F484262

General Info

Members Datasets Scaffolds Average Seq Length
873 549 1746 229

Family's Representative Sequence

Representative Sequence 3300041453|Ga0451797_1494679|Ga0451797_1494679_21_812
Length 263
Sequence MLEIKDLRVSYGQSEVIHGVNLSTERGRIVSVMGRNGMGKTTLFKAVMGVLPSKAGSIVVDGKDVTRLPSYERVRSGLAYVPQGRMIFPTLTVWENLLTGLEGSKTKRLPDDIFTLFPILKDMRSRRGGNLSGGQQQQLAIARALAADPKVLLLDEPTEGLQPSIIKDIAQVLLKIRDSRNLTILVSEQVLSFTLQITDRMLVIEGGRFTADEPPPDSTPASAWPPMTAMLPICLENGSSFRSLRSNTAPASAACRAINPSAS

Samples

Sample ID Description Type Environment
1 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
97 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
98 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
198 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
200 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
206 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
209 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
232 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
246 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
249 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
250 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
251 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
252 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
255 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
256 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
257 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
258 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
259 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
260 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
261 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
262 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
291 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
319 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
335 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
362 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
374 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
378 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
385 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
386 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
387 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
388 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
389 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
390 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
391 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
394 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
395 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
396 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
397 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
398 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
399 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
400 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
401 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
402 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
405 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
406 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
407 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
408 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
409 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
412 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
413 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
414 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
418 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
419 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
420 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
421 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
425 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
426 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
427 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
428 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
429 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
430 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
431 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
432 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
433 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
434 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
435 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
436 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
437 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
438 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
439 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
440 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
441 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
442 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
443 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
444 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
445 2643221683 Variovorax sp. Root473 Isolate Unclassified
446 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
447 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
448 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
449 2738543013 Variovorax sp. BT01 Isolate Unclassified
450 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
451 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
452 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
453 2791355199
454 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
455 2818991446 Variovorax sp. 1180 Isolate Unclassified
456 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
457 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
458 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
459 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
460 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
461 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
462 2858950400 Achromobacter sp. K91 Isolate Unclassified
463 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
464 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
465 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
466 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
467 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
468 2885198086 Variovorax sp. 679 Isolate Unclassified
469 2885211737 Variovorax sp. 553 Isolate Unclassified
470 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
471 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
472 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
473 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
474 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
475 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
476 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
477 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
478 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
479 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
480 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
481 2904699407
482 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
483 2906610324
484 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
485 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
486 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
487 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
488 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
489 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
490 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
491 2922368715
492 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
493 2922425934
494 2928037797 Variovorax sp. 1126 Isolate Unclassified
495 2928044640 Variovorax sp. 1128 Isolate Unclassified
496 2928051484 Variovorax sp. 1133 Isolate Unclassified
497 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
498 2928070936 Variovorax gossypii 1167 Isolate Unclassified
499 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
500 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
501 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
502 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
503 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
504 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
505 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
506 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
507 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
508 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
509 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
510 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
511 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
512 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
513 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
514 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
515 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
516 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
517 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
518 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
519 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
520 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
521 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
522 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
523 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
524 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
525 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
526 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
527 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
528 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
529 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
530 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
531 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
532 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
533 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
534 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
535 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
536 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
537 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
538 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
539 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
540 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
541 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
542 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
543 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
544 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
545 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
546 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
547 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
548 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
549 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.83
Metatranscriptomes 0.23
Isolates 13.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.3
Nodule 9.62
Rhizoplane 2.75
Rhizosphere 55.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451797_1494679 3300041453 Bacteria 2468
2 SwRhRL3b_contig_1238020 2162886006 Bacteria 906
3 JGI24750J21931_1013206 3300002070 Bacteria 1102
4 JGI25159J45721_1000816 3300002987 Bacteria 13575
5 JGI25151J46595_10002642 3300003187 Bacteria 10549
6 JGI25153J46596_10007303 3300003215 Bacteria 5459
7 JGI25153J46596_10008730 3300003215 Bacteria 4802
8 JGI25153J46596_10074515 3300003215 Bacteria 867
9 rootH2_10236421 3300003320 Bacteria 1568
10 rootH1_10071046 3300003323 Bacteria 1120
11 rootH1_10071047 3300003323 Bacteria 1099
12 rootH1_10078959 3300003323 Bacteria 1731
13 rootH1_10112413 3300003323 Bacteria 1838
14 rootH1_10143955 3300003323 Bacteria 1495
15 JGI25160J50197_1000098 3300003354 Bacteria 87307
16 JGI25160J50197_1051849 3300003354 Bacteria 866
17 JGI25161J50226_1000037 3300003374 Bacteria 133331
18 Ga0006562J51391_1088900 3300003578 Bacteria 2948
19 Ga0055529_1008113 3300003763 Bacteria 1404
20 Ga0055537_1002928 3300003773 Bacteria 5435
21 Ga0055536_1005074 3300003781 Bacteria 6533
22 Ga0055534_1011333 3300003784 Bacteria 1818
23 Ga0055528_1006502 3300003790 Bacteria 5297
24 Ga0055530_10000358 3300003791 Bacteria 41173
25 Ga0055540_1000184 3300003792 Bacteria 60646
26 Ga0055540_1002572 3300003792 Bacteria 9462
27 Ga0055540_1004932 3300003792 Bacteria 5815
28 Ga0055531_10007321 3300003794 Bacteria 6050
29 Ga0055543_1000497 3300004625 Bacteria 22716
30 Ga0065165_1003507 3300005262 Bacteria 10899
31 Ga0065165_1005429 3300005262 Bacteria 7171
32 Ga0065707_10084400 3300005295 Bacteria 7240
33 Ga0070658_10001105 3300005327 Bacteria 23012
34 Ga0070658_10802114 3300005327 Bacteria 818
35 Ga0070677_10010390 3300005333 Bacteria 3184
36 Ga0068869_100089288 3300005334 Bacteria 2314
37 Ga0068869_100430277 3300005334 Bacteria 1090
38 Ga0070682_100004212 3300005337 Bacteria 7981
39 Ga0070682_100225158 3300005337 Bacteria 1337
40 Ga0070682_100231187 3300005337 Bacteria 1322
41 Ga0068868_100170776 3300005338 Bacteria 1800
42 Ga0070660_100272659 3300005339 Bacteria 1383
43 Ga0070689_100000001 3300005340 Bacteria 1334580
44 Ga0070687_100109508 3300005343 Bacteria 1561
45 Ga0070661_100169704 3300005344 Bacteria 1656
46 Ga0070668_100047101 3300005347 Bacteria 3313
47 Ga0070669_100069310 3300005353 Bacteria 2605
48 Ga0070669_100193411 3300005353 Bacteria 1597
49 Ga0070669_100210499 3300005353 Bacteria 1534
50 Ga0070675_100039997 3300005354 Bacteria 3827
51 Ga0070675_100112227 3300005354 Bacteria 2308
52 Ga0070671_100080948 3300005355 Bacteria 2715
53 Ga0070674_100465225 3300005356 Bacteria 1046
54 Ga0070673_100144915 3300005364 Bacteria 2007
55 Ga0070659_100097337 3300005366 Bacteria 2365
56 Ga0070667_100338829 3300005367 Bacteria 1359
57 Ga0070709_10010218 3300005434 Bacteria 5190
58 Ga0070709_10023884 3300005434 Bacteria 3595
59 Ga0070714_100034368 3300005435 Bacteria 4246
60 Ga0070714_100563328 3300005435 Bacteria 1092
61 Ga0070713_100021922 3300005436 Bacteria 4927
62 Ga0070713_100029770 3300005436 Bacteria 4327
63 Ga0070713_100734826 3300005436 Bacteria 944
64 Ga0070710_10045296 3300005437 Bacteria 2445
65 Ga0070711_100001277 3300005439 Bacteria 13671
66 Ga0070711_100011775 3300005439 Bacteria 5441
67 Ga0070711_100033622 3300005439 Bacteria 3415
68 Ga0070705_100050929 3300005440 Bacteria 2412
69 Ga0070708_100442554 3300005445 Bacteria 1226
70 Ga0070663_100018048 3300005455 Bacteria 4617
71 Ga0070663_100663840 3300005455 Bacteria 883
72 Ga0070678_100020333 3300005456 Bacteria 4353
73 Ga0070678_100121263 3300005456 Bacteria 2062
74 Ga0070662_100044005 3300005457 Bacteria 3197
75 Ga0070681_10039786 3300005458 Bacteria 4713
76 Ga0070706_100023429 3300005467 Bacteria 5685
77 Ga0070706_100152682 3300005467 Bacteria 2156
78 Ga0070706_100527355 3300005467 Bacteria 1099
79 Ga0070707_100003493 3300005468 Bacteria 14831
80 Ga0070698_100010386 3300005471 Bacteria 9944
81 Ga0070698_100077569 3300005471 Bacteria 3322
82 Ga0070699_100023882 3300005518 Bacteria 5270
83 Ga0070699_100051293 3300005518 Bacteria 3572
84 Ga0070699_100110458 3300005518 Bacteria 2413
85 Ga0070699_100147650 3300005518 Bacteria 2078
86 Ga0070684_100752475 3300005535 Bacteria 910
87 Ga0070697_100023386 3300005536 Bacteria 4913
88 Ga0070697_100315534 3300005536 Bacteria 1345
89 Ga0068853_100003441 3300005539 Bacteria 12109
90 Ga0068853_100070176 3300005539 Bacteria 3049
91 Ga0068853_100113688 3300005539 Bacteria 2407
92 Ga0070696_100414138 3300005546 Bacteria 1057
93 Ga0070693_100066004 3300005547 Bacteria 2117
94 Ga0070693_100241966 3300005547 Bacteria 1192
95 Ga0070665_100053421 3300005548 Bacteria 4052
96 Ga0070665_100115134 3300005548 Bacteria 2691
97 Ga0070665_100487683 3300005548 Bacteria 1243
98 Ga0070665_100855314 3300005548 Bacteria 923
99 Ga0070665_101047843 3300005548 Bacteria 827
100 Ga0070704_100267527 3300005549 Bacteria 1411
101 Ga0068855_100001976 3300005563 Bacteria 25473
102 Ga0068855_100046285 3300005563 Bacteria 5143
103 Ga0068855_100124947 3300005563 Bacteria 2942
104 Ga0068855_100654906 3300005563 Bacteria 1127
105 Ga0068857_100090580 3300005577 Bacteria 2737
106 Ga0068857_101063229 3300005577 Bacteria 780
107 Ga0068854_100175887 3300005578 Bacteria 1669
108 Ga0068856_100035409 3300005614 Bacteria 4892
109 Ga0068856_100135779 3300005614 Bacteria 2465
110 Ga0068856_100138137 3300005614 Bacteria 2443
111 Ga0068856_100398239 3300005614 Bacteria 1396
112 Ga0070702_100177824 3300005615 Bacteria 1390
113 Ga0068852_100793932 3300005616 Bacteria 960
114 Ga0068859_100062750 3300005617 Bacteria 3746
115 Ga0068859_100530743 3300005617 Bacteria 1272
116 Ga0068864_100092604 3300005618 Bacteria 2668
117 Ga0068864_100882137 3300005618 Bacteria 883
118 Ga0068864_100892161 3300005618 Bacteria 878
119 Ga0068861_100073695 3300005719 Bacteria 2653
120 Ga0068861_100103930 3300005719 Bacteria 2265
121 Ga0068851_10002794 3300005834 Bacteria 7692
122 Ga0068863_100539031 3300005841 Bacteria 1151
123 Ga0068860_100006055 3300005843 Bacteria 12173
124 Ga0068860_100484086 3300005843 Bacteria 1234
125 Ga0068862_100256051 3300005844 Bacteria 1596
126 Ga0068862_100284097 3300005844 Bacteria 1517
127 Ga0068862_100294070 3300005844 Bacteria 1492
128 Ga0081455_10461714 3300005937 Bacteria 864
129 Ga0081540_1011585 3300005983 Bacteria 5886
130 Ga0081540_1012130 3300005983 Bacteria 5699
131 Ga0081540_1045487 3300005983 Bacteria 2228
132 Ga0081539_10002350 3300005985 Bacteria 27182
133 Ga0081539_10189053 3300005985 Bacteria 960
134 Ga0081539_10235049 3300005985 Bacteria 824
135 Ga0070717_10543671 3300006028 Bacteria 1052
136 Ga0070717_10599018 3300006028 Bacteria 1000
137 Ga0075365_10147509 3300006038 Bacteria 1635
138 Ga0075365_10192285 3300006038 Bacteria 1428
139 Ga0075365_10361342 3300006038 Bacteria 1024
140 Ga0075363_100028797 3300006048 Bacteria 2861
141 Ga0075363_100029159 3300006048 Bacteria 2846
142 Ga0075363_100037949 3300006048 Bacteria 2531
143 Ga0075363_100077076 3300006048 Bacteria 1819
144 Ga0075364_10062210 3300006051 Bacteria 2449
145 Ga0075364_10351520 3300006051 Bacteria 1005
146 Ga0075364_10352054 3300006051 Bacteria 1004
147 Ga0070715_10184915 3300006163 Bacteria 1048
148 Ga0070716_100106728 3300006173 Bacteria 1728
149 Ga0070712_100029964 3300006175 Bacteria 3652
150 Ga0075362_10016617 3300006177 Bacteria 3016
151 Ga0075362_10032523 3300006177 Bacteria 2263
152 Ga0075362_10043582 3300006177 Bacteria 1987
153 Ga0075362_10197035 3300006177 Bacteria 980
154 Ga0075367_10005456 3300006178 Bacteria 6317
155 Ga0075367_10041321 3300006178 Bacteria 2695
156 Ga0075367_10214687 3300006178 Bacteria 1203
157 Ga0075369_10005854 3300006186 Bacteria 4621
158 Ga0075369_10033816 3300006186 Bacteria 2168
159 Ga0075366_10000857 3300006195 Bacteria 14672
160 Ga0075366_10116389 3300006195 Bacteria 1610
161 Ga0075366_10197976 3300006195 Bacteria 1221
162 Ga0097621_100104347 3300006237 Bacteria 2389
163 Ga0075370_10003260 3300006353 Bacteria 7689
164 Ga0075370_10010598 3300006353 Bacteria 4827
165 Ga0075370_10045526 3300006353 Bacteria 2481
166 Ga0068871_100174028 3300006358 Bacteria 1847
167 Ga0075428_100967490 3300006844 Bacteria 902
168 Ga0075434_100000932 3300006871 Bacteria 23496
169 Ga0075434_100229465 3300006871 Bacteria 1876
170 Ga0075434_100380898 3300006871 Bacteria 1431
171 Ga0075436_100004513 3300006914 Bacteria 9549
172 Ga0075436_100013837 3300006914 Bacteria 5526
173 Ga0097620_100062751 3300006931 Bacteria 3746
174 Ga0097620_100530740 3300006931 Bacteria 1272
175 Ga0099824_1033654 3300006942 Bacteria 1715
176 Ga0099822_1006869 3300006943 Bacteria 14775
177 Ga0099823_1045448 3300006944 Bacteria 2926
178 Ga0075435_100004811 3300007076 Bacteria 9339
179 Ga0099795_10019563 3300007788 Bacteria 2194
180 Ga0099795_10087927 3300007788 Bacteria 1200
181 Ga0105240_10000309 3300009093 Bacteria 93964
182 Ga0105240_10000565 3300009093 Bacteria 68589
183 Ga0105240_10001377 3300009093 Bacteria 41807
184 Ga0105240_10103703 3300009093 Bacteria 3455
185 Ga0105240_10105433 3300009093 Bacteria 3422
186 Ga0105240_10364986 3300009093 Bacteria 1634
187 Ga0111539_10069205 3300009094 Bacteria 4168
188 Ga0111539_10761647 3300009094 Bacteria 1127
189 Ga0105245_10044415 3300009098 Bacteria 3966
190 Ga0105245_10812281 3300009098 Bacteria 974
191 Ga0105247_10000116 3300009101 Bacteria 78228
192 Ga0114129_10018519 3300009147 Bacteria 9913
193 Ga0105243_10003118 3300009148 Bacteria 13622
194 Ga0105243_10090809 3300009148 Bacteria 2514
195 Ga0105243_10123374 3300009148 Bacteria 2188
196 Ga0105243_10142382 3300009148 Bacteria 2047
197 Ga0105243_10760194 3300009148 Bacteria 951
198 Ga0105241_10109588 3300009174 Bacteria 2208
199 Ga0105241_10561622 3300009174 Bacteria 1026
200 Ga0105241_10635768 3300009174 Bacteria 968
201 Ga0105242_10499305 3300009176 Bacteria 1157
202 Ga0105248_10040984 3300009177 Bacteria 5192
203 Ga0105248_10721809 3300009177 Bacteria 1125
204 Ga0105237_10000197 3300009545 Bacteria 85308
205 Ga0105237_10003925 3300009545 Bacteria 17419
206 Ga0105237_10009767 3300009545 Bacteria 10263
207 Ga0105237_10030930 3300009545 Bacteria 5430
208 Ga0105237_10036637 3300009545 Bacteria 4964
209 Ga0105237_10088966 3300009545 Bacteria 3077
210 Ga0105237_10402494 3300009545 Bacteria 1373
211 Ga0105238_10009635 3300009551 Bacteria 9664
212 Ga0105238_10016742 3300009551 Bacteria 7430
213 Ga0105238_10033064 3300009551 Bacteria 5262
214 Ga0105238_10156872 3300009551 Bacteria 2251
215 Ga0105238_10211526 3300009551 Bacteria 1915
216 Ga0105249_10108438 3300009553 Bacteria 2621
217 Ga0105249_10752576 3300009553 Bacteria 1037
218 Ga0105147_104762 3300009982 Bacteria 1139
219 Ga0099796_10012085 3300010159 Bacteria 2427
220 Ga0105239_10002899 3300010375 Bacteria 21425
221 Ga0105239_10040562 3300010375 Bacteria 5100
222 Ga0105239_10064526 3300010375 Bacteria 4020
223 Ga0105239_10064829 3300010375 Bacteria 4011
224 Ga0105239_10121243 3300010375 Bacteria 2904
225 Ga0105239_10152944 3300010375 Bacteria 2575
226 Ga0105239_10173240 3300010375 Bacteria 2413
227 Ga0105239_10607262 3300010375 Bacteria 1248
228 Ga0157347_1005055 3300012502 Bacteria 1249
229 Ga0157373_10000027 3300013100 Bacteria 133695
230 Ga0157373_10065586 3300013100 Bacteria 2569
231 Ga0157371_10041430 3300013102 Bacteria 3286
232 Ga0157370_10012712 3300013104 Bacteria 8711
233 Ga0157378_10071250 3300013297 Bacteria 3121
234 Ga0157378_10132490 3300013297 Bacteria 2309
235 Ga0157378_10598963 3300013297 Bacteria 1113
236 Ga0157378_10918147 3300013297 Bacteria 907
237 Ga0163162_10388975 3300013306 Bacteria 1527
238 Ga0157375_10912797 3300013308 Bacteria 1022
239 Ga0157380_10542872 3300014326 Bacteria 1139
240 Ga0157376_10945855 3300014969 Bacteria 882
241 Ga0182006_1039094 3300015261 Bacteria 1874
242 Ga0163161_10000446 3300017792 Bacteria 34480
243 Ga0163161_10028289 3300017792 Bacteria 3980
244 Ga0163161_10275315 3300017792 Bacteria 1318
245 Ga0213876_10110878 3300021384 Bacteria 1456
246 Ga0213875_10085621 3300021388 Bacteria 1470
247 Ga0209436_105359 3300025208 Bacteria 2968
248 Ga0207425_1002709 3300025245 Bacteria 6052
249 Ga0209677_102734 3300025253 Bacteria 6324
250 Ga0209148_1000334 3300025254 Bacteria 64148
251 Ga0209129_1004239 3300025258 Bacteria 5740
252 Ga0209233_1001804 3300025261 Bacteria 8242
253 Ga0209233_1008944 3300025261 Bacteria 3066
254 Ga0209565_1001371 3300025263 Bacteria 10952
255 Ga0209455_1004147 3300025272 Bacteria 4851
256 Ga0209673_1002874 3300025273 Bacteria 10952
257 Ga0209130_1000141 3300025284 Bacteria 115378
258 Ga0209675_1005201 3300025291 Bacteria 5514
259 Ga0209676_1000432 3300025292 Bacteria 72513
260 Ga0209676_1001071 3300025292 Bacteria 31088
261 Ga0209025_1000294 3300025294 Bacteria 111598
262 Ga0209025_1004609 3300025294 Bacteria 11792
263 Ga0209564_1024100 3300025295 Bacteria 2089
264 Ga0209564_1030148 3300025295 Bacteria 1686
265 Ga0209758_1000249 3300025297 Bacteria 110026
266 Ga0209758_1001476 3300025297 Bacteria 27510
267 Ga0209758_1004383 3300025297 Bacteria 11792
268 Ga0209758_1011353 3300025297 Bacteria 5173
269 Ga0209050_1000015 3300025298 Bacteria 759102
270 Ga0209050_1004667 3300025298 Bacteria 9108
271 Ga0209256_1042224 3300025299 Bacteria 1153
272 Ga0207426_1000145 3300025302 Bacteria 191065
273 Ga0207426_1000942 3300025302 Bacteria 28876
274 Ga0209051_1000081 3300025303 Bacteria 195619
275 Ga0209051_1000622 3300025303 Bacteria 40749
276 Ga0209257_1003557 3300025304 Bacteria 13237
277 Ga0209257_1008029 3300025304 Bacteria 6149
278 Ga0209257_1024427 3300025304 Bacteria 2093
279 Ga0207656_10002219 3300025321 Bacteria 6503
280 Ga0207656_10134803 3300025321 Bacteria 1160
281 Ga0207682_10013101 3300025893 Bacteria 3232
282 Ga0207692_10057994 3300025898 Bacteria 1993
283 Ga0207710_10000418 3300025900 Bacteria 28048
284 Ga0207688_10163985 3300025901 Bacteria 1319
285 Ga0207685_10119631 3300025905 Bacteria 1154
286 Ga0207699_10022976 3300025906 Bacteria 3388
287 Ga0207699_10038622 3300025906 Bacteria 2737
288 Ga0207699_10267994 3300025906 Bacteria 1182
289 Ga0207645_10190666 3300025907 Bacteria 1347
290 Ga0207705_10076636 3300025909 Bacteria 2431
291 Ga0207705_10572300 3300025909 Bacteria 878
292 Ga0207684_10028736 3300025910 Bacteria 4736
293 Ga0207684_10089458 3300025910 Bacteria 2623
294 Ga0207684_10177822 3300025910 Bacteria 1835
295 Ga0207695_10000062 3300025913 Bacteria 351979
296 Ga0207695_10000635 3300025913 Bacteria 70312
297 Ga0207695_10013961 3300025913 Bacteria 9544
298 Ga0207695_10028199 3300025913 Bacteria 6233
299 Ga0207695_10400196 3300025913 Bacteria 1257
300 Ga0207671_10000092 3300025914 Bacteria 139546
301 Ga0207671_10001542 3300025914 Bacteria 26352
302 Ga0207671_10009825 3300025914 Bacteria 7962
303 Ga0207671_10038038 3300025914 Bacteria 3567
304 Ga0207693_10019913 3300025915 Bacteria 5336
305 Ga0207693_10043663 3300025915 Bacteria 3525
306 Ga0207663_10015201 3300025916 Bacteria 4240
307 Ga0207657_10256747 3300025919 Bacteria 1392
308 Ga0207652_10032949 3300025921 Bacteria 4361
309 Ga0207646_10002497 3300025922 Bacteria 21730
310 Ga0207681_10072121 3300025923 Bacteria 2411
311 Ga0207681_10076479 3300025923 Bacteria 2351
312 Ga0207694_10017263 3300025924 Bacteria 5455
313 Ga0207694_10017771 3300025924 Bacteria 5374
314 Ga0207694_10084911 3300025924 Bacteria 2491
315 Ga0207650_10774650 3300025925 Bacteria 812
316 Ga0207659_10128879 3300025926 Bacteria 1949
317 Ga0207687_10496494 3300025927 Bacteria 1018
318 Ga0207687_10508832 3300025927 Bacteria 1006
319 Ga0207700_10014831 3300025928 Bacteria 5119
320 Ga0207700_10017552 3300025928 Bacteria 4784
321 Ga0207700_10154742 3300025928 Bacteria 1898
322 Ga0207700_10256390 3300025928 Bacteria 1496
323 Ga0207664_10058493 3300025929 Bacteria 3066
324 Ga0207664_10449439 3300025929 Bacteria 1150
325 Ga0207690_10051486 3300025932 Bacteria 2754
326 Ga0207706_10057225 3300025933 Bacteria 3436
327 Ga0207706_10508681 3300025933 Bacteria 1039
328 Ga0207709_10000234 3300025935 Bacteria 70092
329 Ga0207709_10359196 3300025935 Bacteria 1102
330 Ga0207670_10000002 3300025936 Bacteria 783058
331 Ga0207665_10133713 3300025939 Bacteria 1763
332 Ga0207691_10001208 3300025940 Bacteria 25729
333 Ga0207691_10169528 3300025940 Bacteria 1912
334 Ga0207691_10229063 3300025940 Bacteria 1609
335 Ga0207711_10045791 3300025941 Bacteria 3738
336 Ga0207711_10077163 3300025941 Bacteria 2903
337 Ga0207689_10057386 3300025942 Bacteria 3203
338 Ga0207679_10668827 3300025945 Bacteria 940
339 Ga0207667_10001145 3300025949 Bacteria 33320
340 Ga0207667_10032537 3300025949 Bacteria 5618
341 Ga0207667_10151895 3300025949 Bacteria 2383
342 Ga0207667_10368925 3300025949 Bacteria 1463
343 Ga0207651_10097753 3300025960 Bacteria 2169
344 Ga0207712_10171241 3300025961 Bacteria 1697
345 Ga0207668_10041674 3300025972 Bacteria 3105
346 Ga0207668_10099407 3300025972 Bacteria 2158
347 Ga0207668_10452090 3300025972 Bacteria 1096
348 Ga0207668_10650335 3300025972 Bacteria 923
349 Ga0207640_10441851 3300025981 Bacteria 1070
350 Ga0207677_10178141 3300026023 Bacteria 1670
351 Ga0207677_10225718 3300026023 Bacteria 1505
352 Ga0207677_10282668 3300026023 Bacteria 1363
353 Ga0207639_10023520 3300026041 Bacteria 4450
354 Ga0207639_10121594 3300026041 Bacteria 2146
355 Ga0207639_10320293 3300026041 Bacteria 1376
356 Ga0207639_10325153 3300026041 Bacteria 1367
357 Ga0207678_10029063 3300026067 Bacteria 4825
358 Ga0207678_10097478 3300026067 Bacteria 2513
359 Ga0207678_10136110 3300026067 Bacteria 2096
360 Ga0207678_10467319 3300026067 Bacteria 1098
361 Ga0207702_10120251 3300026078 Bacteria 2349
362 Ga0207702_10174470 3300026078 Bacteria 1974
363 Ga0207702_10260285 3300026078 Bacteria 1633
364 Ga0207702_10548536 3300026078 Bacteria 1130
365 Ga0207641_10843073 3300026088 Bacteria 908
366 Ga0207676_10442556 3300026095 Bacteria 1223
367 Ga0207674_10067179 3300026116 Bacteria 3610
368 Ga0207674_10401043 3300026116 Bacteria 1325
369 Ga0207683_10488150 3300026121 Bacteria 1137
370 Ga0207683_10556851 3300026121 Bacteria 1060
371 Ga0209389_1000064 3300027296 Bacteria 102177
372 Ga0209371_1033240 3300027312 Bacteria 1103
373 Ga0209589_1000001 3300027357 Bacteria 794224
374 Ga0209489_100001 3300027361 Bacteria 794224
375 Ga0209489_104185 3300027361 Bacteria 26861
376 Ga0209700_100001 3300027363 Bacteria 794224
377 Ga0209700_100014 3300027363 Bacteria 299349
378 Ga0209179_1082758 3300027512 Bacteria 709
379 Ga0207428_10078804 3300027907 Bacteria 2577
380 Ga0268266_10002834 3300028379 Bacteria 18070
381 Ga0268266_10065384 3300028379 Bacteria 3144
382 Ga0268266_10457369 3300028379 Bacteria 1214
383 Ga0268265_10028815 3300028380 Bacteria 3979
384 Ga0268265_10676695 3300028380 Bacteria 994
385 Ga0268264_10000427 3300028381 Bacteria 58342
386 Ga0265337_1008184 3300028556 Bacteria 3827
387 Ga0265319_1036810 3300028563 Bacteria 1671
388 Ga0307515_10000109 3300028794 Bacteria 195895
389 Ga0268256_1044003 3300030500 Bacteria 981
390 Ga0307512_10097214 3300030522 Bacteria 2015
391 Ga0307512_10228006 3300030522 Bacteria 962
392 Ga0265330_10052677 3300031235 Bacteria 1782
393 Ga0265332_10072186 3300031238 Bacteria 1470
394 Ga0265320_10018243 3300031240 Bacteria 3870
395 Ga0265340_10026474 3300031247 Bacteria 2931
396 Ga0265316_10132291 3300031344 Bacteria 1878
397 Ga0265316_10155884 3300031344 Bacteria 1709
398 Ga0307513_10000015 3300031456 Bacteria 296183
399 Ga0307513_10020111 3300031456 Bacteria 7921
400 Ga0307513_10045412 3300031456 Bacteria 4802
401 Ga0307513_10055215 3300031456 Bacteria 4252
402 Ga0307513_10098953 3300031456 Bacteria 2946
403 Ga0307513_10128857 3300031456 Bacteria 2479
404 Ga0307513_10148613 3300031456 Bacteria 2257
405 Ga0307509_10491567 3300031507 Bacteria 913
406 Ga0307509_10521620 3300031507 Bacteria 869
407 Ga0307408_100042038 3300031548 Bacteria 3243
408 Ga0307408_100214957 3300031548 Bacteria 1565
409 Ga0307408_100879520 3300031548 Bacteria 819
410 Ga0265313_10076856 3300031595 Bacteria 1525
411 Ga0265313_10121681 3300031595 Bacteria 1137
412 Ga0307508_10000246 3300031616 Bacteria 65693
413 Ga0307508_10006278 3300031616 Bacteria 11192
414 Ga0307508_10009734 3300031616 Bacteria 8815
415 Ga0307508_10018036 3300031616 Bacteria 6414
416 Ga0307508_10143179 3300031616 Bacteria 1995
417 Ga0307514_10020362 3300031649 Bacteria 5413
418 Ga0265342_10088475 3300031712 Bacteria 1778
419 Ga0307516_10006708 3300031730 Bacteria 13452
420 Ga0307516_10123935 3300031730 Bacteria 2371
421 Ga0307405_10077124 3300031731 Bacteria 2164
422 Ga0307405_10092740 3300031731 Bacteria 2004
423 Ga0307413_10154788 3300031824 Bacteria 1602
424 Ga0307413_10538529 3300031824 Bacteria 945
425 Ga0307409_100383772 3300031995 Bacteria 1336
426 Ga0307416_100023421 3300032002 Bacteria 4480
427 Ga0307416_100873102 3300032002 Bacteria 998
428 Ga0307414_10612364 3300032004 Bacteria 978
429 Ga0307411_10453620 3300032005 Bacteria 1073
430 Ga0307411_10462305 3300032005 Bacteria 1064
431 Ga0307507_10043771 3300033179 Bacteria 4438
432 Ga0307507_10236786 3300033179 Bacteria 1201
433 Ga0307510_10007100 3300033180 Bacteria 13342
434 Ga0307510_10020152 3300033180 Bacteria 7803
435 Ga0307510_10059830 3300033180 Bacteria 3928
436 Ga0307510_10217439 3300033180 Bacteria 1426
437 Ga0315911_1000002 3300033442 Bacteria 926833
438 Ga0316588_1049097 3300033528 Bacteria 1021
439 Ga0373934_0051717 3300035086 Bacteria 1629
440 Ga0373944_0028431 3300035089 Bacteria 1664
441 Ga0373923_0049895 3300035111 Bacteria 1751
442 Ga0373943_0022548 3300035170 Bacteria 2919
443 Ga0373924_0089893 3300035410 Bacteria 1313
444 Ga0373933_0000164 3300035724 Bacteria 43241
445 Ga0373937_0261117 3300036401 Bacteria 1633
446 Ga0373925_0038084 3300037068 Bacteria 3552
447 Ga0395898_0237261 3300037466 Bacteria 1739
448 Ga0395905_0015214 3300037471 Bacteria 7316
449 Ga0436364_0166031 3300037853 Bacteria 824
450 Ga0436364_0176246 3300037853 Bacteria 1750
451 Ga0395901_0320216 3300038443 Bacteria 1605
452 Ga0400490_59588 3300038726 Bacteria 10370
453 Ga0400483_037459 3300039062 Bacteria 2216
454 Ga0400483_079217 3300039062 Bacteria 83041
455 Ga0400483_092352 3300039062 Bacteria 246443
456 Ga0400483_222230 3300039062 Bacteria 4185
457 Ga0400483_222800 3300039062 Bacteria 244239
458 Ga0436365_0022917 3300039437 Bacteria 1279
459 Ga0436365_0694465 3300039437 Bacteria 2443
460 Ga0439436_0001353 3300041404 Bacteria 7051
461 Ga0439438_024843 3300041405 Bacteria 1638
462 Ga0439439_0002684 3300041406 Bacteria 3814
463 Ga0439461_0023308 3300041410 Bacteria 1245
464 Ga0451789_0190617 3300041443 Bacteria 901
465 Ga0451797_0912266 3300041453 Bacteria 762
466 Ga0451807_0885740 3300041486 Bacteria 6515
467 Ga0451807_2272697 3300041486 Bacteria 1795
468 Ga0439433_0022342 3300041999 Bacteria 1418
469 Ga0439432_004573 3300042006 Bacteria 5049
470 Ga0439449_0004052 3300042007 Bacteria 5672
471 Ga0439452_001303 3300042010 Bacteria 10505
472 Ga0439457_014966 3300042014 Bacteria 1733
473 Ga0450897_003577 3300042128 Bacteria 1254
474 Ga0450896_025860 3300042133 Bacteria 874
475 Ga0450910_003635 3300042147 Bacteria 2055
476 Ga0450909_016170 3300042185 Bacteria 1101
477 Ga0451577_0017106 3300042876 Bacteria 6704
478 Ga0451577_0024143 3300042876 Bacteria 5532
479 Ga0466969_0152366 3300044656 Bacteria 1065
480 Ga0453683_0163556 3300044673 Bacteria 1408
481 Ga0466965_0206433 3300044683 Bacteria 1043
482 Ga0466961_0353826 3300044693 Bacteria 894
483 Ga0466963_0145419 3300044694 Bacteria 1644
484 Ga0466964_0225110 3300044706 Bacteria 913
485 Ga0453684_0138384 3300044712 Bacteria 2912
486 Ga0466957_0164597 3300044842 Bacteria 1442
487 Ga0451576_0130666 3300045051 Bacteria 2618
488 Ga0466967_0822628 3300045976 Bacteria 922
489 Ga0495617_114028 3300046452 Bacteria 873
490 Ga0495627_021305 3300046453 Bacteria 2150
491 Ga0495592_0022519 3300046454 Bacteria 4794
492 Ga0495603_0047679 3300046455 Bacteria 2551
493 Ga0495590_0049205 3300046457 Bacteria 1471
494 Ga0495591_000353 3300046458 Bacteria 40689
495 Ga0495591_004510 3300046458 Bacteria 6780
496 Ga0495638_0018358 3300046460 Bacteria 4645
497 Ga0495638_0094282 3300046460 Bacteria 1800
498 Ga0495638_0240898 3300046460 Bacteria 1001
499 Ga0495641_0067953 3300046461 Bacteria 1602
500 Ga0495580_0056114 3300046472 Bacteria 2774
501 Ga0495582_0086227 3300046473 Bacteria 1747
502 Ga0495582_0235766 3300046473 Bacteria 1048
503 Ga0495605_0000436 3300046474 Bacteria 37694
504 Ga0495605_0001028 3300046474 Bacteria 18772
505 Ga0495639_0118631 3300046475 Bacteria 1261
506 Ga0495664_0003029 3300046477 Bacteria 9098
507 Ga0495584_0216591 3300046491 Bacteria 973
508 Ga0495585_0119051 3300046492 Bacteria 1398
509 Ga0495594_0005421 3300046499 Bacteria 6555
510 Ga0495594_0186964 3300046499 Bacteria 1180
511 Ga0495594_0232494 3300046499 Bacteria 1051
512 Ga0495607_0009324 3300046501 Bacteria 6651
513 Ga0495607_0075075 3300046501 Bacteria 1874
514 Ga0495583_0000028 3300046506 Bacteria 255787
515 Ga0495606_0127987 3300046507 Bacteria 1512
516 Ga0495606_0198783 3300046507 Bacteria 1144
517 Ga0495606_0275738 3300046507 Bacteria 922
518 Ga0495610_0017908 3300046512 Bacteria 4021
519 Ga0495610_0090366 3300046512 Bacteria 1389
520 Ga0495616_0198743 3300046513 Bacteria 882
521 Ga0495616_0202819 3300046513 Bacteria 871
522 Ga0495618_0035740 3300046514 Bacteria 3119
523 Ga0495620_0000028 3300046515 Bacteria 123172
524 Ga0495620_0046712 3300046515 Bacteria 1868
525 Ga0495620_0111270 3300046515 Bacteria 1085
526 Ga0495628_0088858 3300046516 Bacteria 2394
527 Ga0495630_0081340 3300046517 Bacteria 2444
528 Ga0495631_0019696 3300046518 Bacteria 3163
529 Ga0495631_0143208 3300046518 Bacteria 1026
530 Ga0495631_0176428 3300046518 Bacteria 916
531 Ga0495632_0075399 3300046519 Bacteria 1614
532 Ga0495637_0058026 3300046520 Bacteria 1596
533 Ga0495637_0087414 3300046520 Bacteria 1234
534 Ga0495643_0000057 3300046522 Bacteria 195145
535 Ga0495643_0007531 3300046522 Bacteria 7005
536 Ga0495643_0148394 3300046522 Bacteria 1163
537 Ga0495644_0134473 3300046523 Bacteria 943
538 Ga0495648_0018358 3300046524 Bacteria 4954
539 Ga0495648_0105183 3300046524 Bacteria 1548
540 Ga0495648_0229435 3300046524 Bacteria 910
541 Ga0495652_0121872 3300046529 Bacteria 2078
542 Ga0495652_0203451 3300046529 Bacteria 1501
543 Ga0495654_0001115 3300046530 Bacteria 19367
544 Ga0495654_0066737 3300046530 Bacteria 1714
545 Ga0495654_0073586 3300046530 Bacteria 1616
546 Ga0495654_0152662 3300046530 Bacteria 1020
547 Ga0495665_0097196 3300046531 Bacteria 1546
548 Ga0495640_0083808 3300046533 Bacteria 2115
549 Ga0495586_0163432 3300046535 Bacteria 1256
550 Ga0495598_0089915 3300046537 Bacteria 999
551 Ga0495609_0000081 3300046538 Bacteria 116100
552 Ga0495621_0132401 3300046539 Bacteria 971
553 Ga0495597_0000037 3300046542 Bacteria 113832
554 Ga0495597_0026112 3300046542 Bacteria 2684
555 Ga0495622_0086965 3300046557 Bacteria 1437
556 Ga0495622_0167545 3300046557 Bacteria 989
557 Ga0495633_0000028 3300046558 Bacteria 203214
558 Ga0495656_0141514 3300046615 Bacteria 1154
559 Ga0495668_0074227 3300046616 Bacteria 1868
560 Ga0495668_0265863 3300046616 Bacteria 939
561 Ga0495668_0317735 3300046616 Bacteria 854
562 Ga0495611_0008756 3300046648 Bacteria 4278
563 Ga0495611_0111947 3300046648 Bacteria 1271
564 Ga0495625_0130041 3300046660 Bacteria 1706
565 Ga0495625_0178502 3300046660 Bacteria 1414
566 Ga0495661_0000217 3300046665 Bacteria 66241
567 Ga0495661_0010263 3300046665 Bacteria 6398
568 Ga0495661_0142128 3300046665 Bacteria 1305
569 Ga0495588_0259671 3300046674 Bacteria 915
570 Ga0495588_0279796 3300046674 Bacteria 879
571 Ga0495647_0021985 3300046681 Bacteria 2302
572 Ga0495624_0108077 3300046690 Bacteria 1711
573 Ga0495670_0001463 3300046691 Bacteria 11538
574 Ga0495671_0006278 3300046692 Bacteria 6880
575 Ga0495671_0033794 3300046692 Bacteria 2603
576 Ga0495671_0276521 3300046692 Bacteria 809
577 Ga0495649_0316663 3300046694 Bacteria 792
578 Ga0495589_0010125 3300046794 Bacteria 4898
579 Ga0495660_0000568 3300046810 Bacteria 29899
580 Ga0495660_0003536 3300046810 Bacteria 9636
581 Ga0495660_0015689 3300046810 Bacteria 4374
582 Ga0495660_0203201 3300046810 Bacteria 945
583 Ga0495604_0172449 3300047317 Bacteria 1520
584 Ga0495674_0037149 3300047319 Bacteria 4377
585 Ga0495672_0072361 3300047320 Bacteria 1947
586 Ga0495672_0101109 3300047320 Bacteria 1563
587 Ga0495672_0244747 3300047320 Bacteria 874
588 Ga0495683_0000060 3300047323 Bacteria 115881
589 Ga0495683_0112253 3300047323 Bacteria 1300
590 Ga0495683_0222511 3300047323 Bacteria 841
591 Ga0495687_049654 3300047443 Bacteria 1792
592 Ga0495679_000823 3300047446 Bacteria 19731
593 Ga0495681_0024953 3300047470 Bacteria 3135
594 Ga0495686_0095860 3300047472 Bacteria 1796
595 Ga0495686_0327534 3300047472 Bacteria 838
596 Ga0495602_0225582 3300048088 Bacteria 1411
597 Ga0496102_0190387 3300048905 Bacteria 1933
598 Ga0496103_0010374 3300048906 Bacteria 5513
599 Ga0496104_0201716 3300048907 Bacteria 1901
600 Ga0496106_0000002 3300048909 Bacteria 377020
601 Ga0496106_0258759 3300048909 Bacteria 1392
602 Ga0496107_0028046 3300048910 Bacteria 4001
603 Ga0496108_0198145 3300048911 Bacteria 1742
604 Ga0496109_0283565 3300048912 Bacteria 1561
605 Ga0496110_0303802 3300048913 Bacteria 1453
606 Ga0496111_0063380 3300048914 Bacteria 2681
607 Ga0496112_0019936 3300048915 Bacteria 6346
608 Ga0496112_0436698 3300048915 Bacteria 1247
609 Ga0496113_0270307 3300048916 Bacteria 1358
610 Ga0496114_0377032 3300048917 Bacteria 1256
611 Ga0496116_0042778 3300048919 Bacteria 3093
612 Ga0496116_0066692 3300048919 Bacteria 2302
613 Ga0496117_0080858 3300048920 Bacteria 2135
614 Ga0496117_0090460 3300048920 Bacteria 1972
615 Ga0496117_0291583 3300048920 Bacteria 868
616 Ga0496117_0320977 3300048920 Bacteria 811
617 Ga0496118_0074574 3300048921 Bacteria 2424
618 Ga0496118_0075118 3300048921 Bacteria 2412
619 Ga0496118_0164712 3300048921 Bacteria 1364
620 Ga0496118_0299639 3300048921 Bacteria 883
621 Ga0496118_0331017 3300048921 Bacteria 821
622 Ga0496119_0170381 3300048922 Bacteria 1150
623 Ga0496120_0133123 3300048923 Bacteria 1271
624 Ga0496121_0002830 3300048924 Bacteria 25630
625 Ga0496121_0025670 3300048924 Bacteria 5583
626 Ga0496121_0027094 3300048924 Bacteria 5373
627 Ga0496121_0085899 3300048924 Bacteria 2474
628 Ga0496121_0168730 3300048924 Bacteria 1592
629 Ga0496121_0235102 3300048924 Bacteria 1281
630 Ga0496121_0238341 3300048924 Bacteria 1269
631 Ga0496121_0289078 3300048924 Bacteria 1118
632 Ga0496121_0418563 3300048924 Bacteria 872
633 Ga0496121_0433577 3300048924 Bacteria 852
634 Ga0496122_0011516 3300048925 Bacteria 8946
635 Ga0496122_0033725 3300048925 Bacteria 4204
636 Ga0496122_0228024 3300048925 Bacteria 1062
637 Ga0496123_0000314 3300048926 Bacteria 92927
638 Ga0496123_0038366 3300048926 Bacteria 3368
639 Ga0496123_0091378 3300048926 Bacteria 1805
640 Ga0496124_0272098 3300048927 Bacteria 1240
641 Ga0496124_0290361 3300048927 Bacteria 1187
642 Ga0496124_0386655 3300048927 Bacteria 976
643 Ga0496125_0002440 3300048928 Bacteria 24147
644 Ga0496125_0051382 3300048928 Bacteria 3400
645 Ga0496125_0171134 3300048928 Bacteria 1460
646 Ga0496126_0012386 3300048929 Bacteria 8743
647 Ga0496126_0031229 3300048929 Bacteria 5036
648 Ga0496126_0034574 3300048929 Bacteria 4746
649 Ga0496126_0189625 3300048929 Bacteria 1742
650 Ga0496126_0209436 3300048929 Bacteria 1642
651 Ga0496126_0367270 3300048929 Bacteria 1174
652 Ga0496126_0375518 3300048929 Bacteria 1158
653 Ga0496126_0550610 3300048929 Bacteria 915
654 Ga0496126_0625567 3300048929 Bacteria 845
655 Ga0495678_000020 3300049459 Bacteria 253654
656 Ga0501031_0061738 3300049568 Bacteria 2442
657 Ga0501033_0466496 3300049570 Bacteria 876
658 Ga0501047_0017499 3300049581 Bacteria 6865
659 Ga0501048_0001083 3300049582 Bacteria 20423
660 Ga0501067_0104958 3300049583 Bacteria 1570
661 Ga0501070_0433096 3300049586 Bacteria 1061
662 Ga0501080_0008470 3300049742 Bacteria 9318
663 Ga0501035_0171787 3300049822 Bacteria 1872
664 Ga0501044_0031380 3300049823 Bacteria 5593
665 Ga0501044_0581210 3300049823 Bacteria 1015
666 nmdc:mga03683_24199_c1 3300050489 Bacteria 2374
667 nmdc:mga03683_246495_c1 3300050489 Bacteria 829
668 nmdc:mga03683_26419_c1 3300050489 Bacteria 2290
669 nmdc:mga03683_36720_c1 3300050489 Bacteria 1994
670 nmdc:mga03n38_12752_c1 3300050490 Bacteria 3172
671 nmdc:mga03n38_144255_c1 3300050490 Bacteria 1192
672 nmdc:mga03n38_34390_c1 3300050490 Bacteria 2164
673 nmdc:mga03n38_72711_c1 3300050490 Bacteria 1595
674 nmdc:mga00v17_153444_c1 3300050491 Bacteria 1480
675 nmdc:mga00v17_43195_c1 3300050491 Bacteria 2713
676 nmdc:mga00v17_65780_c1 3300050491 Bacteria 2237
677 nmdc:mga00v17_84082_c1 3300050491 Bacteria 1991
678 nmdc:mga0yw44_197834_c1 3300050492 Bacteria 1327
679 nmdc:mga0yw44_201313_c1 3300050492 Bacteria 1315
680 nmdc:mga0k408_125833_c1 3300050493 Bacteria 1520
681 nmdc:mga0k408_184951_c1 3300050493 Bacteria 1243
682 nmdc:mga0k408_218754_c1 3300050493 Bacteria 1137
683 nmdc:mga0k408_233813_c1 3300050493 Bacteria 1097
684 nmdc:mga0k408_667_c1 3300050493 Bacteria 18809
685 nmdc:mga0k408_73324_c1 3300050493 Bacteria 1999
686 nmdc:mga06z11_33139_c1 3300050494 Bacteria 2525
687 nmdc:mga06z11_45724_c1 3300050494 Bacteria 2215
688 nmdc:mga06z11_91252_c1 3300050494 Bacteria 1654
689 nmdc:mga06z11_91278_c1 3300050494 Bacteria 1654
690 nmdc:mga07m45_64277_c1 3300050496 Bacteria 2082
691 nmdc:mga05p37_24646_c1 3300050507 Bacteria 7312
692 nmdc:mga08y16_684570_c1 3300050511 Bacteria 1027
693 nmdc:mga0n895_332819_c1 3300050512 Bacteria 1538
694 nmdc:mga0rr50_19965_c1 3300050513 Bacteria 4538
695 nmdc:mga08x19_191018_c1 3300050514 Bacteria 1401
696 nmdc:mga08x19_273905_c1 3300050514 Bacteria 1168
697 nmdc:mga0a205_288615_c1 3300050515 Bacteria 1515
698 nmdc:mga0sz30_121528_c1 3300050516 Bacteria 1148
699 nmdc:mga0sz30_178204_c1 3300050516 Bacteria 943
700 nmdc:mga0sz30_30521_c1 3300050516 Bacteria 2226
701 Ga0495655_0038438 3300053083 Bacteria 1208
702 Ga0495655_0049109 3300053083 Bacteria 1110
703 Ga0500643_001635 3300053087 Bacteria 12518
704 Ga0500644_0003163 3300053088 Bacteria 4079
705 Ga0500644_0094479 3300053088 Bacteria 1125
706 Ga0500581_020365 3300053089 Bacteria 3348
707 Ga0500646_0027161 3300053090 Bacteria 1556
708 Ga0500647_0141254 3300053091 Bacteria 1129
709 Ga0500583_0064544 3300053092 Bacteria 1736
710 Ga0500651_0115319 3300053093 Bacteria 1636
711 Ga0500651_0165488 3300053093 Bacteria 1320
712 Ga0500566_0041846 3300053094 Bacteria 2645
713 Ga0500566_0067562 3300053094 Bacteria 2012
714 Ga0500566_0188741 3300053094 Bacteria 1051
715 Ga0500640_048736 3300053095 Bacteria 1856
716 Ga0500641_0036253 3300053096 Bacteria 1972
717 Ga0500650_0001279 3300053098 Bacteria 7435
718 Ga0500650_0055751 3300053098 Bacteria 1841
719 Ga0500556_0000015 3300053104 Bacteria 202598
720 Ga0500557_000822 3300053105 Bacteria 4511
721 Ga0500569_003618 3300053109 Bacteria 3178
722 Ga0500592_020250 3300053116 Bacteria 1071
723 Ga0500593_035827 3300053117 Bacteria 2220
724 Ga0500594_0150818 3300053118 Bacteria 747
725 Ga0500595_000002 3300053119 Bacteria 1074388
726 Ga0500607_051290 3300053121 Bacteria 2194
727 Ga0500608_001202 3300053122 Bacteria 9261
728 Ga0500614_022890 3300053123 Bacteria 1463
729 Ga0500618_044278 3300053125 Bacteria 1016
730 Ga0500642_0000044 3300053130 Bacteria 82877
731 Ga0500652_000638 3300053131 Bacteria 11977
732 Ga0500568_0000661 3300053139 Bacteria 24893
733 Ga0500586_003197 3300053145 Bacteria 3839
734 Ga0500603_007887 3300053150 Bacteria 2345
735 Ga0500604_0005252 3300053151 Bacteria 3424
736 Ga0500616_0000001 3300053153 Bacteria 1986011
737 Ga0500616_0000041 3300053153 Bacteria 359328
738 Ga0500622_0000700 3300053156 Bacteria 29484
739 Ga0500627_0184689 3300053158 Bacteria 937
740 Ga0500630_056839 3300053159 Bacteria 1878
741 Ga0500634_0177705 3300053161 Bacteria 962
742 Ga0500639_004098 3300053163 Bacteria 7401
743 Ga0500636_0009242 3300053177 Bacteria 5729
744 Ga0500636_0015565 3300053177 Bacteria 4483
745 Ga0500625_096922 3300053729 Bacteria 1246
746 Ga0500645_010186 3300053730 Bacteria 3123
747 Ga0501082_0346876 3300060353 Bacteria 1294
748 2501407527 2501025504 Bacteria 8008976
749 2511097395 2510917014 Bacteria 8296963
750 2511105650 2510917015 Bacteria 7950052
751 2511244051 2511231002 Bacteria 5042903
752 2512346550 2512047030 Bacteria 9031815
753 2513639593 2513237094 Bacteria 8789602
754 2513647921 2513237095 Bacteria 8976980
755 2513653728 2513237096 Bacteria 8722461
756 2513693661 2513237101 Bacteria 7952346
757 2513856168 2513237137 Bacteria 9558895
758 2513918068 2513237145 Bacteria 8979722
759 2517891692 2517572143 Bacteria 9484767
760 2524437231 2524023205 Bacteria 8918781
761 2524536687 2524023228 Bacteria 10118060
762 2528851632 2528768022 Bacteria 10457665
763 2587757677 2585428062 Bacteria 6842168
764 2599621349 2599185214 Bacteria 8209958
765 2599670967 2599185226 Bacteria 8233575
766 2599679457 2599185227 Bacteria 8246414
767 2599690860 2599185229 Bacteria 8216126
768 2603860763 2602042107 Bacteria 6226103
769 2644465584 2643221683 Bacteria 5749203
770 2671118538 2667528175 Bacteria 7532676
771 2723843567 2721755755 Bacteria 8322773
772 2728754845 2728368998 Bacteria 8720350
773 2739249202 2738543013 Bacteria 5618633
774 2745076449 2744054633 Bacteria 8678936
775 2793063071 2791355196 Bacteria 7323613
776 2793067066 2791355197 Bacteria 8420563
777 2793082894
778 2818237321 2816332527 Bacteria 8933356
779 2819597529 2818991446 Bacteria 7757362
780 2824664773 2824661429 Bacteria 9877870
781 2838057947 2838054893 Bacteria 7451788
782 2844321865 2844315083 Bacteria 8138177
783 2847931428 2847930680 Bacteria 9342022
784 2857511611 2857509624 Bacteria 7472071
785 2857524798 2857524615 Bacteria 6615449
786 2858953914 2858950400 Bacteria 6783797
787 2874611524 2874604998 Bacteria 7834745
788 2876769002 2876761206 Bacteria 10111113
789 2876816595 2876808645 Bacteria 8824342
790 2879087536 2879083081 Bacteria 8587928
791 2879114969 2879110137 Bacteria 8907982
792 2885200197 2885198086 Bacteria 7212419
793 2885213849 2885211737 Bacteria 7212420
794 2885381022 2885374607 Bacteria 8927485
795 2885418350 2885409591 Bacteria 9235467
796 2887379161 2887375801 Bacteria 5334027
797 2888379922 2888378607 Bacteria 9652610
798 2893069312 2893066018 Bacteria 6158120
799 2903727585 2903727486 Bacteria 8281579
800 2903755400 2903748898 Bacteria 9972761
801 2903768500 2903768456 Bacteria 9749579
802 2904451478 2904449895 Bacteria 6927402
803 2904543122 2904541872 Bacteria 8915136
804 2904698497 2904690495 Bacteria 9412302
805 2904704550
806 2906602925 2906602504 Bacteria 8295279
807 2906616867
808 2906642906 2906635258 Bacteria 8601019
809 2906649058 2906643746 Bacteria 8722424
810 2906667196 2906660503 Bacteria 8595048
811 2908742054 2908739725 Bacteria 8628932
812 2908762491 2908756301 Bacteria 8864324
813 2919078684 2919073203 Bacteria 6531949
814 2922361823 2922361189 Bacteria 7436256
815 2922378304
816 2922386939 2922386360 Bacteria 7017218
817 2922431060
818 2928040616 2928037797 Bacteria 7273642
819 2928046635 2928044640 Bacteria 7271509
820 2928058181 2928051484 Bacteria 7773759
821 2928067482 2928064002 Bacteria 7419480
822 2928072009 2928070936 Bacteria 8062541
823 2929160355 2929160207 Bacteria 9075316
824 2932786390 2932784394 Bacteria 9704911
825 2932794645 2932794094 Bacteria 7915132
826 2932829628 2932828146 Bacteria 9745859
827 2935618146 2935616580 Bacteria 9032984
828 2935636944 2935630451 Bacteria 8169952
829 2935641456 2935638405 Bacteria 10015038
830 2935669486 2935665750 Bacteria 9571747
831 2935677916 2935675223 Bacteria 9928132
832 2935689635 2935684952 Bacteria 9590419
833 2935707311 2935703347 Bacteria 10242284
834 2935717155 2935713505 Bacteria 9608509
835 2935730011 2935722832 Bacteria 9608746
836 2935738570 2935732158 Bacteria 9706831
837 2935749182 2935741537 Bacteria 9707219
838 2935756989 2935750917 Bacteria 9590372
839 2935804310 2935801545 Bacteria 9301974
840 2935815394 2935810662 Bacteria 9401221
841 2935831187 2935827899 Bacteria 10038562
842 2935841796 2935837841 Bacteria 9454360
843 2935856355 2935855204 Bacteria 9035059
844 2935866313 2935864058 Bacteria 9784707
845 2935874619 2935873716 Bacteria 9632195
846 2935962322 2935959822 Bacteria 7869783
847 2935994080 2935992306 Bacteria 9802711
848 2936004909 2936002035 Bacteria 9362176
849 2936045049 2936037263 Bacteria 9446081
850 2940562903 2940556831 Bacteria 9590747
851 2941513600 2941507105 Bacteria 8166816
852 2941521544 2941515067 Bacteria 8166720
853 2941529298 2941523033 Bacteria 8169134
854 2941543869 2941538514 Bacteria 9402094
855 3005480883 3005474847 Bacteria 9259049
856 3005597659 3005594810 Bacteria 8716512
857 8006939835 8006933436 Bacteria 10410654
858 8006966933 8006964411 Bacteria 8966052
859 8006979605 8006973647 Bacteria 10679141
860 8006984743 8006984368 Bacteria 9651211
861 8006994558 8006994254 Bacteria 8309700
862 8016518575 8016511872 Bacteria 9921665
863 8017058090 8017057580 Bacteria 10023680
864 8019565735 8019555841 Bacteria 9642137
865 8019575825 8019565922 Bacteria 9639779
866 8019577643 8019576017 Bacteria 10049540
867 8019595736 8019586578 Bacteria 10212056
868 8019606024 8019597564 Bacteria 10041141
869 8019612507 8019608314 Bacteria 10042931
870 8019652834 8019648815 Bacteria 10014479
871 8056680976 8056673599 Bacteria 7871253
872 8056690662 8056689827 Bacteria 6712655
873 8056970960 8056967851 Bacteria 9038162
874 Ga0451797_1494679
875 SwRhRL3b_contig_1238020
876 JGI24750J21931_1013206
877 JGI25159J45721_1000816
878 JGI25151J46595_10002642
879 JGI25153J46596_10007303
880 JGI25153J46596_10008730
881 JGI25153J46596_10074515
882 rootH2_10236421
883 rootH1_10071046
884 rootH1_10071047
885 rootH1_10078959
886 rootH1_10112413
887 rootH1_10143955
888 JGI25160J50197_1000098
889 JGI25160J50197_1051849
890 JGI25161J50226_1000037
891 Ga0006562J51391_1088900
892 Ga0055529_1008113
893 Ga0055537_1002928
894 Ga0055536_1005074
895 Ga0055534_1011333
896 Ga0055528_1006502
897 Ga0055530_10000358
898 Ga0055540_1000184
899 Ga0055540_1002572
900 Ga0055540_1004932
901 Ga0055531_10007321
902 Ga0055543_1000497
903 Ga0065165_1003507
904 Ga0065165_1005429
905 Ga0065707_10084400
906 Ga0070658_10001105
907 Ga0070658_10802114
908 Ga0070677_10010390
909 Ga0068869_100089288
910 Ga0068869_100430277
911 Ga0070682_100004212
912 Ga0070682_100225158
913 Ga0070682_100231187
914 Ga0068868_100170776
915 Ga0070660_100272659
916 Ga0070689_100000001
917 Ga0070687_100109508
918 Ga0070661_100169704
919 Ga0070668_100047101
920 Ga0070669_100069310
921 Ga0070669_100193411
922 Ga0070669_100210499
923 Ga0070675_100039997
924 Ga0070675_100112227
925 Ga0070671_100080948
926 Ga0070674_100465225
927 Ga0070673_100144915
928 Ga0070659_100097337
929 Ga0070667_100338829
930 Ga0070709_10010218
931 Ga0070709_10023884
932 Ga0070714_100034368
933 Ga0070714_100563328
934 Ga0070713_100021922
935 Ga0070713_100029770
936 Ga0070713_100734826
937 Ga0070710_10045296
938 Ga0070711_100001277
939 Ga0070711_100011775
940 Ga0070711_100033622
941 Ga0070705_100050929
942 Ga0070708_100442554
943 Ga0070663_100018048
944 Ga0070663_100663840
945 Ga0070678_100020333
946 Ga0070678_100121263
947 Ga0070662_100044005
948 Ga0070681_10039786
949 Ga0070706_100023429
950 Ga0070706_100152682
951 Ga0070706_100527355
952 Ga0070707_100003493
953 Ga0070698_100010386
954 Ga0070698_100077569
955 Ga0070699_100023882
956 Ga0070699_100051293
957 Ga0070699_100110458
958 Ga0070699_100147650
959 Ga0070684_100752475
960 Ga0070697_100023386
961 Ga0070697_100315534
962 Ga0068853_100003441
963 Ga0068853_100070176
964 Ga0068853_100113688
965 Ga0070696_100414138
966 Ga0070693_100066004
967 Ga0070693_100241966
968 Ga0070665_100053421
969 Ga0070665_100115134
970 Ga0070665_100487683
971 Ga0070665_100855314
972 Ga0070665_101047843
973 Ga0070704_100267527
974 Ga0068855_100001976
975 Ga0068855_100046285
976 Ga0068855_100124947
977 Ga0068855_100654906
978 Ga0068857_100090580
979 Ga0068857_101063229
980 Ga0068854_100175887
981 Ga0068856_100035409
982 Ga0068856_100135779
983 Ga0068856_100138137
984 Ga0068856_100398239
985 Ga0070702_100177824
986 Ga0068852_100793932
987 Ga0068859_100062750
988 Ga0068859_100530743
989 Ga0068864_100092604
990 Ga0068864_100882137
991 Ga0068864_100892161
992 Ga0068861_100073695
993 Ga0068861_100103930
994 Ga0068851_10002794
995 Ga0068863_100539031
996 Ga0068860_100006055
997 Ga0068860_100484086
998 Ga0068862_100256051
999 Ga0068862_100284097
1000 Ga0068862_100294070
1001 Ga0081455_10461714
1002 Ga0081540_1011585
1003 Ga0081540_1012130
1004 Ga0081540_1045487
1005 Ga0081539_10002350
1006 Ga0081539_10189053
1007 Ga0081539_10235049
1008 Ga0070717_10543671
1009 Ga0070717_10599018
1010 Ga0075365_10147509
1011 Ga0075365_10192285
1012 Ga0075365_10361342
1013 Ga0075363_100028797
1014 Ga0075363_100029159
1015 Ga0075363_100037949
1016 Ga0075363_100077076
1017 Ga0075364_10062210
1018 Ga0075364_10351520
1019 Ga0075364_10352054
1020 Ga0070715_10184915
1021 Ga0070716_100106728
1022 Ga0070712_100029964
1023 Ga0075362_10016617
1024 Ga0075362_10032523
1025 Ga0075362_10043582
1026 Ga0075362_10197035
1027 Ga0075367_10005456
1028 Ga0075367_10041321
1029 Ga0075367_10214687
1030 Ga0075369_10005854
1031 Ga0075369_10033816
1032 Ga0075366_10000857
1033 Ga0075366_10116389
1034 Ga0075366_10197976
1035 Ga0097621_100104347
1036 Ga0075370_10003260
1037 Ga0075370_10010598
1038 Ga0075370_10045526
1039 Ga0068871_100174028
1040 Ga0075428_100967490
1041 Ga0075434_100000932
1042 Ga0075434_100229465
1043 Ga0075434_100380898
1044 Ga0075436_100004513
1045 Ga0075436_100013837
1046 Ga0097620_100062751
1047 Ga0097620_100530740
1048 Ga0099824_1033654
1049 Ga0099822_1006869
1050 Ga0099823_1045448
1051 Ga0075435_100004811
1052 Ga0099795_10019563
1053 Ga0099795_10087927
1054 Ga0105240_10000309
1055 Ga0105240_10000565
1056 Ga0105240_10001377
1057 Ga0105240_10103703
1058 Ga0105240_10105433
1059 Ga0105240_10364986
1060 Ga0111539_10069205
1061 Ga0111539_10761647
1062 Ga0105245_10044415
1063 Ga0105245_10812281
1064 Ga0105247_10000116
1065 Ga0114129_10018519
1066 Ga0105243_10003118
1067 Ga0105243_10090809
1068 Ga0105243_10123374
1069 Ga0105243_10142382
1070 Ga0105243_10760194
1071 Ga0105241_10109588
1072 Ga0105241_10561622
1073 Ga0105241_10635768
1074 Ga0105242_10499305
1075 Ga0105248_10040984
1076 Ga0105248_10721809
1077 Ga0105237_10000197
1078 Ga0105237_10003925
1079 Ga0105237_10009767
1080 Ga0105237_10030930
1081 Ga0105237_10036637
1082 Ga0105237_10088966
1083 Ga0105237_10402494
1084 Ga0105238_10009635
1085 Ga0105238_10016742
1086 Ga0105238_10033064
1087 Ga0105238_10156872
1088 Ga0105238_10211526
1089 Ga0105249_10108438
1090 Ga0105249_10752576
1091 Ga0105147_104762
1092 Ga0099796_10012085
1093 Ga0105239_10002899
1094 Ga0105239_10040562
1095 Ga0105239_10064526
1096 Ga0105239_10064829
1097 Ga0105239_10121243
1098 Ga0105239_10152944
1099 Ga0105239_10173240
1100 Ga0105239_10607262
1101 Ga0157347_1005055
1102 Ga0157373_10000027
1103 Ga0157373_10065586
1104 Ga0157371_10041430
1105 Ga0157370_10012712
1106 Ga0157378_10071250
1107 Ga0157378_10132490
1108 Ga0157378_10598963
1109 Ga0157378_10918147
1110 Ga0163162_10388975
1111 Ga0157375_10912797
1112 Ga0157380_10542872
1113 Ga0157376_10945855
1114 Ga0182006_1039094
1115 Ga0163161_10000446
1116 Ga0163161_10028289
1117 Ga0163161_10275315
1118 Ga0213876_10110878
1119 Ga0213875_10085621
1120 Ga0209436_105359
1121 Ga0207425_1002709
1122 Ga0209677_102734
1123 Ga0209148_1000334
1124 Ga0209129_1004239
1125 Ga0209233_1001804
1126 Ga0209233_1008944
1127 Ga0209565_1001371
1128 Ga0209455_1004147
1129 Ga0209673_1002874
1130 Ga0209130_1000141
1131 Ga0209675_1005201
1132 Ga0209676_1000432
1133 Ga0209676_1001071
1134 Ga0209025_1000294
1135 Ga0209025_1004609
1136 Ga0209564_1024100
1137 Ga0209564_1030148
1138 Ga0209758_1000249
1139 Ga0209758_1001476
1140 Ga0209758_1004383
1141 Ga0209758_1011353
1142 Ga0209050_1000015
1143 Ga0209050_1004667
1144 Ga0209256_1042224
1145 Ga0207426_1000145
1146 Ga0207426_1000942
1147 Ga0209051_1000081
1148 Ga0209051_1000622
1149 Ga0209257_1003557
1150 Ga0209257_1008029
1151 Ga0209257_1024427
1152 Ga0207656_10002219
1153 Ga0207656_10134803
1154 Ga0207682_10013101
1155 Ga0207692_10057994
1156 Ga0207710_10000418
1157 Ga0207688_10163985
1158 Ga0207685_10119631
1159 Ga0207699_10022976
1160 Ga0207699_10038622
1161 Ga0207699_10267994
1162 Ga0207645_10190666
1163 Ga0207705_10076636
1164 Ga0207705_10572300
1165 Ga0207684_10028736
1166 Ga0207684_10089458
1167 Ga0207684_10177822
1168 Ga0207695_10000062
1169 Ga0207695_10000635
1170 Ga0207695_10013961
1171 Ga0207695_10028199
1172 Ga0207695_10400196
1173 Ga0207671_10000092
1174 Ga0207671_10001542
1175 Ga0207671_10009825
1176 Ga0207671_10038038
1177 Ga0207693_10019913
1178 Ga0207693_10043663
1179 Ga0207663_10015201
1180 Ga0207657_10256747
1181 Ga0207652_10032949
1182 Ga0207646_10002497
1183 Ga0207681_10072121
1184 Ga0207681_10076479
1185 Ga0207694_10017263
1186 Ga0207694_10017771
1187 Ga0207694_10084911
1188 Ga0207650_10774650
1189 Ga0207659_10128879
1190 Ga0207687_10496494
1191 Ga0207687_10508832
1192 Ga0207700_10014831
1193 Ga0207700_10017552
1194 Ga0207700_10154742
1195 Ga0207700_10256390
1196 Ga0207664_10058493
1197 Ga0207664_10449439
1198 Ga0207690_10051486
1199 Ga0207706_10057225
1200 Ga0207706_10508681
1201 Ga0207709_10000234
1202 Ga0207709_10359196
1203 Ga0207670_10000002
1204 Ga0207665_10133713
1205 Ga0207691_10001208
1206 Ga0207691_10169528
1207 Ga0207691_10229063
1208 Ga0207711_10045791
1209 Ga0207711_10077163
1210 Ga0207689_10057386
1211 Ga0207679_10668827
1212 Ga0207667_10001145
1213 Ga0207667_10032537
1214 Ga0207667_10151895
1215 Ga0207667_10368925
1216 Ga0207651_10097753
1217 Ga0207712_10171241
1218 Ga0207668_10041674
1219 Ga0207668_10099407
1220 Ga0207668_10452090
1221 Ga0207668_10650335
1222 Ga0207640_10441851
1223 Ga0207677_10178141
1224 Ga0207677_10225718
1225 Ga0207677_10282668
1226 Ga0207639_10023520
1227 Ga0207639_10121594
1228 Ga0207639_10320293
1229 Ga0207639_10325153
1230 Ga0207678_10029063
1231 Ga0207678_10097478
1232 Ga0207678_10136110
1233 Ga0207678_10467319
1234 Ga0207702_10120251
1235 Ga0207702_10174470
1236 Ga0207702_10260285
1237 Ga0207702_10548536
1238 Ga0207641_10843073
1239 Ga0207676_10442556
1240 Ga0207674_10067179
1241 Ga0207674_10401043
1242 Ga0207683_10488150
1243 Ga0207683_10556851
1244 Ga0209389_1000064
1245 Ga0209371_1033240
1246 Ga0209589_1000001
1247 Ga0209489_100001
1248 Ga0209489_104185
1249 Ga0209700_100001
1250 Ga0209700_100014
1251 Ga0209179_1082758
1252 Ga0207428_10078804
1253 Ga0268266_10002834
1254 Ga0268266_10065384
1255 Ga0268266_10457369
1256 Ga0268265_10028815
1257 Ga0268265_10676695
1258 Ga0268264_10000427
1259 Ga0265337_1008184
1260 Ga0265319_1036810
1261 Ga0307515_10000109
1262 Ga0268256_1044003
1263 Ga0307512_10097214
1264 Ga0307512_10228006
1265 Ga0265330_10052677
1266 Ga0265332_10072186
1267 Ga0265320_10018243
1268 Ga0265340_10026474
1269 Ga0265316_10132291
1270 Ga0265316_10155884
1271 Ga0307513_10000015
1272 Ga0307513_10020111
1273 Ga0307513_10045412
1274 Ga0307513_10055215
1275 Ga0307513_10098953
1276 Ga0307513_10128857
1277 Ga0307513_10148613
1278 Ga0307509_10491567
1279 Ga0307509_10521620
1280 Ga0307408_100042038
1281 Ga0307408_100214957
1282 Ga0307408_100879520
1283 Ga0265313_10076856
1284 Ga0265313_10121681
1285 Ga0307508_10000246
1286 Ga0307508_10006278
1287 Ga0307508_10009734
1288 Ga0307508_10018036
1289 Ga0307508_10143179
1290 Ga0307514_10020362
1291 Ga0265342_10088475
1292 Ga0307516_10006708
1293 Ga0307516_10123935
1294 Ga0307405_10077124
1295 Ga0307405_10092740
1296 Ga0307413_10154788
1297 Ga0307413_10538529
1298 Ga0307409_100383772
1299 Ga0307416_100023421
1300 Ga0307416_100873102
1301 Ga0307414_10612364
1302 Ga0307411_10453620
1303 Ga0307411_10462305
1304 Ga0307507_10043771
1305 Ga0307507_10236786
1306 Ga0307510_10007100
1307 Ga0307510_10020152
1308 Ga0307510_10059830
1309 Ga0307510_10217439
1310 Ga0315911_1000002
1311 Ga0316588_1049097
1312 Ga0373934_0051717
1313 Ga0373944_0028431
1314 Ga0373923_0049895
1315 Ga0373943_0022548
1316 Ga0373924_0089893
1317 Ga0373933_0000164
1318 Ga0373937_0261117
1319 Ga0373925_0038084
1320 Ga0395898_0237261
1321 Ga0395905_0015214
1322 Ga0436364_0166031
1323 Ga0436364_0176246
1324 Ga0395901_0320216
1325 Ga0400490_59588
1326 Ga0400483_037459
1327 Ga0400483_079217
1328 Ga0400483_092352
1329 Ga0400483_222230
1330 Ga0400483_222800
1331 Ga0436365_0022917
1332 Ga0436365_0694465
1333 Ga0439436_0001353
1334 Ga0439438_024843
1335 Ga0439439_0002684
1336 Ga0439461_0023308
1337 Ga0451789_0190617
1338 Ga0451797_0912266
1339 Ga0451807_0885740
1340 Ga0451807_2272697
1341 Ga0439433_0022342
1342 Ga0439432_004573
1343 Ga0439449_0004052
1344 Ga0439452_001303
1345 Ga0439457_014966
1346 Ga0450897_003577
1347 Ga0450896_025860
1348 Ga0450910_003635
1349 Ga0450909_016170
1350 Ga0451577_0017106
1351 Ga0451577_0024143
1352 Ga0466969_0152366
1353 Ga0453683_0163556
1354 Ga0466965_0206433
1355 Ga0466961_0353826
1356 Ga0466963_0145419
1357 Ga0466964_0225110
1358 Ga0453684_0138384
1359 Ga0466957_0164597
1360 Ga0451576_0130666
1361 Ga0466967_0822628
1362 Ga0495617_114028
1363 Ga0495627_021305
1364 Ga0495592_0022519
1365 Ga0495603_0047679
1366 Ga0495590_0049205
1367 Ga0495591_000353
1368 Ga0495591_004510
1369 Ga0495638_0018358
1370 Ga0495638_0094282
1371 Ga0495638_0240898
1372 Ga0495641_0067953
1373 Ga0495580_0056114
1374 Ga0495582_0086227
1375 Ga0495582_0235766
1376 Ga0495605_0000436
1377 Ga0495605_0001028
1378 Ga0495639_0118631
1379 Ga0495664_0003029
1380 Ga0495584_0216591
1381 Ga0495585_0119051
1382 Ga0495594_0005421
1383 Ga0495594_0186964
1384 Ga0495594_0232494
1385 Ga0495607_0009324
1386 Ga0495607_0075075
1387 Ga0495583_0000028
1388 Ga0495606_0127987
1389 Ga0495606_0198783
1390 Ga0495606_0275738
1391 Ga0495610_0017908
1392 Ga0495610_0090366
1393 Ga0495616_0198743
1394 Ga0495616_0202819
1395 Ga0495618_0035740
1396 Ga0495620_0000028
1397 Ga0495620_0046712
1398 Ga0495620_0111270
1399 Ga0495628_0088858
1400 Ga0495630_0081340
1401 Ga0495631_0019696
1402 Ga0495631_0143208
1403 Ga0495631_0176428
1404 Ga0495632_0075399
1405 Ga0495637_0058026
1406 Ga0495637_0087414
1407 Ga0495643_0000057
1408 Ga0495643_0007531
1409 Ga0495643_0148394
1410 Ga0495644_0134473
1411 Ga0495648_0018358
1412 Ga0495648_0105183
1413 Ga0495648_0229435
1414 Ga0495652_0121872
1415 Ga0495652_0203451
1416 Ga0495654_0001115
1417 Ga0495654_0066737
1418 Ga0495654_0073586
1419 Ga0495654_0152662
1420 Ga0495665_0097196
1421 Ga0495640_0083808
1422 Ga0495586_0163432
1423 Ga0495598_0089915
1424 Ga0495609_0000081
1425 Ga0495621_0132401
1426 Ga0495597_0000037
1427 Ga0495597_0026112
1428 Ga0495622_0086965
1429 Ga0495622_0167545
1430 Ga0495633_0000028
1431 Ga0495656_0141514
1432 Ga0495668_0074227
1433 Ga0495668_0265863
1434 Ga0495668_0317735
1435 Ga0495611_0008756
1436 Ga0495611_0111947
1437 Ga0495625_0130041
1438 Ga0495625_0178502
1439 Ga0495661_0000217
1440 Ga0495661_0010263
1441 Ga0495661_0142128
1442 Ga0495588_0259671
1443 Ga0495588_0279796
1444 Ga0495647_0021985
1445 Ga0495624_0108077
1446 Ga0495670_0001463
1447 Ga0495671_0006278
1448 Ga0495671_0033794
1449 Ga0495671_0276521
1450 Ga0495649_0316663
1451 Ga0495589_0010125
1452 Ga0495660_0000568
1453 Ga0495660_0003536
1454 Ga0495660_0015689
1455 Ga0495660_0203201
1456 Ga0495604_0172449
1457 Ga0495674_0037149
1458 Ga0495672_0072361
1459 Ga0495672_0101109
1460 Ga0495672_0244747
1461 Ga0495683_0000060
1462 Ga0495683_0112253
1463 Ga0495683_0222511
1464 Ga0495687_049654
1465 Ga0495679_000823
1466 Ga0495681_0024953
1467 Ga0495686_0095860
1468 Ga0495686_0327534
1469 Ga0495602_0225582
1470 Ga0496102_0190387
1471 Ga0496103_0010374
1472 Ga0496104_0201716
1473 Ga0496106_0000002
1474 Ga0496106_0258759
1475 Ga0496107_0028046
1476 Ga0496108_0198145
1477 Ga0496109_0283565
1478 Ga0496110_0303802
1479 Ga0496111_0063380
1480 Ga0496112_0019936
1481 Ga0496112_0436698
1482 Ga0496113_0270307
1483 Ga0496114_0377032
1484 Ga0496116_0042778
1485 Ga0496116_0066692
1486 Ga0496117_0080858
1487 Ga0496117_0090460
1488 Ga0496117_0291583
1489 Ga0496117_0320977
1490 Ga0496118_0074574
1491 Ga0496118_0075118
1492 Ga0496118_0164712
1493 Ga0496118_0299639
1494 Ga0496118_0331017
1495 Ga0496119_0170381
1496 Ga0496120_0133123
1497 Ga0496121_0002830
1498 Ga0496121_0025670
1499 Ga0496121_0027094
1500 Ga0496121_0085899
1501 Ga0496121_0168730
1502 Ga0496121_0235102
1503 Ga0496121_0238341
1504 Ga0496121_0289078
1505 Ga0496121_0418563
1506 Ga0496121_0433577
1507 Ga0496122_0011516
1508 Ga0496122_0033725
1509 Ga0496122_0228024
1510 Ga0496123_0000314
1511 Ga0496123_0038366
1512 Ga0496123_0091378
1513 Ga0496124_0272098
1514 Ga0496124_0290361
1515 Ga0496124_0386655
1516 Ga0496125_0002440
1517 Ga0496125_0051382
1518 Ga0496125_0171134
1519 Ga0496126_0012386
1520 Ga0496126_0031229
1521 Ga0496126_0034574
1522 Ga0496126_0189625
1523 Ga0496126_0209436
1524 Ga0496126_0367270
1525 Ga0496126_0375518
1526 Ga0496126_0550610
1527 Ga0496126_0625567
1528 Ga0495678_000020
1529 Ga0501031_0061738
1530 Ga0501033_0466496
1531 Ga0501047_0017499
1532 Ga0501048_0001083
1533 Ga0501067_0104958
1534 Ga0501070_0433096
1535 Ga0501080_0008470
1536 Ga0501035_0171787
1537 Ga0501044_0031380
1538 Ga0501044_0581210
1539 nmdc:mga03683_24199_c1
1540 nmdc:mga03683_246495_c1
1541 nmdc:mga03683_26419_c1
1542 nmdc:mga03683_36720_c1
1543 nmdc:mga03n38_12752_c1
1544 nmdc:mga03n38_144255_c1
1545 nmdc:mga03n38_34390_c1
1546 nmdc:mga03n38_72711_c1
1547 nmdc:mga00v17_153444_c1
1548 nmdc:mga00v17_43195_c1
1549 nmdc:mga00v17_65780_c1
1550 nmdc:mga00v17_84082_c1
1551 nmdc:mga0yw44_197834_c1
1552 nmdc:mga0yw44_201313_c1
1553 nmdc:mga0k408_125833_c1
1554 nmdc:mga0k408_184951_c1
1555 nmdc:mga0k408_218754_c1
1556 nmdc:mga0k408_233813_c1
1557 nmdc:mga0k408_667_c1
1558 nmdc:mga0k408_73324_c1
1559 nmdc:mga06z11_33139_c1
1560 nmdc:mga06z11_45724_c1
1561 nmdc:mga06z11_91252_c1
1562 nmdc:mga06z11_91278_c1
1563 nmdc:mga07m45_64277_c1
1564 nmdc:mga05p37_24646_c1
1565 nmdc:mga08y16_684570_c1
1566 nmdc:mga0n895_332819_c1
1567 nmdc:mga0rr50_19965_c1
1568 nmdc:mga08x19_191018_c1
1569 nmdc:mga08x19_273905_c1
1570 nmdc:mga0a205_288615_c1
1571 nmdc:mga0sz30_121528_c1
1572 nmdc:mga0sz30_178204_c1
1573 nmdc:mga0sz30_30521_c1
1574 Ga0495655_0038438
1575 Ga0495655_0049109
1576 Ga0500643_001635
1577 Ga0500644_0003163
1578 Ga0500644_0094479
1579 Ga0500581_020365
1580 Ga0500646_0027161
1581 Ga0500647_0141254
1582 Ga0500583_0064544
1583 Ga0500651_0115319
1584 Ga0500651_0165488
1585 Ga0500566_0041846
1586 Ga0500566_0067562
1587 Ga0500566_0188741
1588 Ga0500640_048736
1589 Ga0500641_0036253
1590 Ga0500650_0001279
1591 Ga0500650_0055751
1592 Ga0500556_0000015
1593 Ga0500557_000822
1594 Ga0500569_003618
1595 Ga0500592_020250
1596 Ga0500593_035827
1597 Ga0500594_0150818
1598 Ga0500595_000002
1599 Ga0500607_051290
1600 Ga0500608_001202
1601 Ga0500614_022890
1602 Ga0500618_044278
1603 Ga0500642_0000044
1604 Ga0500652_000638
1605 Ga0500568_0000661
1606 Ga0500586_003197
1607 Ga0500603_007887
1608 Ga0500604_0005252
1609 Ga0500616_0000001
1610 Ga0500616_0000041
1611 Ga0500622_0000700
1612 Ga0500627_0184689
1613 Ga0500630_056839
1614 Ga0500634_0177705
1615 Ga0500639_004098
1616 Ga0500636_0009242
1617 Ga0500636_0015565
1618 Ga0500625_096922
1619 Ga0500645_010186
1620 Ga0501082_0346876
1621 2501407527
1622 2511097395
1623 2511105650
1624 2511244051
1625 2512346550
1626 2513639593
1627 2513647921
1628 2513653728
1629 2513693661
1630 2513856168
1631 2513918068
1632 2517891692
1633 2524437231
1634 2524536687
1635 2528851632
1636 2587757677
1637 2599621349
1638 2599670967
1639 2599679457
1640 2599690860
1641 2603860763
1642 2644465584
1643 2671118538
1644 2723843567
1645 2728754845
1646 2739249202
1647 2745076449
1648 2793063071
1649 2793067066
1650 2793082894
1651 2818237321
1652 2819597529
1653 2824664773
1654 2838057947
1655 2844321865
1656 2847931428
1657 2857511611
1658 2857524798
1659 2858953914
1660 2874611524
1661 2876769002
1662 2876816595
1663 2879087536
1664 2879114969
1665 2885200197
1666 2885213849
1667 2885381022
1668 2885418350
1669 2887379161
1670 2888379922
1671 2893069312
1672 2903727585
1673 2903755400
1674 2903768500
1675 2904451478
1676 2904543122
1677 2904698497
1678 2904704550
1679 2906602925
1680 2906616867
1681 2906642906
1682 2906649058
1683 2906667196
1684 2908742054
1685 2908762491
1686 2919078684
1687 2922361823
1688 2922378304
1689 2922386939
1690 2922431060
1691 2928040616
1692 2928046635
1693 2928058181
1694 2928067482
1695 2928072009
1696 2929160355
1697 2932786390
1698 2932794645
1699 2932829628
1700 2935618146
1701 2935636944
1702 2935641456
1703 2935669486
1704 2935677916
1705 2935689635
1706 2935707311
1707 2935717155
1708 2935730011
1709 2935738570
1710 2935749182
1711 2935756989
1712 2935804310
1713 2935815394
1714 2935831187
1715 2935841796
1716 2935856355
1717 2935866313
1718 2935874619
1719 2935962322
1720 2935994080
1721 2936004909
1722 2936045049
1723 2940562903
1724 2941513600
1725 2941521544
1726 2941529298
1727 2941543869
1728 3005480883
1729 3005597659
1730 8006939835
1731 8006966933
1732 8006979605
1733 8006984743
1734 8006994558
1735 8016518575
1736 8017058090
1737 8019565735
1738 8019575825
1739 8019577643
1740 8019595736
1741 8019606024
1742 8019612507
1743 8019652834
1744 8056680976
1745 8056690662
1746 8056970960

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

159

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9336 2 229
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9258 2 229
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9209 2 216
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9097 2 215
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9096 2 216
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9394 1 228 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 2 227 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9315 1 228 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9312 2 215 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9205 2 213 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W5IBP4-F1-model_v4 deleted 0.9709 1 228
AF-A0A269XWW6-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 0.9702 2 229 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A382XKN7-F1-model_v4 ABC transporter domain-containing protein 0.963 4 211 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A7W5IBP4-F1-model_v4 deleted 0.9626 1 228
AF-A0A269XWW6-F1-model_v4 Urea ABC transporter ATP-binding subunit UrtE 0.9618 2 229 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map