F484227

General Info

Members Datasets Scaffolds Average Seq Length
872 481 1744 171

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1980144|Ga0451853_1980144_1314_1889
Length 191
Sequence MLDGGRMDVKDVLIDAFGRIREEVHAVVDGLSQADLHARPAPDANSVAWLVWHLTRIQDDHVADAAGREQVWLSQGWEKRFGLALAARDTGYGHSPAQVAQVRVGSGDLLTGYFDAVHEQTGEFVRGVDADALDRIVDERWTPAVTLGVRLVSVLADDLQHVGQAAYVRGLVRREGGQEPVRRPPRTSGGL

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
186 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
211 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
235 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
238 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
241 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
246 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
247 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
248 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
249 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
250 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
251 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
254 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
261 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
268 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
279 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
314 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
315 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
386 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
387 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
400 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
406 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
407 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
408 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
409 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
410 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
411 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
412 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
416 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
417 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
418 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
419 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
420 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
421 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
425 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
426 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
427 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
428 2643221647 Streptomyces sp. Root369 Isolate Unclassified
429 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
430 2643221714 Streptomyces sp. Root264 Isolate Unclassified
431 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
432 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
433 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
434 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
435 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
436 2808606448 Streptomyces sp. 193411 Isolate Unclassified
437 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
438 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
439 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
440 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
441 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
442 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
443 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
444 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
445 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
446 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
447 2862574272 Streptomyces sp. AcE210 Isolate Nodule
448 2867428634 Streptomyces sp. RP5T Isolate Unclassified
449 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
450 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
451 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
452 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
453 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
454 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
455 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
456 2928153084 Leifsonia sp. 563 Isolate Unclassified
457 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
458 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
459 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
460 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
461 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
462 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
463 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
464 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
465 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
466 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
467 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
468 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
469 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
470 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
471 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
472 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
473 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
474 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
475 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
476 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
477 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
478 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
479 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
480 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
481 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.32
Metatranscriptomes 1.03
Isolates 6.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 6.19
Nodule 0.46
Rhizoplane 4.47
Rhizosphere 79.01
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_1980144 3300041512 Bacteria 3642
2 LJNas_1007201 3300000546 Bacteria 1202
3 JGI24740J21852_10108297 3300001979 Bacteria 702
4 JGI24739J22299_10038691 3300001989 Bacteria 1602
5 JGI24737J22298_10117102 3300001990 Bacteria 787
6 JGI24735J21928_10038628 3300002067 Bacteria 1396
7 JGI24735J21928_10076469 3300002067 Bacteria 959
8 JGI24735J21928_10077889 3300002067 Bacteria 949
9 JGI24738J21930_10068099 3300002075 Bacteria 735
10 JGI25406J46586_10007955 3300003203 Bacteria 4824
11 JGI25153J46596_10067939 3300003215 Bacteria 936
12 rootH1_10038533 3300003323 Bacteria 1480
13 Ga0006562J51391_1034931 3300003578 Bacteria 1203
14 Ga0006562J51391_1034932 3300003578 Bacteria 2500
15 Ga0058860_10109326 3300004801 Bacteria 1524
16 Ga0070670_100678659 3300005331 Bacteria 925
17 Ga0068869_100017667 3300005334 Bacteria 4840
18 Ga0068869_100037554 3300005334 Bacteria 3444
19 Ga0070666_10007312 3300005335 Bacteria 6802
20 Ga0070682_100090447 3300005337 Bacteria 2001
21 Ga0068868_100162809 3300005338 Bacteria 1843
22 Ga0068868_100252750 3300005338 Bacteria 1484
23 Ga0070660_100303079 3300005339 Bacteria 1310
24 Ga0070691_10005471 3300005341 Bacteria 5779
25 Ga0070687_100067522 3300005343 Bacteria 1909
26 Ga0070687_100229776 3300005343 Bacteria 1141
27 Ga0070692_10218895 3300005345 Bacteria 1124
28 Ga0070692_10764031 3300005345 Bacteria 656
29 Ga0070668_100275575 3300005347 Bacteria 1403
30 Ga0070668_100295376 3300005347 Bacteria 1357
31 Ga0070675_100345231 3300005354 Bacteria 1319
32 Ga0070671_100016429 3300005355 Bacteria 5985
33 Ga0070674_100147162 3300005356 Bacteria 1774
34 Ga0070673_100171630 3300005364 Bacteria 1851
35 Ga0070673_100271545 3300005364 Bacteria 1484
36 Ga0070688_100529431 3300005365 Bacteria 893
37 Ga0070659_100944738 3300005366 Bacteria 755
38 Ga0070667_100002613 3300005367 Bacteria 15617
39 Ga0070667_101500305 3300005367 Bacteria 633
40 Ga0070703_10094246 3300005406 Bacteria 1044
41 Ga0070709_10043271 3300005434 Bacteria 2784
42 Ga0070714_100002217 3300005435 Bacteria 14316
43 Ga0070714_100029677 3300005435 Bacteria 4547
44 Ga0070714_100872556 3300005435 Bacteria 873
45 Ga0070713_100065521 3300005436 Bacteria 3052
46 Ga0070713_100235272 3300005436 Bacteria 1666
47 Ga0070710_10003885 3300005437 Bacteria 7073
48 Ga0070711_100221674 3300005439 Bacteria 1470
49 Ga0070700_100141701 3300005441 Bacteria 1635
50 Ga0070700_100849353 3300005441 Bacteria 739
51 Ga0070694_100026153 3300005444 Bacteria 3780
52 Ga0070708_100718187 3300005445 Bacteria 940
53 Ga0070663_100032213 3300005455 Bacteria 3611
54 Ga0070681_10151867 3300005458 Bacteria 2242
55 Ga0068867_100247681 3300005459 Bacteria 1448
56 Ga0070685_10665148 3300005466 Bacteria 756
57 Ga0070698_100030269 3300005471 Bacteria 5614
58 Ga0070697_100590285 3300005536 Bacteria 976
59 Ga0070697_100773200 3300005536 Bacteria 849
60 Ga0068853_100017618 3300005539 Bacteria 5895
61 Ga0068853_100027326 3300005539 Bacteria 4793
62 Ga0068853_100030904 3300005539 Bacteria 4526
63 Ga0068853_100034938 3300005539 Bacteria 4268
64 Ga0070672_100020134 3300005543 Bacteria 4862
65 Ga0070672_100575451 3300005543 Bacteria 979
66 Ga0070686_100033705 3300005544 Bacteria 3149
67 Ga0070696_100075725 3300005546 Bacteria 2375
68 Ga0070693_100138032 3300005547 Bacteria 1531
69 Ga0070665_100001319 3300005548 Bacteria 29608
70 Ga0070665_100061049 3300005548 Bacteria 3779
71 Ga0070665_100108924 3300005548 Bacteria 2772
72 Ga0070665_101015941 3300005548 Unclassified 841
73 Ga0070704_100004542 3300005549 Bacteria 8018
74 Ga0070704_100043787 3300005549 Bacteria 3105
75 Ga0070704_100982963 3300005549 Bacteria 763
76 Ga0068855_100218234 3300005563 Bacteria 2140
77 Ga0068855_100572907 3300005563 Bacteria 1220
78 Ga0070664_100023962 3300005564 Bacteria 5044
79 Ga0070664_100579108 3300005564 Bacteria 1040
80 Ga0068857_100978270 3300005577 Bacteria 814
81 Ga0068854_100172109 3300005578 Bacteria 1686
82 Ga0068854_100317215 3300005578 Bacteria 1266
83 Ga0068856_100055598 3300005614 Bacteria 3906
84 Ga0068856_101119387 3300005614 Bacteria 804
85 Ga0070702_100025912 3300005615 Bacteria 3147
86 Ga0068852_100010216 3300005616 Bacteria 6997
87 Ga0068859_100067109 3300005617 Bacteria 3621
88 Ga0068864_100020461 3300005618 Bacteria 5536
89 Ga0068864_100190680 3300005618 Bacteria 1879
90 Ga0068863_100000838 3300005841 Bacteria 30841
91 Ga0068863_100074158 3300005841 Bacteria 3219
92 Ga0068858_100006027 3300005842 Bacteria 11820
93 Ga0068860_100000035 3300005843 Bacteria 238993
94 Ga0068860_100064659 3300005843 Bacteria 3474
95 Ga0081538_10030686 3300005981 Bacteria 3643
96 Ga0081540_1026985 3300005983 Unclassified 3265
97 Ga0081539_10000299 3300005985 Bacteria 111908
98 Ga0081539_10006331 3300005985 Bacteria 11424
99 Ga0070717_10192018 3300006028 Bacteria 1784
100 Ga0070717_10312930 3300006028 Bacteria 1398
101 Ga0075365_10000271 3300006038 Bacteria 17671
102 Ga0075365_10000542 3300006038 Bacteria 14523
103 Ga0075365_10003022 3300006038 Bacteria 8528
104 Ga0075365_10014333 3300006038 Bacteria 4766
105 Ga0075365_10427506 3300006038 Bacteria 935
106 Ga0075365_10500357 3300006038 Bacteria 859
107 Ga0075368_10001577 3300006042 Bacteria 7316
108 Ga0075368_10019267 3300006042 Bacteria 2574
109 Ga0075368_10318418 3300006042 Bacteria 673
110 Ga0075363_100018949 3300006048 Bacteria 3435
111 Ga0075363_100073595 3300006048 Bacteria 1859
112 Ga0075363_100126999 3300006048 Bacteria 1428
113 Ga0075364_10036412 3300006051 Bacteria 3181
114 Ga0075364_10067808 3300006051 Bacteria 2346
115 Ga0075364_10135996 3300006051 Bacteria 1651
116 Ga0075432_10022412 3300006058 Bacteria 2160
117 Ga0070715_10006410 3300006163 Bacteria 3999
118 Ga0070715_10105983 3300006163 Bacteria 1318
119 Ga0070716_100012812 3300006173 Bacteria 4260
120 Ga0070716_100027728 3300006173 Bacteria 3045
121 Ga0070716_100130263 3300006173 Bacteria 1589
122 Ga0070712_100036994 3300006175 Bacteria 3324
123 Ga0070712_100325396 3300006175 Bacteria 1251
124 Ga0075362_10052869 3300006177 Bacteria 1821
125 Ga0075362_10287511 3300006177 Bacteria 814
126 Ga0075367_10000756 3300006178 Bacteria 12614
127 Ga0075367_10118581 3300006178 Bacteria 1629
128 Ga0075369_10316917 3300006186 Bacteria 729
129 Ga0097621_100289125 3300006237 Bacteria 1445
130 Ga0097621_100370094 3300006237 Bacteria 1278
131 Ga0075370_10002095 3300006353 Bacteria 9092
132 Ga0075370_10076808 3300006353 Bacteria 1916
133 Ga0075370_10128591 3300006353 Bacteria 1477
134 Ga0068871_100585140 3300006358 Bacteria 1014
135 Ga0075428_100066825 3300006844 Bacteria 3936
136 Ga0075428_100085244 3300006844 Bacteria 3446
137 Ga0075430_100022164 3300006846 Bacteria 5400
138 Ga0075431_100028052 3300006847 Bacteria 5779
139 Ga0075431_100420960 3300006847 Bacteria 1335
140 Ga0075433_10012282 3300006852 Bacteria 6908
141 Ga0075433_10289408 3300006852 Bacteria 1451
142 Ga0075434_100221394 3300006871 Bacteria 1912
143 Ga0075429_100034922 3300006880 Bacteria 4370
144 Ga0075436_100051627 3300006914 Bacteria 2837
145 Ga0075436_100330858 3300006914 Bacteria 1096
146 Ga0097620_100067105 3300006931 Bacteria 3621
147 Ga0099826_10081921 3300006948 Bacteria 2007
148 Ga0075435_100240249 3300007076 Bacteria 1540
149 Ga0075435_100783989 3300007076 Bacteria 830
150 Ga0105250_10073405 3300009092 Bacteria 1383
151 Ga0111539_10005904 3300009094 Bacteria 15815
152 Ga0111539_10050736 3300009094 Bacteria 4943
153 Ga0105245_10106544 3300009098 Bacteria 2601
154 Ga0105245_10134706 3300009098 Bacteria 2321
155 Ga0105245_10142322 3300009098 Bacteria 2260
156 Ga0105245_10981784 3300009098 Bacteria 888
157 Ga0105247_10484379 3300009101 Bacteria 898
158 Ga0114129_10031516 3300009147 Bacteria 7494
159 Ga0114129_10041599 3300009147 Bacteria 6473
160 Ga0105243_10095085 3300009148 Bacteria 2462
161 Ga0105243_11054063 3300009148 Bacteria 819
162 Ga0105241_10087584 3300009174 Bacteria 2451
163 Ga0105241_11300118 3300009174 Bacteria 693
164 Ga0105242_10008778 3300009176 Bacteria 7755
165 Ga0105242_10013266 3300009176 Bacteria 6362
166 Ga0105248_10055247 3300009177 Bacteria 4453
167 Ga0105248_10386642 3300009177 Bacteria 1575
168 Ga0105237_10006793 3300009545 Bacteria 12618
169 Ga0105237_10157455 3300009545 Bacteria 2268
170 Ga0105238_10198156 3300009551 Bacteria 1983
171 Ga0105238_10251949 3300009551 Bacteria 1744
172 Ga0105238_10713011 3300009551 Bacteria 1016
173 Ga0105249_10086907 3300009553 Bacteria 2917
174 Ga0105249_10746174 3300009553 Bacteria 1041
175 Ga0105239_10015899 3300010375 Bacteria 8332
176 Ga0105239_10262236 3300010375 Bacteria 1942
177 Ga0105246_10318634 3300011119 Bacteria 1262
178 Ga0157373_10117922 3300013100 Bacteria 1866
179 Ga0157371_10031342 3300013102 Bacteria 3830
180 Ga0157370_10707537 3300013104 Bacteria 919
181 Ga0157369_10056851 3300013105 Bacteria 4221
182 Ga0157369_10299882 3300013105 Bacteria 1672
183 Ga0157374_10237493 3300013296 Bacteria 1792
184 Ga0157378_10009197 3300013297 Bacteria 8605
185 Ga0163162_10270256 3300013306 Bacteria 1832
186 Ga0157372_10094253 3300013307 Bacteria 3409
187 Ga0157372_10887475 3300013307 Bacteria 1035
188 Ga0157375_10427272 3300013308 Bacteria 1491
189 Ga0157375_10584430 3300013308 Bacteria 1277
190 Ga0163163_10034121 3300014325 Bacteria 4926
191 Ga0157380_10231828 3300014326 Bacteria 1659
192 Ga0157380_10433529 3300014326 Bacteria 1257
193 Ga0182008_10005993 3300014497 Bacteria 6843
194 Ga0182008_10076556 3300014497 Bacteria 1646
195 Ga0182008_10492486 3300014497 Bacteria 673
196 Ga0157377_10066285 3300014745 Bacteria 2075
197 Ga0157379_10068205 3300014968 Bacteria 3180
198 Ga0157379_10431802 3300014968 Bacteria 1214
199 Ga0182006_1014687 3300015261 Bacteria 3372
200 Ga0182007_10002837 3300015262 Bacteria 8431
201 Ga0182005_1035747 3300015265 Bacteria 1351
202 Ga0163161_10020276 3300017792 Bacteria 4664
203 Ga0163161_10499065 3300017792 Bacteria 991
204 Ga0206351_10975587 3300020077 Bacteria 1748
205 Ga0206350_10754245 3300020080 Bacteria 1587
206 Ga0206353_11322166 3300020082 Bacteria 1401
207 Ga0224712_10061034 3300022467 Bacteria 1502
208 Ga0224712_10521785 3300022467 Bacteria 575
209 Ga0209758_1008268 3300025297 Bacteria 6806
210 Ga0207426_1012186 3300025302 Bacteria 3241
211 Ga0207653_10057601 3300025885 Bacteria 1304
212 Ga0207692_10039497 3300025898 Bacteria 2322
213 Ga0207642_10158691 3300025899 Bacteria 1212
214 Ga0207710_10179295 3300025900 Bacteria 1039
215 Ga0207688_10013126 3300025901 Bacteria 4504
216 Ga0207680_10014377 3300025903 Bacteria 4093
217 Ga0207680_10365454 3300025903 Bacteria 1015
218 Ga0207647_10036111 3300025904 Bacteria 3142
219 Ga0207647_10104530 3300025904 Bacteria 1678
220 Ga0207647_10113378 3300025904 Bacteria 1602
221 Ga0207699_10115330 3300025906 Bacteria 1728
222 Ga0207699_10120396 3300025906 Bacteria 1697
223 Ga0207699_10183685 3300025906 Bacteria 1407
224 Ga0207699_10464510 3300025906 Bacteria 910
225 Ga0207671_10006937 3300025914 Bacteria 9974
226 Ga0207671_10594841 3300025914 Bacteria 882
227 Ga0207693_10051272 3300025915 Bacteria 3239
228 Ga0207693_10538198 3300025915 Bacteria 911
229 Ga0207663_10132714 3300025916 Bacteria 1723
230 Ga0207663_10322781 3300025916 Bacteria 1161
231 Ga0207662_10040255 3300025918 Bacteria 2746
232 Ga0207657_10008156 3300025919 Bacteria 10675
233 Ga0207657_10034789 3300025919 Bacteria 4525
234 Ga0207657_10067636 3300025919 Bacteria 3037
235 Ga0207694_10139106 3300025924 Bacteria 1951
236 Ga0207650_10880248 3300025925 Bacteria 760
237 Ga0207659_10354279 3300025926 Bacteria 1218
238 Ga0207687_10049641 3300025927 Bacteria 2919
239 Ga0207687_10437949 3300025927 Bacteria 1082
240 Ga0207687_10837451 3300025927 Bacteria 786
241 Ga0207700_10001420 3300025928 Bacteria 13601
242 Ga0207700_10037944 3300025928 Bacteria 3494
243 Ga0207700_10350682 3300025928 Bacteria 1285
244 Ga0207664_10014378 3300025929 Bacteria 5714
245 Ga0207664_10153653 3300025929 Bacteria 1957
246 Ga0207664_10239297 3300025929 Bacteria 1580
247 Ga0207664_10346452 3300025929 Bacteria 1314
248 Ga0207664_10756437 3300025929 Bacteria 874
249 Ga0207644_10342854 3300025931 Bacteria 1212
250 Ga0207690_10266611 3300025932 Bacteria 1329
251 Ga0207690_10575765 3300025932 Bacteria 917
252 Ga0207706_10256138 3300025933 Bacteria 1528
253 Ga0207706_10482263 3300025933 Bacteria 1071
254 Ga0207686_10015002 3300025934 Bacteria 4325
255 Ga0207686_10171024 3300025934 Bacteria 1532
256 Ga0207709_10065760 3300025935 Bacteria 2281
257 Ga0207709_10555384 3300025935 Bacteria 904
258 Ga0207669_11198775 3300025937 Bacteria 643
259 Ga0207704_10115337 3300025938 Bacteria 1825
260 Ga0207704_10441561 3300025938 Bacteria 1036
261 Ga0207665_10000659 3300025939 Bacteria 23268
262 Ga0207665_10274811 3300025939 Bacteria 1252
263 Ga0207691_10272019 3300025940 Bacteria 1458
264 Ga0207689_10106819 3300025942 Bacteria 2300
265 Ga0207679_10017072 3300025945 Bacteria 4831
266 Ga0207667_10071239 3300025949 Bacteria 3615
267 Ga0207667_10284371 3300025949 Bacteria 1690
268 Ga0207712_11158120 3300025961 Bacteria 689
269 Ga0207668_10151112 3300025972 Bacteria 1798
270 Ga0207640_10348447 3300025981 Bacteria 1189
271 Ga0207658_10002029 3300025986 Bacteria 15117
272 Ga0207658_10036514 3300025986 Bacteria 3524
273 Ga0207677_10190553 3300026023 Bacteria 1621
274 Ga0207677_10546007 3300026023 Bacteria 1009
275 Ga0207703_10022485 3300026035 Bacteria 4947
276 Ga0207639_10069194 3300026041 Bacteria 2754
277 Ga0207639_10075730 3300026041 Bacteria 2647
278 Ga0207639_10169352 3300026041 Bacteria 1848
279 Ga0207678_10016674 3300026067 Bacteria 6453
280 Ga0207678_10166996 3300026067 Bacteria 1879
281 Ga0207708_10146533 3300026075 Bacteria 1856
282 Ga0207702_10392889 3300026078 Bacteria 1336
283 Ga0207702_10432510 3300026078 Unclassified 1274
284 Ga0207641_10001869 3300026088 Bacteria 20215
285 Ga0207641_10032411 3300026088 Bacteria 4338
286 Ga0207641_10754587 3300026088 Bacteria 961
287 Ga0207676_10088204 3300026095 Bacteria 2539
288 Ga0207674_10730746 3300026116 Bacteria 955
289 Ga0207675_100006189 3300026118 Bacteria 11363
290 Ga0207675_100012650 3300026118 Bacteria 7885
291 Ga0207675_100934499 3300026118 Bacteria 884
292 Ga0207683_10000422 3300026121 Bacteria 39048
293 Ga0207683_10004101 3300026121 Bacteria 12585
294 Ga0207698_10715047 3300026142 Bacteria 998
295 Ga0209813_10000650 3300027866 Bacteria 7976
296 Ga0209813_10035369 3300027866 Bacteria 1496
297 Ga0207428_10016463 3300027907 Bacteria 6359
298 Ga0207428_10240650 3300027907 Bacteria 1352
299 Ga0268266_10020267 3300028379 Bacteria 5669
300 Ga0268266_10201573 3300028379 Bacteria 1821
301 Ga0268266_10862651 3300028379 Unclassified 875
302 Ga0268266_10872411 3300028379 Bacteria 870
303 Ga0268264_10000031 3300028381 Bacteria 409525
304 Ga0268264_10116835 3300028381 Bacteria 2345
305 Ga0265322_10019247 3300028654 Bacteria 1960
306 Ga0307517_10353543 3300028786 Bacteria 797
307 Ga0307515_10000106 3300028794 Bacteria 197218
308 Ga0307511_10112505 3300030521 Bacteria 1725
309 Ga0307511_10120376 3300030521 Bacteria 1626
310 Ga0307512_10008193 3300030522 Bacteria 10219
311 Ga0307512_10048262 3300030522 Bacteria 3449
312 Ga0307512_10137615 3300030522 Bacteria 1506
313 Ga0316181_1223888 3300030744 Bacteria 905
314 Ga0265327_10000322 3300031251 Bacteria 91392
315 Ga0265327_10013425 3300031251 Bacteria 5439
316 Ga0265327_10014018 3300031251 Bacteria 5278
317 Ga0265327_10252696 3300031251 Bacteria 785
318 Ga0265316_10196098 3300031344 Bacteria 1499
319 Ga0307513_10005279 3300031456 Bacteria 17096
320 Ga0307513_10345393 3300031456 Bacteria 1237
321 Ga0307509_10028795 3300031507 Bacteria 6172
322 Ga0307509_10049136 3300031507 Bacteria 4525
323 Ga0307408_100126297 3300031548 Bacteria 1989
324 Ga0307408_100262084 3300031548 Bacteria 1431
325 Ga0307408_100525783 3300031548 Bacteria 1040
326 Ga0307508_10031447 3300031616 Bacteria 4797
327 Ga0307508_10053893 3300031616 Bacteria 3566
328 Ga0307508_10248328 3300031616 Bacteria 1376
329 Ga0307514_10009865 3300031649 Bacteria 8001
330 Ga0307514_10128835 3300031649 Bacteria 1747
331 Ga0307514_10185033 3300031649 Bacteria 1336
332 Ga0307514_10290776 3300031649 Bacteria 925
333 Ga0307514_10310201 3300031649 Bacteria 876
334 Ga0307516_10000711 3300031730 Bacteria 45216
335 Ga0307516_10135569 3300031730 Bacteria 2236
336 Ga0307516_10278577 3300031730 Bacteria 1355
337 Ga0307516_10333246 3300031730 Bacteria 1186
338 Ga0307405_10082358 3300031731 Bacteria 2106
339 Ga0307413_10002840 3300031824 Bacteria 7147
340 Ga0307413_10751318 3300031824 Bacteria 815
341 Ga0307518_10021394 3300031838 Bacteria 4651
342 Ga0307518_10188872 3300031838 Bacteria 1383
343 Ga0307518_10344618 3300031838 Bacteria 872
344 Ga0307410_10018273 3300031852 Bacteria 4234
345 Ga0307410_10131455 3300031852 Bacteria 1839
346 Ga0307410_10145135 3300031852 Bacteria 1760
347 Ga0307410_10436229 3300031852 Bacteria 1066
348 Ga0307406_10023717 3300031901 Bacteria 3655
349 Ga0307406_10103813 3300031901 Bacteria 1942
350 Ga0307407_10001638 3300031903 Bacteria 8281
351 Ga0307407_10112733 3300031903 Bacteria 1710
352 Ga0307407_10377844 3300031903 Bacteria 1011
353 Ga0307412_10013621 3300031911 Bacteria 4775
354 Ga0307412_10080959 3300031911 Bacteria 2245
355 Ga0307409_100010114 3300031995 Bacteria 5840
356 Ga0307409_100027269 3300031995 Bacteria 4046
357 Ga0307409_100174211 3300031995 Bacteria 1897
358 Ga0307416_100003225 3300032002 Bacteria 9557
359 Ga0307416_100019268 3300032002 Bacteria 4833
360 Ga0307416_100889942 3300032002 Bacteria 990
361 Ga0307416_100925033 3300032002 Bacteria 973
362 Ga0307416_101894688 3300032002 Bacteria 700
363 Ga0307414_10497174 3300032004 Bacteria 1078
364 Ga0307411_10487614 3300032005 Bacteria 1039
365 Ga0307411_10816539 3300032005 Bacteria 822
366 Ga0307415_100000965 3300032126 Bacteria 13202
367 Ga0307415_100084927 3300032126 Bacteria 2273
368 Ga0307415_100176098 3300032126 Bacteria 1673
369 Ga0307415_100822126 3300032126 Bacteria 850
370 Ga0307507_10021548 3300033179 Bacteria 7166
371 Ga0307507_10089786 3300033179 Bacteria 2641
372 Ga0307507_10341947 3300033179 Bacteria 886
373 Ga0307510_10007245 3300033180 Bacteria 13211
374 Ga0307510_10086198 3300033180 Bacteria 3013
375 Ga0307510_10158183 3300033180 Bacteria 1869
376 Ga0307510_10485672 3300033180 Bacteria 677
377 Ga0373959_0085509 3300034820 Bacteria 732
378 Ga0373928_0009331 3300035084 Bacteria 1916
379 Ga0373928_0013644 3300035084 Bacteria 1634
380 Ga0373928_0072611 3300035084 Bacteria 854
381 Ga0373929_0009062 3300035085 Bacteria 1840
382 Ga0373949_0052163 3300035090 Bacteria 1033
383 Ga0373932_0004115 3300035112 Bacteria 3456
384 Ga0373939_0033347 3300035114 Bacteria 1503
385 Ga0373941_0043995 3300035115 Bacteria 1392
386 Ga0373960_0085310 3300035121 Bacteria 1001
387 Ga0373961_0011635 3300035241 Bacteria 2186
388 Ga0373962_0244645 3300035242 Bacteria 621
389 Ga0316574_0144040 3300035398 Bacteria 1536
390 Ga0373931_0010210 3300035691 Bacteria 4509
391 Ga0373931_0434091 3300035691 Bacteria 837
392 Ga0395899_0564661 3300037312 Bacteria 729
393 Ga0395900_0135131 3300037418 Bacteria 2526
394 Ga0395900_0215479 3300037418 Bacteria 1938
395 Ga0395900_0860313 3300037418 Bacteria 832
396 Ga0395898_0003326 3300037466 Bacteria 18055
397 Ga0395898_0006955 3300037466 Bacteria 12022
398 Ga0395898_0160510 3300037466 Bacteria 2150
399 Ga0395898_0181057 3300037466 Bacteria 2014
400 Ga0395898_1041013 3300037466 Bacteria 753
401 Ga0436364_0816037 3300037853 Bacteria 2659
402 Ga0436364_1123106 3300037853 Bacteria 985
403 Ga0395901_0902799 3300038443 Bacteria 865
404 Ga0395901_1294216 3300038443 Bacteria 691
405 Ga0242420_044069 3300038996 Bacteria 858
406 Ga0436365_1612808 3300039437 Bacteria 1530
407 Ga0436363_0033422 3300039450 Bacteria 747
408 Ga0436363_0890894 3300039450 Bacteria 1743
409 Ga0436362_0012047 3300039453 Bacteria 2006
410 Ga0436362_0867026 3300039453 Bacteria 928
411 Ga0436362_1296310 3300039453 Bacteria 579
412 Ga0439436_0026628 3300041404 Bacteria 1694
413 Ga0439439_0000318 3300041406 Bacteria 7768
414 Ga0439439_0009611 3300041406 Bacteria 2304
415 Ga0439439_0274729 3300041406 Bacteria 504
416 Ga0439466_0043993 3300041411 Bacteria 1481
417 Ga0439465_0000719 3300041413 Bacteria 10204
418 Ga0439465_0154062 3300041413 Bacteria 822
419 Ga0451789_1102227 3300041443 Bacteria 996
420 Ga0451791_1847581 3300041451 Bacteria 1069
421 Ga0451841_0137988 3300041498 Bacteria 2119
422 Ga0451849_0982872 3300041505 Bacteria 1571
423 Ga0451843_1047387 3300041509 Bacteria 775
424 Ga0451853_0886294 3300041512 Bacteria 710
425 Ga0451853_3469875 3300041512 Bacteria 754
426 Ga0439433_0067035 3300041999 Bacteria 861
427 Ga0439442_022016 3300042002 Bacteria 1322
428 Ga0439448_0050525 3300042005 Bacteria 1360
429 Ga0439448_0057964 3300042005 Bacteria 1277
430 Ga0439449_0002621 3300042007 Bacteria 7007
431 Ga0439449_0029392 3300042007 Bacteria 2048
432 Ga0439457_000615 3300042014 Bacteria 10515
433 Ga0439457_005065 3300042014 Bacteria 3359
434 Ga0439462_0010781 3300042015 Bacteria 2318
435 Ga0450920_048376 3300042122 Bacteria 851
436 Ga0450894_000046 3300042131 Bacteria 18159
437 Ga0450894_018196 3300042131 Bacteria 939
438 Ga0450899_004797 3300042135 Bacteria 1449
439 Ga0450903_000207 3300042138 Bacteria 13042
440 Ga0450906_002372 3300042145 Bacteria 4119
441 Ga0439458_0008566 3300042157 Bacteria 2279
442 Ga0450908_012583 3300042184 Bacteria 1534
443 Ga0466969_0016573 3300044656 Bacteria 3854
444 Ga0466969_0052854 3300044656 Bacteria 1995
445 Ga0466969_0060698 3300044656 Bacteria 1838
446 Ga0466972_0045984 3300044658 Bacteria 2114
447 Ga0466972_0058310 3300044658 Bacteria 1854
448 Ga0466972_0133627 3300044658 Bacteria 1168
449 Ga0466972_0167599 3300044658 Bacteria 1031
450 Ga0466972_0233812 3300044658 Bacteria 860
451 Ga0466965_0027062 3300044683 Bacteria 2781
452 Ga0466965_0176967 3300044683 Bacteria 1124
453 Ga0466965_0190476 3300044683 Bacteria 1085
454 Ga0466965_0243129 3300044683 Bacteria 964
455 Ga0466965_0243816 3300044683 Bacteria 962
456 Ga0466966_0001620 3300044684 Bacteria 14498
457 Ga0466966_0003597 3300044684 Bacteria 10227
458 Ga0466966_0008661 3300044684 Bacteria 6734
459 Ga0466966_0024136 3300044684 Bacteria 3980
460 Ga0466966_0271365 3300044684 Bacteria 1021
461 Ga0466966_0311011 3300044684 Bacteria 947
462 Ga0466961_0017529 3300044693 Bacteria 4602
463 Ga0466961_0017761 3300044693 Bacteria 4570
464 Ga0466961_0022144 3300044693 Bacteria 4089
465 Ga0466961_0105008 3300044693 Bacteria 1779
466 Ga0466961_0170195 3300044693 Bacteria 1355
467 Ga0466963_0000279 3300044694 Bacteria 22827
468 Ga0466963_0077918 3300044694 Bacteria 2240
469 Ga0466963_0088628 3300044694 Bacteria 2105
470 Ga0466963_0453206 3300044694 Bacteria 905
471 Ga0466963_0673557 3300044694 Bacteria 730
472 Ga0466964_0003280 3300044706 Bacteria 5887
473 Ga0466964_0539824 3300044706 Bacteria 632
474 Ga0466971_0012314 3300044719 Bacteria 3747
475 Ga0466971_0012611 3300044719 Bacteria 3707
476 Ga0466971_0092383 3300044719 Bacteria 1386
477 Ga0466968_0119243 3300044735 Bacteria 1192
478 Ga0466968_0136393 3300044735 Bacteria 1119
479 Ga0466968_0330635 3300044735 Bacteria 737
480 Ga0466970_0002248 3300044765 Bacteria 9322
481 Ga0466970_0049688 3300044765 Bacteria 2236
482 Ga0466970_0485329 3300044765 Bacteria 710
483 Ga0466970_0518423 3300044765 Bacteria 687
484 Ga0466957_0000404 3300044842 Bacteria 21092
485 Ga0466957_0040516 3300044842 Bacteria 2814
486 Ga0466960_0057120 3300044901 Bacteria 1902
487 Ga0466960_0250144 3300044901 Bacteria 984
488 Ga0466959_0000297 3300045049 Bacteria 29628
489 Ga0466959_0063864 3300045049 Bacteria 2673
490 Ga0466959_0221141 3300045049 Bacteria 1313
491 Ga0466959_0315719 3300045049 Bacteria 1069
492 Ga0466958_0020949 3300045836 Bacteria 3816
493 Ga0466958_0090986 3300045836 Bacteria 1888
494 Ga0466958_0493638 3300045836 Bacteria 794
495 Ga0466958_0535604 3300045836 Bacteria 760
496 Ga0466967_0000412 3300045976 Bacteria 20240
497 Ga0466967_0034626 3300045976 Bacteria 4289
498 Ga0466967_0062856 3300045976 Bacteria 3297
499 Ga0466967_0146044 3300045976 Bacteria 2206
500 Ga0466967_0150735 3300045976 Bacteria 2173
501 Ga0466967_0447743 3300045976 Bacteria 1262
502 Ga0466967_0479952 3300045976 Bacteria 1218
503 Ga0495617_056506 3300046452 Bacteria 1301
504 Ga0495627_156088 3300046453 Bacteria 636
505 Ga0495592_0051655 3300046454 Bacteria 3053
506 Ga0495592_0327375 3300046454 Bacteria 988
507 Ga0495603_0002129 3300046455 Bacteria 11645
508 Ga0495603_0003323 3300046455 Bacteria 9576
509 Ga0495590_0119706 3300046457 Bacteria 943
510 Ga0495629_0002482 3300046459 Bacteria 14145
511 Ga0495629_0054188 3300046459 Bacteria 2805
512 Ga0495629_0163205 3300046459 Bacteria 1547
513 Ga0495629_0906721 3300046459 Bacteria 577
514 Ga0495638_0127827 3300046460 Bacteria 1496
515 Ga0495651_0005915 3300046462 Bacteria 9332
516 Ga0495651_0370028 3300046462 Bacteria 942
517 Ga0495651_0565523 3300046462 Bacteria 721
518 Ga0495653_0143473 3300046463 Bacteria 1677
519 Ga0495582_0047463 3300046473 Bacteria 2366
520 Ga0495582_0087403 3300046473 Bacteria 1735
521 Ga0495639_0015156 3300046475 Bacteria 3341
522 Ga0495662_0001234 3300046476 Bacteria 12592
523 Ga0495662_0003831 3300046476 Bacteria 7581
524 Ga0495662_0052009 3300046476 Bacteria 1977
525 Ga0495662_0056242 3300046476 Bacteria 1900
526 Ga0495664_0000236 3300046477 Bacteria 26604
527 Ga0495585_0067393 3300046492 Bacteria 1957
528 Ga0495594_0037193 3300046499 Bacteria 2655
529 Ga0495594_0041562 3300046499 Bacteria 2517
530 Ga0495594_0264944 3300046499 Bacteria 979
531 Ga0495594_0282886 3300046499 Bacteria 945
532 Ga0495596_0139543 3300046500 Bacteria 941
533 Ga0495607_0019302 3300046501 Bacteria 4333
534 Ga0495583_0042126 3300046506 Bacteria 2134
535 Ga0495606_0073578 3300046507 Bacteria 2143
536 Ga0495608_0139303 3300046511 Bacteria 1549
537 Ga0495610_0063310 3300046512 Bacteria 1752
538 Ga0495616_0025507 3300046513 Bacteria 3157
539 Ga0495620_0094486 3300046515 Bacteria 1196
540 Ga0495620_0131368 3300046515 Bacteria 982
541 Ga0495628_0146333 3300046516 Bacteria 1801
542 Ga0495630_0037299 3300046517 Bacteria 3634
543 Ga0495631_0101964 3300046518 Bacteria 1235
544 Ga0495632_0047367 3300046519 Bacteria 2132
545 Ga0495643_0006220 3300046522 Bacteria 7919
546 Ga0495644_0077417 3300046523 Bacteria 1253
547 Ga0495648_0093206 3300046524 Bacteria 1680
548 Ga0495666_0036449 3300046526 Bacteria 2395
549 Ga0495652_0188680 3300046529 Bacteria 1575
550 Ga0495652_0233405 3300046529 Bacteria 1374
551 Ga0495640_0047649 3300046533 Bacteria 2965
552 Ga0495586_0469610 3300046535 Bacteria 725
553 Ga0495587_0037649 3300046536 Bacteria 2903
554 Ga0495597_0064965 3300046542 Bacteria 1583
555 Ga0495597_0079578 3300046542 Bacteria 1403
556 Ga0495645_0083414 3300046543 Bacteria 2291
557 Ga0495622_0013219 3300046557 Bacteria 3830
558 Ga0495622_0087828 3300046557 Bacteria 1429
559 Ga0495622_0106865 3300046557 Bacteria 1282
560 Ga0495633_0032369 3300046558 Bacteria 2527
561 Ga0495667_0041540 3300046559 Bacteria 3050
562 Ga0495656_0089983 3300046615 Bacteria 1402
563 Ga0495668_0064832 3300046616 Bacteria 2010
564 Ga0495668_0244007 3300046616 Bacteria 984
565 Ga0495634_0003864 3300046642 Bacteria 11894
566 Ga0495634_0044822 3300046642 Bacteria 2991
567 Ga0495611_0015155 3300046648 Bacteria 3294
568 Ga0495625_0004908 3300046660 Bacteria 12453
569 Ga0495625_0013310 3300046660 Bacteria 6615
570 Ga0495625_0288419 3300046660 Bacteria 1054
571 Ga0495635_0029477 3300046663 Bacteria 3816
572 Ga0495635_0041265 3300046663 Bacteria 3188
573 Ga0495661_0071062 3300046665 Bacteria 2035
574 Ga0495588_0007022 3300046674 Bacteria 5105
575 Ga0495588_0015036 3300046674 Bacteria 3717
576 Ga0495588_0087874 3300046674 Bacteria 1626
577 Ga0495588_0154926 3300046674 Bacteria 1211
578 Ga0495588_0590218 3300046674 Bacteria 582
579 Ga0495657_0002703 3300046675 Bacteria 14802
580 Ga0495657_0092041 3300046675 Bacteria 1943
581 Ga0495657_0118425 3300046675 Bacteria 1670
582 Ga0495657_0154597 3300046675 Bacteria 1422
583 Ga0495646_0005201 3300046680 Bacteria 8207
584 Ga0495658_0097823 3300046683 Bacteria 1747
585 Ga0495613_0000319 3300046689 Bacteria 43656
586 Ga0495613_0002293 3300046689 Bacteria 14491
587 Ga0495613_0013644 3300046689 Bacteria 6028
588 Ga0495613_0084683 3300046689 Bacteria 2301
589 Ga0495613_0115687 3300046689 Bacteria 1929
590 Ga0495613_0336331 3300046689 Bacteria 1039
591 Ga0495624_0027009 3300046690 Bacteria 3760
592 Ga0495624_0037998 3300046690 Bacteria 3095
593 Ga0495670_0058277 3300046691 Bacteria 1939
594 Ga0495670_0076668 3300046691 Bacteria 1699
595 Ga0495671_0010037 3300046692 Bacteria 5266
596 Ga0495671_0126183 3300046692 Bacteria 1248
597 Ga0495589_0039334 3300046794 Bacteria 2363
598 Ga0495589_0051361 3300046794 Bacteria 2038
599 Ga0495589_0066850 3300046794 Bacteria 1760
600 Ga0495589_0074572 3300046794 Bacteria 1655
601 Ga0495589_0200689 3300046794 Bacteria 941
602 Ga0495600_0042400 3300046809 Bacteria 2967
603 Ga0495600_0233169 3300046809 Bacteria 1174
604 Ga0495581_0060845 3300047315 Bacteria 2182
605 Ga0495581_0234007 3300047315 Bacteria 1074
606 Ga0495581_0516254 3300047315 Bacteria 694
607 Ga0495604_0006154 3300047317 Bacteria 9521
608 Ga0495604_0025120 3300047317 Bacteria 4748
609 Ga0495636_0009278 3300047318 Bacteria 3875
610 Ga0495636_0010641 3300047318 Bacteria 3635
611 Ga0495636_0023651 3300047318 Bacteria 2488
612 Ga0495636_0050757 3300047318 Bacteria 1737
613 Ga0495674_0448838 3300047319 Bacteria 1036
614 Ga0495676_0010735 3300047321 Bacteria 8290
615 Ga0495676_0023896 3300047321 Bacteria 5296
616 Ga0495676_0047750 3300047321 Bacteria 3457
617 Ga0495680_0023673 3300047322 Bacteria 5103
618 Ga0495680_0420145 3300047322 Bacteria 920
619 Ga0495683_0036295 3300047323 Bacteria 2502
620 Ga0495687_002261 3300047443 Bacteria 15793
621 Ga0495687_008166 3300047443 Bacteria 6036
622 Ga0495687_028854 3300047443 Bacteria 2574
623 Ga0495687_079065 3300047443 Bacteria 1293
624 Ga0495687_105905 3300047443 Bacteria 1044
625 Ga0495675_0003141 3300047444 Bacteria 9915
626 Ga0495677_0247044 3300047445 Bacteria 697
627 Ga0495685_001508 3300047447 Bacteria 7137
628 Ga0495685_043400 3300047447 Bacteria 1534
629 Ga0495685_046505 3300047447 Bacteria 1476
630 Ga0495685_047532 3300047447 Bacteria 1459
631 Ga0495685_144686 3300047447 Bacteria 773
632 Ga0495673_0190114 3300047469 Bacteria 773
633 Ga0495681_0058581 3300047470 Bacteria 1784
634 Ga0495686_0040996 3300047472 Bacteria 2950
635 Ga0495686_0053304 3300047472 Bacteria 2535
636 Ga0495686_0074567 3300047472 Bacteria 2082
637 Ga0495593_0001745 3300047673 Bacteria 12875
638 Ga0495593_0187996 3300047673 Bacteria 1039
639 Ga0495593_0349578 3300047673 Bacteria 739
640 Ga0495614_0042535 3300048089 Bacteria 1947
641 Ga0495614_0067039 3300048089 Bacteria 1544
642 Ga0495626_0114841 3300048091 Bacteria 1162
643 Ga0496100_0001735 3300048903 Bacteria 10867
644 Ga0496100_0054985 3300048903 Bacteria 2599
645 Ga0496101_0000014 3300048904 Bacteria 253487
646 Ga0496101_0031466 3300048904 Bacteria 3730
647 Ga0496101_0109269 3300048904 Bacteria 2080
648 Ga0496102_0000041 3300048905 Bacteria 196634
649 Ga0496102_0077088 3300048905 Bacteria 3067
650 Ga0496102_0352262 3300048905 Bacteria 1386
651 Ga0496102_0549585 3300048905 Bacteria 1078
652 Ga0496103_0000058 3300048906 Bacteria 141099
653 Ga0496103_0254543 3300048906 Bacteria 1130
654 Ga0496104_0314541 3300048907 Bacteria 1479
655 Ga0496104_0458365 3300048907 Bacteria 1186
656 Ga0496105_0015338 3300048908 Bacteria 6104
657 Ga0496105_0250878 3300048908 Bacteria 1434
658 Ga0496105_0257914 3300048908 Bacteria 1411
659 Ga0496105_0443777 3300048908 Bacteria 1025
660 Ga0496106_0004428 3300048909 Bacteria 10408
661 Ga0496106_0577232 3300048909 Bacteria 901
662 Ga0496107_0028698 3300048910 Bacteria 3955
663 Ga0496108_0092942 3300048911 Bacteria 2565
664 Ga0496109_0023084 3300048912 Bacteria 5518
665 Ga0496109_0141003 3300048912 Bacteria 2253
666 Ga0496109_0365662 3300048912 Bacteria 1362
667 Ga0496110_0010666 3300048913 Bacteria 7481
668 Ga0496110_0768770 3300048913 Bacteria 867
669 Ga0496111_0444146 3300048914 Bacteria 957
670 Ga0496112_0017910 3300048915 Bacteria 6666
671 Ga0496112_0055031 3300048915 Bacteria 3910
672 Ga0496112_0162808 3300048915 Bacteria 2197
673 Ga0496113_0049695 3300048916 Bacteria 3124
674 Ga0496113_0246567 3300048916 Bacteria 1425
675 Ga0496114_0032203 3300048917 Bacteria 4314
676 Ga0496114_0215758 3300048917 Bacteria 1684
677 Ga0496114_0369541 3300048917 Bacteria 1269
678 Ga0496115_0350368 3300048918 Bacteria 1204
679 Ga0496115_0688726 3300048918 Bacteria 804
680 Ga0496116_0000098 3300048919 Bacteria 196497
681 Ga0496117_0000071 3300048920 Bacteria 242170
682 Ga0496117_0000096 3300048920 Bacteria 196788
683 Ga0496117_0010296 3300048920 Bacteria 8550
684 Ga0496118_0000073 3300048921 Bacteria 196712
685 Ga0496119_0000125 3300048922 Bacteria 108373
686 Ga0496119_0195590 3300048922 Bacteria 1050
687 Ga0496120_0000695 3300048923 Bacteria 49341
688 Ga0496120_0004773 3300048923 Bacteria 11120
689 Ga0496121_0000354 3300048924 Bacteria 94725
690 Ga0496126_0001057 3300048929 Bacteria 46555
691 Ga0496126_0324513 3300048929 Bacteria 1265
692 Ga0501306_034581 3300049127 Bacteria 764
693 Ga0495678_021225 3300049459 Bacteria 2863
694 Ga0501031_0007022 3300049568 Bacteria 7349
695 Ga0501031_0069963 3300049568 Bacteria 2286
696 Ga0501032_0013317 3300049569 Bacteria 5854
697 Ga0501032_0137732 3300049569 Bacteria 1608
698 Ga0501032_0227073 3300049569 Bacteria 1214
699 Ga0501033_0004006 3300049570 Bacteria 11918
700 Ga0501033_0004072 3300049570 Bacteria 11798
701 Ga0501033_0009541 3300049570 Bacteria 7468
702 Ga0501033_0070557 3300049570 Bacteria 2566
703 Ga0501033_0295469 3300049570 Bacteria 1141
704 Ga0501034_0017466 3300049571 Bacteria 7358
705 Ga0501034_0023316 3300049571 Bacteria 6307
706 Ga0501034_0068902 3300049571 Bacteria 3548
707 Ga0501034_0089540 3300049571 Bacteria 3075
708 Ga0501034_0119047 3300049571 Bacteria 2627
709 Ga0501036_0006377 3300049572 Bacteria 9574
710 Ga0501036_0006831 3300049572 Bacteria 9270
711 Ga0501036_0311739 3300049572 Bacteria 1315
712 Ga0501037_0046594 3300049573 Bacteria 3179
713 Ga0501037_0098960 3300049573 Bacteria 2106
714 Ga0501037_0113202 3300049573 Bacteria 1954
715 Ga0501038_0001431 3300049574 Bacteria 21881
716 Ga0501038_0024394 3300049574 Bacteria 5397
717 Ga0501038_0032688 3300049574 Bacteria 4588
718 Ga0501038_0034781 3300049574 Bacteria 4427
719 Ga0501038_0051583 3300049574 Bacteria 3549
720 Ga0501039_0115582 3300049575 Bacteria 2100
721 Ga0501042_0014252 3300049578 Bacteria 5423
722 Ga0501043_0012342 3300049579 Bacteria 6679
723 Ga0501043_0737277 3300049579 Bacteria 717
724 Ga0501046_0000546 3300049580 Bacteria 37423
725 Ga0501046_0017268 3300049580 Bacteria 6026
726 Ga0501046_0018100 3300049580 Bacteria 5868
727 Ga0501046_0065375 3300049580 Bacteria 2837
728 Ga0501046_0183329 3300049580 Bacteria 1564
729 Ga0501047_0007717 3300049581 Bacteria 10131
730 Ga0501047_0072468 3300049581 Bacteria 3316
731 Ga0501047_0076014 3300049581 Bacteria 3232
732 Ga0501047_0114981 3300049581 Bacteria 2572
733 Ga0501047_0250784 3300049581 Bacteria 1618
734 Ga0501048_0009770 3300049582 Bacteria 7193
735 Ga0501067_0126998 3300049583 Bacteria 1419
736 Ga0501067_0230141 3300049583 Bacteria 1032
737 Ga0501069_0022652 3300049585 Bacteria 3420
738 Ga0501069_0160594 3300049585 Bacteria 1294
739 Ga0501069_0193922 3300049585 Bacteria 1176
740 Ga0501070_0002466 3300049586 Bacteria 16203
741 Ga0501070_0004002 3300049586 Bacteria 12665
742 Ga0501070_0071841 3300049586 Bacteria 2865
743 Ga0501070_0495589 3300049586 Bacteria 982
744 Ga0501073_0024000 3300049589 Bacteria 4379
745 Ga0501074_0030576 3300049590 Bacteria 3902
746 Ga0501075_0251067 3300049591 Bacteria 1348
747 Ga0501075_0663448 3300049591 Bacteria 795
748 Ga0501077_0217586 3300049593 Bacteria 1214
749 Ga0501251_045516 3300049681 Bacteria 679
750 Ga0501256_009573 3300049685 Bacteria 916
751 Ga0501080_0027515 3300049742 Bacteria 5288
752 Ga0501080_0030607 3300049742 Bacteria 5016
753 Ga0501080_0054018 3300049742 Bacteria 3741
754 Ga0501080_0058277 3300049742 Bacteria 3595
755 Ga0501035_0072854 3300049822 Bacteria 3039
756 Ga0501035_0152767 3300049822 Bacteria 2003
757 Ga0501035_0238981 3300049822 Bacteria 1545
758 Ga0501035_0269781 3300049822 Bacteria 1441
759 Ga0501044_0000831 3300049823 Bacteria 37090
760 Ga0501044_0041695 3300049823 Bacteria 4778
761 Ga0501044_0051502 3300049823 Bacteria 4244
762 Ga0501044_0072343 3300049823 Bacteria 3505
763 Ga0501044_0108394 3300049823 Bacteria 2787
764 Ga0501044_0179548 3300049823 Bacteria 2084
765 Ga0501045_0015508 3300049824 Bacteria 5406
766 nmdc:mga03683_105703_c1 3300050489 Bacteria 791
767 nmdc:mga03683_133585_c1 3300050489 Bacteria 1112
768 nmdc:mga03n38_28529_c1 3300050490 Bacteria 2328
769 nmdc:mga03n38_32551_c1 3300050490 Bacteria 2210
770 nmdc:mga03n38_407172_c1 3300050490 Bacteria 750
771 nmdc:mga00v17_127870_c1 3300050491 Bacteria 1622
772 nmdc:mga00v17_81811_c1 3300050491 Bacteria 2018
773 nmdc:mga0yw44_358_c1 3300050492 Bacteria 15905
774 nmdc:mga0yw44_394600_c1 3300050492 Bacteria 935
775 nmdc:mga0yw44_701_c1 3300050492 Bacteria 12279
776 nmdc:mga06z11_1372_c1 3300050494 Bacteria 9014
777 nmdc:mga06z11_17141_c1 3300050494 Bacteria 3281
778 nmdc:mga06z11_27097_c1 3300050494 Bacteria 2737
779 nmdc:mga06z11_466781_c1 3300050494 Bacteria 763
780 nmdc:mga04h51_1187_c1 3300050495 Bacteria 6006
781 nmdc:mga07m45_14284_c1 3300050496 Bacteria 4226
782 nmdc:mga05p37_1141_c1 3300050507 Bacteria 30525
783 nmdc:mga09592_892_c1 3300050508 Bacteria 23407
784 nmdc:mga0qj67_129813_c1 3300050509 Bacteria 2041
785 nmdc:mga06r32_1808_c1 3300050510 Bacteria 19117
786 nmdc:mga06r32_562598_c1 3300050510 Bacteria 1113
787 nmdc:mga08y16_24256_c1 3300050511 Bacteria 6402
788 nmdc:mga08y16_483222_c1 3300050511 Bacteria 1260
789 nmdc:mga0n895_34212_c1 3300050512 Bacteria 4890
790 nmdc:mga0n895_492282_c1 3300050512 Bacteria 1236
791 nmdc:mga0n895_525157_c1 3300050512 Bacteria 1191
792 nmdc:mga0rr50_30177_c1 3300050513 Bacteria 3835
793 nmdc:mga0rr50_823953_c1 3300050513 Bacteria 792
794 nmdc:mga08x19_46583_c1 3300050514 Bacteria 2773
795 nmdc:mga0a205_173780_c1 3300050515 Bacteria 2050
796 nmdc:mga0a205_255092_c1 3300050515 Bacteria 1633
797 nmdc:mga0a205_549893_c1 3300050515 Bacteria 1009
798 nmdc:mga0sz30_179365_c1 3300050516 Bacteria 631
799 Ga0495601_0456885 3300053077 Bacteria 826
800 Ga0495612_0098896 3300053078 Bacteria 1241
801 Ga0500635_0000518 3300053080 Bacteria 10599
802 Ga0495655_0106662 3300053083 Bacteria 837
803 Ga0495619_0160655 3300053085 Bacteria 1552
804 Ga0500643_001933 3300053087 Bacteria 11225
805 Ga0500644_0137755 3300053088 Bacteria 967
806 Ga0500614_053912 3300053123 Bacteria 1064
807 Ga0500573_0060266 3300053140 Bacteria 2174
808 Ga0500586_134906 3300053145 Bacteria 852
809 Ga0500600_0108247 3300053149 Bacteria 1454
810 Ga0500624_002931 3300053157 Bacteria 2256
811 Ga0500587_018897 3300053739 Bacteria 890
812 Ga0501084_0138730 3300054114 Bacteria 2047
813 Ga0466962_0002489 3300061719 Bacteria 8730
814 Ga0466962_0093752 3300061719 Bacteria 1439
815 2547408880 2547132111 Bacteria 8013147
816 2585305996 2582581313 Bacteria 10042643
817 2585316401 2582581314 Bacteria 11452267
818 2616693733 2616644814 Bacteria 11555299
819 2644265139 2643221647 Bacteria 10741251
820 2644441817 2643221678 Bacteria 9540101
821 2644630796 2643221714 Bacteria 9015452
822 2784586019 2784132148 Bacteria 8627943
823 2785366239 2784746768 Bacteria 10036182
824 2786667210 2786546132 Bacteria 10419719
825 2808846836 2808606359 Bacteria 9866990
826 2808917475 2808606375 Bacteria 9466072
827 2809229520 2808606448 Bacteria 8656184
828 2811846407 2808606982 Bacteria 7791042
829 2812361551 2811994879 Bacteria 9313447
830 2812477203 2811994917 Bacteria 7761064
831 2819744315 2818991472 Bacteria 10089953
832 2852641729 2852635781 Bacteria 8251373
833 2855388569 2855386786 Bacteria 4752232
834 2857712808 2857710386 Bacteria 3186771
835 2862181994 2862178590 Bacteria 8583590
836 2862282378 2862281513 Bacteria 9621493
837 2862387282 2862382967 Bacteria 10317375
838 2862574896 2862574272 Bacteria 10567477
839 2867437248 2867428634 Bacteria 9590268
840 2868095216 2868088558 Bacteria 7609351
841 2877684274 2877676314 Bacteria 9512378
842 2902794450 2902792274 Bacteria 7270173
843 2912723706 2912715099 Bacteria 9460473
844 2912726802 2912723979 Bacteria 8557534
845 2915772854 2915768154 Bacteria 8424322
846 2919473858 2919468124 Bacteria 9133025
847 2928156199 2928153084 Bacteria 4020257
848 2939660889 2939660829 Bacteria 3784848
849 2946064612 2946064051 Bacteria 8957905
850 2946073021 2946072368 Bacteria 8999607
851 2947224552 2947224130 Bacteria 9938529
852 2954008173 2954002825 Bacteria 9173742
853 2954389610 2954380949 Bacteria 10050426
854 2954682298 2954673503 Bacteria 9685905
855 2954690626 2954682443 Bacteria 9862841
856 2954719127 2954711539 Bacteria 10867210
857 2954729097 2954721474 Bacteria 10456478
858 2954732714 2954731030 Bacteria 10243860
859 2954747997 2954740390 Bacteria 10229294
860 2954751592 2954749733 Bacteria 10366972
861 2954767122 2954759201 Bacteria 9358192
862 2984578781 2984576629 Bacteria 4248407
863 2990066045 2990059506 Bacteria 9321252
864 2990257967 2990256926 Bacteria 4252839
865 3006396706 3006393351 Bacteria 6615579
866 3006498606 3006493962 Bacteria 8825450
867 8008560229 8008558824 Bacteria 10610750
868 8008581415 8008574985 Bacteria 7815457
869 8023624569 8023623736 Bacteria 8593882
870 8048414193 8048406513 Bacteria 8936924
871 8056581914 8056579771 Bacteria 5840325
872 8056831009 8056829672 Bacteria 9045328
873 Ga0451853_1980144
874 LJNas_1007201
875 JGI24740J21852_10108297
876 JGI24739J22299_10038691
877 JGI24737J22298_10117102
878 JGI24735J21928_10038628
879 JGI24735J21928_10076469
880 JGI24735J21928_10077889
881 JGI24738J21930_10068099
882 JGI25406J46586_10007955
883 JGI25153J46596_10067939
884 rootH1_10038533
885 Ga0006562J51391_1034931
886 Ga0006562J51391_1034932
887 Ga0058860_10109326
888 Ga0070670_100678659
889 Ga0068869_100017667
890 Ga0068869_100037554
891 Ga0070666_10007312
892 Ga0070682_100090447
893 Ga0068868_100162809
894 Ga0068868_100252750
895 Ga0070660_100303079
896 Ga0070691_10005471
897 Ga0070687_100067522
898 Ga0070687_100229776
899 Ga0070692_10218895
900 Ga0070692_10764031
901 Ga0070668_100275575
902 Ga0070668_100295376
903 Ga0070675_100345231
904 Ga0070671_100016429
905 Ga0070674_100147162
906 Ga0070673_100171630
907 Ga0070673_100271545
908 Ga0070688_100529431
909 Ga0070659_100944738
910 Ga0070667_100002613
911 Ga0070667_101500305
912 Ga0070703_10094246
913 Ga0070709_10043271
914 Ga0070714_100002217
915 Ga0070714_100029677
916 Ga0070714_100872556
917 Ga0070713_100065521
918 Ga0070713_100235272
919 Ga0070710_10003885
920 Ga0070711_100221674
921 Ga0070700_100141701
922 Ga0070700_100849353
923 Ga0070694_100026153
924 Ga0070708_100718187
925 Ga0070663_100032213
926 Ga0070681_10151867
927 Ga0068867_100247681
928 Ga0070685_10665148
929 Ga0070698_100030269
930 Ga0070697_100590285
931 Ga0070697_100773200
932 Ga0068853_100017618
933 Ga0068853_100027326
934 Ga0068853_100030904
935 Ga0068853_100034938
936 Ga0070672_100020134
937 Ga0070672_100575451
938 Ga0070686_100033705
939 Ga0070696_100075725
940 Ga0070693_100138032
941 Ga0070665_100001319
942 Ga0070665_100061049
943 Ga0070665_100108924
944 Ga0070665_101015941
945 Ga0070704_100004542
946 Ga0070704_100043787
947 Ga0070704_100982963
948 Ga0068855_100218234
949 Ga0068855_100572907
950 Ga0070664_100023962
951 Ga0070664_100579108
952 Ga0068857_100978270
953 Ga0068854_100172109
954 Ga0068854_100317215
955 Ga0068856_100055598
956 Ga0068856_101119387
957 Ga0070702_100025912
958 Ga0068852_100010216
959 Ga0068859_100067109
960 Ga0068864_100020461
961 Ga0068864_100190680
962 Ga0068863_100000838
963 Ga0068863_100074158
964 Ga0068858_100006027
965 Ga0068860_100000035
966 Ga0068860_100064659
967 Ga0081538_10030686
968 Ga0081540_1026985
969 Ga0081539_10000299
970 Ga0081539_10006331
971 Ga0070717_10192018
972 Ga0070717_10312930
973 Ga0075365_10000271
974 Ga0075365_10000542
975 Ga0075365_10003022
976 Ga0075365_10014333
977 Ga0075365_10427506
978 Ga0075365_10500357
979 Ga0075368_10001577
980 Ga0075368_10019267
981 Ga0075368_10318418
982 Ga0075363_100018949
983 Ga0075363_100073595
984 Ga0075363_100126999
985 Ga0075364_10036412
986 Ga0075364_10067808
987 Ga0075364_10135996
988 Ga0075432_10022412
989 Ga0070715_10006410
990 Ga0070715_10105983
991 Ga0070716_100012812
992 Ga0070716_100027728
993 Ga0070716_100130263
994 Ga0070712_100036994
995 Ga0070712_100325396
996 Ga0075362_10052869
997 Ga0075362_10287511
998 Ga0075367_10000756
999 Ga0075367_10118581
1000 Ga0075369_10316917
1001 Ga0097621_100289125
1002 Ga0097621_100370094
1003 Ga0075370_10002095
1004 Ga0075370_10076808
1005 Ga0075370_10128591
1006 Ga0068871_100585140
1007 Ga0075428_100066825
1008 Ga0075428_100085244
1009 Ga0075430_100022164
1010 Ga0075431_100028052
1011 Ga0075431_100420960
1012 Ga0075433_10012282
1013 Ga0075433_10289408
1014 Ga0075434_100221394
1015 Ga0075429_100034922
1016 Ga0075436_100051627
1017 Ga0075436_100330858
1018 Ga0097620_100067105
1019 Ga0099826_10081921
1020 Ga0075435_100240249
1021 Ga0075435_100783989
1022 Ga0105250_10073405
1023 Ga0111539_10005904
1024 Ga0111539_10050736
1025 Ga0105245_10106544
1026 Ga0105245_10134706
1027 Ga0105245_10142322
1028 Ga0105245_10981784
1029 Ga0105247_10484379
1030 Ga0114129_10031516
1031 Ga0114129_10041599
1032 Ga0105243_10095085
1033 Ga0105243_11054063
1034 Ga0105241_10087584
1035 Ga0105241_11300118
1036 Ga0105242_10008778
1037 Ga0105242_10013266
1038 Ga0105248_10055247
1039 Ga0105248_10386642
1040 Ga0105237_10006793
1041 Ga0105237_10157455
1042 Ga0105238_10198156
1043 Ga0105238_10251949
1044 Ga0105238_10713011
1045 Ga0105249_10086907
1046 Ga0105249_10746174
1047 Ga0105239_10015899
1048 Ga0105239_10262236
1049 Ga0105246_10318634
1050 Ga0157373_10117922
1051 Ga0157371_10031342
1052 Ga0157370_10707537
1053 Ga0157369_10056851
1054 Ga0157369_10299882
1055 Ga0157374_10237493
1056 Ga0157378_10009197
1057 Ga0163162_10270256
1058 Ga0157372_10094253
1059 Ga0157372_10887475
1060 Ga0157375_10427272
1061 Ga0157375_10584430
1062 Ga0163163_10034121
1063 Ga0157380_10231828
1064 Ga0157380_10433529
1065 Ga0182008_10005993
1066 Ga0182008_10076556
1067 Ga0182008_10492486
1068 Ga0157377_10066285
1069 Ga0157379_10068205
1070 Ga0157379_10431802
1071 Ga0182006_1014687
1072 Ga0182007_10002837
1073 Ga0182005_1035747
1074 Ga0163161_10020276
1075 Ga0163161_10499065
1076 Ga0206351_10975587
1077 Ga0206350_10754245
1078 Ga0206353_11322166
1079 Ga0224712_10061034
1080 Ga0224712_10521785
1081 Ga0209758_1008268
1082 Ga0207426_1012186
1083 Ga0207653_10057601
1084 Ga0207692_10039497
1085 Ga0207642_10158691
1086 Ga0207710_10179295
1087 Ga0207688_10013126
1088 Ga0207680_10014377
1089 Ga0207680_10365454
1090 Ga0207647_10036111
1091 Ga0207647_10104530
1092 Ga0207647_10113378
1093 Ga0207699_10115330
1094 Ga0207699_10120396
1095 Ga0207699_10183685
1096 Ga0207699_10464510
1097 Ga0207671_10006937
1098 Ga0207671_10594841
1099 Ga0207693_10051272
1100 Ga0207693_10538198
1101 Ga0207663_10132714
1102 Ga0207663_10322781
1103 Ga0207662_10040255
1104 Ga0207657_10008156
1105 Ga0207657_10034789
1106 Ga0207657_10067636
1107 Ga0207694_10139106
1108 Ga0207650_10880248
1109 Ga0207659_10354279
1110 Ga0207687_10049641
1111 Ga0207687_10437949
1112 Ga0207687_10837451
1113 Ga0207700_10001420
1114 Ga0207700_10037944
1115 Ga0207700_10350682
1116 Ga0207664_10014378
1117 Ga0207664_10153653
1118 Ga0207664_10239297
1119 Ga0207664_10346452
1120 Ga0207664_10756437
1121 Ga0207644_10342854
1122 Ga0207690_10266611
1123 Ga0207690_10575765
1124 Ga0207706_10256138
1125 Ga0207706_10482263
1126 Ga0207686_10015002
1127 Ga0207686_10171024
1128 Ga0207709_10065760
1129 Ga0207709_10555384
1130 Ga0207669_11198775
1131 Ga0207704_10115337
1132 Ga0207704_10441561
1133 Ga0207665_10000659
1134 Ga0207665_10274811
1135 Ga0207691_10272019
1136 Ga0207689_10106819
1137 Ga0207679_10017072
1138 Ga0207667_10071239
1139 Ga0207667_10284371
1140 Ga0207712_11158120
1141 Ga0207668_10151112
1142 Ga0207640_10348447
1143 Ga0207658_10002029
1144 Ga0207658_10036514
1145 Ga0207677_10190553
1146 Ga0207677_10546007
1147 Ga0207703_10022485
1148 Ga0207639_10069194
1149 Ga0207639_10075730
1150 Ga0207639_10169352
1151 Ga0207678_10016674
1152 Ga0207678_10166996
1153 Ga0207708_10146533
1154 Ga0207702_10392889
1155 Ga0207702_10432510
1156 Ga0207641_10001869
1157 Ga0207641_10032411
1158 Ga0207641_10754587
1159 Ga0207676_10088204
1160 Ga0207674_10730746
1161 Ga0207675_100006189
1162 Ga0207675_100012650
1163 Ga0207675_100934499
1164 Ga0207683_10000422
1165 Ga0207683_10004101
1166 Ga0207698_10715047
1167 Ga0209813_10000650
1168 Ga0209813_10035369
1169 Ga0207428_10016463
1170 Ga0207428_10240650
1171 Ga0268266_10020267
1172 Ga0268266_10201573
1173 Ga0268266_10862651
1174 Ga0268266_10872411
1175 Ga0268264_10000031
1176 Ga0268264_10116835
1177 Ga0265322_10019247
1178 Ga0307517_10353543
1179 Ga0307515_10000106
1180 Ga0307511_10112505
1181 Ga0307511_10120376
1182 Ga0307512_10008193
1183 Ga0307512_10048262
1184 Ga0307512_10137615
1185 Ga0316181_1223888
1186 Ga0265327_10000322
1187 Ga0265327_10013425
1188 Ga0265327_10014018
1189 Ga0265327_10252696
1190 Ga0265316_10196098
1191 Ga0307513_10005279
1192 Ga0307513_10345393
1193 Ga0307509_10028795
1194 Ga0307509_10049136
1195 Ga0307408_100126297
1196 Ga0307408_100262084
1197 Ga0307408_100525783
1198 Ga0307508_10031447
1199 Ga0307508_10053893
1200 Ga0307508_10248328
1201 Ga0307514_10009865
1202 Ga0307514_10128835
1203 Ga0307514_10185033
1204 Ga0307514_10290776
1205 Ga0307514_10310201
1206 Ga0307516_10000711
1207 Ga0307516_10135569
1208 Ga0307516_10278577
1209 Ga0307516_10333246
1210 Ga0307405_10082358
1211 Ga0307413_10002840
1212 Ga0307413_10751318
1213 Ga0307518_10021394
1214 Ga0307518_10188872
1215 Ga0307518_10344618
1216 Ga0307410_10018273
1217 Ga0307410_10131455
1218 Ga0307410_10145135
1219 Ga0307410_10436229
1220 Ga0307406_10023717
1221 Ga0307406_10103813
1222 Ga0307407_10001638
1223 Ga0307407_10112733
1224 Ga0307407_10377844
1225 Ga0307412_10013621
1226 Ga0307412_10080959
1227 Ga0307409_100010114
1228 Ga0307409_100027269
1229 Ga0307409_100174211
1230 Ga0307416_100003225
1231 Ga0307416_100019268
1232 Ga0307416_100889942
1233 Ga0307416_100925033
1234 Ga0307416_101894688
1235 Ga0307414_10497174
1236 Ga0307411_10487614
1237 Ga0307411_10816539
1238 Ga0307415_100000965
1239 Ga0307415_100084927
1240 Ga0307415_100176098
1241 Ga0307415_100822126
1242 Ga0307507_10021548
1243 Ga0307507_10089786
1244 Ga0307507_10341947
1245 Ga0307510_10007245
1246 Ga0307510_10086198
1247 Ga0307510_10158183
1248 Ga0307510_10485672
1249 Ga0373959_0085509
1250 Ga0373928_0009331
1251 Ga0373928_0013644
1252 Ga0373928_0072611
1253 Ga0373929_0009062
1254 Ga0373949_0052163
1255 Ga0373932_0004115
1256 Ga0373939_0033347
1257 Ga0373941_0043995
1258 Ga0373960_0085310
1259 Ga0373961_0011635
1260 Ga0373962_0244645
1261 Ga0316574_0144040
1262 Ga0373931_0010210
1263 Ga0373931_0434091
1264 Ga0395899_0564661
1265 Ga0395900_0135131
1266 Ga0395900_0215479
1267 Ga0395900_0860313
1268 Ga0395898_0003326
1269 Ga0395898_0006955
1270 Ga0395898_0160510
1271 Ga0395898_0181057
1272 Ga0395898_1041013
1273 Ga0436364_0816037
1274 Ga0436364_1123106
1275 Ga0395901_0902799
1276 Ga0395901_1294216
1277 Ga0242420_044069
1278 Ga0436365_1612808
1279 Ga0436363_0033422
1280 Ga0436363_0890894
1281 Ga0436362_0012047
1282 Ga0436362_0867026
1283 Ga0436362_1296310
1284 Ga0439436_0026628
1285 Ga0439439_0000318
1286 Ga0439439_0009611
1287 Ga0439439_0274729
1288 Ga0439466_0043993
1289 Ga0439465_0000719
1290 Ga0439465_0154062
1291 Ga0451789_1102227
1292 Ga0451791_1847581
1293 Ga0451841_0137988
1294 Ga0451849_0982872
1295 Ga0451843_1047387
1296 Ga0451853_0886294
1297 Ga0451853_3469875
1298 Ga0439433_0067035
1299 Ga0439442_022016
1300 Ga0439448_0050525
1301 Ga0439448_0057964
1302 Ga0439449_0002621
1303 Ga0439449_0029392
1304 Ga0439457_000615
1305 Ga0439457_005065
1306 Ga0439462_0010781
1307 Ga0450920_048376
1308 Ga0450894_000046
1309 Ga0450894_018196
1310 Ga0450899_004797
1311 Ga0450903_000207
1312 Ga0450906_002372
1313 Ga0439458_0008566
1314 Ga0450908_012583
1315 Ga0466969_0016573
1316 Ga0466969_0052854
1317 Ga0466969_0060698
1318 Ga0466972_0045984
1319 Ga0466972_0058310
1320 Ga0466972_0133627
1321 Ga0466972_0167599
1322 Ga0466972_0233812
1323 Ga0466965_0027062
1324 Ga0466965_0176967
1325 Ga0466965_0190476
1326 Ga0466965_0243129
1327 Ga0466965_0243816
1328 Ga0466966_0001620
1329 Ga0466966_0003597
1330 Ga0466966_0008661
1331 Ga0466966_0024136
1332 Ga0466966_0271365
1333 Ga0466966_0311011
1334 Ga0466961_0017529
1335 Ga0466961_0017761
1336 Ga0466961_0022144
1337 Ga0466961_0105008
1338 Ga0466961_0170195
1339 Ga0466963_0000279
1340 Ga0466963_0077918
1341 Ga0466963_0088628
1342 Ga0466963_0453206
1343 Ga0466963_0673557
1344 Ga0466964_0003280
1345 Ga0466964_0539824
1346 Ga0466971_0012314
1347 Ga0466971_0012611
1348 Ga0466971_0092383
1349 Ga0466968_0119243
1350 Ga0466968_0136393
1351 Ga0466968_0330635
1352 Ga0466970_0002248
1353 Ga0466970_0049688
1354 Ga0466970_0485329
1355 Ga0466970_0518423
1356 Ga0466957_0000404
1357 Ga0466957_0040516
1358 Ga0466960_0057120
1359 Ga0466960_0250144
1360 Ga0466959_0000297
1361 Ga0466959_0063864
1362 Ga0466959_0221141
1363 Ga0466959_0315719
1364 Ga0466958_0020949
1365 Ga0466958_0090986
1366 Ga0466958_0493638
1367 Ga0466958_0535604
1368 Ga0466967_0000412
1369 Ga0466967_0034626
1370 Ga0466967_0062856
1371 Ga0466967_0146044
1372 Ga0466967_0150735
1373 Ga0466967_0447743
1374 Ga0466967_0479952
1375 Ga0495617_056506
1376 Ga0495627_156088
1377 Ga0495592_0051655
1378 Ga0495592_0327375
1379 Ga0495603_0002129
1380 Ga0495603_0003323
1381 Ga0495590_0119706
1382 Ga0495629_0002482
1383 Ga0495629_0054188
1384 Ga0495629_0163205
1385 Ga0495629_0906721
1386 Ga0495638_0127827
1387 Ga0495651_0005915
1388 Ga0495651_0370028
1389 Ga0495651_0565523
1390 Ga0495653_0143473
1391 Ga0495582_0047463
1392 Ga0495582_0087403
1393 Ga0495639_0015156
1394 Ga0495662_0001234
1395 Ga0495662_0003831
1396 Ga0495662_0052009
1397 Ga0495662_0056242
1398 Ga0495664_0000236
1399 Ga0495585_0067393
1400 Ga0495594_0037193
1401 Ga0495594_0041562
1402 Ga0495594_0264944
1403 Ga0495594_0282886
1404 Ga0495596_0139543
1405 Ga0495607_0019302
1406 Ga0495583_0042126
1407 Ga0495606_0073578
1408 Ga0495608_0139303
1409 Ga0495610_0063310
1410 Ga0495616_0025507
1411 Ga0495620_0094486
1412 Ga0495620_0131368
1413 Ga0495628_0146333
1414 Ga0495630_0037299
1415 Ga0495631_0101964
1416 Ga0495632_0047367
1417 Ga0495643_0006220
1418 Ga0495644_0077417
1419 Ga0495648_0093206
1420 Ga0495666_0036449
1421 Ga0495652_0188680
1422 Ga0495652_0233405
1423 Ga0495640_0047649
1424 Ga0495586_0469610
1425 Ga0495587_0037649
1426 Ga0495597_0064965
1427 Ga0495597_0079578
1428 Ga0495645_0083414
1429 Ga0495622_0013219
1430 Ga0495622_0087828
1431 Ga0495622_0106865
1432 Ga0495633_0032369
1433 Ga0495667_0041540
1434 Ga0495656_0089983
1435 Ga0495668_0064832
1436 Ga0495668_0244007
1437 Ga0495634_0003864
1438 Ga0495634_0044822
1439 Ga0495611_0015155
1440 Ga0495625_0004908
1441 Ga0495625_0013310
1442 Ga0495625_0288419
1443 Ga0495635_0029477
1444 Ga0495635_0041265
1445 Ga0495661_0071062
1446 Ga0495588_0007022
1447 Ga0495588_0015036
1448 Ga0495588_0087874
1449 Ga0495588_0154926
1450 Ga0495588_0590218
1451 Ga0495657_0002703
1452 Ga0495657_0092041
1453 Ga0495657_0118425
1454 Ga0495657_0154597
1455 Ga0495646_0005201
1456 Ga0495658_0097823
1457 Ga0495613_0000319
1458 Ga0495613_0002293
1459 Ga0495613_0013644
1460 Ga0495613_0084683
1461 Ga0495613_0115687
1462 Ga0495613_0336331
1463 Ga0495624_0027009
1464 Ga0495624_0037998
1465 Ga0495670_0058277
1466 Ga0495670_0076668
1467 Ga0495671_0010037
1468 Ga0495671_0126183
1469 Ga0495589_0039334
1470 Ga0495589_0051361
1471 Ga0495589_0066850
1472 Ga0495589_0074572
1473 Ga0495589_0200689
1474 Ga0495600_0042400
1475 Ga0495600_0233169
1476 Ga0495581_0060845
1477 Ga0495581_0234007
1478 Ga0495581_0516254
1479 Ga0495604_0006154
1480 Ga0495604_0025120
1481 Ga0495636_0009278
1482 Ga0495636_0010641
1483 Ga0495636_0023651
1484 Ga0495636_0050757
1485 Ga0495674_0448838
1486 Ga0495676_0010735
1487 Ga0495676_0023896
1488 Ga0495676_0047750
1489 Ga0495680_0023673
1490 Ga0495680_0420145
1491 Ga0495683_0036295
1492 Ga0495687_002261
1493 Ga0495687_008166
1494 Ga0495687_028854
1495 Ga0495687_079065
1496 Ga0495687_105905
1497 Ga0495675_0003141
1498 Ga0495677_0247044
1499 Ga0495685_001508
1500 Ga0495685_043400
1501 Ga0495685_046505
1502 Ga0495685_047532
1503 Ga0495685_144686
1504 Ga0495673_0190114
1505 Ga0495681_0058581
1506 Ga0495686_0040996
1507 Ga0495686_0053304
1508 Ga0495686_0074567
1509 Ga0495593_0001745
1510 Ga0495593_0187996
1511 Ga0495593_0349578
1512 Ga0495614_0042535
1513 Ga0495614_0067039
1514 Ga0495626_0114841
1515 Ga0496100_0001735
1516 Ga0496100_0054985
1517 Ga0496101_0000014
1518 Ga0496101_0031466
1519 Ga0496101_0109269
1520 Ga0496102_0000041
1521 Ga0496102_0077088
1522 Ga0496102_0352262
1523 Ga0496102_0549585
1524 Ga0496103_0000058
1525 Ga0496103_0254543
1526 Ga0496104_0314541
1527 Ga0496104_0458365
1528 Ga0496105_0015338
1529 Ga0496105_0250878
1530 Ga0496105_0257914
1531 Ga0496105_0443777
1532 Ga0496106_0004428
1533 Ga0496106_0577232
1534 Ga0496107_0028698
1535 Ga0496108_0092942
1536 Ga0496109_0023084
1537 Ga0496109_0141003
1538 Ga0496109_0365662
1539 Ga0496110_0010666
1540 Ga0496110_0768770
1541 Ga0496111_0444146
1542 Ga0496112_0017910
1543 Ga0496112_0055031
1544 Ga0496112_0162808
1545 Ga0496113_0049695
1546 Ga0496113_0246567
1547 Ga0496114_0032203
1548 Ga0496114_0215758
1549 Ga0496114_0369541
1550 Ga0496115_0350368
1551 Ga0496115_0688726
1552 Ga0496116_0000098
1553 Ga0496117_0000071
1554 Ga0496117_0000096
1555 Ga0496117_0010296
1556 Ga0496118_0000073
1557 Ga0496119_0000125
1558 Ga0496119_0195590
1559 Ga0496120_0000695
1560 Ga0496120_0004773
1561 Ga0496121_0000354
1562 Ga0496126_0001057
1563 Ga0496126_0324513
1564 Ga0501306_034581
1565 Ga0495678_021225
1566 Ga0501031_0007022
1567 Ga0501031_0069963
1568 Ga0501032_0013317
1569 Ga0501032_0137732
1570 Ga0501032_0227073
1571 Ga0501033_0004006
1572 Ga0501033_0004072
1573 Ga0501033_0009541
1574 Ga0501033_0070557
1575 Ga0501033_0295469
1576 Ga0501034_0017466
1577 Ga0501034_0023316
1578 Ga0501034_0068902
1579 Ga0501034_0089540
1580 Ga0501034_0119047
1581 Ga0501036_0006377
1582 Ga0501036_0006831
1583 Ga0501036_0311739
1584 Ga0501037_0046594
1585 Ga0501037_0098960
1586 Ga0501037_0113202
1587 Ga0501038_0001431
1588 Ga0501038_0024394
1589 Ga0501038_0032688
1590 Ga0501038_0034781
1591 Ga0501038_0051583
1592 Ga0501039_0115582
1593 Ga0501042_0014252
1594 Ga0501043_0012342
1595 Ga0501043_0737277
1596 Ga0501046_0000546
1597 Ga0501046_0017268
1598 Ga0501046_0018100
1599 Ga0501046_0065375
1600 Ga0501046_0183329
1601 Ga0501047_0007717
1602 Ga0501047_0072468
1603 Ga0501047_0076014
1604 Ga0501047_0114981
1605 Ga0501047_0250784
1606 Ga0501048_0009770
1607 Ga0501067_0126998
1608 Ga0501067_0230141
1609 Ga0501069_0022652
1610 Ga0501069_0160594
1611 Ga0501069_0193922
1612 Ga0501070_0002466
1613 Ga0501070_0004002
1614 Ga0501070_0071841
1615 Ga0501070_0495589
1616 Ga0501073_0024000
1617 Ga0501074_0030576
1618 Ga0501075_0251067
1619 Ga0501075_0663448
1620 Ga0501077_0217586
1621 Ga0501251_045516
1622 Ga0501256_009573
1623 Ga0501080_0027515
1624 Ga0501080_0030607
1625 Ga0501080_0054018
1626 Ga0501080_0058277
1627 Ga0501035_0072854
1628 Ga0501035_0152767
1629 Ga0501035_0238981
1630 Ga0501035_0269781
1631 Ga0501044_0000831
1632 Ga0501044_0041695
1633 Ga0501044_0051502
1634 Ga0501044_0072343
1635 Ga0501044_0108394
1636 Ga0501044_0179548
1637 Ga0501045_0015508
1638 nmdc:mga03683_105703_c1
1639 nmdc:mga03683_133585_c1
1640 nmdc:mga03n38_28529_c1
1641 nmdc:mga03n38_32551_c1
1642 nmdc:mga03n38_407172_c1
1643 nmdc:mga00v17_127870_c1
1644 nmdc:mga00v17_81811_c1
1645 nmdc:mga0yw44_358_c1
1646 nmdc:mga0yw44_394600_c1
1647 nmdc:mga0yw44_701_c1
1648 nmdc:mga06z11_1372_c1
1649 nmdc:mga06z11_17141_c1
1650 nmdc:mga06z11_27097_c1
1651 nmdc:mga06z11_466781_c1
1652 nmdc:mga04h51_1187_c1
1653 nmdc:mga07m45_14284_c1
1654 nmdc:mga05p37_1141_c1
1655 nmdc:mga09592_892_c1
1656 nmdc:mga0qj67_129813_c1
1657 nmdc:mga06r32_1808_c1
1658 nmdc:mga06r32_562598_c1
1659 nmdc:mga08y16_24256_c1
1660 nmdc:mga08y16_483222_c1
1661 nmdc:mga0n895_34212_c1
1662 nmdc:mga0n895_492282_c1
1663 nmdc:mga0n895_525157_c1
1664 nmdc:mga0rr50_30177_c1
1665 nmdc:mga0rr50_823953_c1
1666 nmdc:mga08x19_46583_c1
1667 nmdc:mga0a205_173780_c1
1668 nmdc:mga0a205_255092_c1
1669 nmdc:mga0a205_549893_c1
1670 nmdc:mga0sz30_179365_c1
1671 Ga0495601_0456885
1672 Ga0495612_0098896
1673 Ga0500635_0000518
1674 Ga0495655_0106662
1675 Ga0495619_0160655
1676 Ga0500643_001933
1677 Ga0500644_0137755
1678 Ga0500614_053912
1679 Ga0500573_0060266
1680 Ga0500586_134906
1681 Ga0500600_0108247
1682 Ga0500624_002931
1683 Ga0500587_018897
1684 Ga0501084_0138730
1685 Ga0466962_0002489
1686 Ga0466962_0093752
1687 2547408880
1688 2585305996
1689 2585316401
1690 2616693733
1691 2644265139
1692 2644441817
1693 2644630796
1694 2784586019
1695 2785366239
1696 2786667210
1697 2808846836
1698 2808917475
1699 2809229520
1700 2811846407
1701 2812361551
1702 2812477203
1703 2819744315
1704 2852641729
1705 2855388569
1706 2857712808
1707 2862181994
1708 2862282378
1709 2862387282
1710 2862574896
1711 2867437248
1712 2868095216
1713 2877684274
1714 2902794450
1715 2912723706
1716 2912726802
1717 2915772854
1718 2919473858
1719 2928156199
1720 2939660889
1721 2946064612
1722 2946073021
1723 2947224552
1724 2954008173
1725 2954389610
1726 2954682298
1727 2954690626
1728 2954719127
1729 2954729097
1730 2954732714
1731 2954747997
1732 2954751592
1733 2954767122
1734 2984578781
1735 2990066045
1736 2990257967
1737 3006396706
1738 3006498606
1739 8008560229
1740 8008581415
1741 8023624569
1742 8048414193
1743 8056581914
1744 8056831009

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

16

165

0.86

PF04978

DUF664

Protein of unknown function (DUF664)

12

174

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.991 20 184
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9877 19 184
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9734 20 184
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9591 19 184
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.933 23 182
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9987 20 186 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9869 20 186 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9356 23 182 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.887 23 182 1.20.120.450
af_Q2FUS3_1_147_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7476 27 181 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2S8LCC3-F1-model_v4 deleted 0.9991 18 186
AF-A0A7I9ZK04-F1-model_v4 Chorismate synthase 0.9972 19 186
AF-A0A1X0FY10-F1-model_v4 Chorismate synthase 0.9968 20 184
AF-A0A2S8MYX2-F1-model_v4 deleted 0.9968 82 165
AF-A0A7I7LBG9-F1-model_v4 Chorismate synthase 0.9967 17 186

Map