0495630_0140714 Ga0495630_0140714_167_1297 365
279 3300046524 Ga0495648_0050416 Ga0495648_0050416_261_1412 365
280 3300046529 Ga0495652_0003538 Ga0495652_0003538_10073_11185 365
281 3300046533 Ga0495640_0008034 Ga0495640_0008034_1928_3040 365
282 3300046533 Ga0495640_0029702 Ga0495640_0029702_1670_2776 365
283 3300046536 Ga0495587_0010725 Ga0495587_0010725_1029_2159 365
284 3300046536 Ga0495587_0053316 Ga0495587_0053316_311_1423 365
285 3300046543 Ga0495645_0023317 Ga0495645_0023317_1224_2336 365
286 3300046557 Ga0495622_0013293 Ga0495622_0013293_203_1321 365
287 3300046559 Ga0495667_0006624 Ga0495667_0006624_2999_4129 365
288 3300046559 Ga0495667_0007023 Ga0495667_0007023_5722_6834 365
289 3300046642 Ga0495634_0004641 Ga0495634_0004641_5905_7017 365
290 3300046660 Ga0495625_0195401 Ga0495625_0195401_66_1217 365
291 3300046663 Ga0495635_0000372 Ga0495635_0000372_19300_20412 365
292 3300046663 Ga0495635_0132037 Ga0495635_0132037_130_1260 365
293 3300046674 Ga0495588_0017434 Ga0495588_0017434_2000_3163 365
294 3300046675 Ga0495657_0006148 Ga0495657_0006148_6517_7629 365
295 3300046678 Ga0495599_0009058 Ga0495599_0009058_1771_2901 365
296 3300046678 Ga0495599_0014706 Ga0495599_0014706_3139_4251 365
297 3300046679 Ga0495623_0073399 Ga0495623_0073399_704_1816 365
298 3300046680 Ga0495646_0003761 Ga0495646_0003761_326_1438 365
299 3300046680 Ga0495646_0017020 Ga0495646_0017020_2077_3207 365
300 3300046689 Ga0495613_0013379 Ga0495613_0013379_4112_5224 365
301 3300046689 Ga0495613_0043461 Ga0495613_0043461_829_1959 365
302 3300046809 Ga0495600_0001217 Ga0495600_0001217_4890_6002 365
303 3300046809 Ga0495600_0004048 Ga0495600_0004048_5259_6389 365
304 3300047317 Ga0495604_0005876 Ga0495604_0005876_7568_8698 365
305 3300047317 Ga0495604_0012415 Ga0495604_0012415_4347_5459 365
306 3300047319 Ga0495674_0018626 Ga0495674_0018626_1362_2474 365
307 3300047319 Ga0495674_0024836 Ga0495674_0024836_2334_3464 365
308 3300047322 Ga0495680_0002856 Ga0495680_0002856_2440_3570 365
309 3300047322 Ga0495680_0007925 Ga0495680_0007925_972_2084 365
310 3300047444 Ga0495675_0003518 Ga0495675_0003518_918_2030 365
311 3300047444 Ga0495675_0153681 Ga0495675_0153681_253_1383 365
312 3300047471 Ga0495684_0001014 Ga0495684_0001014_13867_14979 365
313 3300047673 Ga0495593_0004444 Ga0495593_0004444_7194_8306 365
314 3300048088 Ga0495602_0005816 Ga0495602_0005816_8040_9152 365
315 3300048088 Ga0495602_0010096 Ga0495602_0010096_3412_4542 365
316 3300048903 Ga0496100_0205035 Ga0496100_0205035_271_1422 365
317 3300048906 Ga0496103_0001945 Ga0496103_0001945_12088_13194 365
318 3300048907 Ga0496104_0098594 Ga0496104_0098594_1093_2256 365
319 3300048908 Ga0496105_0029405 Ga0496105_0029405_1247_2410 365
320 3300048908 Ga0496105_0051296 Ga0496105_0051296_235_1386 365
321 3300048910 Ga0496107_0035584 Ga0496107_0035584_2309_3472 365
322 3300048911 Ga0496108_0010972 Ga0496108_0010972_3714_4865 365
323 3300048912 Ga0496109_0073228 Ga0496109_0073228_1056_2207 365
324 3300048912 Ga0496109_0287308 Ga0496109_0287308_282_1388 365
325 3300048913 Ga0496110_0068203 Ga0496110_0068203_755_1918 365
326 3300048915 Ga0496112_0134483 Ga0496112_0134483_1304_2410 365
327 3300048915 Ga0496112_0382484 Ga0496112_0382484_128_1291 365
328 3300048917 Ga0496114_0030213 Ga0496114_0030213_2524_3642 365
329 3300048921 Ga0496118_0013973 Ga0496118_0013973_932_2083 365
330 3300048922 Ga0496119_0033766 Ga0496119_0033766_501_1607 365
331 3300048923 Ga0496120_0041545 Ga0496120_0041545_716_1822 365
332 3300048923 Ga0496120_0106933 Ga0496120_0106933_230_1336 365
333 3300048924 Ga0496121_0017298 Ga0496121_0017298_14_1132 365
334 3300048928 Ga0496125_0000420 Ga0496125_0000420_52588_53706 365
335 3300048929 Ga0496126_0099199 Ga0496126_0099199_1183_2289 365
336 3300048929 Ga0496126_0149804 Ga0496126_0149804_191_1297 365
337 3300049583 Ga0501067_0125022 Ga0501067_0125022_25_1131 365
338 3300050496 nmdc:mga07m45_4399_c1 nmdc:mga07m45_4399_c1_2437_3543 365
339 3300053077 Ga0495601_0019123 Ga0495601_0019123_620_1732 365
340 3300053084 Ga0495595_0002712 Ga0495595_0002712_4467_5579 365
341 3300053085 Ga0495619_0005683 Ga0495619_0005683_6486_7598 365
342 3300053087 Ga0500643_000270 Ga0500643_000270_3853_4959 365
343 3300053094 Ga0500566_0005084 Ga0500566_0005084_143_1270 365
344 3300053096 Ga0500641_0002387 Ga0500641_0002387_5454_6629 365
345 3300053096 Ga0500641_0002665 Ga0500641_0002665_3247_4353 365
346 3300053098 Ga0500650_0059284 Ga0500650_0059284_56_1162 365
347 3300053103 Ga0500555_002818 Ga0500555_002818_1149_2255 365
348 3300053119 Ga0500595_006420 Ga0500595_006420_521_1627 365
349 3300053130 Ga0500642_0000091 Ga0500642_0000091_6279_7385 365
350 3300053139 Ga0500568_0011063 Ga0500568_0011063_1351_2457 365
351 3300053151 Ga0500604_0039195 Ga0500604_0039195_157_1263 365
352 3300053158 Ga0500627_0050982 Ga0500627_0050982_169_1275 365
353 3300053737 Ga0500601_006231 Ga0500601_006231_169_1275 365
354 iso_pu_bacteria 2508501009 2508539435 365
355 iso_pu_bacteria 2513237092 2513624795 365
356 iso_pu_bacteria 2513237094 2513642338 365
357 iso_pu_bacteria 2513237101 2513695011 365
358 iso_pu_bacteria 2824600985 2824603005 365
359 iso_pu_bacteria 2824609381 2824615477 365
360 iso_pu_bacteria 2824653114 2824660316 365
361 iso_pu_bacteria 2844315083 2844315768 365
362 iso_pu_bacteria 2857509624 2857516483 365
363 iso_pu_bacteria 2874612657 2874619070 365
364 iso_pu_bacteria 2881665667 2881671504 365
365 iso_pu_bacteria 2888419890 2888419960 365
366 iso_pu_bacteria 2903727486 2903730933 365
367 iso_pu_bacteria 2906602504 2906603755 365
368 iso_pu_bacteria 2935608549 2935614616 365
369 iso_pu_bacteria 2935648319 2935654778 365
370 iso_pu_bacteria 2935656913 2935663658 365
371 iso_pu_bacteria 2935819856 2935826352 365
372 iso_pu_bacteria 2935847175 2935853839 365
373 iso_pu_bacteria 2935908558 2935915386 365
374 iso_pu_bacteria 2935916978 2935925138 365
375 iso_pu_bacteria 2935926038 2935933281 365
376 iso_pu_bacteria 2935934488 2935941373 365
377 iso_pu_bacteria 2935942939 2935949568 365
378 iso_pu_bacteria 2935951376 2935958257 365
379 iso_pu_bacteria 2935959822 2935966504 365
380 iso_pu_bacteria 2935967501 2935974845 365
381 iso_pu_bacteria 2936011229 2936017814 365
382 iso_pu_bacteria 2936019824 2936026317 365
383 iso_pu_bacteria 2936028420 2936035064 365
384 iso_pu_bacteria 2936046547 2936053179 365
385 iso_pu_bacteria 2936055302 2936056970 365
386 iso_pu_bacteria 3005587118 3005592288 365
387 iso_pu_bacteria 3005594810 3005595355 365
388 iso_pu_bacteria 8006926726 8006932663 365
389 iso_pu_bacteria 8016630954 8016635310 365
390 iso_pu_bacteria 8056673599 8056678562 365
391 3300003187 JGI25151J46595_10002341 JGI25151J46595_100023419 366
392 3300003215 JGI25153J46596_10001684 JGI25153J46596_100016843 366
393 3300003215 JGI25153J46596_10003279 JGI25153J46596_100032799 366
394 3300003794 Ga0055531_10012840 Ga0055531_100128402 366
395 3300005262 Ga0065165_1005779 Ga0065165_10057793 366
396 3300005456 Ga0070678_100225553 Ga0070678_1002255532 366
397 3300005468 Ga0070707_100145721 Ga0070707_1001457212 366
398 3300005617 Ga0068859_100182179 Ga0068859_1001821792 366
399 3300005719 Ga0068861_100176935 Ga0068861_1001769351 366
400 3300005983 Ga0081540_1014693 Ga0081540_10146933 366
401 3300006931 Ga0097620_100182157 Ga0097620_1001821572 366
402 3300009551 Ga0105238_10291869 Ga0105238_102918691 366
403 3300025294 Ga0209025_1000034 Ga0209025_100003492 366
404 3300025295 Ga0209564_1002767 Ga0209564_100276713 366
405 3300025297 Ga0209758_1000030 Ga0209758_100003095 366
406 3300025297 Ga0209758_1001374 Ga0209758_100137419 366
407 3300025297 Ga0209758_1002971 Ga0209758_100297111 366
408 3300025299 Ga0209256_1007102 Ga0209256_10071023 366
409 3300025302 Ga0207426_1001611 Ga0207426_10016119 366
410 3300025304 Ga0209257_1000778 Ga0209257_10007783 366
411 3300025904 Ga0207647_10039838 Ga0207647_100398381 366
412 3300026118 Ga0207675_100201581 Ga0207675_1002015812 366
413 3300031616 Ga0307508_10000154 Ga0307508_1000015415 366
414 3300037068 Ga0373925_0053272 Ga0373925_0053272_1618_2739 366
415 3300037068 Ga0373925_0175657 Ga0373925_0175657_53_1162 366
416 3300037312 Ga0395899_0040702 Ga0395899_0040702_603_1736 366
417 3300037466 Ga0395898_0138484 Ga0395898_0138484_578_1711 366
418 3300038443 Ga0395901_0265344 Ga0395901_0265344_232_1365 366
419 3300039447 Ga0436361_0471583 Ga0436361_0471583_720_1829 366
420 3300044684 Ga0466966_0005407 Ga0466966_0005407_3834_4970 366
421 3300044693 Ga0466961_0000446 Ga0466961_0000446_10891_12027 366
422 3300044694 Ga0466963_0005316 Ga0466963_0005316_1065_2186 366
423 3300045976 Ga0466967_0018622 Ga0466967_0018622_3976_5097 366
424 3300046526 Ga0495666_0018810 Ga0495666_0018810_2013_3122 366
425 3300046537 Ga0495598_0013621 Ga0495598_0013621_634_1743 366
426 3300046664 Ga0495659_0007020 Ga0495659_0007020_1747_2856 366
427 3300048912 Ga0496109_0073804 Ga0496109_0073804_1907_3022 366
428 3300048913 Ga0496110_0126387 Ga0496110_0126387_1031_2146 366
429 3300048915 Ga0496112_0083898 Ga0496112_0083898_2006_3121 366
430 3300048916 Ga0496113_0035172 Ga0496113_0035172_208_1323 366
431 3300048927 Ga0496124_0115552 Ga0496124_0115552_75_1184 366
432 3300048928 Ga0496125_0137389 Ga0496125_0137389_253_1362 366
433 3300048929 Ga0496126_0371795 Ga0496126_0371795_34_1143 366
434 3300049570 Ga0501033_0128637 Ga0501033_0128637_673_1806 366
435 3300049579 Ga0501043_0035870 Ga0501043_0035870_722_1855 366
436 3300049585 Ga0501069_0097565 Ga0501069_0097565_239_1369 366
437 3300049823 Ga0501044_0043051 Ga0501044_0043051_344_1477 366
438 3300049823 Ga0501044_0091454 Ga0501044_0091454_872_2005 366
439 3300053148 Ga0500590_016900 Ga0500590_016900_140_1261 366
440 iso_pu_bacteria 2507262055 2507505557 366
441 iso_pu_bacteria 2508501042 2508695774 366
442 iso_pu_bacteria 2508501128 2509152535 366
443 iso_pu_bacteria 2513237095 2513652566 366
444 iso_pu_bacteria 2513237096 2513658094 366
445 iso_pu_bacteria 2513237102 2513704839 366
446 iso_pu_bacteria 2513237104 2513721869 366
447 iso_pu_bacteria 2513237145 2513922932 366
448 iso_pu_bacteria 2515154112 2515630147 366
449 iso_pu_bacteria 2517572143 2517889163 366
450 iso_pu_bacteria 2524023228 2524536585 366
451 iso_pu_bacteria 2617270741 2617377360 366
452 iso_pu_bacteria 2667528175 2671121555 366
453 iso_pu_bacteria 2728368998 2728753676 366
454 iso_pu_bacteria 2791355197 2793072591 366
455 iso_pu_bacteria 2816332527 2818239072 366
456 iso_pu_bacteria 2824617872 2824623927 366
457 iso_pu_bacteria 2824626560 2824632594 366
458 iso_pu_bacteria 2824635225 2824639452 366
459 iso_pu_bacteria 2824644064 2824649450 366
460 iso_pu_bacteria 2824714736 2824719332 366
461 iso_pu_bacteria 2824723954 2824727962 366
462 iso_pu_bacteria 2824732956 2824736172 366
463 iso_pu_bacteria 2824746037 2824750243 366
464 iso_pu_bacteria 2842038055 2842041289 366
465 iso_pu_bacteria 2842045827 2842049331 366
466 iso_pu_bacteria 2874590934 2874592632 366
467 iso_pu_bacteria 2874628541 2874636838 366
468 iso_pu_bacteria 2874645413 2874647456 366
469 iso_pu_bacteria 2876771140 2876772756 366
470 iso_pu_bacteria 2876808645 2876817426 366
471 iso_pu_bacteria 2876818435 2876820089 366
472 iso_pu_bacteria 2879074833 2879076594 366
473 iso_pu_bacteria 2879110137 2879115117 366
474 iso_pu_bacteria 2879127579 2879129227 366
475 iso_pu_bacteria 2879142872 2879144866 366
476 iso_pu_bacteria 2885374607 2885376103 366
477 iso_pu_bacteria 2888378607 2888379275 366
478 iso_pu_bacteria 2903748898 2903751179 366
479 iso_pu_bacteria 2904690495 2904690893 366
480 iso_pu_bacteria 2904699407 2904708978 366
481 iso_pu_bacteria 2906610324 2906613446 366
482 iso_pu_bacteria 2906635258 2906636160 366
483 iso_pu_bacteria 2906660503 2906668477 366
484 iso_pu_bacteria 2908739725 2908747771 366
485 iso_pu_bacteria 2908756301 2908756949 366
486 iso_pu_bacteria 2908775508 2908775880 366
487 iso_pu_bacteria 2922361189 2922363416 366
488 iso_pu_bacteria 2922425934 2922433883 366
489 iso_pu_bacteria 2932794094 2932799993 366
490 iso_pu_bacteria 2932801729 2932809004 366
491 iso_pu_bacteria 2935630451 2935634912 366
492 iso_pu_bacteria 2935769743 2935774184 366
493 iso_pu_bacteria 2935777560 2935782359 366
494 iso_pu_bacteria 2935785616 2935789100 366
495 iso_pu_bacteria 2935793552 2935796850 366
496 iso_pu_bacteria 2935883170 2935888205 366
497 iso_pu_bacteria 2935975950 2935983106 366
498 iso_pu_bacteria 2935984226 2935985268 366
499 iso_pu_bacteria 2941507105 2941514300 366
500 iso_pu_bacteria 2941515067 2941522261 366
501 iso_pu_bacteria 2941523033 2941530132 366
502 iso_pu_bacteria 2941531003 2941537990 366
503 iso_pu_bacteria 3005474847 3005475396 366
504 iso_pu_bacteria 3005506211 3005511501 366
505 iso_pu_bacteria 3005710791 3005711316 366
506 iso_pu_bacteria 8006933436 8006935888 366
507 iso_pu_bacteria 8006964411 8006969376 366
508 iso_pu_bacteria 8006973647 8006975995 366
509 iso_pu_bacteria 8006994254 8007000669 366
510 iso_pu_bacteria 8016522445 8016525896 366
511 iso_pu_bacteria 8016548790 8016549507 366
512 iso_pu_bacteria 8016557553 8016557929 366
513 iso_pu_bacteria 8016566248 8016569188 366
514 iso_pu_bacteria 8016575299 8016581829 366
515 iso_pu_bacteria 8016595262 8016595949 366
516 iso_pu_bacteria 8016603502 8016606819 366
517 iso_pu_bacteria 8016622563 8016622805 366
518 iso_pu_bacteria 8019530166 8019530778 366
519 iso_pu_bacteria 8019538911 8019540806 366
520 iso_pu_bacteria 8019555841 8019562790 366
521 iso_pu_bacteria 8019565922 8019572867 366
522 iso_pu_bacteria 8019619141 8019623282 366
523 iso_pu_bacteria 8019629233 8019629811 366
524 iso_pu_bacteria 8019659431 8019666651 366
525 iso_pu_bacteria 8019668869 8019676413 366
526 iso_pu_bacteria 8019678201 8019679578 366
527 iso_pu_bacteria 8056689827 8056691918 366
528 iso_pu_bacteria 8056967851 8056975741 366
529 3300003354 JGI25160J50197_1022859 JGI25160J50197_10228592 367
530 3300004625 Ga0055543_1001860 Ga0055543_10018605 367
531 3300005262 Ga0065165_1001256 Ga0065165_10012565 367
532 3300005262 Ga0065165_1001882 Ga0065165_10018826 367
533 3300005329 Ga0070683_100006785 Ga0070683_1000067858 367
534 3300005329 Ga0070683_100063089 Ga0070683_1000630891 367
535 3300005336 Ga0070680_100072406 Ga0070680_1000724062 367
536 3300005336 Ga0070680_100115183 Ga0070680_1001151831 367
537 3300005338 Ga0068868_100020206 Ga0068868_1000202063 367
538 3300005355 Ga0070671_100107399 Ga0070671_1001073992 367
539 3300005434 Ga0070709_10013398 Ga0070709_100133982 367
540 3300005434 Ga0070709_10191243 Ga0070709_101912431 367
541 3300005435 Ga0070714_100025747 Ga0070714_1000257475 367
542 3300005435 Ga0070714_100085240 Ga0070714_1000852402 367
543 3300005436 Ga0070713_100045763 Ga0070713_1000457633 367
544 3300005436 Ga0070713_100114123 Ga0070713_1001141232 367
545 3300005436 Ga0070713_100146201 Ga0070713_1001462011 367
546 3300005437 Ga0070710_10058677 Ga0070710_100586772 367
547 3300005437 Ga0070710_10146031 Ga0070710_101460311 367
548 3300005439 Ga0070711_100029579 Ga0070711_1000295794 367
549 3300005439 Ga0070711_100072221 Ga0070711_1000722212 367
550 3300005458 Ga0070681_10007785 Ga0070681_100077855 367
551 3300005458 Ga0070681_10025960 Ga0070681_100259602 367
552 3300005458 Ga0070681_10067612 Ga0070681_100676123 367
553 3300005530 Ga0070679_100029510 Ga0070679_1000295103 367
554 3300005535 Ga0070684_100039474 Ga0070684_1000394741 367
555 3300005535 Ga0070684_100043666 Ga0070684_1000436661 367
556 3300005539 Ga0068853_100249969 Ga0068853_1002499692 367
557 3300005547 Ga0070693_100139979 Ga0070693_1001399791 367
558 3300005548 Ga0070665_100473897 Ga0070665_1004738971 367
559 3300005563 Ga0068855_100076020 Ga0068855_1000760203 367
560 3300005577 Ga0068857_100192075 Ga0068857_1001920752 367
561 3300005578 Ga0068854_100066395 Ga0068854_1000663952 367
562 3300005616 Ga0068852_100048996 Ga0068852_1000489963 367
563 3300005617 Ga0068859_100162321 Ga0068859_1001623212 367
564 3300005618 Ga0068864_100055046 Ga0068864_1000550463 367
565 3300005834 Ga0068851_10133862 Ga0068851_101338621 367
566 3300005842 Ga0068858_100115869 Ga0068858_1001158693 367
567 3300005843 Ga0068860_100001721 Ga0068860_1000017214 367
568 3300005981 Ga0081538_10083948 Ga0081538_100839482 367
569 3300005983 Ga0081540_1032770 Ga0081540_10327702 367
570 3300005983 Ga0081540_1054173 Ga0081540_10541732 367
571 3300006048 Ga0075363_100041314 Ga0075363_1000413143 367
572 3300006175 Ga0070712_100029439 Ga0070712_1000294392 367
573 3300006237 Ga0097621_100301261 Ga0097621_1003012611 367
574 3300006871 Ga0075434_100015658 Ga0075434_1000156584 367
575 3300006931 Ga0097620_100162325 Ga0097620_1001623252 367
576 3300006941 Ga0099825_1036210 Ga0099825_10362101 367
577 3300006942 Ga0099824_1012896 Ga0099824_10128961 367
578 3300006943 Ga0099822_1024801 Ga0099822_10248011 367
579 3300009093 Ga0105240_10246338 Ga0105240_102463381 367
580 3300009098 Ga0105245_10027097 Ga0105245_100270972 367
581 3300009177 Ga0105248_10046836 Ga0105248_100468365 367
582 3300009177 Ga0105248_10448268 Ga0105248_104482682 367
583 3300009545 Ga0105237_10037317 Ga0105237_100373172 367
584 3300009545 Ga0105237_10040511 Ga0105237_100405114 367
585 3300010375 Ga0105239_10131733 Ga0105239_101317333 367
586 3300013104 Ga0157370_10125102 Ga0157370_101251022 367
587 3300013105 Ga0157369_10037979 Ga0157369_100379795 367
588 3300013105 Ga0157369_10345636 Ga0157369_103456362 367
589 3300013306 Ga0163162_10051075 Ga0163162_100510754 367
590 3300013308 Ga0157375_10049447 Ga0157375_100494472 367
591 3300014325 Ga0163163_10062000 Ga0163163_100620002 367
592 3300014325 Ga0163163_10110182 Ga0163163_101101823 367
593 3300014968 Ga0157379_10094448 Ga0157379_100944482 367
594 3300014968 Ga0157379_10208802 Ga0157379_102088022 367
595 3300017792 Ga0163161_10091232 Ga0163161_100912322 367
596 3300021320 Ga0214544_1000344 Ga0214544_100034456 367
597 3300021321 Ga0214542_1000018 Ga0214542_100001856 367
598 3300021324 Ga0214545_1000009 Ga0214545_1000009127 367
599 3300021327 Ga0214543_1000037 Ga0214543_100003748 367
600 3300025253 Ga0209677_100589 Ga0209677_1005898 367
601 3300025254 Ga0209148_1000192 Ga0209148_100019284 367
602 3300025254 Ga0209148_1015780 Ga0209148_10157802 367
603 3300025261 Ga0209233_1007220 Ga0209233_10072201 367
604 3300025272 Ga0209455_1000892 Ga0209455_10008925 367
605 3300025272 Ga0209455_1008942 Ga0209455_10089423 367
606 3300025272 Ga0209455_1010792 Ga0209455_10107921 367
607 3300025297 Ga0209758_1006840 Ga0209758_10068406 367
608 3300025302 Ga0207426_1002230 Ga0207426_100223013 367
609 3300025321 Ga0207656_10106012 Ga0207656_101060121 367
610 3300025898 Ga0207692_10064080 Ga0207692_100640802 367
611 3300025901 Ga0207688_10076931 Ga0207688_100769312 367
612 3300025905 Ga0207685_10017833 Ga0207685_100178332 367
613 3300025906 Ga0207699_10024107 Ga0207699_100241073 367
614 3300025909 Ga0207705_10028807 Ga0207705_100288072 367
615 3300025910 Ga0207684_10067768 Ga0207684_100677682 367
616 3300025911 Ga0207654_10018076 Ga0207654_100180763 367
617 3300025912 Ga0207707_10001578 Ga0207707_1000157811 367
618 3300025912 Ga0207707_10119841 Ga0207707_101198412 367
619 3300025915 Ga0207693_10035603 Ga0207693_100356035 367
620 3300025917 Ga0207660_10025124 Ga0207660_100251243 367
621 3300025921 Ga0207652_10185062 Ga0207652_101850622 367
622 3300025927 Ga0207687_10015988 Ga0207687_100159883 367
623 3300025928 Ga0207700_10037283 Ga0207700_100372832 367
624 3300025928 Ga0207700_10044600 Ga0207700_100446002 367
625 3300025932 Ga0207690_10117365 Ga0207690_101173653 367
626 3300025939 Ga0207665_10181823 Ga0207665_101818232 367
627 3300025941 Ga0207711_10093621 Ga0207711_100936212 367
628 3300025942 Ga0207689_10138006 Ga0207689_101380062 367
629 3300025944 Ga0207661_10001342 Ga0207661_100013422 367
630 3300025944 Ga0207661_10061223 Ga0207661_100612232 367
631 3300025945 Ga0207679_10164670 Ga0207679_101646702 367
632 3300025981 Ga0207640_10052250 Ga0207640_100522502 367
633 3300026023 Ga0207677_10022538 Ga0207677_100225382 367
634 3300026035 Ga0207703_10182084 Ga0207703_101820842 367
635 3300026035 Ga0207703_10275308 Ga0207703_102753081 367
636 3300026041 Ga0207639_10132669 Ga0207639_101326692 367
637 3300026078 Ga0207702_10000589 Ga0207702_1000058922 367
638 3300026116 Ga0207674_10063655 Ga0207674_100636553 367
639 3300026121 Ga0207683_10069852 Ga0207683_100698522 367
640 3300027296 Ga0209389_1000064 Ga0209389_100006478 367
641 3300027357 Ga0209589_1000017 Ga0209589_10000171 367
642 3300027361 Ga0209489_100018 Ga0209489_1000181 367
643 3300027361 Ga0209489_104884 Ga0209489_10488412 367
644 3300027363 Ga0209700_100014 Ga0209700_100014202 367
645 3300027363 Ga0209700_100028 Ga0209700_1000281 367
646 3300028379 Ga0268266_10004550 Ga0268266_100045501 367
647 3300028379 Ga0268266_10123600 Ga0268266_101236002 367
648 3300028381 Ga0268264_10000107 Ga0268264_10000107135 367
649 3300028563 Ga0265319_1001409 Ga0265319_100140912 367
650 3300028573 Ga0265334_10001624 Ga0265334_100016247 367
651 3300028653 Ga0265323_10000684 Ga0265323_100006849 367
652 3300028666 Ga0265336_10000459 Ga0265336_1000045912 367
653 3300028786 Ga0307517_10002574 Ga0307517_100025748 367
654 3300028794 Ga0307515_10027983 Ga0307515_100279832 367
655 3300028800 Ga0265338_10002741 Ga0265338_1000274111 367
656 3300029957 Ga0265324_10002054 Ga0265324_100020546 367
657 3300031247 Ga0265340_10047370 Ga0265340_100473702 367
658 3300031249 Ga0265339_10000343 Ga0265339_1000034327 367
659 3300031249 Ga0265339_10014756 Ga0265339_100147563 367
660 3300031250 Ga0265331_10009516 Ga0265331_100095161 367
661 3300031456 Ga0307513_10129649 Ga0307513_101296493 367
662 3300031507 Ga0307509_10035847 Ga0307509_100358476 367
663 3300031507 Ga0307509_10042195 Ga0307509_100421953 367
664 3300031616 Ga0307508_10020956 Ga0307508_100209565 367
665 3300031711 Ga0265314_10007141 Ga0265314_100071413 367
666 3300031711 Ga0265314_10024387 Ga0265314_100243873 367
667 3300031730 Ga0307516_10006998 Ga0307516_100069983 367
668 3300031730 Ga0307516_10080619 Ga0307516_100806192 367
669 3300031731 Ga0307405_10065596 Ga0307405_100655962 367
670 3300033180 Ga0307510_10014423 Ga0307510_100144237 367
671 3300033180 Ga0307510_10073938 Ga0307510_100739383 367
672 3300033180 Ga0307510_10093620 Ga0307510_100936202 367
673 3300033442 Ga0315911_1000048 Ga0315911_100004817 367
674 3300035112 Ga0373932_0033681 Ga0373932_0033681_280_1392 367
675 3300035113 Ga0373936_0003688 Ga0373936_0003688_1492_2604 367
676 3300035115 Ga0373941_0037501 Ga0373941_0037501_129_1241 367
677 3300035170 Ga0373943_0006410 Ga0373943_0006410_932_2044 367
678 3300035171 Ga0373946_0029352 Ga0373946_0029352_673_1785 367
679 3300035172 Ga0373955_0020868 Ga0373955_0020868_1411_2523 367
680 3300035691 Ga0373931_0004987 Ga0373931_0004987_2133_3245 367
681 3300035692 Ga0373935_0000119 Ga0373935_0000119_19121_20233 367
682 3300035692 Ga0373935_0032120 Ga0373935_0032120_1152_2264 367
683 3300035692 Ga0373935_0181812 Ga0373935_0181812_41_1153 367
684 3300035695 Ga0373927_0000965 Ga0373927_0000965_729_1841 367
685 3300035695 Ga0373927_0003633 Ga0373927_0003633_2233_3351 367
686 3300035695 Ga0373927_0015399 Ga0373927_0015399_2367_3479 367
687 3300035695 Ga0373927_0030573 Ga0373927_0030573_969_2081 367
688 3300035725 Ga0373947_0001785 Ga0373947_0001785_3140_4252 367
689 3300035725 Ga0373947_0007763 Ga0373947_0007763_3321_4439 367
690 3300035725 Ga0373947_0105965 Ga0373947_0105965_542_1654 367
691 3300037068 Ga0373925_0091624 Ga0373925_0091624_93_1205 367
692 3300037466 Ga0395898_0083383 Ga0395898_0083383_1131_2243 367
693 3300037471 Ga0395905_0211709 Ga0395905_0211709_35_1147 367
694 3300037853 Ga0436364_1512892 Ga0436364_1512892_266_1378 367
695 3300038443 Ga0395901_0124917 Ga0395901_0124917_890_2002 367
696 3300039437 Ga0436365_1777612 Ga0436365_1777612_703_1815 367
697 3300039447 Ga0436361_0907816 Ga0436361_0907816_141_1253 367
698 3300039450 Ga0436363_1460349 Ga0436363_1460349_9621_10733 367
699 3300044735 Ga0466968_0106923 Ga0466968_0106923_49_1161 367
700 3300045976 Ga0466967_0053723 Ga0466967_0053723_95_1207 367
701 3300046455 Ga0495603_0001895 Ga0495603_0001895_3159_4271 367
702 3300046459 Ga0495629_0000353 Ga0495629_0000353_15086_16198 367
703 3300046460 Ga0495638_0008632 Ga0495638_0008632_5443_6555 367
704 3300046461 Ga0495641_0000972 Ga0495641_0000972_8593_9705 367
705 3300046462 Ga0495651_0023259 Ga0495651_0023259_2519_3631 367
706 3300046463 Ga0495653_0074094 Ga0495653_0074094_224_1336 367
707 3300046463 Ga0495653_0117196 Ga0495653_0117196_332_1444 367
708 3300046472 Ga0495580_0004944 Ga0495580_0004944_1119_2231 367
709 3300046472 Ga0495580_0120636 Ga0495580_0120636_523_1635 367
710 3300046473 Ga0495582_0000444 Ga0495582_0000444_14195_15307 367
711 3300046473 Ga0495582_0079158 Ga0495582_0079158_624_1736 367
712 3300046475 Ga0495639_0000177 Ga0495639_0000177_22895_24007 367
713 3300046475 Ga0495639_0014881 Ga0495639_0014881_1422_2534 367
714 3300046476 Ga0495662_0011228 Ga0495662_0011228_2073_3185 367
715 3300046477 Ga0495664_0007231 Ga0495664_0007231_1949_3061 367
716 3300046477 Ga0495664_0062816 Ga0495664_0062816_569_1681 367
717 3300046477 Ga0495664_0083223 Ga0495664_0083223_761_1873 367
718 3300046492 Ga0495585_0060854 Ga0495585_0060854_129_1241 367
719 3300046499 Ga0495594_0000079 Ga0495594_0000079_14504_15616 367
720 3300046507 Ga0495606_0000901 Ga0495606_0000901_10131_11258 367
721 3300046516 Ga0495628_0053632 Ga0495628_0053632_783_1895 367
722 3300046516 Ga0495628_0072261 Ga0495628_0072261_325_1437 367
723 3300046517 Ga0495630_0011873 Ga0495630_0011873_4466_5578 367
724 3300046531 Ga0495665_0000570 Ga0495665_0000570_2796_3908 367
725 3300046533 Ga0495640_0021203 Ga0495640_0021203_1076_2188 367
726 3300046537 Ga0495598_0001754 Ga0495598_0001754_1893_3005 367
727 3300046543 Ga0495645_0004492 Ga0495645_0004492_6580_7692 367
728 3300046543 Ga0495645_0142379 Ga0495645_0142379_171_1283 367
729 3300046557 Ga0495622_0000888 Ga0495622_0000888_14609_15721 367
730 3300046615 Ga0495656_0001212 Ga0495656_0001212_1816_2928 367
731 3300046642 Ga0495634_0000334 Ga0495634_0000334_20436_21548 367
732 3300046660 Ga0495625_0045332 Ga0495625_0045332_1117_2229 367
733 3300046663 Ga0495635_0035680 Ga0495635_0035680_1973_3085 367
734 3300046663 Ga0495635_0062948 Ga0495635_0062948_630_1787 367
735 3300046663 Ga0495635_0248920 Ga0495635_0248920_26_1138 367
736 3300046675 Ga0495657_0010390 Ga0495657_0010390_74_1186 367
737 3300046675 Ga0495657_0044452 Ga0495657_0044452_1240_2352 367
738 3300046679 Ga0495623_0079436 Ga0495623_0079436_460_1572 367
739 3300046681 Ga0495647_0000894 Ga0495647_0000894_721_1833 367
740 3300046683 Ga0495658_0000416 Ga0495658_0000416_3798_4910 367
741 3300046690 Ga0495624_0003210 Ga0495624_0003210_3960_5072 367
742 3300046809 Ga0495600_0039333 Ga0495600_0039333_869_1981 367
743 3300047315 Ga0495581_0000426 Ga0495581_0000426_5309_6421 367
744 3300047315 Ga0495581_0174638 Ga0495581_0174638_45_1157 367
745 3300047317 Ga0495604_0010461 Ga0495604_0010461_4827_5984 367
746 3300047317 Ga0495604_0138076 Ga0495604_0138076_65_1321 367
747 3300047318 Ga0495636_0075605 Ga0495636_0075605_311_1423 367
748 3300047319 Ga0495674_0000533 Ga0495674_0000533_19497_20609 367
749 3300047319 Ga0495674_0018661 Ga0495674_0018661_1292_2404 367
750 3300047322 Ga0495680_0076618 Ga0495680_0076618_1360_2472 367
751 3300047444 Ga0495675_0094781 Ga0495675_0094781_191_1303 367
752 3300047469 Ga0495673_0019403 Ga0495673_0019403_1953_3065 367
753 3300047472 Ga0495686_0028879 Ga0495686_0028879_1162_2379 367
754 3300048088 Ga0495602_0281441 Ga0495602_0281441_83_1195 367
755 3300048089 Ga0495614_0038997 Ga0495614_0038997_681_1793 367
756 3300048903 Ga0496100_0072280 Ga0496100_0072280_150_1262 367
757 3300048903 Ga0496100_0106717 Ga0496100_0106717_291_1403 367
758 3300048904 Ga0496101_0003771 Ga0496101_0003771_297_1409 367
759 3300048904 Ga0496101_0263915 Ga0496101_0263915_164_1276 367
760 3300048905 Ga0496102_0005218 Ga0496102_0005218_6366_7478 367
761 3300048905 Ga0496102_0167530 Ga0496102_0167530_112_1224 367
762 3300048905 Ga0496102_0326701 Ga0496102_0326701_255_1367 367
763 3300048907 Ga0496104_0016231 Ga0496104_0016231_3581_4693 367
764 3300048907 Ga0496104_0022194 Ga0496104_0022194_1035_2147 367
765 3300048907 Ga0496104_0093971 Ga0496104_0093971_1381_2493 367
766 3300048908 Ga0496105_0019070 Ga0496105_0019070_2070_3182 367
767 3300048910 Ga0496107_0003550 Ga0496107_0003550_7034_8146 367
768 3300048910 Ga0496107_0246505 Ga0496107_0246505_48_1160 367
769 3300048911 Ga0496108_0022679 Ga0496108_0022679_2673_3785 367
770 3300048912 Ga0496109_0011126 Ga0496109_0011126_5305_6417 367
771 3300048912 Ga0496109_0093698 Ga0496109_0093698_254_1366 367
772 3300048913 Ga0496110_0007857 Ga0496110_0007857_2070_3182 367
773 3300048914 Ga0496111_0047714 Ga0496111_0047714_729_1841 367
774 3300048914 Ga0496111_0071439 Ga0496111_0071439_520_1632 367
775 3300048915 Ga0496112_0056475 Ga0496112_0056475_985_2097 367
776 3300048915 Ga0496112_0360592 Ga0496112_0360592_120_1277 367
777 3300048916 Ga0496113_0006395 Ga0496113_0006395_363_1475 367
778 3300048916 Ga0496113_0137080 Ga0496113_0137080_234_1346 367
779 3300048917 Ga0496114_0075310 Ga0496114_0075310_208_1320 367
780 3300048917 Ga0496114_0080809 Ga0496114_0080809_264_1376 367
781 3300048918 Ga0496115_0002700 Ga0496115_0002700_6028_7140 367
782 3300048918 Ga0496115_0006372 Ga0496115_0006372_192_1304 367
783 3300048918 Ga0496115_0057962 Ga0496115_0057962_984_2096 367
784 3300048918 Ga0496115_0255972 Ga0496115_0255972_195_1307 367
785 3300048920 Ga0496117_0054649 Ga0496117_0054649_343_1467 367
786 3300048920 Ga0496117_0112018 Ga0496117_0112018_81_1193 367
787 3300048921 Ga0496118_0005790 Ga0496118_0005790_8894_10018 367
788 3300048921 Ga0496118_0190073 Ga0496118_0190073_38_1150 367
789 3300048922 Ga0496119_0075898 Ga0496119_0075898_774_1886 367
790 3300048923 Ga0496120_0144660 Ga0496120_0144660_37_1149 367
791 3300048924 Ga0496121_0001272 Ga0496121_0001272_39391_40515 367
792 3300048924 Ga0496121_0020252 Ga0496121_0020252_1936_3093 367
793 3300048924 Ga0496121_0125503 Ga0496121_0125503_621_1733 367
794 3300048924 Ga0496121_0157641 Ga0496121_0157641_119_1231 367
795 3300048924 Ga0496121_0255556 Ga0496121_0255556_66_1178 367
796 3300048926 Ga0496123_0080063 Ga0496123_0080063_663_1775 367
797 3300048927 Ga0496124_0001012 Ga0496124_0001012_27555_28679 367
798 3300048927 Ga0496124_0205458 Ga0496124_0205458_68_1180 367
799 3300048928 Ga0496125_0034253 Ga0496125_0034253_3082_4206 367
800 3300048928 Ga0496125_0037965 Ga0496125_0037965_220_1332 367
801 3300048928 Ga0496125_0198570 Ga0496125_0198570_105_1217 367
802 3300048929 Ga0496126_0003575 Ga0496126_0003575_9146_10258 367
803 3300048929 Ga0496126_0007151 Ga0496126_0007151_1641_2753 367
804 3300048929 Ga0496126_0037272 Ga0496126_0037272_1276_2388 367
805 3300048929 Ga0496126_0047051 Ga0496126_0047051_1413_2582 367
806 3300048929 Ga0496126_0108539 Ga0496126_0108539_904_2016 367
807 3300048929 Ga0496126_0131325 Ga0496126_0131325_632_1744 367
808 3300049580 Ga0501046_0045107 Ga0501046_0045107_1823_2935 367
809 3300049586 Ga0501070_0011799 Ga0501070_0011799_5029_6141 367
810 3300049590 Ga0501074_0043112 Ga0501074_0043112_455_1567 367
811 3300050490 nmdc:mga03n38_5383_c1 nmdc:mga03n38_5383_c1_3180_4292 367
812 3300050496 nmdc:mga07m45_11152_c1 nmdc:mga07m45_11152_c1_604_1716 367
813 3300050496 nmdc:mga07m45_24236_c1 nmdc:mga07m45_24236_c1_2173_3285 367
814 3300050512 nmdc:mga0n895_4662_c1 nmdc:mga0n895_4662_c1_7875_8990 367
815 3300053077 Ga0495601_0139632 Ga0495601_0139632_146_1258 367
816 3300053080 Ga0500635_0006999 Ga0500635_0006999_1569_2681 367
817 3300053080 Ga0500635_0048824 Ga0500635_0048824_44_1156 367
818 3300053086 Ga0500578_0089271 Ga0500578_0089271_236_1393 367
819 3300053094 Ga0500566_0000022 Ga0500566_0000022_40448_41560 367
820 3300053095 Ga0500640_011905 Ga0500640_011905_2357_3469 367
821 3300053102 Ga0500554_002353 Ga0500554_002353_2505_3617 367
822 3300053105 Ga0500557_000026 Ga0500557_000026_38264_39376 367
823 3300053109 Ga0500569_046832 Ga0500569_046832_23_1180 367
824 3300053111 Ga0500572_001109 Ga0500572_001109_6500_7612 367
825 3300053111 Ga0500572_021422 Ga0500572_021422_97_1209 367
826 3300053119 Ga0500595_000095 Ga0500595_000095_2180_3415 367
827 3300053119 Ga0500595_005768 Ga0500595_005768_53_1165 367
828 3300053122 Ga0500608_008047 Ga0500608_008047_1381_2493 367
829 3300053123 Ga0500614_002834 Ga0500614_002834_1644_2756 367
830 3300053136 Ga0500559_0000219 Ga0500559_0000219_29950_31062 367
831 3300053136 Ga0500559_0002476 Ga0500559_0002476_126_1238 367
832 3300053139 Ga0500568_0045000 Ga0500568_0045000_558_1670 367
833 3300053150 Ga0500603_000192 Ga0500603_000192_409_1521 367
834 3300053150 Ga0500603_000199 Ga0500603_000199_2888_4000 367
835 3300053153 Ga0500616_0021691 Ga0500616_0021691_699_1811 367
836 3300053155 Ga0500620_030897 Ga0500620_030897_238_1395 367
837 3300053156 Ga0500622_0006911 Ga0500622_0006911_3324_4436 367
838 3300053162 Ga0500638_030072 Ga0500638_030072_906_2141 367
839 3300053163 Ga0500639_029184 Ga0500639_029184_845_1957 367
840 3300053177 Ga0500636_0009769 Ga0500636_0009769_4396_5553 367
841 3300053177 Ga0500636_0018270 Ga0500636_0018270_1988_3145 367
842 3300053178 Ga0500637_0016091 Ga0500637_0016091_1645_2757 367
843 3300053725 Ga0500576_084736 Ga0500576_084736_191_1303 367
844 3300053729 Ga0500625_003257 Ga0500625_003257_168_1280 367
845 3300053730 Ga0500645_013287 Ga0500645_013287_613_1725 367
846 3300053730 Ga0500645_023810 Ga0500645_023810_168_1280 367
847 iso_pu_bacteria 2513237137 2513863836 367
848 iso_pu_bacteria 2528768022 2528851849 367
849 iso_pu_bacteria 2841957949 2841965069 367
850 iso_pu_bacteria 2847930680 2847931368 367
851 iso_pu_bacteria 2879083081 2879087595 367
852 iso_pu_bacteria 2885409591 2885417692 367
853 iso_pu_bacteria 2906626472 2906629106 367
854 iso_pu_bacteria 2906643746 2906650509 367
855 iso_pu_bacteria 8016583857 8016586026 367
856 3300053140 Ga0500573_0095248 Ga0500573_0095248_294_1430 369
857 3300053177 Ga0500636_0015595 Ga0500636_0015595_3294_4430 369
858 3300001979 JGI24740J21852_10001506 JGI24740J21852_100015063 371
859 3300001990 JGI24737J22298_10000974 JGI24737J22298_100009745 371
860 3300005457 Ga0070662_100079169 Ga0070662_1000791691 371
861 3300005539 Ga0068853_100030486 Ga0068853_1000304863 371
862 3300005616 Ga0068852_100022654 Ga0068852_1000226543 371
863 3300005834 Ga0068851_10001130 Ga0068851_100011306 371
864 3300009174 Ga0105241_10006358 Ga0105241_100063583 371
865 3300025321 Ga0207656_10032185 Ga0207656_100321852 371
866 3300025904 Ga0207647_10002062 Ga0207647_100020626 371
867 3300025911 Ga0207654_10000152 Ga0207654_100001524 371
868 3300025913 Ga0207695_10009228 Ga0207695_100092288 371
869 3300025914 Ga0207671_10043870 Ga0207671_100438703 371
870 3300025924 Ga0207694_10000106 Ga0207694_1000010637 371
871 3300026078 Ga0207702_10000004 Ga0207702_1000000437 371
872 3300026078 Ga0207702_10021167 Ga0207702_100211673 371
873 3300048908 Ga0496105_0005991 Ga0496105_0005991_4071_5324 371
874 3300048911 Ga0496108_0002680 Ga0496108_0002680_9714_10967 371
875 3300048912 Ga0496109_0002643 Ga0496109_0002643_9526_10779 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

11

354

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd0-assembly1.cif.gz_A the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety 0.9367 15 368
2yim-assembly2.cif.gz_C the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue 0.9358 15 368
2gd0-assembly1.cif.gz_A the 1,1-proton transfer reaction mechanism by alpha-methylacyl-coa racemase is catalyzed by an aspartate/histidine pair and involves a smooth, methionine-rich surface for binding the fatty acyl moiety 0.9316 15 368
2yim-assembly2.cif.gz_C the enolisation chemistry of a thioester-dependent racemase: the 1.4 a crystal structure of a complex with a planar reaction intermediate analogue 0.9307 15 368
2g04-assembly2.cif.gz_D crystal structure of fatty acid-coa racemase from mycobacterium tuberculosis h37rv 0.9254 16 359
ID Description Score Start End Superfamily
1x74A04 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9468 222 312 3.30.1540.10
af_Q9VIK0_212_295_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9448 229 313 3.30.1540.10
1x74D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9397 21 195 3.40.50.10540
1x74A04 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9369 222 312 3.30.1540.10
af_O06543_1_217_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9309 15 226 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A2D8WUT7-F1-model_v4 Carnitine dehydratase 0.9492 13 127 GO:0003824
AF-A0A2S8WC69-F1-model_v4 Carnitine dehydratase 0.9452 27 356 GO:0003824
AF-W3RIM7-F1-model_v4 Carnitine dehydratase 0.9406 8 369 GO:0003824
AF-A0A0L8NHC7-F1-model_v4 deleted 0.9404 21 342
AF-A0A3A9TT03-F1-model_v4 deleted 0.9395 14 367

Feature Viewer

pLDDT pTM Quality
83.55 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map