F484262
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 873 | 549 | 1746 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300041453|Ga0451797_1494679|Ga0451797_1494679_21_812 |
| Length | 263 |
| Sequence | MLEIKDLRVSYGQSEVIHGVNLSTERGRIVSVMGRNGMGKTTLFKAVMGVLPSKAGSIVVDGKDVTRLPSYERVRSGLAYVPQGRMIFPTLTVWENLLTGLEGSKTKRLPDDIFTLFPILKDMRSRRGGNLSGGQQQQLAIARALAADPKVLLLDEPTEGLQPSIIKDIAQVLLKIRDSRNLTILVSEQVLSFTLQITDRMLVIEGGRFTADEPPPDSTPASAWPPMTAMLPICLENGSSFRSLRSNTAPASAACRAINPSAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 97 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 98 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 208 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 221 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 232 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 243 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 246 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 249 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 250 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 251 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 252 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 255 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 256 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 257 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 258 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 259 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 260 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 261 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 262 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 351 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 357 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 376 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 389 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 390 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 391 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 392 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 393 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 397 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 399 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 400 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 404 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 405 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 406 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 407 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 409 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 410 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 411 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 412 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 415 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 416 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 420 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 422 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 425 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 426 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 427 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 428 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 429 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 430 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 431 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 432 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 433 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 434 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 435 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 436 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 437 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 438 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 439 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 440 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 441 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 442 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 443 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 444 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 445 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 446 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 447 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 448 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 449 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 450 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 451 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 452 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 453 | 2791355199 | |||
| 454 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 455 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 456 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 457 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 458 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 459 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 460 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 461 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 462 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 463 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 464 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 465 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 466 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 467 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 468 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 469 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 470 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 471 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 472 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 473 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 474 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 475 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 476 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 477 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 478 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 479 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 480 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 481 | 2904699407 | |||
| 482 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 483 | 2906610324 | |||
| 484 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 485 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 486 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 487 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 488 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 489 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 490 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 491 | 2922368715 | |||
| 492 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 493 | 2922425934 | |||
| 494 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 495 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 496 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 497 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 498 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 499 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 500 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 501 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 502 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 503 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 504 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 505 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 506 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 507 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 508 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 509 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 510 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 511 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 512 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 513 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 514 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 515 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 516 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 517 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 518 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 519 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 520 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 521 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 522 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 523 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 524 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 525 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 526 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 527 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 528 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 529 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 530 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 531 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 532 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 533 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 534 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 535 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 536 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 537 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 538 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 539 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 540 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 541 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 542 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 543 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 544 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 545 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 546 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 547 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 548 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 549 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.83 |
| Metatranscriptomes | 0.23 |
| Isolates | 13.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.3 |
| Nodule | 9.62 |
| Rhizoplane | 2.75 |
| Rhizosphere | 55.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451797_1494679 | 3300041453 | Bacteria | 2468 |
| 2 | SwRhRL3b_contig_1238020 | 2162886006 | Bacteria | 906 |
| 3 | JGI24750J21931_1013206 | 3300002070 | Bacteria | 1102 |
| 4 | JGI25159J45721_1000816 | 3300002987 | Bacteria | 13575 |
| 5 | JGI25151J46595_10002642 | 3300003187 | Bacteria | 10549 |
| 6 | JGI25153J46596_10007303 | 3300003215 | Bacteria | 5459 |
| 7 | JGI25153J46596_10008730 | 3300003215 | Bacteria | 4802 |
| 8 | JGI25153J46596_10074515 | 3300003215 | Bacteria | 867 |
| 9 | rootH2_10236421 | 3300003320 | Bacteria | 1568 |
| 10 | rootH1_10071046 | 3300003323 | Bacteria | 1120 |
| 11 | rootH1_10071047 | 3300003323 | Bacteria | 1099 |
| 12 | rootH1_10078959 | 3300003323 | Bacteria | 1731 |
| 13 | rootH1_10112413 | 3300003323 | Bacteria | 1838 |
| 14 | rootH1_10143955 | 3300003323 | Bacteria | 1495 |
| 15 | JGI25160J50197_1000098 | 3300003354 | Bacteria | 87307 |
| 16 | JGI25160J50197_1051849 | 3300003354 | Bacteria | 866 |
| 17 | JGI25161J50226_1000037 | 3300003374 | Bacteria | 133331 |
| 18 | Ga0006562J51391_1088900 | 3300003578 | Bacteria | 2948 |
| 19 | Ga0055529_1008113 | 3300003763 | Bacteria | 1404 |
| 20 | Ga0055537_1002928 | 3300003773 | Bacteria | 5435 |
| 21 | Ga0055536_1005074 | 3300003781 | Bacteria | 6533 |
| 22 | Ga0055534_1011333 | 3300003784 | Bacteria | 1818 |
| 23 | Ga0055528_1006502 | 3300003790 | Bacteria | 5297 |
| 24 | Ga0055530_10000358 | 3300003791 | Bacteria | 41173 |
| 25 | Ga0055540_1000184 | 3300003792 | Bacteria | 60646 |
| 26 | Ga0055540_1002572 | 3300003792 | Bacteria | 9462 |
| 27 | Ga0055540_1004932 | 3300003792 | Bacteria | 5815 |
| 28 | Ga0055531_10007321 | 3300003794 | Bacteria | 6050 |
| 29 | Ga0055543_1000497 | 3300004625 | Bacteria | 22716 |
| 30 | Ga0065165_1003507 | 3300005262 | Bacteria | 10899 |
| 31 | Ga0065165_1005429 | 3300005262 | Bacteria | 7171 |
| 32 | Ga0065707_10084400 | 3300005295 | Bacteria | 7240 |
| 33 | Ga0070658_10001105 | 3300005327 | Bacteria | 23012 |
| 34 | Ga0070658_10802114 | 3300005327 | Bacteria | 818 |
| 35 | Ga0070677_10010390 | 3300005333 | Bacteria | 3184 |
| 36 | Ga0068869_100089288 | 3300005334 | Bacteria | 2314 |
| 37 | Ga0068869_100430277 | 3300005334 | Bacteria | 1090 |
| 38 | Ga0070682_100004212 | 3300005337 | Bacteria | 7981 |
| 39 | Ga0070682_100225158 | 3300005337 | Bacteria | 1337 |
| 40 | Ga0070682_100231187 | 3300005337 | Bacteria | 1322 |
| 41 | Ga0068868_100170776 | 3300005338 | Bacteria | 1800 |
| 42 | Ga0070660_100272659 | 3300005339 | Bacteria | 1383 |
| 43 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 44 | Ga0070687_100109508 | 3300005343 | Bacteria | 1561 |
| 45 | Ga0070661_100169704 | 3300005344 | Bacteria | 1656 |
| 46 | Ga0070668_100047101 | 3300005347 | Bacteria | 3313 |
| 47 | Ga0070669_100069310 | 3300005353 | Bacteria | 2605 |
| 48 | Ga0070669_100193411 | 3300005353 | Bacteria | 1597 |
| 49 | Ga0070669_100210499 | 3300005353 | Bacteria | 1534 |
| 50 | Ga0070675_100039997 | 3300005354 | Bacteria | 3827 |
| 51 | Ga0070675_100112227 | 3300005354 | Bacteria | 2308 |
| 52 | Ga0070671_100080948 | 3300005355 | Bacteria | 2715 |
| 53 | Ga0070674_100465225 | 3300005356 | Bacteria | 1046 |
| 54 | Ga0070673_100144915 | 3300005364 | Bacteria | 2007 |
| 55 | Ga0070659_100097337 | 3300005366 | Bacteria | 2365 |
| 56 | Ga0070667_100338829 | 3300005367 | Bacteria | 1359 |
| 57 | Ga0070709_10010218 | 3300005434 | Bacteria | 5190 |
| 58 | Ga0070709_10023884 | 3300005434 | Bacteria | 3595 |
| 59 | Ga0070714_100034368 | 3300005435 | Bacteria | 4246 |
| 60 | Ga0070714_100563328 | 3300005435 | Bacteria | 1092 |
| 61 | Ga0070713_100021922 | 3300005436 | Bacteria | 4927 |
| 62 | Ga0070713_100029770 | 3300005436 | Bacteria | 4327 |
| 63 | Ga0070713_100734826 | 3300005436 | Bacteria | 944 |
| 64 | Ga0070710_10045296 | 3300005437 | Bacteria | 2445 |
| 65 | Ga0070711_100001277 | 3300005439 | Bacteria | 13671 |
| 66 | Ga0070711_100011775 | 3300005439 | Bacteria | 5441 |
| 67 | Ga0070711_100033622 | 3300005439 | Bacteria | 3415 |
| 68 | Ga0070705_100050929 | 3300005440 | Bacteria | 2412 |
| 69 | Ga0070708_100442554 | 3300005445 | Bacteria | 1226 |
| 70 | Ga0070663_100018048 | 3300005455 | Bacteria | 4617 |
| 71 | Ga0070663_100663840 | 3300005455 | Bacteria | 883 |
| 72 | Ga0070678_100020333 | 3300005456 | Bacteria | 4353 |
| 73 | Ga0070678_100121263 | 3300005456 | Bacteria | 2062 |
| 74 | Ga0070662_100044005 | 3300005457 | Bacteria | 3197 |
| 75 | Ga0070681_10039786 | 3300005458 | Bacteria | 4713 |
| 76 | Ga0070706_100023429 | 3300005467 | Bacteria | 5685 |
| 77 | Ga0070706_100152682 | 3300005467 | Bacteria | 2156 |
| 78 | Ga0070706_100527355 | 3300005467 | Bacteria | 1099 |
| 79 | Ga0070707_100003493 | 3300005468 | Bacteria | 14831 |
| 80 | Ga0070698_100010386 | 3300005471 | Bacteria | 9944 |
| 81 | Ga0070698_100077569 | 3300005471 | Bacteria | 3322 |
| 82 | Ga0070699_100023882 | 3300005518 | Bacteria | 5270 |
| 83 | Ga0070699_100051293 | 3300005518 | Bacteria | 3572 |
| 84 | Ga0070699_100110458 | 3300005518 | Bacteria | 2413 |
| 85 | Ga0070699_100147650 | 3300005518 | Bacteria | 2078 |
| 86 | Ga0070684_100752475 | 3300005535 | Bacteria | 910 |
| 87 | Ga0070697_100023386 | 3300005536 | Bacteria | 4913 |
| 88 | Ga0070697_100315534 | 3300005536 | Bacteria | 1345 |
| 89 | Ga0068853_100003441 | 3300005539 | Bacteria | 12109 |
| 90 | Ga0068853_100070176 | 3300005539 | Bacteria | 3049 |
| 91 | Ga0068853_100113688 | 3300005539 | Bacteria | 2407 |
| 92 | Ga0070696_100414138 | 3300005546 | Bacteria | 1057 |
| 93 | Ga0070693_100066004 | 3300005547 | Bacteria | 2117 |
| 94 | Ga0070693_100241966 | 3300005547 | Bacteria | 1192 |
| 95 | Ga0070665_100053421 | 3300005548 | Bacteria | 4052 |
| 96 | Ga0070665_100115134 | 3300005548 | Bacteria | 2691 |
| 97 | Ga0070665_100487683 | 3300005548 | Bacteria | 1243 |
| 98 | Ga0070665_100855314 | 3300005548 | Bacteria | 923 |
| 99 | Ga0070665_101047843 | 3300005548 | Bacteria | 827 |
| 100 | Ga0070704_100267527 | 3300005549 | Bacteria | 1411 |
| 101 | Ga0068855_100001976 | 3300005563 | Bacteria | 25473 |
| 102 | Ga0068855_100046285 | 3300005563 | Bacteria | 5143 |
| 103 | Ga0068855_100124947 | 3300005563 | Bacteria | 2942 |
| 104 | Ga0068855_100654906 | 3300005563 | Bacteria | 1127 |
| 105 | Ga0068857_100090580 | 3300005577 | Bacteria | 2737 |
| 106 | Ga0068857_101063229 | 3300005577 | Bacteria | 780 |
| 107 | Ga0068854_100175887 | 3300005578 | Bacteria | 1669 |
| 108 | Ga0068856_100035409 | 3300005614 | Bacteria | 4892 |
| 109 | Ga0068856_100135779 | 3300005614 | Bacteria | 2465 |
| 110 | Ga0068856_100138137 | 3300005614 | Bacteria | 2443 |
| 111 | Ga0068856_100398239 | 3300005614 | Bacteria | 1396 |
| 112 | Ga0070702_100177824 | 3300005615 | Bacteria | 1390 |
| 113 | Ga0068852_100793932 | 3300005616 | Bacteria | 960 |
| 114 | Ga0068859_100062750 | 3300005617 | Bacteria | 3746 |
| 115 | Ga0068859_100530743 | 3300005617 | Bacteria | 1272 |
| 116 | Ga0068864_100092604 | 3300005618 | Bacteria | 2668 |
| 117 | Ga0068864_100882137 | 3300005618 | Bacteria | 883 |
| 118 | Ga0068864_100892161 | 3300005618 | Bacteria | 878 |
| 119 | Ga0068861_100073695 | 3300005719 | Bacteria | 2653 |
| 120 | Ga0068861_100103930 | 3300005719 | Bacteria | 2265 |
| 121 | Ga0068851_10002794 | 3300005834 | Bacteria | 7692 |
| 122 | Ga0068863_100539031 | 3300005841 | Bacteria | 1151 |
| 123 | Ga0068860_100006055 | 3300005843 | Bacteria | 12173 |
| 124 | Ga0068860_100484086 | 3300005843 | Bacteria | 1234 |
| 125 | Ga0068862_100256051 | 3300005844 | Bacteria | 1596 |
| 126 | Ga0068862_100284097 | 3300005844 | Bacteria | 1517 |
| 127 | Ga0068862_100294070 | 3300005844 | Bacteria | 1492 |
| 128 | Ga0081455_10461714 | 3300005937 | Bacteria | 864 |
| 129 | Ga0081540_1011585 | 3300005983 | Bacteria | 5886 |
| 130 | Ga0081540_1012130 | 3300005983 | Bacteria | 5699 |
| 131 | Ga0081540_1045487 | 3300005983 | Bacteria | 2228 |
| 132 | Ga0081539_10002350 | 3300005985 | Bacteria | 27182 |
| 133 | Ga0081539_10189053 | 3300005985 | Bacteria | 960 |
| 134 | Ga0081539_10235049 | 3300005985 | Bacteria | 824 |
| 135 | Ga0070717_10543671 | 3300006028 | Bacteria | 1052 |
| 136 | Ga0070717_10599018 | 3300006028 | Bacteria | 1000 |
| 137 | Ga0075365_10147509 | 3300006038 | Bacteria | 1635 |
| 138 | Ga0075365_10192285 | 3300006038 | Bacteria | 1428 |
| 139 | Ga0075365_10361342 | 3300006038 | Bacteria | 1024 |
| 140 | Ga0075363_100028797 | 3300006048 | Bacteria | 2861 |
| 141 | Ga0075363_100029159 | 3300006048 | Bacteria | 2846 |
| 142 | Ga0075363_100037949 | 3300006048 | Bacteria | 2531 |
| 143 | Ga0075363_100077076 | 3300006048 | Bacteria | 1819 |
| 144 | Ga0075364_10062210 | 3300006051 | Bacteria | 2449 |
| 145 | Ga0075364_10351520 | 3300006051 | Bacteria | 1005 |
| 146 | Ga0075364_10352054 | 3300006051 | Bacteria | 1004 |
| 147 | Ga0070715_10184915 | 3300006163 | Bacteria | 1048 |
| 148 | Ga0070716_100106728 | 3300006173 | Bacteria | 1728 |
| 149 | Ga0070712_100029964 | 3300006175 | Bacteria | 3652 |
| 150 | Ga0075362_10016617 | 3300006177 | Bacteria | 3016 |
| 151 | Ga0075362_10032523 | 3300006177 | Bacteria | 2263 |
| 152 | Ga0075362_10043582 | 3300006177 | Bacteria | 1987 |
| 153 | Ga0075362_10197035 | 3300006177 | Bacteria | 980 |
| 154 | Ga0075367_10005456 | 3300006178 | Bacteria | 6317 |
| 155 | Ga0075367_10041321 | 3300006178 | Bacteria | 2695 |
| 156 | Ga0075367_10214687 | 3300006178 | Bacteria | 1203 |
| 157 | Ga0075369_10005854 | 3300006186 | Bacteria | 4621 |
| 158 | Ga0075369_10033816 | 3300006186 | Bacteria | 2168 |
| 159 | Ga0075366_10000857 | 3300006195 | Bacteria | 14672 |
| 160 | Ga0075366_10116389 | 3300006195 | Bacteria | 1610 |
| 161 | Ga0075366_10197976 | 3300006195 | Bacteria | 1221 |
| 162 | Ga0097621_100104347 | 3300006237 | Bacteria | 2389 |
| 163 | Ga0075370_10003260 | 3300006353 | Bacteria | 7689 |
| 164 | Ga0075370_10010598 | 3300006353 | Bacteria | 4827 |
| 165 | Ga0075370_10045526 | 3300006353 | Bacteria | 2481 |
| 166 | Ga0068871_100174028 | 3300006358 | Bacteria | 1847 |
| 167 | Ga0075428_100967490 | 3300006844 | Bacteria | 902 |
| 168 | Ga0075434_100000932 | 3300006871 | Bacteria | 23496 |
| 169 | Ga0075434_100229465 | 3300006871 | Bacteria | 1876 |
| 170 | Ga0075434_100380898 | 3300006871 | Bacteria | 1431 |
| 171 | Ga0075436_100004513 | 3300006914 | Bacteria | 9549 |
| 172 | Ga0075436_100013837 | 3300006914 | Bacteria | 5526 |
| 173 | Ga0097620_100062751 | 3300006931 | Bacteria | 3746 |
| 174 | Ga0097620_100530740 | 3300006931 | Bacteria | 1272 |
| 175 | Ga0099824_1033654 | 3300006942 | Bacteria | 1715 |
| 176 | Ga0099822_1006869 | 3300006943 | Bacteria | 14775 |
| 177 | Ga0099823_1045448 | 3300006944 | Bacteria | 2926 |
| 178 | Ga0075435_100004811 | 3300007076 | Bacteria | 9339 |
| 179 | Ga0099795_10019563 | 3300007788 | Bacteria | 2194 |
| 180 | Ga0099795_10087927 | 3300007788 | Bacteria | 1200 |
| 181 | Ga0105240_10000309 | 3300009093 | Bacteria | 93964 |
| 182 | Ga0105240_10000565 | 3300009093 | Bacteria | 68589 |
| 183 | Ga0105240_10001377 | 3300009093 | Bacteria | 41807 |
| 184 | Ga0105240_10103703 | 3300009093 | Bacteria | 3455 |
| 185 | Ga0105240_10105433 | 3300009093 | Bacteria | 3422 |
| 186 | Ga0105240_10364986 | 3300009093 | Bacteria | 1634 |
| 187 | Ga0111539_10069205 | 3300009094 | Bacteria | 4168 |
| 188 | Ga0111539_10761647 | 3300009094 | Bacteria | 1127 |
| 189 | Ga0105245_10044415 | 3300009098 | Bacteria | 3966 |
| 190 | Ga0105245_10812281 | 3300009098 | Bacteria | 974 |
| 191 | Ga0105247_10000116 | 3300009101 | Bacteria | 78228 |
| 192 | Ga0114129_10018519 | 3300009147 | Bacteria | 9913 |
| 193 | Ga0105243_10003118 | 3300009148 | Bacteria | 13622 |
| 194 | Ga0105243_10090809 | 3300009148 | Bacteria | 2514 |
| 195 | Ga0105243_10123374 | 3300009148 | Bacteria | 2188 |
| 196 | Ga0105243_10142382 | 3300009148 | Bacteria | 2047 |
| 197 | Ga0105243_10760194 | 3300009148 | Bacteria | 951 |
| 198 | Ga0105241_10109588 | 3300009174 | Bacteria | 2208 |
| 199 | Ga0105241_10561622 | 3300009174 | Bacteria | 1026 |
| 200 | Ga0105241_10635768 | 3300009174 | Bacteria | 968 |
| 201 | Ga0105242_10499305 | 3300009176 | Bacteria | 1157 |
| 202 | Ga0105248_10040984 | 3300009177 | Bacteria | 5192 |
| 203 | Ga0105248_10721809 | 3300009177 | Bacteria | 1125 |
| 204 | Ga0105237_10000197 | 3300009545 | Bacteria | 85308 |
| 205 | Ga0105237_10003925 | 3300009545 | Bacteria | 17419 |
| 206 | Ga0105237_10009767 | 3300009545 | Bacteria | 10263 |
| 207 | Ga0105237_10030930 | 3300009545 | Bacteria | 5430 |
| 208 | Ga0105237_10036637 | 3300009545 | Bacteria | 4964 |
| 209 | Ga0105237_10088966 | 3300009545 | Bacteria | 3077 |
| 210 | Ga0105237_10402494 | 3300009545 | Bacteria | 1373 |
| 211 | Ga0105238_10009635 | 3300009551 | Bacteria | 9664 |
| 212 | Ga0105238_10016742 | 3300009551 | Bacteria | 7430 |
| 213 | Ga0105238_10033064 | 3300009551 | Bacteria | 5262 |
| 214 | Ga0105238_10156872 | 3300009551 | Bacteria | 2251 |
| 215 | Ga0105238_10211526 | 3300009551 | Bacteria | 1915 |
| 216 | Ga0105249_10108438 | 3300009553 | Bacteria | 2621 |
| 217 | Ga0105249_10752576 | 3300009553 | Bacteria | 1037 |
| 218 | Ga0105147_104762 | 3300009982 | Bacteria | 1139 |
| 219 | Ga0099796_10012085 | 3300010159 | Bacteria | 2427 |
| 220 | Ga0105239_10002899 | 3300010375 | Bacteria | 21425 |
| 221 | Ga0105239_10040562 | 3300010375 | Bacteria | 5100 |
| 222 | Ga0105239_10064526 | 3300010375 | Bacteria | 4020 |
| 223 | Ga0105239_10064829 | 3300010375 | Bacteria | 4011 |
| 224 | Ga0105239_10121243 | 3300010375 | Bacteria | 2904 |
| 225 | Ga0105239_10152944 | 3300010375 | Bacteria | 2575 |
| 226 | Ga0105239_10173240 | 3300010375 | Bacteria | 2413 |
| 227 | Ga0105239_10607262 | 3300010375 | Bacteria | 1248 |
| 228 | Ga0157347_1005055 | 3300012502 | Bacteria | 1249 |
| 229 | Ga0157373_10000027 | 3300013100 | Bacteria | 133695 |
| 230 | Ga0157373_10065586 | 3300013100 | Bacteria | 2569 |
| 231 | Ga0157371_10041430 | 3300013102 | Bacteria | 3286 |
| 232 | Ga0157370_10012712 | 3300013104 | Bacteria | 8711 |
| 233 | Ga0157378_10071250 | 3300013297 | Bacteria | 3121 |
| 234 | Ga0157378_10132490 | 3300013297 | Bacteria | 2309 |
| 235 | Ga0157378_10598963 | 3300013297 | Bacteria | 1113 |
| 236 | Ga0157378_10918147 | 3300013297 | Bacteria | 907 |
| 237 | Ga0163162_10388975 | 3300013306 | Bacteria | 1527 |
| 238 | Ga0157375_10912797 | 3300013308 | Bacteria | 1022 |
| 239 | Ga0157380_10542872 | 3300014326 | Bacteria | 1139 |
| 240 | Ga0157376_10945855 | 3300014969 | Bacteria | 882 |
| 241 | Ga0182006_1039094 | 3300015261 | Bacteria | 1874 |
| 242 | Ga0163161_10000446 | 3300017792 | Bacteria | 34480 |
| 243 | Ga0163161_10028289 | 3300017792 | Bacteria | 3980 |
| 244 | Ga0163161_10275315 | 3300017792 | Bacteria | 1318 |
| 245 | Ga0213876_10110878 | 3300021384 | Bacteria | 1456 |
| 246 | Ga0213875_10085621 | 3300021388 | Bacteria | 1470 |
| 247 | Ga0209436_105359 | 3300025208 | Bacteria | 2968 |
| 248 | Ga0207425_1002709 | 3300025245 | Bacteria | 6052 |
| 249 | Ga0209677_102734 | 3300025253 | Bacteria | 6324 |
| 250 | Ga0209148_1000334 | 3300025254 | Bacteria | 64148 |
| 251 | Ga0209129_1004239 | 3300025258 | Bacteria | 5740 |
| 252 | Ga0209233_1001804 | 3300025261 | Bacteria | 8242 |
| 253 | Ga0209233_1008944 | 3300025261 | Bacteria | 3066 |
| 254 | Ga0209565_1001371 | 3300025263 | Bacteria | 10952 |
| 255 | Ga0209455_1004147 | 3300025272 | Bacteria | 4851 |
| 256 | Ga0209673_1002874 | 3300025273 | Bacteria | 10952 |
| 257 | Ga0209130_1000141 | 3300025284 | Bacteria | 115378 |
| 258 | Ga0209675_1005201 | 3300025291 | Bacteria | 5514 |
| 259 | Ga0209676_1000432 | 3300025292 | Bacteria | 72513 |
| 260 | Ga0209676_1001071 | 3300025292 | Bacteria | 31088 |
| 261 | Ga0209025_1000294 | 3300025294 | Bacteria | 111598 |
| 262 | Ga0209025_1004609 | 3300025294 | Bacteria | 11792 |
| 263 | Ga0209564_1024100 | 3300025295 | Bacteria | 2089 |
| 264 | Ga0209564_1030148 | 3300025295 | Bacteria | 1686 |
| 265 | Ga0209758_1000249 | 3300025297 | Bacteria | 110026 |
| 266 | Ga0209758_1001476 | 3300025297 | Bacteria | 27510 |
| 267 | Ga0209758_1004383 | 3300025297 | Bacteria | 11792 |
| 268 | Ga0209758_1011353 | 3300025297 | Bacteria | 5173 |
| 269 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 270 | Ga0209050_1004667 | 3300025298 | Bacteria | 9108 |
| 271 | Ga0209256_1042224 | 3300025299 | Bacteria | 1153 |
| 272 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 273 | Ga0207426_1000942 | 3300025302 | Bacteria | 28876 |
| 274 | Ga0209051_1000081 | 3300025303 | Bacteria | 195619 |
| 275 | Ga0209051_1000622 | 3300025303 | Bacteria | 40749 |
| 276 | Ga0209257_1003557 | 3300025304 | Bacteria | 13237 |
| 277 | Ga0209257_1008029 | 3300025304 | Bacteria | 6149 |
| 278 | Ga0209257_1024427 | 3300025304 | Bacteria | 2093 |
| 279 | Ga0207656_10002219 | 3300025321 | Bacteria | 6503 |
| 280 | Ga0207656_10134803 | 3300025321 | Bacteria | 1160 |
| 281 | Ga0207682_10013101 | 3300025893 | Bacteria | 3232 |
| 282 | Ga0207692_10057994 | 3300025898 | Bacteria | 1993 |
| 283 | Ga0207710_10000418 | 3300025900 | Bacteria | 28048 |
| 284 | Ga0207688_10163985 | 3300025901 | Bacteria | 1319 |
| 285 | Ga0207685_10119631 | 3300025905 | Bacteria | 1154 |
| 286 | Ga0207699_10022976 | 3300025906 | Bacteria | 3388 |
| 287 | Ga0207699_10038622 | 3300025906 | Bacteria | 2737 |
| 288 | Ga0207699_10267994 | 3300025906 | Bacteria | 1182 |
| 289 | Ga0207645_10190666 | 3300025907 | Bacteria | 1347 |
| 290 | Ga0207705_10076636 | 3300025909 | Bacteria | 2431 |
| 291 | Ga0207705_10572300 | 3300025909 | Bacteria | 878 |
| 292 | Ga0207684_10028736 | 3300025910 | Bacteria | 4736 |
| 293 | Ga0207684_10089458 | 3300025910 | Bacteria | 2623 |
| 294 | Ga0207684_10177822 | 3300025910 | Bacteria | 1835 |
| 295 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 296 | Ga0207695_10000635 | 3300025913 | Bacteria | 70312 |
| 297 | Ga0207695_10013961 | 3300025913 | Bacteria | 9544 |
| 298 | Ga0207695_10028199 | 3300025913 | Bacteria | 6233 |
| 299 | Ga0207695_10400196 | 3300025913 | Bacteria | 1257 |
| 300 | Ga0207671_10000092 | 3300025914 | Bacteria | 139546 |
| 301 | Ga0207671_10001542 | 3300025914 | Bacteria | 26352 |
| 302 | Ga0207671_10009825 | 3300025914 | Bacteria | 7962 |
| 303 | Ga0207671_10038038 | 3300025914 | Bacteria | 3567 |
| 304 | Ga0207693_10019913 | 3300025915 | Bacteria | 5336 |
| 305 | Ga0207693_10043663 | 3300025915 | Bacteria | 3525 |
| 306 | Ga0207663_10015201 | 3300025916 | Bacteria | 4240 |
| 307 | Ga0207657_10256747 | 3300025919 | Bacteria | 1392 |
| 308 | Ga0207652_10032949 | 3300025921 | Bacteria | 4361 |
| 309 | Ga0207646_10002497 | 3300025922 | Bacteria | 21730 |
| 310 | Ga0207681_10072121 | 3300025923 | Bacteria | 2411 |
| 311 | Ga0207681_10076479 | 3300025923 | Bacteria | 2351 |
| 312 | Ga0207694_10017263 | 3300025924 | Bacteria | 5455 |
| 313 | Ga0207694_10017771 | 3300025924 | Bacteria | 5374 |
| 314 | Ga0207694_10084911 | 3300025924 | Bacteria | 2491 |
| 315 | Ga0207650_10774650 | 3300025925 | Bacteria | 812 |
| 316 | Ga0207659_10128879 | 3300025926 | Bacteria | 1949 |
| 317 | Ga0207687_10496494 | 3300025927 | Bacteria | 1018 |
| 318 | Ga0207687_10508832 | 3300025927 | Bacteria | 1006 |
| 319 | Ga0207700_10014831 | 3300025928 | Bacteria | 5119 |
| 320 | Ga0207700_10017552 | 3300025928 | Bacteria | 4784 |
| 321 | Ga0207700_10154742 | 3300025928 | Bacteria | 1898 |
| 322 | Ga0207700_10256390 | 3300025928 | Bacteria | 1496 |
| 323 | Ga0207664_10058493 | 3300025929 | Bacteria | 3066 |
| 324 | Ga0207664_10449439 | 3300025929 | Bacteria | 1150 |
| 325 | Ga0207690_10051486 | 3300025932 | Bacteria | 2754 |
| 326 | Ga0207706_10057225 | 3300025933 | Bacteria | 3436 |
| 327 | Ga0207706_10508681 | 3300025933 | Bacteria | 1039 |
| 328 | Ga0207709_10000234 | 3300025935 | Bacteria | 70092 |
| 329 | Ga0207709_10359196 | 3300025935 | Bacteria | 1102 |
| 330 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 331 | Ga0207665_10133713 | 3300025939 | Bacteria | 1763 |
| 332 | Ga0207691_10001208 | 3300025940 | Bacteria | 25729 |
| 333 | Ga0207691_10169528 | 3300025940 | Bacteria | 1912 |
| 334 | Ga0207691_10229063 | 3300025940 | Bacteria | 1609 |
| 335 | Ga0207711_10045791 | 3300025941 | Bacteria | 3738 |
| 336 | Ga0207711_10077163 | 3300025941 | Bacteria | 2903 |
| 337 | Ga0207689_10057386 | 3300025942 | Bacteria | 3203 |
| 338 | Ga0207679_10668827 | 3300025945 | Bacteria | 940 |
| 339 | Ga0207667_10001145 | 3300025949 | Bacteria | 33320 |
| 340 | Ga0207667_10032537 | 3300025949 | Bacteria | 5618 |
| 341 | Ga0207667_10151895 | 3300025949 | Bacteria | 2383 |
| 342 | Ga0207667_10368925 | 3300025949 | Bacteria | 1463 |
| 343 | Ga0207651_10097753 | 3300025960 | Bacteria | 2169 |
| 344 | Ga0207712_10171241 | 3300025961 | Bacteria | 1697 |
| 345 | Ga0207668_10041674 | 3300025972 | Bacteria | 3105 |
| 346 | Ga0207668_10099407 | 3300025972 | Bacteria | 2158 |
| 347 | Ga0207668_10452090 | 3300025972 | Bacteria | 1096 |
| 348 | Ga0207668_10650335 | 3300025972 | Bacteria | 923 |
| 349 | Ga0207640_10441851 | 3300025981 | Bacteria | 1070 |
| 350 | Ga0207677_10178141 | 3300026023 | Bacteria | 1670 |
| 351 | Ga0207677_10225718 | 3300026023 | Bacteria | 1505 |
| 352 | Ga0207677_10282668 | 3300026023 | Bacteria | 1363 |
| 353 | Ga0207639_10023520 | 3300026041 | Bacteria | 4450 |
| 354 | Ga0207639_10121594 | 3300026041 | Bacteria | 2146 |
| 355 | Ga0207639_10320293 | 3300026041 | Bacteria | 1376 |
| 356 | Ga0207639_10325153 | 3300026041 | Bacteria | 1367 |
| 357 | Ga0207678_10029063 | 3300026067 | Bacteria | 4825 |
| 358 | Ga0207678_10097478 | 3300026067 | Bacteria | 2513 |
| 359 | Ga0207678_10136110 | 3300026067 | Bacteria | 2096 |
| 360 | Ga0207678_10467319 | 3300026067 | Bacteria | 1098 |
| 361 | Ga0207702_10120251 | 3300026078 | Bacteria | 2349 |
| 362 | Ga0207702_10174470 | 3300026078 | Bacteria | 1974 |
| 363 | Ga0207702_10260285 | 3300026078 | Bacteria | 1633 |
| 364 | Ga0207702_10548536 | 3300026078 | Bacteria | 1130 |
| 365 | Ga0207641_10843073 | 3300026088 | Bacteria | 908 |
| 366 | Ga0207676_10442556 | 3300026095 | Bacteria | 1223 |
| 367 | Ga0207674_10067179 | 3300026116 | Bacteria | 3610 |
| 368 | Ga0207674_10401043 | 3300026116 | Bacteria | 1325 |
| 369 | Ga0207683_10488150 | 3300026121 | Bacteria | 1137 |
| 370 | Ga0207683_10556851 | 3300026121 | Bacteria | 1060 |
| 371 | Ga0209389_1000064 | 3300027296 | Bacteria | 102177 |
| 372 | Ga0209371_1033240 | 3300027312 | Bacteria | 1103 |
| 373 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 374 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 375 | Ga0209489_104185 | 3300027361 | Bacteria | 26861 |
| 376 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 377 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 378 | Ga0209179_1082758 | 3300027512 | Bacteria | 709 |
| 379 | Ga0207428_10078804 | 3300027907 | Bacteria | 2577 |
| 380 | Ga0268266_10002834 | 3300028379 | Bacteria | 18070 |
| 381 | Ga0268266_10065384 | 3300028379 | Bacteria | 3144 |
| 382 | Ga0268266_10457369 | 3300028379 | Bacteria | 1214 |
| 383 | Ga0268265_10028815 | 3300028380 | Bacteria | 3979 |
| 384 | Ga0268265_10676695 | 3300028380 | Bacteria | 994 |
| 385 | Ga0268264_10000427 | 3300028381 | Bacteria | 58342 |
| 386 | Ga0265337_1008184 | 3300028556 | Bacteria | 3827 |
| 387 | Ga0265319_1036810 | 3300028563 | Bacteria | 1671 |
| 388 | Ga0307515_10000109 | 3300028794 | Bacteria | 195895 |
| 389 | Ga0268256_1044003 | 3300030500 | Bacteria | 981 |
| 390 | Ga0307512_10097214 | 3300030522 | Bacteria | 2015 |
| 391 | Ga0307512_10228006 | 3300030522 | Bacteria | 962 |
| 392 | Ga0265330_10052677 | 3300031235 | Bacteria | 1782 |
| 393 | Ga0265332_10072186 | 3300031238 | Bacteria | 1470 |
| 394 | Ga0265320_10018243 | 3300031240 | Bacteria | 3870 |
| 395 | Ga0265340_10026474 | 3300031247 | Bacteria | 2931 |
| 396 | Ga0265316_10132291 | 3300031344 | Bacteria | 1878 |
| 397 | Ga0265316_10155884 | 3300031344 | Bacteria | 1709 |
| 398 | Ga0307513_10000015 | 3300031456 | Bacteria | 296183 |
| 399 | Ga0307513_10020111 | 3300031456 | Bacteria | 7921 |
| 400 | Ga0307513_10045412 | 3300031456 | Bacteria | 4802 |
| 401 | Ga0307513_10055215 | 3300031456 | Bacteria | 4252 |
| 402 | Ga0307513_10098953 | 3300031456 | Bacteria | 2946 |
| 403 | Ga0307513_10128857 | 3300031456 | Bacteria | 2479 |
| 404 | Ga0307513_10148613 | 3300031456 | Bacteria | 2257 |
| 405 | Ga0307509_10491567 | 3300031507 | Bacteria | 913 |
| 406 | Ga0307509_10521620 | 3300031507 | Bacteria | 869 |
| 407 | Ga0307408_100042038 | 3300031548 | Bacteria | 3243 |
| 408 | Ga0307408_100214957 | 3300031548 | Bacteria | 1565 |
| 409 | Ga0307408_100879520 | 3300031548 | Bacteria | 819 |
| 410 | Ga0265313_10076856 | 3300031595 | Bacteria | 1525 |
| 411 | Ga0265313_10121681 | 3300031595 | Bacteria | 1137 |
| 412 | Ga0307508_10000246 | 3300031616 | Bacteria | 65693 |
| 413 | Ga0307508_10006278 | 3300031616 | Bacteria | 11192 |
| 414 | Ga0307508_10009734 | 3300031616 | Bacteria | 8815 |
| 415 | Ga0307508_10018036 | 3300031616 | Bacteria | 6414 |
| 416 | Ga0307508_10143179 | 3300031616 | Bacteria | 1995 |
| 417 | Ga0307514_10020362 | 3300031649 | Bacteria | 5413 |
| 418 | Ga0265342_10088475 | 3300031712 | Bacteria | 1778 |
| 419 | Ga0307516_10006708 | 3300031730 | Bacteria | 13452 |
| 420 | Ga0307516_10123935 | 3300031730 | Bacteria | 2371 |
| 421 | Ga0307405_10077124 | 3300031731 | Bacteria | 2164 |
| 422 | Ga0307405_10092740 | 3300031731 | Bacteria | 2004 |
| 423 | Ga0307413_10154788 | 3300031824 | Bacteria | 1602 |
| 424 | Ga0307413_10538529 | 3300031824 | Bacteria | 945 |
| 425 | Ga0307409_100383772 | 3300031995 | Bacteria | 1336 |
| 426 | Ga0307416_100023421 | 3300032002 | Bacteria | 4480 |
| 427 | Ga0307416_100873102 | 3300032002 | Bacteria | 998 |
| 428 | Ga0307414_10612364 | 3300032004 | Bacteria | 978 |
| 429 | Ga0307411_10453620 | 3300032005 | Bacteria | 1073 |
| 430 | Ga0307411_10462305 | 3300032005 | Bacteria | 1064 |
| 431 | Ga0307507_10043771 | 3300033179 | Bacteria | 4438 |
| 432 | Ga0307507_10236786 | 3300033179 | Bacteria | 1201 |
| 433 | Ga0307510_10007100 | 3300033180 | Bacteria | 13342 |
| 434 | Ga0307510_10020152 | 3300033180 | Bacteria | 7803 |
| 435 | Ga0307510_10059830 | 3300033180 | Bacteria | 3928 |
| 436 | Ga0307510_10217439 | 3300033180 | Bacteria | 1426 |
| 437 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 438 | Ga0316588_1049097 | 3300033528 | Bacteria | 1021 |
| 439 | Ga0373934_0051717 | 3300035086 | Bacteria | 1629 |
| 440 | Ga0373944_0028431 | 3300035089 | Bacteria | 1664 |
| 441 | Ga0373923_0049895 | 3300035111 | Bacteria | 1751 |
| 442 | Ga0373943_0022548 | 3300035170 | Bacteria | 2919 |
| 443 | Ga0373924_0089893 | 3300035410 | Bacteria | 1313 |
| 444 | Ga0373933_0000164 | 3300035724 | Bacteria | 43241 |
| 445 | Ga0373937_0261117 | 3300036401 | Bacteria | 1633 |
| 446 | Ga0373925_0038084 | 3300037068 | Bacteria | 3552 |
| 447 | Ga0395898_0237261 | 3300037466 | Bacteria | 1739 |
| 448 | Ga0395905_0015214 | 3300037471 | Bacteria | 7316 |
| 449 | Ga0436364_0166031 | 3300037853 | Bacteria | 824 |
| 450 | Ga0436364_0176246 | 3300037853 | Bacteria | 1750 |
| 451 | Ga0395901_0320216 | 3300038443 | Bacteria | 1605 |
| 452 | Ga0400490_59588 | 3300038726 | Bacteria | 10370 |
| 453 | Ga0400483_037459 | 3300039062 | Bacteria | 2216 |
| 454 | Ga0400483_079217 | 3300039062 | Bacteria | 83041 |
| 455 | Ga0400483_092352 | 3300039062 | Bacteria | 246443 |
| 456 | Ga0400483_222230 | 3300039062 | Bacteria | 4185 |
| 457 | Ga0400483_222800 | 3300039062 | Bacteria | 244239 |
| 458 | Ga0436365_0022917 | 3300039437 | Bacteria | 1279 |
| 459 | Ga0436365_0694465 | 3300039437 | Bacteria | 2443 |
| 460 | Ga0439436_0001353 | 3300041404 | Bacteria | 7051 |
| 461 | Ga0439438_024843 | 3300041405 | Bacteria | 1638 |
| 462 | Ga0439439_0002684 | 3300041406 | Bacteria | 3814 |
| 463 | Ga0439461_0023308 | 3300041410 | Bacteria | 1245 |
| 464 | Ga0451789_0190617 | 3300041443 | Bacteria | 901 |
| 465 | Ga0451797_0912266 | 3300041453 | Bacteria | 762 |
| 466 | Ga0451807_0885740 | 3300041486 | Bacteria | 6515 |
| 467 | Ga0451807_2272697 | 3300041486 | Bacteria | 1795 |
| 468 | Ga0439433_0022342 | 3300041999 | Bacteria | 1418 |
| 469 | Ga0439432_004573 | 3300042006 | Bacteria | 5049 |
| 470 | Ga0439449_0004052 | 3300042007 | Bacteria | 5672 |
| 471 | Ga0439452_001303 | 3300042010 | Bacteria | 10505 |
| 472 | Ga0439457_014966 | 3300042014 | Bacteria | 1733 |
| 473 | Ga0450897_003577 | 3300042128 | Bacteria | 1254 |
| 474 | Ga0450896_025860 | 3300042133 | Bacteria | 874 |
| 475 | Ga0450910_003635 | 3300042147 | Bacteria | 2055 |
| 476 | Ga0450909_016170 | 3300042185 | Bacteria | 1101 |
| 477 | Ga0451577_0017106 | 3300042876 | Bacteria | 6704 |
| 478 | Ga0451577_0024143 | 3300042876 | Bacteria | 5532 |
| 479 | Ga0466969_0152366 | 3300044656 | Bacteria | 1065 |
| 480 | Ga0453683_0163556 | 3300044673 | Bacteria | 1408 |
| 481 | Ga0466965_0206433 | 3300044683 | Bacteria | 1043 |
| 482 | Ga0466961_0353826 | 3300044693 | Bacteria | 894 |
| 483 | Ga0466963_0145419 | 3300044694 | Bacteria | 1644 |
| 484 | Ga0466964_0225110 | 3300044706 | Bacteria | 913 |
| 485 | Ga0453684_0138384 | 3300044712 | Bacteria | 2912 |
| 486 | Ga0466957_0164597 | 3300044842 | Bacteria | 1442 |
| 487 | Ga0451576_0130666 | 3300045051 | Bacteria | 2618 |
| 488 | Ga0466967_0822628 | 3300045976 | Bacteria | 922 |
| 489 | Ga0495617_114028 | 3300046452 | Bacteria | 873 |
| 490 | Ga0495627_021305 | 3300046453 | Bacteria | 2150 |
| 491 | Ga0495592_0022519 | 3300046454 | Bacteria | 4794 |
| 492 | Ga0495603_0047679 | 3300046455 | Bacteria | 2551 |
| 493 | Ga0495590_0049205 | 3300046457 | Bacteria | 1471 |
| 494 | Ga0495591_000353 | 3300046458 | Bacteria | 40689 |
| 495 | Ga0495591_004510 | 3300046458 | Bacteria | 6780 |
| 496 | Ga0495638_0018358 | 3300046460 | Bacteria | 4645 |
| 497 | Ga0495638_0094282 | 3300046460 | Bacteria | 1800 |
| 498 | Ga0495638_0240898 | 3300046460 | Bacteria | 1001 |
| 499 | Ga0495641_0067953 | 3300046461 | Bacteria | 1602 |
| 500 | Ga0495580_0056114 | 3300046472 | Bacteria | 2774 |
| 501 | Ga0495582_0086227 | 3300046473 | Bacteria | 1747 |
| 502 | Ga0495582_0235766 | 3300046473 | Bacteria | 1048 |
| 503 | Ga0495605_0000436 | 3300046474 | Bacteria | 37694 |
| 504 | Ga0495605_0001028 | 3300046474 | Bacteria | 18772 |
| 505 | Ga0495639_0118631 | 3300046475 | Bacteria | 1261 |
| 506 | Ga0495664_0003029 | 3300046477 | Bacteria | 9098 |
| 507 | Ga0495584_0216591 | 3300046491 | Bacteria | 973 |
| 508 | Ga0495585_0119051 | 3300046492 | Bacteria | 1398 |
| 509 | Ga0495594_0005421 | 3300046499 | Bacteria | 6555 |
| 510 | Ga0495594_0186964 | 3300046499 | Bacteria | 1180 |
| 511 | Ga0495594_0232494 | 3300046499 | Bacteria | 1051 |
| 512 | Ga0495607_0009324 | 3300046501 | Bacteria | 6651 |
| 513 | Ga0495607_0075075 | 3300046501 | Bacteria | 1874 |
| 514 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 515 | Ga0495606_0127987 | 3300046507 | Bacteria | 1512 |
| 516 | Ga0495606_0198783 | 3300046507 | Bacteria | 1144 |
| 517 | Ga0495606_0275738 | 3300046507 | Bacteria | 922 |
| 518 | Ga0495610_0017908 | 3300046512 | Bacteria | 4021 |
| 519 | Ga0495610_0090366 | 3300046512 | Bacteria | 1389 |
| 520 | Ga0495616_0198743 | 3300046513 | Bacteria | 882 |
| 521 | Ga0495616_0202819 | 3300046513 | Bacteria | 871 |
| 522 | Ga0495618_0035740 | 3300046514 | Bacteria | 3119 |
| 523 | Ga0495620_0000028 | 3300046515 | Bacteria | 123172 |
| 524 | Ga0495620_0046712 | 3300046515 | Bacteria | 1868 |
| 525 | Ga0495620_0111270 | 3300046515 | Bacteria | 1085 |
| 526 | Ga0495628_0088858 | 3300046516 | Bacteria | 2394 |
| 527 | Ga0495630_0081340 | 3300046517 | Bacteria | 2444 |
| 528 | Ga0495631_0019696 | 3300046518 | Bacteria | 3163 |
| 529 | Ga0495631_0143208 | 3300046518 | Bacteria | 1026 |
| 530 | Ga0495631_0176428 | 3300046518 | Bacteria | 916 |
| 531 | Ga0495632_0075399 | 3300046519 | Bacteria | 1614 |
| 532 | Ga0495637_0058026 | 3300046520 | Bacteria | 1596 |
| 533 | Ga0495637_0087414 | 3300046520 | Bacteria | 1234 |
| 534 | Ga0495643_0000057 | 3300046522 | Bacteria | 195145 |
| 535 | Ga0495643_0007531 | 3300046522 | Bacteria | 7005 |
| 536 | Ga0495643_0148394 | 3300046522 | Bacteria | 1163 |
| 537 | Ga0495644_0134473 | 3300046523 | Bacteria | 943 |
| 538 | Ga0495648_0018358 | 3300046524 | Bacteria | 4954 |
| 539 | Ga0495648_0105183 | 3300046524 | Bacteria | 1548 |
| 540 | Ga0495648_0229435 | 3300046524 | Bacteria | 910 |
| 541 | Ga0495652_0121872 | 3300046529 | Bacteria | 2078 |
| 542 | Ga0495652_0203451 | 3300046529 | Bacteria | 1501 |
| 543 | Ga0495654_0001115 | 3300046530 | Bacteria | 19367 |
| 544 | Ga0495654_0066737 | 3300046530 | Bacteria | 1714 |
| 545 | Ga0495654_0073586 | 3300046530 | Bacteria | 1616 |
| 546 | Ga0495654_0152662 | 3300046530 | Bacteria | 1020 |
| 547 | Ga0495665_0097196 | 3300046531 | Bacteria | 1546 |
| 548 | Ga0495640_0083808 | 3300046533 | Bacteria | 2115 |
| 549 | Ga0495586_0163432 | 3300046535 | Bacteria | 1256 |
| 550 | Ga0495598_0089915 | 3300046537 | Bacteria | 999 |
| 551 | Ga0495609_0000081 | 3300046538 | Bacteria | 116100 |
| 552 | Ga0495621_0132401 | 3300046539 | Bacteria | 971 |
| 553 | Ga0495597_0000037 | 3300046542 | Bacteria | 113832 |
| 554 | Ga0495597_0026112 | 3300046542 | Bacteria | 2684 |
| 555 | Ga0495622_0086965 | 3300046557 | Bacteria | 1437 |
| 556 | Ga0495622_0167545 | 3300046557 | Bacteria | 989 |
| 557 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 558 | Ga0495656_0141514 | 3300046615 | Bacteria | 1154 |
| 559 | Ga0495668_0074227 | 3300046616 | Bacteria | 1868 |
| 560 | Ga0495668_0265863 | 3300046616 | Bacteria | 939 |
| 561 | Ga0495668_0317735 | 3300046616 | Bacteria | 854 |
| 562 | Ga0495611_0008756 | 3300046648 | Bacteria | 4278 |
| 563 | Ga0495611_0111947 | 3300046648 | Bacteria | 1271 |
| 564 | Ga0495625_0130041 | 3300046660 | Bacteria | 1706 |
| 565 | Ga0495625_0178502 | 3300046660 | Bacteria | 1414 |
| 566 | Ga0495661_0000217 | 3300046665 | Bacteria | 66241 |
| 567 | Ga0495661_0010263 | 3300046665 | Bacteria | 6398 |
| 568 | Ga0495661_0142128 | 3300046665 | Bacteria | 1305 |
| 569 | Ga0495588_0259671 | 3300046674 | Bacteria | 915 |
| 570 | Ga0495588_0279796 | 3300046674 | Bacteria | 879 |
| 571 | Ga0495647_0021985 | 3300046681 | Bacteria | 2302 |
| 572 | Ga0495624_0108077 | 3300046690 | Bacteria | 1711 |
| 573 | Ga0495670_0001463 | 3300046691 | Bacteria | 11538 |
| 574 | Ga0495671_0006278 | 3300046692 | Bacteria | 6880 |
| 575 | Ga0495671_0033794 | 3300046692 | Bacteria | 2603 |
| 576 | Ga0495671_0276521 | 3300046692 | Bacteria | 809 |
| 577 | Ga0495649_0316663 | 3300046694 | Bacteria | 792 |
| 578 | Ga0495589_0010125 | 3300046794 | Bacteria | 4898 |
| 579 | Ga0495660_0000568 | 3300046810 | Bacteria | 29899 |
| 580 | Ga0495660_0003536 | 3300046810 | Bacteria | 9636 |
| 581 | Ga0495660_0015689 | 3300046810 | Bacteria | 4374 |
| 582 | Ga0495660_0203201 | 3300046810 | Bacteria | 945 |
| 583 | Ga0495604_0172449 | 3300047317 | Bacteria | 1520 |
| 584 | Ga0495674_0037149 | 3300047319 | Bacteria | 4377 |
| 585 | Ga0495672_0072361 | 3300047320 | Bacteria | 1947 |
| 586 | Ga0495672_0101109 | 3300047320 | Bacteria | 1563 |
| 587 | Ga0495672_0244747 | 3300047320 | Bacteria | 874 |
| 588 | Ga0495683_0000060 | 3300047323 | Bacteria | 115881 |
| 589 | Ga0495683_0112253 | 3300047323 | Bacteria | 1300 |
| 590 | Ga0495683_0222511 | 3300047323 | Bacteria | 841 |
| 591 | Ga0495687_049654 | 3300047443 | Bacteria | 1792 |
| 592 | Ga0495679_000823 | 3300047446 | Bacteria | 19731 |
| 593 | Ga0495681_0024953 | 3300047470 | Bacteria | 3135 |
| 594 | Ga0495686_0095860 | 3300047472 | Bacteria | 1796 |
| 595 | Ga0495686_0327534 | 3300047472 | Bacteria | 838 |
| 596 | Ga0495602_0225582 | 3300048088 | Bacteria | 1411 |
| 597 | Ga0496102_0190387 | 3300048905 | Bacteria | 1933 |
| 598 | Ga0496103_0010374 | 3300048906 | Bacteria | 5513 |
| 599 | Ga0496104_0201716 | 3300048907 | Bacteria | 1901 |
| 600 | Ga0496106_0000002 | 3300048909 | Bacteria | 377020 |
| 601 | Ga0496106_0258759 | 3300048909 | Bacteria | 1392 |
| 602 | Ga0496107_0028046 | 3300048910 | Bacteria | 4001 |
| 603 | Ga0496108_0198145 | 3300048911 | Bacteria | 1742 |
| 604 | Ga0496109_0283565 | 3300048912 | Bacteria | 1561 |
| 605 | Ga0496110_0303802 | 3300048913 | Bacteria | 1453 |
| 606 | Ga0496111_0063380 | 3300048914 | Bacteria | 2681 |
| 607 | Ga0496112_0019936 | 3300048915 | Bacteria | 6346 |
| 608 | Ga0496112_0436698 | 3300048915 | Bacteria | 1247 |
| 609 | Ga0496113_0270307 | 3300048916 | Bacteria | 1358 |
| 610 | Ga0496114_0377032 | 3300048917 | Bacteria | 1256 |
| 611 | Ga0496116_0042778 | 3300048919 | Bacteria | 3093 |
| 612 | Ga0496116_0066692 | 3300048919 | Bacteria | 2302 |
| 613 | Ga0496117_0080858 | 3300048920 | Bacteria | 2135 |
| 614 | Ga0496117_0090460 | 3300048920 | Bacteria | 1972 |
| 615 | Ga0496117_0291583 | 3300048920 | Bacteria | 868 |
| 616 | Ga0496117_0320977 | 3300048920 | Bacteria | 811 |
| 617 | Ga0496118_0074574 | 3300048921 | Bacteria | 2424 |
| 618 | Ga0496118_0075118 | 3300048921 | Bacteria | 2412 |
| 619 | Ga0496118_0164712 | 3300048921 | Bacteria | 1364 |
| 620 | Ga0496118_0299639 | 3300048921 | Bacteria | 883 |
| 621 | Ga0496118_0331017 | 3300048921 | Bacteria | 821 |
| 622 | Ga0496119_0170381 | 3300048922 | Bacteria | 1150 |
| 623 | Ga0496120_0133123 | 3300048923 | Bacteria | 1271 |
| 624 | Ga0496121_0002830 | 3300048924 | Bacteria | 25630 |
| 625 | Ga0496121_0025670 | 3300048924 | Bacteria | 5583 |
| 626 | Ga0496121_0027094 | 3300048924 | Bacteria | 5373 |
| 627 | Ga0496121_0085899 | 3300048924 | Bacteria | 2474 |
| 628 | Ga0496121_0168730 | 3300048924 | Bacteria | 1592 |
| 629 | Ga0496121_0235102 | 3300048924 | Bacteria | 1281 |
| 630 | Ga0496121_0238341 | 3300048924 | Bacteria | 1269 |
| 631 | Ga0496121_0289078 | 3300048924 | Bacteria | 1118 |
| 632 | Ga0496121_0418563 | 3300048924 | Bacteria | 872 |
| 633 | Ga0496121_0433577 | 3300048924 | Bacteria | 852 |
| 634 | Ga0496122_0011516 | 3300048925 | Bacteria | 8946 |
| 635 | Ga0496122_0033725 | 3300048925 | Bacteria | 4204 |
| 636 | Ga0496122_0228024 | 3300048925 | Bacteria | 1062 |
| 637 | Ga0496123_0000314 | 3300048926 | Bacteria | 92927 |
| 638 | Ga0496123_0038366 | 3300048926 | Bacteria | 3368 |
| 639 | Ga0496123_0091378 | 3300048926 | Bacteria | 1805 |
| 640 | Ga0496124_0272098 | 3300048927 | Bacteria | 1240 |
| 641 | Ga0496124_0290361 | 3300048927 | Bacteria | 1187 |
| 642 | Ga0496124_0386655 | 3300048927 | Bacteria | 976 |
| 643 | Ga0496125_0002440 | 3300048928 | Bacteria | 24147 |
| 644 | Ga0496125_0051382 | 3300048928 | Bacteria | 3400 |
| 645 | Ga0496125_0171134 | 3300048928 | Bacteria | 1460 |
| 646 | Ga0496126_0012386 | 3300048929 | Bacteria | 8743 |
| 647 | Ga0496126_0031229 | 3300048929 | Bacteria | 5036 |
| 648 | Ga0496126_0034574 | 3300048929 | Bacteria | 4746 |
| 649 | Ga0496126_0189625 | 3300048929 | Bacteria | 1742 |
| 650 | Ga0496126_0209436 | 3300048929 | Bacteria | 1642 |
| 651 | Ga0496126_0367270 | 3300048929 | Bacteria | 1174 |
| 652 | Ga0496126_0375518 | 3300048929 | Bacteria | 1158 |
| 653 | Ga0496126_0550610 | 3300048929 | Bacteria | 915 |
| 654 | Ga0496126_0625567 | 3300048929 | Bacteria | 845 |
| 655 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 656 | Ga0501031_0061738 | 3300049568 | Bacteria | 2442 |
| 657 | Ga0501033_0466496 | 3300049570 | Bacteria | 876 |
| 658 | Ga0501047_0017499 | 3300049581 | Bacteria | 6865 |
| 659 | Ga0501048_0001083 | 3300049582 | Bacteria | 20423 |
| 660 | Ga0501067_0104958 | 3300049583 | Bacteria | 1570 |
| 661 | Ga0501070_0433096 | 3300049586 | Bacteria | 1061 |
| 662 | Ga0501080_0008470 | 3300049742 | Bacteria | 9318 |
| 663 | Ga0501035_0171787 | 3300049822 | Bacteria | 1872 |
| 664 | Ga0501044_0031380 | 3300049823 | Bacteria | 5593 |
| 665 | Ga0501044_0581210 | 3300049823 | Bacteria | 1015 |
| 666 | nmdc:mga03683_24199_c1 | 3300050489 | Bacteria | 2374 |
| 667 | nmdc:mga03683_246495_c1 | 3300050489 | Bacteria | 829 |
| 668 | nmdc:mga03683_26419_c1 | 3300050489 | Bacteria | 2290 |
| 669 | nmdc:mga03683_36720_c1 | 3300050489 | Bacteria | 1994 |
| 670 | nmdc:mga03n38_12752_c1 | 3300050490 | Bacteria | 3172 |
| 671 | nmdc:mga03n38_144255_c1 | 3300050490 | Bacteria | 1192 |
| 672 | nmdc:mga03n38_34390_c1 | 3300050490 | Bacteria | 2164 |
| 673 | nmdc:mga03n38_72711_c1 | 3300050490 | Bacteria | 1595 |
| 674 | nmdc:mga00v17_153444_c1 | 3300050491 | Bacteria | 1480 |
| 675 | nmdc:mga00v17_43195_c1 | 3300050491 | Bacteria | 2713 |
| 676 | nmdc:mga00v17_65780_c1 | 3300050491 | Bacteria | 2237 |
| 677 | nmdc:mga00v17_84082_c1 | 3300050491 | Bacteria | 1991 |
| 678 | nmdc:mga0yw44_197834_c1 | 3300050492 | Bacteria | 1327 |
| 679 | nmdc:mga0yw44_201313_c1 | 3300050492 | Bacteria | 1315 |
| 680 | nmdc:mga0k408_125833_c1 | 3300050493 | Bacteria | 1520 |
| 681 | nmdc:mga0k408_184951_c1 | 3300050493 | Bacteria | 1243 |
| 682 | nmdc:mga0k408_218754_c1 | 3300050493 | Bacteria | 1137 |
| 683 | nmdc:mga0k408_233813_c1 | 3300050493 | Bacteria | 1097 |
| 684 | nmdc:mga0k408_667_c1 | 3300050493 | Bacteria | 18809 |
| 685 | nmdc:mga0k408_73324_c1 | 3300050493 | Bacteria | 1999 |
| 686 | nmdc:mga06z11_33139_c1 | 3300050494 | Bacteria | 2525 |
| 687 | nmdc:mga06z11_45724_c1 | 3300050494 | Bacteria | 2215 |
| 688 | nmdc:mga06z11_91252_c1 | 3300050494 | Bacteria | 1654 |
| 689 | nmdc:mga06z11_91278_c1 | 3300050494 | Bacteria | 1654 |
| 690 | nmdc:mga07m45_64277_c1 | 3300050496 | Bacteria | 2082 |
| 691 | nmdc:mga05p37_24646_c1 | 3300050507 | Bacteria | 7312 |
| 692 | nmdc:mga08y16_684570_c1 | 3300050511 | Bacteria | 1027 |
| 693 | nmdc:mga0n895_332819_c1 | 3300050512 | Bacteria | 1538 |
| 694 | nmdc:mga0rr50_19965_c1 | 3300050513 | Bacteria | 4538 |
| 695 | nmdc:mga08x19_191018_c1 | 3300050514 | Bacteria | 1401 |
| 696 | nmdc:mga08x19_273905_c1 | 3300050514 | Bacteria | 1168 |
| 697 | nmdc:mga0a205_288615_c1 | 3300050515 | Bacteria | 1515 |
| 698 | nmdc:mga0sz30_121528_c1 | 3300050516 | Bacteria | 1148 |
| 699 | nmdc:mga0sz30_178204_c1 | 3300050516 | Bacteria | 943 |
| 700 | nmdc:mga0sz30_30521_c1 | 3300050516 | Bacteria | 2226 |
| 701 | Ga0495655_0038438 | 3300053083 | Bacteria | 1208 |
| 702 | Ga0495655_0049109 | 3300053083 | Bacteria | 1110 |
| 703 | Ga0500643_001635 | 3300053087 | Bacteria | 12518 |
| 704 | Ga0500644_0003163 | 3300053088 | Bacteria | 4079 |
| 705 | Ga0500644_0094479 | 3300053088 | Bacteria | 1125 |
| 706 | Ga0500581_020365 | 3300053089 | Bacteria | 3348 |
| 707 | Ga0500646_0027161 | 3300053090 | Bacteria | 1556 |
| 708 | Ga0500647_0141254 | 3300053091 | Bacteria | 1129 |
| 709 | Ga0500583_0064544 | 3300053092 | Bacteria | 1736 |
| 710 | Ga0500651_0115319 | 3300053093 | Bacteria | 1636 |
| 711 | Ga0500651_0165488 | 3300053093 | Bacteria | 1320 |
| 712 | Ga0500566_0041846 | 3300053094 | Bacteria | 2645 |
| 713 | Ga0500566_0067562 | 3300053094 | Bacteria | 2012 |
| 714 | Ga0500566_0188741 | 3300053094 | Bacteria | 1051 |
| 715 | Ga0500640_048736 | 3300053095 | Bacteria | 1856 |
| 716 | Ga0500641_0036253 | 3300053096 | Bacteria | 1972 |
| 717 | Ga0500650_0001279 | 3300053098 | Bacteria | 7435 |
| 718 | Ga0500650_0055751 | 3300053098 | Bacteria | 1841 |
| 719 | Ga0500556_0000015 | 3300053104 | Bacteria | 202598 |
| 720 | Ga0500557_000822 | 3300053105 | Bacteria | 4511 |
| 721 | Ga0500569_003618 | 3300053109 | Bacteria | 3178 |
| 722 | Ga0500592_020250 | 3300053116 | Bacteria | 1071 |
| 723 | Ga0500593_035827 | 3300053117 | Bacteria | 2220 |
| 724 | Ga0500594_0150818 | 3300053118 | Bacteria | 747 |
| 725 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 726 | Ga0500607_051290 | 3300053121 | Bacteria | 2194 |
| 727 | Ga0500608_001202 | 3300053122 | Bacteria | 9261 |
| 728 | Ga0500614_022890 | 3300053123 | Bacteria | 1463 |
| 729 | Ga0500618_044278 | 3300053125 | Bacteria | 1016 |
| 730 | Ga0500642_0000044 | 3300053130 | Bacteria | 82877 |
| 731 | Ga0500652_000638 | 3300053131 | Bacteria | 11977 |
| 732 | Ga0500568_0000661 | 3300053139 | Bacteria | 24893 |
| 733 | Ga0500586_003197 | 3300053145 | Bacteria | 3839 |
| 734 | Ga0500603_007887 | 3300053150 | Bacteria | 2345 |
| 735 | Ga0500604_0005252 | 3300053151 | Bacteria | 3424 |
| 736 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 737 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 738 | Ga0500622_0000700 | 3300053156 | Bacteria | 29484 |
| 739 | Ga0500627_0184689 | 3300053158 | Bacteria | 937 |
| 740 | Ga0500630_056839 | 3300053159 | Bacteria | 1878 |
| 741 | Ga0500634_0177705 | 3300053161 | Bacteria | 962 |
| 742 | Ga0500639_004098 | 3300053163 | Bacteria | 7401 |
| 743 | Ga0500636_0009242 | 3300053177 | Bacteria | 5729 |
| 744 | Ga0500636_0015565 | 3300053177 | Bacteria | 4483 |
| 745 | Ga0500625_096922 | 3300053729 | Bacteria | 1246 |
| 746 | Ga0500645_010186 | 3300053730 | Bacteria | 3123 |
| 747 | Ga0501082_0346876 | 3300060353 | Bacteria | 1294 |
| 748 | 2501407527 | 2501025504 | Bacteria | 8008976 |
| 749 | 2511097395 | 2510917014 | Bacteria | 8296963 |
| 750 | 2511105650 | 2510917015 | Bacteria | 7950052 |
| 751 | 2511244051 | 2511231002 | Bacteria | 5042903 |
| 752 | 2512346550 | 2512047030 | Bacteria | 9031815 |
| 753 | 2513639593 | 2513237094 | Bacteria | 8789602 |
| 754 | 2513647921 | 2513237095 | Bacteria | 8976980 |
| 755 | 2513653728 | 2513237096 | Bacteria | 8722461 |
| 756 | 2513693661 | 2513237101 | Bacteria | 7952346 |
| 757 | 2513856168 | 2513237137 | Bacteria | 9558895 |
| 758 | 2513918068 | 2513237145 | Bacteria | 8979722 |
| 759 | 2517891692 | 2517572143 | Bacteria | 9484767 |
| 760 | 2524437231 | 2524023205 | Bacteria | 8918781 |
| 761 | 2524536687 | 2524023228 | Bacteria | 10118060 |
| 762 | 2528851632 | 2528768022 | Bacteria | 10457665 |
| 763 | 2587757677 | 2585428062 | Bacteria | 6842168 |
| 764 | 2599621349 | 2599185214 | Bacteria | 8209958 |
| 765 | 2599670967 | 2599185226 | Bacteria | 8233575 |
| 766 | 2599679457 | 2599185227 | Bacteria | 8246414 |
| 767 | 2599690860 | 2599185229 | Bacteria | 8216126 |
| 768 | 2603860763 | 2602042107 | Bacteria | 6226103 |
| 769 | 2644465584 | 2643221683 | Bacteria | 5749203 |
| 770 | 2671118538 | 2667528175 | Bacteria | 7532676 |
| 771 | 2723843567 | 2721755755 | Bacteria | 8322773 |
| 772 | 2728754845 | 2728368998 | Bacteria | 8720350 |
| 773 | 2739249202 | 2738543013 | Bacteria | 5618633 |
| 774 | 2745076449 | 2744054633 | Bacteria | 8678936 |
| 775 | 2793063071 | 2791355196 | Bacteria | 7323613 |
| 776 | 2793067066 | 2791355197 | Bacteria | 8420563 |
| 777 | 2793082894 | |||
| 778 | 2818237321 | 2816332527 | Bacteria | 8933356 |
| 779 | 2819597529 | 2818991446 | Bacteria | 7757362 |
| 780 | 2824664773 | 2824661429 | Bacteria | 9877870 |
| 781 | 2838057947 | 2838054893 | Bacteria | 7451788 |
| 782 | 2844321865 | 2844315083 | Bacteria | 8138177 |
| 783 | 2847931428 | 2847930680 | Bacteria | 9342022 |
| 784 | 2857511611 | 2857509624 | Bacteria | 7472071 |
| 785 | 2857524798 | 2857524615 | Bacteria | 6615449 |
| 786 | 2858953914 | 2858950400 | Bacteria | 6783797 |
| 787 | 2874611524 | 2874604998 | Bacteria | 7834745 |
| 788 | 2876769002 | 2876761206 | Bacteria | 10111113 |
| 789 | 2876816595 | 2876808645 | Bacteria | 8824342 |
| 790 | 2879087536 | 2879083081 | Bacteria | 8587928 |
| 791 | 2879114969 | 2879110137 | Bacteria | 8907982 |
| 792 | 2885200197 | 2885198086 | Bacteria | 7212419 |
| 793 | 2885213849 | 2885211737 | Bacteria | 7212420 |
| 794 | 2885381022 | 2885374607 | Bacteria | 8927485 |
| 795 | 2885418350 | 2885409591 | Bacteria | 9235467 |
| 796 | 2887379161 | 2887375801 | Bacteria | 5334027 |
| 797 | 2888379922 | 2888378607 | Bacteria | 9652610 |
| 798 | 2893069312 | 2893066018 | Bacteria | 6158120 |
| 799 | 2903727585 | 2903727486 | Bacteria | 8281579 |
| 800 | 2903755400 | 2903748898 | Bacteria | 9972761 |
| 801 | 2903768500 | 2903768456 | Bacteria | 9749579 |
| 802 | 2904451478 | 2904449895 | Bacteria | 6927402 |
| 803 | 2904543122 | 2904541872 | Bacteria | 8915136 |
| 804 | 2904698497 | 2904690495 | Bacteria | 9412302 |
| 805 | 2904704550 | |||
| 806 | 2906602925 | 2906602504 | Bacteria | 8295279 |
| 807 | 2906616867 | |||
| 808 | 2906642906 | 2906635258 | Bacteria | 8601019 |
| 809 | 2906649058 | 2906643746 | Bacteria | 8722424 |
| 810 | 2906667196 | 2906660503 | Bacteria | 8595048 |
| 811 | 2908742054 | 2908739725 | Bacteria | 8628932 |
| 812 | 2908762491 | 2908756301 | Bacteria | 8864324 |
| 813 | 2919078684 | 2919073203 | Bacteria | 6531949 |
| 814 | 2922361823 | 2922361189 | Bacteria | 7436256 |
| 815 | 2922378304 | |||
| 816 | 2922386939 | 2922386360 | Bacteria | 7017218 |
| 817 | 2922431060 | |||
| 818 | 2928040616 | 2928037797 | Bacteria | 7273642 |
| 819 | 2928046635 | 2928044640 | Bacteria | 7271509 |
| 820 | 2928058181 | 2928051484 | Bacteria | 7773759 |
| 821 | 2928067482 | 2928064002 | Bacteria | 7419480 |
| 822 | 2928072009 | 2928070936 | Bacteria | 8062541 |
| 823 | 2929160355 | 2929160207 | Bacteria | 9075316 |
| 824 | 2932786390 | 2932784394 | Bacteria | 9704911 |
| 825 | 2932794645 | 2932794094 | Bacteria | 7915132 |
| 826 | 2932829628 | 2932828146 | Bacteria | 9745859 |
| 827 | 2935618146 | 2935616580 | Bacteria | 9032984 |
| 828 | 2935636944 | 2935630451 | Bacteria | 8169952 |
| 829 | 2935641456 | 2935638405 | Bacteria | 10015038 |
| 830 | 2935669486 | 2935665750 | Bacteria | 9571747 |
| 831 | 2935677916 | 2935675223 | Bacteria | 9928132 |
| 832 | 2935689635 | 2935684952 | Bacteria | 9590419 |
| 833 | 2935707311 | 2935703347 | Bacteria | 10242284 |
| 834 | 2935717155 | 2935713505 | Bacteria | 9608509 |
| 835 | 2935730011 | 2935722832 | Bacteria | 9608746 |
| 836 | 2935738570 | 2935732158 | Bacteria | 9706831 |
| 837 | 2935749182 | 2935741537 | Bacteria | 9707219 |
| 838 | 2935756989 | 2935750917 | Bacteria | 9590372 |
| 839 | 2935804310 | 2935801545 | Bacteria | 9301974 |
| 840 | 2935815394 | 2935810662 | Bacteria | 9401221 |
| 841 | 2935831187 | 2935827899 | Bacteria | 10038562 |
| 842 | 2935841796 | 2935837841 | Bacteria | 9454360 |
| 843 | 2935856355 | 2935855204 | Bacteria | 9035059 |
| 844 | 2935866313 | 2935864058 | Bacteria | 9784707 |
| 845 | 2935874619 | 2935873716 | Bacteria | 9632195 |
| 846 | 2935962322 | 2935959822 | Bacteria | 7869783 |
| 847 | 2935994080 | 2935992306 | Bacteria | 9802711 |
| 848 | 2936004909 | 2936002035 | Bacteria | 9362176 |
| 849 | 2936045049 | 2936037263 | Bacteria | 9446081 |
| 850 | 2940562903 | 2940556831 | Bacteria | 9590747 |
| 851 | 2941513600 | 2941507105 | Bacteria | 8166816 |
| 852 | 2941521544 | 2941515067 | Bacteria | 8166720 |
| 853 | 2941529298 | 2941523033 | Bacteria | 8169134 |
| 854 | 2941543869 | 2941538514 | Bacteria | 9402094 |
| 855 | 3005480883 | 3005474847 | Bacteria | 9259049 |
| 856 | 3005597659 | 3005594810 | Bacteria | 8716512 |
| 857 | 8006939835 | 8006933436 | Bacteria | 10410654 |
| 858 | 8006966933 | 8006964411 | Bacteria | 8966052 |
| 859 | 8006979605 | 8006973647 | Bacteria | 10679141 |
| 860 | 8006984743 | 8006984368 | Bacteria | 9651211 |
| 861 | 8006994558 | 8006994254 | Bacteria | 8309700 |
| 862 | 8016518575 | 8016511872 | Bacteria | 9921665 |
| 863 | 8017058090 | 8017057580 | Bacteria | 10023680 |
| 864 | 8019565735 | 8019555841 | Bacteria | 9642137 |
| 865 | 8019575825 | 8019565922 | Bacteria | 9639779 |
| 866 | 8019577643 | 8019576017 | Bacteria | 10049540 |
| 867 | 8019595736 | 8019586578 | Bacteria | 10212056 |
| 868 | 8019606024 | 8019597564 | Bacteria | 10041141 |
| 869 | 8019612507 | 8019608314 | Bacteria | 10042931 |
| 870 | 8019652834 | 8019648815 | Bacteria | 10014479 |
| 871 | 8056680976 | 8056673599 | Bacteria | 7871253 |
| 872 | 8056690662 | 8056689827 | Bacteria | 6712655 |
| 873 | 8056970960 | 8056967851 | Bacteria | 9038162 |
| 874 | Ga0451797_1494679 | |||
| 875 | SwRhRL3b_contig_1238020 | |||
| 876 | JGI24750J21931_1013206 | |||
| 877 | JGI25159J45721_1000816 | |||
| 878 | JGI25151J46595_10002642 | |||
| 879 | JGI25153J46596_10007303 | |||
| 880 | JGI25153J46596_10008730 | |||
| 881 | JGI25153J46596_10074515 | |||
| 882 | rootH2_10236421 | |||
| 883 | rootH1_10071046 | |||
| 884 | rootH1_10071047 | |||
| 885 | rootH1_10078959 | |||
| 886 | rootH1_10112413 | |||
| 887 | rootH1_10143955 | |||
| 888 | JGI25160J50197_1000098 | |||
| 889 | JGI25160J50197_1051849 | |||
| 890 | JGI25161J50226_1000037 | |||
| 891 | Ga0006562J51391_1088900 | |||
| 892 | Ga0055529_1008113 | |||
| 893 | Ga0055537_1002928 | |||
| 894 | Ga0055536_1005074 | |||
| 895 | Ga0055534_1011333 | |||
| 896 | Ga0055528_1006502 | |||
| 897 | Ga0055530_10000358 | |||
| 898 | Ga0055540_1000184 | |||
| 899 | Ga0055540_1002572 | |||
| 900 | Ga0055540_1004932 | |||
| 901 | Ga0055531_10007321 | |||
| 902 | Ga0055543_1000497 | |||
| 903 | Ga0065165_1003507 | |||
| 904 | Ga0065165_1005429 | |||
| 905 | Ga0065707_10084400 | |||
| 906 | Ga0070658_10001105 | |||
| 907 | Ga0070658_10802114 | |||
| 908 | Ga0070677_10010390 | |||
| 909 | Ga0068869_100089288 | |||
| 910 | Ga0068869_100430277 | |||
| 911 | Ga0070682_100004212 | |||
| 912 | Ga0070682_100225158 | |||
| 913 | Ga0070682_100231187 | |||
| 914 | Ga0068868_100170776 | |||
| 915 | Ga0070660_100272659 | |||
| 916 | Ga0070689_100000001 | |||
| 917 | Ga0070687_100109508 | |||
| 918 | Ga0070661_100169704 | |||
| 919 | Ga0070668_100047101 | |||
| 920 | Ga0070669_100069310 | |||
| 921 | Ga0070669_100193411 | |||
| 922 | Ga0070669_100210499 | |||
| 923 | Ga0070675_100039997 | |||
| 924 | Ga0070675_100112227 | |||
| 925 | Ga0070671_100080948 | |||
| 926 | Ga0070674_100465225 | |||
| 927 | Ga0070673_100144915 | |||
| 928 | Ga0070659_100097337 | |||
| 929 | Ga0070667_100338829 | |||
| 930 | Ga0070709_10010218 | |||
| 931 | Ga0070709_10023884 | |||
| 932 | Ga0070714_100034368 | |||
| 933 | Ga0070714_100563328 | |||
| 934 | Ga0070713_100021922 | |||
| 935 | Ga0070713_100029770 | |||
| 936 | Ga0070713_100734826 | |||
| 937 | Ga0070710_10045296 | |||
| 938 | Ga0070711_100001277 | |||
| 939 | Ga0070711_100011775 | |||
| 940 | Ga0070711_100033622 | |||
| 941 | Ga0070705_100050929 | |||
| 942 | Ga0070708_100442554 | |||
| 943 | Ga0070663_100018048 | |||
| 944 | Ga0070663_100663840 | |||
| 945 | Ga0070678_100020333 | |||
| 946 | Ga0070678_100121263 | |||
| 947 | Ga0070662_100044005 | |||
| 948 | Ga0070681_10039786 | |||
| 949 | Ga0070706_100023429 | |||
| 950 | Ga0070706_100152682 | |||
| 951 | Ga0070706_100527355 | |||
| 952 | Ga0070707_100003493 | |||
| 953 | Ga0070698_100010386 | |||
| 954 | Ga0070698_100077569 | |||
| 955 | Ga0070699_100023882 | |||
| 956 | Ga0070699_100051293 | |||
| 957 | Ga0070699_100110458 | |||
| 958 | Ga0070699_100147650 | |||
| 959 | Ga0070684_100752475 | |||
| 960 | Ga0070697_100023386 | |||
| 961 | Ga0070697_100315534 | |||
| 962 | Ga0068853_100003441 | |||
| 963 | Ga0068853_100070176 | |||
| 964 | Ga0068853_100113688 | |||
| 965 | Ga0070696_100414138 | |||
| 966 | Ga0070693_100066004 | |||
| 967 | Ga0070693_100241966 | |||
| 968 | Ga0070665_100053421 | |||
| 969 | Ga0070665_100115134 | |||
| 970 | Ga0070665_100487683 | |||
| 971 | Ga0070665_100855314 | |||
| 972 | Ga0070665_101047843 | |||
| 973 | Ga0070704_100267527 | |||
| 974 | Ga0068855_100001976 | |||
| 975 | Ga0068855_100046285 | |||
| 976 | Ga0068855_100124947 | |||
| 977 | Ga0068855_100654906 | |||
| 978 | Ga0068857_100090580 | |||
| 979 | Ga0068857_101063229 | |||
| 980 | Ga0068854_100175887 | |||
| 981 | Ga0068856_100035409 | |||
| 982 | Ga0068856_100135779 | |||
| 983 | Ga0068856_100138137 | |||
| 984 | Ga0068856_100398239 | |||
| 985 | Ga0070702_100177824 | |||
| 986 | Ga0068852_100793932 | |||
| 987 | Ga0068859_100062750 | |||
| 988 | Ga0068859_100530743 | |||
| 989 | Ga0068864_100092604 | |||
| 990 | Ga0068864_100882137 | |||
| 991 | Ga0068864_100892161 | |||
| 992 | Ga0068861_100073695 | |||
| 993 | Ga0068861_100103930 | |||
| 994 | Ga0068851_10002794 | |||
| 995 | Ga0068863_100539031 | |||
| 996 | Ga0068860_100006055 | |||
| 997 | Ga0068860_100484086 | |||
| 998 | Ga0068862_100256051 | |||
| 999 | Ga0068862_100284097 | |||
| 1000 | Ga0068862_100294070 | |||
| 1001 | Ga0081455_10461714 | |||
| 1002 | Ga0081540_1011585 | |||
| 1003 | Ga0081540_1012130 | |||
| 1004 | Ga0081540_1045487 | |||
| 1005 | Ga0081539_10002350 | |||
| 1006 | Ga0081539_10189053 | |||
| 1007 | Ga0081539_10235049 | |||
| 1008 | Ga0070717_10543671 | |||
| 1009 | Ga0070717_10599018 | |||
| 1010 | Ga0075365_10147509 | |||
| 1011 | Ga0075365_10192285 | |||
| 1012 | Ga0075365_10361342 | |||
| 1013 | Ga0075363_100028797 | |||
| 1014 | Ga0075363_100029159 | |||
| 1015 | Ga0075363_100037949 | |||
| 1016 | Ga0075363_100077076 | |||
| 1017 | Ga0075364_10062210 | |||
| 1018 | Ga0075364_10351520 | |||
| 1019 | Ga0075364_10352054 | |||
| 1020 | Ga0070715_10184915 | |||
| 1021 | Ga0070716_100106728 | |||
| 1022 | Ga0070712_100029964 | |||
| 1023 | Ga0075362_10016617 | |||
| 1024 | Ga0075362_10032523 | |||
| 1025 | Ga0075362_10043582 | |||
| 1026 | Ga0075362_10197035 | |||
| 1027 | Ga0075367_10005456 | |||
| 1028 | Ga0075367_10041321 | |||
| 1029 | Ga0075367_10214687 | |||
| 1030 | Ga0075369_10005854 | |||
| 1031 | Ga0075369_10033816 | |||
| 1032 | Ga0075366_10000857 | |||
| 1033 | Ga0075366_10116389 | |||
| 1034 | Ga0075366_10197976 | |||
| 1035 | Ga0097621_100104347 | |||
| 1036 | Ga0075370_10003260 | |||
| 1037 | Ga0075370_10010598 | |||
| 1038 | Ga0075370_10045526 | |||
| 1039 | Ga0068871_100174028 | |||
| 1040 | Ga0075428_100967490 | |||
| 1041 | Ga0075434_100000932 | |||
| 1042 | Ga0075434_100229465 | |||
| 1043 | Ga0075434_100380898 | |||
| 1044 | Ga0075436_100004513 | |||
| 1045 | Ga0075436_100013837 | |||
| 1046 | Ga0097620_100062751 | |||
| 1047 | Ga0097620_100530740 | |||
| 1048 | Ga0099824_1033654 | |||
| 1049 | Ga0099822_1006869 | |||
| 1050 | Ga0099823_1045448 | |||
| 1051 | Ga0075435_100004811 | |||
| 1052 | Ga0099795_10019563 | |||
| 1053 | Ga0099795_10087927 | |||
| 1054 | Ga0105240_10000309 | |||
| 1055 | Ga0105240_10000565 | |||
| 1056 | Ga0105240_10001377 | |||
| 1057 | Ga0105240_10103703 | |||
| 1058 | Ga0105240_10105433 | |||
| 1059 | Ga0105240_10364986 | |||
| 1060 | Ga0111539_10069205 | |||
| 1061 | Ga0111539_10761647 | |||
| 1062 | Ga0105245_10044415 | |||
| 1063 | Ga0105245_10812281 | |||
| 1064 | Ga0105247_10000116 | |||
| 1065 | Ga0114129_10018519 | |||
| 1066 | Ga0105243_10003118 | |||
| 1067 | Ga0105243_10090809 | |||
| 1068 | Ga0105243_10123374 | |||
| 1069 | Ga0105243_10142382 | |||
| 1070 | Ga0105243_10760194 | |||
| 1071 | Ga0105241_10109588 | |||
| 1072 | Ga0105241_10561622 | |||
| 1073 | Ga0105241_10635768 | |||
| 1074 | Ga0105242_10499305 | |||
| 1075 | Ga0105248_10040984 | |||
| 1076 | Ga0105248_10721809 | |||
| 1077 | Ga0105237_10000197 | |||
| 1078 | Ga0105237_10003925 | |||
| 1079 | Ga0105237_10009767 | |||
| 1080 | Ga0105237_10030930 | |||
| 1081 | Ga0105237_10036637 | |||
| 1082 | Ga0105237_10088966 | |||
| 1083 | Ga0105237_10402494 | |||
| 1084 | Ga0105238_10009635 | |||
| 1085 | Ga0105238_10016742 | |||
| 1086 | Ga0105238_10033064 | |||
| 1087 | Ga0105238_10156872 | |||
| 1088 | Ga0105238_10211526 | |||
| 1089 | Ga0105249_10108438 | |||
| 1090 | Ga0105249_10752576 | |||
| 1091 | Ga0105147_104762 | |||
| 1092 | Ga0099796_10012085 | |||
| 1093 | Ga0105239_10002899 | |||
| 1094 | Ga0105239_10040562 | |||
| 1095 | Ga0105239_10064526 | |||
| 1096 | Ga0105239_10064829 | |||
| 1097 | Ga0105239_10121243 | |||
| 1098 | Ga0105239_10152944 | |||
| 1099 | Ga0105239_10173240 | |||
| 1100 | Ga0105239_10607262 | |||
| 1101 | Ga0157347_1005055 | |||
| 1102 | Ga0157373_10000027 | |||
| 1103 | Ga0157373_10065586 | |||
| 1104 | Ga0157371_10041430 | |||
| 1105 | Ga0157370_10012712 | |||
| 1106 | Ga0157378_10071250 | |||
| 1107 | Ga0157378_10132490 | |||
| 1108 | Ga0157378_10598963 | |||
| 1109 | Ga0157378_10918147 | |||
| 1110 | Ga0163162_10388975 | |||
| 1111 | Ga0157375_10912797 | |||
| 1112 | Ga0157380_10542872 | |||
| 1113 | Ga0157376_10945855 | |||
| 1114 | Ga0182006_1039094 | |||
| 1115 | Ga0163161_10000446 | |||
| 1116 | Ga0163161_10028289 | |||
| 1117 | Ga0163161_10275315 | |||
| 1118 | Ga0213876_10110878 | |||
| 1119 | Ga0213875_10085621 | |||
| 1120 | Ga0209436_105359 | |||
| 1121 | Ga0207425_1002709 | |||
| 1122 | Ga0209677_102734 | |||
| 1123 | Ga0209148_1000334 | |||
| 1124 | Ga0209129_1004239 | |||
| 1125 | Ga0209233_1001804 | |||
| 1126 | Ga0209233_1008944 | |||
| 1127 | Ga0209565_1001371 | |||
| 1128 | Ga0209455_1004147 | |||
| 1129 | Ga0209673_1002874 | |||
| 1130 | Ga0209130_1000141 | |||
| 1131 | Ga0209675_1005201 | |||
| 1132 | Ga0209676_1000432 | |||
| 1133 | Ga0209676_1001071 | |||
| 1134 | Ga0209025_1000294 | |||
| 1135 | Ga0209025_1004609 | |||
| 1136 | Ga0209564_1024100 | |||
| 1137 | Ga0209564_1030148 | |||
| 1138 | Ga0209758_1000249 | |||
| 1139 | Ga0209758_1001476 | |||
| 1140 | Ga0209758_1004383 | |||
| 1141 | Ga0209758_1011353 | |||
| 1142 | Ga0209050_1000015 | |||
| 1143 | Ga0209050_1004667 | |||
| 1144 | Ga0209256_1042224 | |||
| 1145 | Ga0207426_1000145 | |||
| 1146 | Ga0207426_1000942 | |||
| 1147 | Ga0209051_1000081 | |||
| 1148 | Ga0209051_1000622 | |||
| 1149 | Ga0209257_1003557 | |||
| 1150 | Ga0209257_1008029 | |||
| 1151 | Ga0209257_1024427 | |||
| 1152 | Ga0207656_10002219 | |||
| 1153 | Ga0207656_10134803 | |||
| 1154 | Ga0207682_10013101 | |||
| 1155 | Ga0207692_10057994 | |||
| 1156 | Ga0207710_10000418 | |||
| 1157 | Ga0207688_10163985 | |||
| 1158 | Ga0207685_10119631 | |||
| 1159 | Ga0207699_10022976 | |||
| 1160 | Ga0207699_10038622 | |||
| 1161 | Ga0207699_10267994 | |||
| 1162 | Ga0207645_10190666 | |||
| 1163 | Ga0207705_10076636 | |||
| 1164 | Ga0207705_10572300 | |||
| 1165 | Ga0207684_10028736 | |||
| 1166 | Ga0207684_10089458 | |||
| 1167 | Ga0207684_10177822 | |||
| 1168 | Ga0207695_10000062 | |||
| 1169 | Ga0207695_10000635 | |||
| 1170 | Ga0207695_10013961 | |||
| 1171 | Ga0207695_10028199 | |||
| 1172 | Ga0207695_10400196 | |||
| 1173 | Ga0207671_10000092 | |||
| 1174 | Ga0207671_10001542 | |||
| 1175 | Ga0207671_10009825 | |||
| 1176 | Ga0207671_10038038 | |||
| 1177 | Ga0207693_10019913 | |||
| 1178 | Ga0207693_10043663 | |||
| 1179 | Ga0207663_10015201 | |||
| 1180 | Ga0207657_10256747 | |||
| 1181 | Ga0207652_10032949 | |||
| 1182 | Ga0207646_10002497 | |||
| 1183 | Ga0207681_10072121 | |||
| 1184 | Ga0207681_10076479 | |||
| 1185 | Ga0207694_10017263 | |||
| 1186 | Ga0207694_10017771 | |||
| 1187 | Ga0207694_10084911 | |||
| 1188 | Ga0207650_10774650 | |||
| 1189 | Ga0207659_10128879 | |||
| 1190 | Ga0207687_10496494 | |||
| 1191 | Ga0207687_10508832 | |||
| 1192 | Ga0207700_10014831 | |||
| 1193 | Ga0207700_10017552 | |||
| 1194 | Ga0207700_10154742 | |||
| 1195 | Ga0207700_10256390 | |||
| 1196 | Ga0207664_10058493 | |||
| 1197 | Ga0207664_10449439 | |||
| 1198 | Ga0207690_10051486 | |||
| 1199 | Ga0207706_10057225 | |||
| 1200 | Ga0207706_10508681 | |||
| 1201 | Ga0207709_10000234 | |||
| 1202 | Ga0207709_10359196 | |||
| 1203 | Ga0207670_10000002 | |||
| 1204 | Ga0207665_10133713 | |||
| 1205 | Ga0207691_10001208 | |||
| 1206 | Ga0207691_10169528 | |||
| 1207 | Ga0207691_10229063 | |||
| 1208 | Ga0207711_10045791 | |||
| 1209 | Ga0207711_10077163 | |||
| 1210 | Ga0207689_10057386 | |||
| 1211 | Ga0207679_10668827 | |||
| 1212 | Ga0207667_10001145 | |||
| 1213 | Ga0207667_10032537 | |||
| 1214 | Ga0207667_10151895 | |||
| 1215 | Ga0207667_10368925 | |||
| 1216 | Ga0207651_10097753 | |||
| 1217 | Ga0207712_10171241 | |||
| 1218 | Ga0207668_10041674 | |||
| 1219 | Ga0207668_10099407 | |||
| 1220 | Ga0207668_10452090 | |||
| 1221 | Ga0207668_10650335 | |||
| 1222 | Ga0207640_10441851 | |||
| 1223 | Ga0207677_10178141 | |||
| 1224 | Ga0207677_10225718 | |||
| 1225 | Ga0207677_10282668 | |||
| 1226 | Ga0207639_10023520 | |||
| 1227 | Ga0207639_10121594 | |||
| 1228 | Ga0207639_10320293 | |||
| 1229 | Ga0207639_10325153 | |||
| 1230 | Ga0207678_10029063 | |||
| 1231 | Ga0207678_10097478 | |||
| 1232 | Ga0207678_10136110 | |||
| 1233 | Ga0207678_10467319 | |||
| 1234 | Ga0207702_10120251 | |||
| 1235 | Ga0207702_10174470 | |||
| 1236 | Ga0207702_10260285 | |||
| 1237 | Ga0207702_10548536 | |||
| 1238 | Ga0207641_10843073 | |||
| 1239 | Ga0207676_10442556 | |||
| 1240 | Ga0207674_10067179 | |||
| 1241 | Ga0207674_10401043 | |||
| 1242 | Ga0207683_10488150 | |||
| 1243 | Ga0207683_10556851 | |||
| 1244 | Ga0209389_1000064 | |||
| 1245 | Ga0209371_1033240 | |||
| 1246 | Ga0209589_1000001 | |||
| 1247 | Ga0209489_100001 | |||
| 1248 | Ga0209489_104185 | |||
| 1249 | Ga0209700_100001 | |||
| 1250 | Ga0209700_100014 | |||
| 1251 | Ga0209179_1082758 | |||
| 1252 | Ga0207428_10078804 | |||
| 1253 | Ga0268266_10002834 | |||
| 1254 | Ga0268266_10065384 | |||
| 1255 | Ga0268266_10457369 | |||
| 1256 | Ga0268265_10028815 | |||
| 1257 | Ga0268265_10676695 | |||
| 1258 | Ga0268264_10000427 | |||
| 1259 | Ga0265337_1008184 | |||
| 1260 | Ga0265319_1036810 | |||
| 1261 | Ga0307515_10000109 | |||
| 1262 | Ga0268256_1044003 | |||
| 1263 | Ga0307512_10097214 | |||
| 1264 | Ga0307512_10228006 | |||
| 1265 | Ga0265330_10052677 | |||
| 1266 | Ga0265332_10072186 | |||
| 1267 | Ga0265320_10018243 | |||
| 1268 | Ga0265340_10026474 | |||
| 1269 | Ga0265316_10132291 | |||
| 1270 | Ga0265316_10155884 | |||
| 1271 | Ga0307513_10000015 | |||
| 1272 | Ga0307513_10020111 | |||
| 1273 | Ga0307513_10045412 | |||
| 1274 | Ga0307513_10055215 | |||
| 1275 | Ga0307513_10098953 | |||
| 1276 | Ga0307513_10128857 | |||
| 1277 | Ga0307513_10148613 | |||
| 1278 | Ga0307509_10491567 | |||
| 1279 | Ga0307509_10521620 | |||
| 1280 | Ga0307408_100042038 | |||
| 1281 | Ga0307408_100214957 | |||
| 1282 | Ga0307408_100879520 | |||
| 1283 | Ga0265313_10076856 | |||
| 1284 | Ga0265313_10121681 | |||
| 1285 | Ga0307508_10000246 | |||
| 1286 | Ga0307508_10006278 | |||
| 1287 | Ga0307508_10009734 | |||
| 1288 | Ga0307508_10018036 | |||
| 1289 | Ga0307508_10143179 | |||
| 1290 | Ga0307514_10020362 | |||
| 1291 | Ga0265342_10088475 | |||
| 1292 | Ga0307516_10006708 | |||
| 1293 | Ga0307516_10123935 | |||
| 1294 | Ga0307405_10077124 | |||
| 1295 | Ga0307405_10092740 | |||
| 1296 | Ga0307413_10154788 | |||
| 1297 | Ga0307413_10538529 | |||
| 1298 | Ga0307409_100383772 | |||
| 1299 | Ga0307416_100023421 | |||
| 1300 | Ga0307416_100873102 | |||
| 1301 | Ga0307414_10612364 | |||
| 1302 | Ga0307411_10453620 | |||
| 1303 | Ga0307411_10462305 | |||
| 1304 | Ga0307507_10043771 | |||
| 1305 | Ga0307507_10236786 | |||
| 1306 | Ga0307510_10007100 | |||
| 1307 | Ga0307510_10020152 | |||
| 1308 | Ga0307510_10059830 | |||
| 1309 | Ga0307510_10217439 | |||
| 1310 | Ga0315911_1000002 | |||
| 1311 | Ga0316588_1049097 | |||
| 1312 | Ga0373934_0051717 | |||
| 1313 | Ga0373944_0028431 | |||
| 1314 | Ga0373923_0049895 | |||
| 1315 | Ga0373943_0022548 | |||
| 1316 | Ga0373924_0089893 | |||
| 1317 | Ga0373933_0000164 | |||
| 1318 | Ga0373937_0261117 | |||
| 1319 | Ga0373925_0038084 | |||
| 1320 | Ga0395898_0237261 | |||
| 1321 | Ga0395905_0015214 | |||
| 1322 | Ga0436364_0166031 | |||
| 1323 | Ga0436364_0176246 | |||
| 1324 | Ga0395901_0320216 | |||
| 1325 | Ga0400490_59588 | |||
| 1326 | Ga0400483_037459 | |||
| 1327 | Ga0400483_079217 | |||
| 1328 | Ga0400483_092352 | |||
| 1329 | Ga0400483_222230 | |||
| 1330 | Ga0400483_222800 | |||
| 1331 | Ga0436365_0022917 | |||
| 1332 | Ga0436365_0694465 | |||
| 1333 | Ga0439436_0001353 | |||
| 1334 | Ga0439438_024843 | |||
| 1335 | Ga0439439_0002684 | |||
| 1336 | Ga0439461_0023308 | |||
| 1337 | Ga0451789_0190617 | |||
| 1338 | Ga0451797_0912266 | |||
| 1339 | Ga0451807_0885740 | |||
| 1340 | Ga0451807_2272697 | |||
| 1341 | Ga0439433_0022342 | |||
| 1342 | Ga0439432_004573 | |||
| 1343 | Ga0439449_0004052 | |||
| 1344 | Ga0439452_001303 | |||
| 1345 | Ga0439457_014966 | |||
| 1346 | Ga0450897_003577 | |||
| 1347 | Ga0450896_025860 | |||
| 1348 | Ga0450910_003635 | |||
| 1349 | Ga0450909_016170 | |||
| 1350 | Ga0451577_0017106 | |||
| 1351 | Ga0451577_0024143 | |||
| 1352 | Ga0466969_0152366 | |||
| 1353 | Ga0453683_0163556 | |||
| 1354 | Ga0466965_0206433 | |||
| 1355 | Ga0466961_0353826 | |||
| 1356 | Ga0466963_0145419 | |||
| 1357 | Ga0466964_0225110 | |||
| 1358 | Ga0453684_0138384 | |||
| 1359 | Ga0466957_0164597 | |||
| 1360 | Ga0451576_0130666 | |||
| 1361 | Ga0466967_0822628 | |||
| 1362 | Ga0495617_114028 | |||
| 1363 | Ga0495627_021305 | |||
| 1364 | Ga0495592_0022519 | |||
| 1365 | Ga0495603_0047679 | |||
| 1366 | Ga0495590_0049205 | |||
| 1367 | Ga0495591_000353 | |||
| 1368 | Ga0495591_004510 | |||
| 1369 | Ga0495638_0018358 | |||
| 1370 | Ga0495638_0094282 | |||
| 1371 | Ga0495638_0240898 | |||
| 1372 | Ga0495641_0067953 | |||
| 1373 | Ga0495580_0056114 | |||
| 1374 | Ga0495582_0086227 | |||
| 1375 | Ga0495582_0235766 | |||
| 1376 | Ga0495605_0000436 | |||
| 1377 | Ga0495605_0001028 | |||
| 1378 | Ga0495639_0118631 | |||
| 1379 | Ga0495664_0003029 | |||
| 1380 | Ga0495584_0216591 | |||
| 1381 | Ga0495585_0119051 | |||
| 1382 | Ga0495594_0005421 | |||
| 1383 | Ga0495594_0186964 | |||
| 1384 | Ga0495594_0232494 | |||
| 1385 | Ga0495607_0009324 | |||
| 1386 | Ga0495607_0075075 | |||
| 1387 | Ga0495583_0000028 | |||
| 1388 | Ga0495606_0127987 | |||
| 1389 | Ga0495606_0198783 | |||
| 1390 | Ga0495606_0275738 | |||
| 1391 | Ga0495610_0017908 | |||
| 1392 | Ga0495610_0090366 | |||
| 1393 | Ga0495616_0198743 | |||
| 1394 | Ga0495616_0202819 | |||
| 1395 | Ga0495618_0035740 | |||
| 1396 | Ga0495620_0000028 | |||
| 1397 | Ga0495620_0046712 | |||
| 1398 | Ga0495620_0111270 | |||
| 1399 | Ga0495628_0088858 | |||
| 1400 | Ga0495630_0081340 | |||
| 1401 | Ga0495631_0019696 | |||
| 1402 | Ga0495631_0143208 | |||
| 1403 | Ga0495631_0176428 | |||
| 1404 | Ga0495632_0075399 | |||
| 1405 | Ga0495637_0058026 | |||
| 1406 | Ga0495637_0087414 | |||
| 1407 | Ga0495643_0000057 | |||
| 1408 | Ga0495643_0007531 | |||
| 1409 | Ga0495643_0148394 | |||
| 1410 | Ga0495644_0134473 | |||
| 1411 | Ga0495648_0018358 | |||
| 1412 | Ga0495648_0105183 | |||
| 1413 | Ga0495648_0229435 | |||
| 1414 | Ga0495652_0121872 | |||
| 1415 | Ga0495652_0203451 | |||
| 1416 | Ga0495654_0001115 | |||
| 1417 | Ga0495654_0066737 | |||
| 1418 | Ga0495654_0073586 | |||
| 1419 | Ga0495654_0152662 | |||
| 1420 | Ga0495665_0097196 | |||
| 1421 | Ga0495640_0083808 | |||
| 1422 | Ga0495586_0163432 | |||
| 1423 | Ga0495598_0089915 | |||
| 1424 | Ga0495609_0000081 | |||
| 1425 | Ga0495621_0132401 | |||
| 1426 | Ga0495597_0000037 | |||
| 1427 | Ga0495597_0026112 | |||
| 1428 | Ga0495622_0086965 | |||
| 1429 | Ga0495622_0167545 | |||
| 1430 | Ga0495633_0000028 | |||
| 1431 | Ga0495656_0141514 | |||
| 1432 | Ga0495668_0074227 | |||
| 1433 | Ga0495668_0265863 | |||
| 1434 | Ga0495668_0317735 | |||
| 1435 | Ga0495611_0008756 | |||
| 1436 | Ga0495611_0111947 | |||
| 1437 | Ga0495625_0130041 | |||
| 1438 | Ga0495625_0178502 | |||
| 1439 | Ga0495661_0000217 | |||
| 1440 | Ga0495661_0010263 | |||
| 1441 | Ga0495661_0142128 | |||
| 1442 | Ga0495588_0259671 | |||
| 1443 | Ga0495588_0279796 | |||
| 1444 | Ga0495647_0021985 | |||
| 1445 | Ga0495624_0108077 | |||
| 1446 | Ga0495670_0001463 | |||
| 1447 | Ga0495671_0006278 | |||
| 1448 | Ga0495671_0033794 | |||
| 1449 | Ga0495671_0276521 | |||
| 1450 | Ga0495649_0316663 | |||
| 1451 | Ga0495589_0010125 | |||
| 1452 | Ga0495660_0000568 | |||
| 1453 | Ga0495660_0003536 | |||
| 1454 | Ga0495660_0015689 | |||
| 1455 | Ga0495660_0203201 | |||
| 1456 | Ga0495604_0172449 | |||
| 1457 | Ga0495674_0037149 | |||
| 1458 | Ga0495672_0072361 | |||
| 1459 | Ga0495672_0101109 | |||
| 1460 | Ga0495672_0244747 | |||
| 1461 | Ga0495683_0000060 | |||
| 1462 | Ga0495683_0112253 | |||
| 1463 | Ga0495683_0222511 | |||
| 1464 | Ga0495687_049654 | |||
| 1465 | Ga0495679_000823 | |||
| 1466 | Ga0495681_0024953 | |||
| 1467 | Ga0495686_0095860 | |||
| 1468 | Ga0495686_0327534 | |||
| 1469 | Ga0495602_0225582 | |||
| 1470 | Ga0496102_0190387 | |||
| 1471 | Ga0496103_0010374 | |||
| 1472 | Ga0496104_0201716 | |||
| 1473 | Ga0496106_0000002 | |||
| 1474 | Ga0496106_0258759 | |||
| 1475 | Ga0496107_0028046 | |||
| 1476 | Ga0496108_0198145 | |||
| 1477 | Ga0496109_0283565 | |||
| 1478 | Ga0496110_0303802 | |||
| 1479 | Ga0496111_0063380 | |||
| 1480 | Ga0496112_0019936 | |||
| 1481 | Ga0496112_0436698 | |||
| 1482 | Ga0496113_0270307 | |||
| 1483 | Ga0496114_0377032 | |||
| 1484 | Ga0496116_0042778 | |||
| 1485 | Ga0496116_0066692 | |||
| 1486 | Ga0496117_0080858 | |||
| 1487 | Ga0496117_0090460 | |||
| 1488 | Ga0496117_0291583 | |||
| 1489 | Ga0496117_0320977 | |||
| 1490 | Ga0496118_0074574 | |||
| 1491 | Ga0496118_0075118 | |||
| 1492 | Ga0496118_0164712 | |||
| 1493 | Ga0496118_0299639 | |||
| 1494 | Ga0496118_0331017 | |||
| 1495 | Ga0496119_0170381 | |||
| 1496 | Ga0496120_0133123 | |||
| 1497 | Ga0496121_0002830 | |||
| 1498 | Ga0496121_0025670 | |||
| 1499 | Ga0496121_0027094 | |||
| 1500 | Ga0496121_0085899 | |||
| 1501 | Ga0496121_0168730 | |||
| 1502 | Ga0496121_0235102 | |||
| 1503 | Ga0496121_0238341 | |||
| 1504 | Ga0496121_0289078 | |||
| 1505 | Ga0496121_0418563 | |||
| 1506 | Ga0496121_0433577 | |||
| 1507 | Ga0496122_0011516 | |||
| 1508 | Ga0496122_0033725 | |||
| 1509 | Ga0496122_0228024 | |||
| 1510 | Ga0496123_0000314 | |||
| 1511 | Ga0496123_0038366 | |||
| 1512 | Ga0496123_0091378 | |||
| 1513 | Ga0496124_0272098 | |||
| 1514 | Ga0496124_0290361 | |||
| 1515 | Ga0496124_0386655 | |||
| 1516 | Ga0496125_0002440 | |||
| 1517 | Ga0496125_0051382 | |||
| 1518 | Ga0496125_0171134 | |||
| 1519 | Ga0496126_0012386 | |||
| 1520 | Ga0496126_0031229 | |||
| 1521 | Ga0496126_0034574 | |||
| 1522 | Ga0496126_0189625 | |||
| 1523 | Ga0496126_0209436 | |||
| 1524 | Ga0496126_0367270 | |||
| 1525 | Ga0496126_0375518 | |||
| 1526 | Ga0496126_0550610 | |||
| 1527 | Ga0496126_0625567 | |||
| 1528 | Ga0495678_000020 | |||
| 1529 | Ga0501031_0061738 | |||
| 1530 | Ga0501033_0466496 | |||
| 1531 | Ga0501047_0017499 | |||
| 1532 | Ga0501048_0001083 | |||
| 1533 | Ga0501067_0104958 | |||
| 1534 | Ga0501070_0433096 | |||
| 1535 | Ga0501080_0008470 | |||
| 1536 | Ga0501035_0171787 | |||
| 1537 | Ga0501044_0031380 | |||
| 1538 | Ga0501044_0581210 | |||
| 1539 | nmdc:mga03683_24199_c1 | |||
| 1540 | nmdc:mga03683_246495_c1 | |||
| 1541 | nmdc:mga03683_26419_c1 | |||
| 1542 | nmdc:mga03683_36720_c1 | |||
| 1543 | nmdc:mga03n38_12752_c1 | |||
| 1544 | nmdc:mga03n38_144255_c1 | |||
| 1545 | nmdc:mga03n38_34390_c1 | |||
| 1546 | nmdc:mga03n38_72711_c1 | |||
| 1547 | nmdc:mga00v17_153444_c1 | |||
| 1548 | nmdc:mga00v17_43195_c1 | |||
| 1549 | nmdc:mga00v17_65780_c1 | |||
| 1550 | nmdc:mga00v17_84082_c1 | |||
| 1551 | nmdc:mga0yw44_197834_c1 | |||
| 1552 | nmdc:mga0yw44_201313_c1 | |||
| 1553 | nmdc:mga0k408_125833_c1 | |||
| 1554 | nmdc:mga0k408_184951_c1 | |||
| 1555 | nmdc:mga0k408_218754_c1 | |||
| 1556 | nmdc:mga0k408_233813_c1 | |||
| 1557 | nmdc:mga0k408_667_c1 | |||
| 1558 | nmdc:mga0k408_73324_c1 | |||
| 1559 | nmdc:mga06z11_33139_c1 | |||
| 1560 | nmdc:mga06z11_45724_c1 | |||
| 1561 | nmdc:mga06z11_91252_c1 | |||
| 1562 | nmdc:mga06z11_91278_c1 | |||
| 1563 | nmdc:mga07m45_64277_c1 | |||
| 1564 | nmdc:mga05p37_24646_c1 | |||
| 1565 | nmdc:mga08y16_684570_c1 | |||
| 1566 | nmdc:mga0n895_332819_c1 | |||
| 1567 | nmdc:mga0rr50_19965_c1 | |||
| 1568 | nmdc:mga08x19_191018_c1 | |||
| 1569 | nmdc:mga08x19_273905_c1 | |||
| 1570 | nmdc:mga0a205_288615_c1 | |||
| 1571 | nmdc:mga0sz30_121528_c1 | |||
| 1572 | nmdc:mga0sz30_178204_c1 | |||
| 1573 | nmdc:mga0sz30_30521_c1 | |||
| 1574 | Ga0495655_0038438 | |||
| 1575 | Ga0495655_0049109 | |||
| 1576 | Ga0500643_001635 | |||
| 1577 | Ga0500644_0003163 | |||
| 1578 | Ga0500644_0094479 | |||
| 1579 | Ga0500581_020365 | |||
| 1580 | Ga0500646_0027161 | |||
| 1581 | Ga0500647_0141254 | |||
| 1582 | Ga0500583_0064544 | |||
| 1583 | Ga0500651_0115319 | |||
| 1584 | Ga0500651_0165488 | |||
| 1585 | Ga0500566_0041846 | |||
| 1586 | Ga0500566_0067562 | |||
| 1587 | Ga0500566_0188741 | |||
| 1588 | Ga0500640_048736 | |||
| 1589 | Ga0500641_0036253 | |||
| 1590 | Ga0500650_0001279 | |||
| 1591 | Ga0500650_0055751 | |||
| 1592 | Ga0500556_0000015 | |||
| 1593 | Ga0500557_000822 | |||
| 1594 | Ga0500569_003618 | |||
| 1595 | Ga0500592_020250 | |||
| 1596 | Ga0500593_035827 | |||
| 1597 | Ga0500594_0150818 | |||
| 1598 | Ga0500595_000002 | |||
| 1599 | Ga0500607_051290 | |||
| 1600 | Ga0500608_001202 | |||
| 1601 | Ga0500614_022890 | |||
| 1602 | Ga0500618_044278 | |||
| 1603 | Ga0500642_0000044 | |||
| 1604 | Ga0500652_000638 | |||
| 1605 | Ga0500568_0000661 | |||
| 1606 | Ga0500586_003197 | |||
| 1607 | Ga0500603_007887 | |||
| 1608 | Ga0500604_0005252 | |||
| 1609 | Ga0500616_0000001 | |||
| 1610 | Ga0500616_0000041 | |||
| 1611 | Ga0500622_0000700 | |||
| 1612 | Ga0500627_0184689 | |||
| 1613 | Ga0500630_056839 | |||
| 1614 | Ga0500634_0177705 | |||
| 1615 | Ga0500639_004098 | |||
| 1616 | Ga0500636_0009242 | |||
| 1617 | Ga0500636_0015565 | |||
| 1618 | Ga0500625_096922 | |||
| 1619 | Ga0500645_010186 | |||
| 1620 | Ga0501082_0346876 | |||
| 1621 | 2501407527 | |||
| 1622 | 2511097395 | |||
| 1623 | 2511105650 | |||
| 1624 | 2511244051 | |||
| 1625 | 2512346550 | |||
| 1626 | 2513639593 | |||
| 1627 | 2513647921 | |||
| 1628 | 2513653728 | |||
| 1629 | 2513693661 | |||
| 1630 | 2513856168 | |||
| 1631 | 2513918068 | |||
| 1632 | 2517891692 | |||
| 1633 | 2524437231 | |||
| 1634 | 2524536687 | |||
| 1635 | 2528851632 | |||
| 1636 | 2587757677 | |||
| 1637 | 2599621349 | |||
| 1638 | 2599670967 | |||
| 1639 | 2599679457 | |||
| 1640 | 2599690860 | |||
| 1641 | 2603860763 | |||
| 1642 | 2644465584 | |||
| 1643 | 2671118538 | |||
| 1644 | 2723843567 | |||
| 1645 | 2728754845 | |||
| 1646 | 2739249202 | |||
| 1647 | 2745076449 | |||
| 1648 | 2793063071 | |||
| 1649 | 2793067066 | |||
| 1650 | 2793082894 | |||
| 1651 | 2818237321 | |||
| 1652 | 2819597529 | |||
| 1653 | 2824664773 | |||
| 1654 | 2838057947 | |||
| 1655 | 2844321865 | |||
| 1656 | 2847931428 | |||
| 1657 | 2857511611 | |||
| 1658 | 2857524798 | |||
| 1659 | 2858953914 | |||
| 1660 | 2874611524 | |||
| 1661 | 2876769002 | |||
| 1662 | 2876816595 | |||
| 1663 | 2879087536 | |||
| 1664 | 2879114969 | |||
| 1665 | 2885200197 | |||
| 1666 | 2885213849 | |||
| 1667 | 2885381022 | |||
| 1668 | 2885418350 | |||
| 1669 | 2887379161 | |||
| 1670 | 2888379922 | |||
| 1671 | 2893069312 | |||
| 1672 | 2903727585 | |||
| 1673 | 2903755400 | |||
| 1674 | 2903768500 | |||
| 1675 | 2904451478 | |||
| 1676 | 2904543122 | |||
| 1677 | 2904698497 | |||
| 1678 | 2904704550 | |||
| 1679 | 2906602925 | |||
| 1680 | 2906616867 | |||
| 1681 | 2906642906 | |||
| 1682 | 2906649058 | |||
| 1683 | 2906667196 | |||
| 1684 | 2908742054 | |||
| 1685 | 2908762491 | |||
| 1686 | 2919078684 | |||
| 1687 | 2922361823 | |||
| 1688 | 2922378304 | |||
| 1689 | 2922386939 | |||
| 1690 | 2922431060 | |||
| 1691 | 2928040616 | |||
| 1692 | 2928046635 | |||
| 1693 | 2928058181 | |||
| 1694 | 2928067482 | |||
| 1695 | 2928072009 | |||
| 1696 | 2929160355 | |||
| 1697 | 2932786390 | |||
| 1698 | 2932794645 | |||
| 1699 | 2932829628 | |||
| 1700 | 2935618146 | |||
| 1701 | 2935636944 | |||
| 1702 | 2935641456 | |||
| 1703 | 2935669486 | |||
| 1704 | 2935677916 | |||
| 1705 | 2935689635 | |||
| 1706 | 2935707311 | |||
| 1707 | 2935717155 | |||
| 1708 | 2935730011 | |||
| 1709 | 2935738570 | |||
| 1710 | 2935749182 | |||
| 1711 | 2935756989 | |||
| 1712 | 2935804310 | |||
| 1713 | 2935815394 | |||
| 1714 | 2935831187 | |||
| 1715 | 2935841796 | |||
| 1716 | 2935856355 | |||
| 1717 | 2935866313 | |||
| 1718 | 2935874619 | |||
| 1719 | 2935962322 | |||
| 1720 | 2935994080 | |||
| 1721 | 2936004909 | |||
| 1722 | 2936045049 | |||
| 1723 | 2940562903 | |||
| 1724 | 2941513600 | |||
| 1725 | 2941521544 | |||
| 1726 | 2941529298 | |||
| 1727 | 2941543869 | |||
| 1728 | 3005480883 | |||
| 1729 | 3005597659 | |||
| 1730 | 8006939835 | |||
| 1731 | 8006966933 | |||
| 1732 | 8006979605 | |||
| 1733 | 8006984743 | |||
| 1734 | 8006994558 | |||
| 1735 | 8016518575 | |||
| 1736 | 8017058090 | |||
| 1737 | 8019565735 | |||
| 1738 | 8019575825 | |||
| 1739 | 8019577643 | |||
| 1740 | 8019595736 | |||
| 1741 | 8019606024 | |||
| 1742 | 8019612507 | |||
| 1743 | 8019652834 | |||
| 1744 | 8056680976 | |||
| 1745 | 8056690662 | |||
| 1746 | 8056970960 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9336 | 2 | 229 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9258 | 2 | 229 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9209 | 2 | 216 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9097 | 2 | 215 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9096 | 2 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9394 | 1 | 228 | 3.40.50.300 |
| af_P77257_8_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9345 | 2 | 227 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9315 | 1 | 228 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9312 | 2 | 215 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9205 | 2 | 213 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5IBP4-F1-model_v4 | deleted | 0.9709 | 1 | 228 |
|
| AF-A0A269XWW6-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 0.9702 | 2 | 229 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A382XKN7-F1-model_v4 | ABC transporter domain-containing protein | 0.963 | 4 | 211 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A7W5IBP4-F1-model_v4 | deleted | 0.9626 | 1 | 228 |
|
| AF-A0A269XWW6-F1-model_v4 | Urea ABC transporter ATP-binding subunit UrtE | 0.9618 | 2 | 229 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |