F484151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 870 | 332 | 1740 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10194559|Ga0307406_101945591 |
| Length | 308 |
| Sequence | MMGGDYAPLEAVKGVQLYLSGHNIPANLLLIGDEKKISELLDAEKVPRDHIRIVHADQVIDMHEHPTRAMKEKQRSSIAVGFHLLATGKMDAFLSAGNTGAMMVGALFALKPVDGVIRPAISTLVPKTNGGTALLLDVGLNADCKPEQLNQFAMMGSVYANLVLGIDNPRVGLINVGEEESKGNMLAQATYPLLKENSSINFIGNVEGREVLLGDQADVMICEGFTGNIILKMAESLFDVGTYIGVDHPYFKRFDFENYGGTPVLGISKPVIIGHGISHAKAFMNMIHLAQIMVEKQVVEKVSSGLSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 199 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 200 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 204 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 205 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 206 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 244 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 248 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 249 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 250 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 267 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 268 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 272 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 276 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 277 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 284 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 285 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 288 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 289 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 293 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 304 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 307 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 309 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 312 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 315 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 316 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 318 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 319 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 320 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 321 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 322 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 323 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 324 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 325 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 326 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 327 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 328 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 329 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 330 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 331 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 332 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0.23 |
| Isolates | 1.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.25 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 91.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307406_10194559 | 3300031901 | Bacteria | 1488 |
| 2 | SwRhRL2b_contig_1653087 | 2162886007 | Bacteria | 2458 |
| 3 | JGI24744J21845_10008862 | 3300002077 | Bacteria | 2068 |
| 4 | JGI24751J29686_10000663 | 3300002459 | Bacteria | 8621 |
| 5 | rootH1_10001281 | 3300003316 | Bacteria | 1223 |
| 6 | rootH1_10023420 | 3300003316 | Bacteria | 13941 |
| 7 | rootH2_10010689 | 3300003320 | Bacteria | 7877 |
| 8 | rootH2_10010690 | 3300003320 | Bacteria | 22348 |
| 9 | rootH2_10042456 | 3300003320 | Bacteria | 19931 |
| 10 | rootL2_10010012 | 3300003322 | Bacteria | 5124 |
| 11 | rootL2_10268153 | 3300003322 | Bacteria | 1154 |
| 12 | rootH1_10007222 | 3300003323 | Bacteria | 5665 |
| 13 | Ga0055535_1001518 | 3300003761 | Bacteria | 11445 |
| 14 | Ga0055542_1004712 | 3300003762 | Bacteria | 3226 |
| 15 | Ga0065165_1004475 | 3300005262 | Bacteria | 8625 |
| 16 | Ga0065714_10003722 | 3300005288 | Bacteria | 22816 |
| 17 | Ga0065714_10006151 | 3300005288 | Bacteria | 6883 |
| 18 | Ga0065704_10000425 | 3300005289 | Bacteria | 76756 |
| 19 | Ga0065704_10113039 | 3300005289 | Bacteria | 1920 |
| 20 | Ga0065712_10003529 | 3300005290 | Bacteria | 5603 |
| 21 | Ga0065707_10236541 | 3300005295 | Unclassified | 1170 |
| 22 | Ga0070658_10013253 | 3300005327 | Bacteria | 6613 |
| 23 | Ga0070658_10079956 | 3300005327 | Bacteria | 2685 |
| 24 | Ga0070658_10093425 | 3300005327 | Bacteria | 2481 |
| 25 | Ga0070676_10007961 | 3300005328 | Bacteria | 5698 |
| 26 | Ga0070676_10012157 | 3300005328 | Bacteria | 4694 |
| 27 | Ga0070676_10026931 | 3300005328 | Bacteria | 3256 |
| 28 | Ga0070676_10035505 | 3300005328 | Unclassified | 2868 |
| 29 | Ga0070676_10135204 | 3300005328 | Bacteria | 1563 |
| 30 | Ga0070683_100000512 | 3300005329 | Bacteria | 27191 |
| 31 | Ga0070683_100025645 | 3300005329 | Bacteria | 5297 |
| 32 | Ga0070683_100059038 | 3300005329 | Bacteria | 3564 |
| 33 | Ga0070683_100164265 | 3300005329 | Bacteria | 2106 |
| 34 | Ga0070690_100038963 | 3300005330 | Unclassified | 3001 |
| 35 | Ga0070690_100179714 | 3300005330 | Unclassified | 1461 |
| 36 | Ga0070690_100308854 | 3300005330 | Bacteria | 1136 |
| 37 | Ga0070670_100015018 | 3300005331 | Bacteria | 6645 |
| 38 | Ga0070670_100050652 | 3300005331 | Bacteria | 3568 |
| 39 | Ga0070670_100097944 | 3300005331 | Bacteria | 2523 |
| 40 | Ga0070670_100136070 | 3300005331 | Bacteria | 2123 |
| 41 | Ga0070670_100246948 | 3300005331 | Unclassified | 1554 |
| 42 | Ga0070670_100275290 | 3300005331 | Bacteria | 1469 |
| 43 | Ga0070677_10007092 | 3300005333 | Unclassified | 3732 |
| 44 | Ga0070677_10020248 | 3300005333 | Bacteria | 2421 |
| 45 | Ga0068869_100009369 | 3300005334 | Bacteria | 6354 |
| 46 | Ga0068869_100024895 | 3300005334 | Bacteria | 4150 |
| 47 | Ga0068869_100035283 | 3300005334 | Unclassified | 3544 |
| 48 | Ga0068869_100035864 | 3300005334 | Unclassified | 3518 |
| 49 | Ga0068869_100043519 | 3300005334 | Bacteria | 3225 |
| 50 | Ga0068869_100115309 | 3300005334 | Bacteria | 2048 |
| 51 | Ga0068869_100158449 | 3300005334 | Bacteria | 1761 |
| 52 | Ga0070666_10060167 | 3300005335 | Bacteria | 2570 |
| 53 | Ga0070666_10168885 | 3300005335 | Bacteria | 1531 |
| 54 | Ga0070666_10168939 | 3300005335 | Bacteria | 1531 |
| 55 | Ga0070666_10265365 | 3300005335 | Bacteria | 1218 |
| 56 | Ga0070680_100002240 | 3300005336 | Bacteria | 14265 |
| 57 | Ga0070680_100021329 | 3300005336 | Bacteria | 5147 |
| 58 | Ga0070680_100172848 | 3300005336 | Bacteria | 1818 |
| 59 | Ga0070682_100007420 | 3300005337 | Bacteria | 6185 |
| 60 | Ga0068868_100006993 | 3300005338 | Bacteria | 8022 |
| 61 | Ga0068868_100033356 | 3300005338 | Bacteria | 3968 |
| 62 | Ga0068868_100047423 | 3300005338 | Bacteria | 3367 |
| 63 | Ga0068868_100052611 | 3300005338 | Unclassified | 3206 |
| 64 | Ga0070660_100003183 | 3300005339 | Bacteria | 11279 |
| 65 | Ga0070689_100013318 | 3300005340 | Bacteria | 5949 |
| 66 | Ga0070689_100026682 | 3300005340 | Unclassified | 4351 |
| 67 | Ga0070689_100033351 | 3300005340 | Bacteria | 3923 |
| 68 | Ga0070689_100065190 | 3300005340 | Bacteria | 2836 |
| 69 | Ga0070691_10020293 | 3300005341 | Bacteria | 3070 |
| 70 | Ga0070661_100000634 | 3300005344 | Bacteria | 26141 |
| 71 | Ga0070661_100059617 | 3300005344 | Unclassified | 2799 |
| 72 | Ga0070661_100113146 | 3300005344 | Bacteria | 2028 |
| 73 | Ga0070668_100027281 | 3300005347 | Bacteria | 4336 |
| 74 | Ga0070668_100058742 | 3300005347 | Bacteria | 2976 |
| 75 | Ga0070668_100427998 | 3300005347 | Bacteria | 1134 |
| 76 | Ga0070669_100001036 | 3300005353 | Bacteria | 20291 |
| 77 | Ga0070669_100016058 | 3300005353 | Bacteria | 5342 |
| 78 | Ga0070669_100048580 | 3300005353 | Bacteria | 3097 |
| 79 | Ga0070669_100145019 | 3300005353 | Bacteria | 1834 |
| 80 | Ga0070669_100205111 | 3300005353 | Bacteria | 1553 |
| 81 | Ga0070669_100230752 | 3300005353 | Bacteria | 1467 |
| 82 | Ga0070675_100015289 | 3300005354 | Bacteria | 6065 |
| 83 | Ga0070675_100041537 | 3300005354 | Bacteria | 3757 |
| 84 | Ga0070675_100106087 | 3300005354 | Bacteria | 2371 |
| 85 | Ga0070675_100143204 | 3300005354 | Bacteria | 2045 |
| 86 | Ga0070675_100383980 | 3300005354 | Bacteria | 1251 |
| 87 | Ga0070675_100404532 | 3300005354 | Bacteria | 1218 |
| 88 | Ga0070671_100037910 | 3300005355 | Unclassified | 3999 |
| 89 | Ga0070671_100128878 | 3300005355 | Bacteria | 2130 |
| 90 | Ga0070671_100258456 | 3300005355 | Unclassified | 1480 |
| 91 | Ga0070674_100015390 | 3300005356 | Bacteria | 4775 |
| 92 | Ga0070673_100009239 | 3300005364 | Bacteria | 6612 |
| 93 | Ga0070673_100010058 | 3300005364 | Bacteria | 6385 |
| 94 | Ga0070673_100042711 | 3300005364 | Bacteria | 3497 |
| 95 | Ga0070673_100345840 | 3300005364 | Unclassified | 1319 |
| 96 | Ga0070688_100001275 | 3300005365 | Bacteria | 12550 |
| 97 | Ga0070688_100230134 | 3300005365 | Bacteria | 1311 |
| 98 | Ga0070659_100007461 | 3300005366 | Bacteria | 7947 |
| 99 | Ga0070659_100052846 | 3300005366 | Bacteria | 3196 |
| 100 | Ga0070659_100087142 | 3300005366 | Bacteria | 2499 |
| 101 | Ga0070659_100230808 | 3300005366 | Bacteria | 1529 |
| 102 | Ga0070667_100056499 | 3300005367 | Bacteria | 3316 |
| 103 | Ga0070667_100079054 | 3300005367 | Unclassified | 2811 |
| 104 | Ga0070667_100097400 | 3300005367 | Bacteria | 2537 |
| 105 | Ga0070663_100097632 | 3300005455 | Bacteria | 2187 |
| 106 | Ga0070678_100006297 | 3300005456 | Bacteria | 6955 |
| 107 | Ga0070678_100035117 | 3300005456 | Bacteria | 3497 |
| 108 | Ga0070678_100088579 | 3300005456 | Unclassified | 2367 |
| 109 | Ga0070678_100371455 | 3300005456 | Bacteria | 1235 |
| 110 | Ga0070662_100006760 | 3300005457 | Bacteria | 7414 |
| 111 | Ga0070681_10001251 | 3300005458 | Bacteria | 22123 |
| 112 | Ga0068867_100036347 | 3300005459 | Unclassified | 3575 |
| 113 | Ga0068867_100068482 | 3300005459 | Unclassified | 2649 |
| 114 | Ga0068867_100096438 | 3300005459 | Bacteria | 2251 |
| 115 | Ga0068867_100198613 | 3300005459 | Bacteria | 1604 |
| 116 | Ga0068867_100263976 | 3300005459 | Bacteria | 1405 |
| 117 | Ga0070685_10012174 | 3300005466 | Bacteria | 4513 |
| 118 | Ga0070698_100005891 | 3300005471 | Bacteria | 13381 |
| 119 | Ga0070698_100007220 | 3300005471 | Bacteria | 12036 |
| 120 | Ga0070698_100224820 | 3300005471 | Bacteria | 1810 |
| 121 | Ga0070698_100272864 | 3300005471 | Bacteria | 1623 |
| 122 | Ga0070679_100006537 | 3300005530 | Bacteria | 10864 |
| 123 | Ga0070679_100050984 | 3300005530 | Bacteria | 4122 |
| 124 | Ga0070679_100082522 | 3300005530 | Bacteria | 3204 |
| 125 | Ga0070679_100174300 | 3300005530 | Bacteria | 2123 |
| 126 | Ga0070679_100198468 | 3300005530 | Bacteria | 1973 |
| 127 | Ga0070684_100000251 | 3300005535 | Bacteria | 37139 |
| 128 | Ga0070684_100031546 | 3300005535 | Bacteria | 4511 |
| 129 | Ga0070684_100125735 | 3300005535 | Bacteria | 2309 |
| 130 | Ga0070684_100273092 | 3300005535 | Bacteria | 1548 |
| 131 | Ga0070684_100361453 | 3300005535 | Bacteria | 1336 |
| 132 | Ga0068853_100000201 | 3300005539 | Bacteria | 41960 |
| 133 | Ga0068853_100039029 | 3300005539 | Bacteria | 4048 |
| 134 | Ga0068853_100045528 | 3300005539 | Bacteria | 3758 |
| 135 | Ga0068853_100051466 | 3300005539 | Bacteria | 3545 |
| 136 | Ga0068853_100073146 | 3300005539 | Unclassified | 2988 |
| 137 | Ga0068853_100082228 | 3300005539 | Bacteria | 2821 |
| 138 | Ga0068853_100115291 | 3300005539 | Bacteria | 2391 |
| 139 | Ga0070672_100037905 | 3300005543 | Unclassified | 3680 |
| 140 | Ga0070672_100049845 | 3300005543 | Bacteria | 3259 |
| 141 | Ga0070672_100111539 | 3300005543 | Unclassified | 2230 |
| 142 | Ga0070672_100258380 | 3300005543 | Unclassified | 1468 |
| 143 | Ga0070686_100212894 | 3300005544 | Bacteria | 1392 |
| 144 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 145 | Ga0070665_100020959 | 3300005548 | Bacteria | 6569 |
| 146 | Ga0070665_100428216 | 3300005548 | Unclassified | 1332 |
| 147 | Ga0070704_100110763 | 3300005549 | Unclassified | 2088 |
| 148 | Ga0068855_100001845 | 3300005563 | Bacteria | 26357 |
| 149 | Ga0068855_100022508 | 3300005563 | Bacteria | 7553 |
| 150 | Ga0068855_100031682 | 3300005563 | Bacteria | 6313 |
| 151 | Ga0068855_100037843 | 3300005563 | Bacteria | 5734 |
| 152 | Ga0068855_100038248 | 3300005563 | Bacteria | 5702 |
| 153 | Ga0068855_100105819 | 3300005563 | Bacteria | 3234 |
| 154 | Ga0068855_100250298 | 3300005563 | Bacteria | 1976 |
| 155 | Ga0068855_100286098 | 3300005563 | Unclassified | 1829 |
| 156 | Ga0068855_100335243 | 3300005563 | Bacteria | 1669 |
| 157 | Ga0070664_100175261 | 3300005564 | Bacteria | 1904 |
| 158 | Ga0070664_100268493 | 3300005564 | Bacteria | 1536 |
| 159 | Ga0070664_100272966 | 3300005564 | Unclassified | 1523 |
| 160 | Ga0070664_100312514 | 3300005564 | Bacteria | 1422 |
| 161 | Ga0068857_100003568 | 3300005577 | Bacteria | 13012 |
| 162 | Ga0068857_100042339 | 3300005577 | Bacteria | 4039 |
| 163 | Ga0068857_100047325 | 3300005577 | Bacteria | 3818 |
| 164 | Ga0068857_100077502 | 3300005577 | Bacteria | 2966 |
| 165 | Ga0068857_100113884 | 3300005577 | Bacteria | 2432 |
| 166 | Ga0068857_100343719 | 3300005577 | Bacteria | 1381 |
| 167 | Ga0068857_100376552 | 3300005577 | Bacteria | 1317 |
| 168 | Ga0068857_100413914 | 3300005577 | Unclassified | 1256 |
| 169 | Ga0068854_100006771 | 3300005578 | Bacteria | 7302 |
| 170 | Ga0068854_100030233 | 3300005578 | Bacteria | 3757 |
| 171 | Ga0068854_100167820 | 3300005578 | Bacteria | 1705 |
| 172 | Ga0068856_100139537 | 3300005614 | Bacteria | 2431 |
| 173 | Ga0068856_100184507 | 3300005614 | Bacteria | 2100 |
| 174 | Ga0068856_100502098 | 3300005614 | Bacteria | 1234 |
| 175 | Ga0070702_100028072 | 3300005615 | Unclassified | 3046 |
| 176 | Ga0068852_100003450 | 3300005616 | Bacteria | 11053 |
| 177 | Ga0068852_100006690 | 3300005616 | Bacteria | 8355 |
| 178 | Ga0068852_100077233 | 3300005616 | Bacteria | 2943 |
| 179 | Ga0068852_100115553 | 3300005616 | Bacteria | 2447 |
| 180 | Ga0068852_100341434 | 3300005616 | Bacteria | 1460 |
| 181 | Ga0068852_100415000 | 3300005616 | Bacteria | 1327 |
| 182 | Ga0068859_100007240 | 3300005617 | Bacteria | 11254 |
| 183 | Ga0068859_100034486 | 3300005617 | Bacteria | 5079 |
| 184 | Ga0068859_100111254 | 3300005617 | Bacteria | 2801 |
| 185 | Ga0068859_100114949 | 3300005617 | Unclassified | 2755 |
| 186 | Ga0068859_100315988 | 3300005617 | Bacteria | 1656 |
| 187 | Ga0068859_100483155 | 3300005617 | Unclassified | 1334 |
| 188 | Ga0068864_100012029 | 3300005618 | Bacteria | 7147 |
| 189 | Ga0068864_100033010 | 3300005618 | Unclassified | 4399 |
| 190 | Ga0068864_100292922 | 3300005618 | Bacteria | 1522 |
| 191 | Ga0068864_100581143 | 3300005618 | Bacteria | 1085 |
| 192 | Ga0068866_10039250 | 3300005718 | Unclassified | 2337 |
| 193 | Ga0068866_10048472 | 3300005718 | Unclassified | 2148 |
| 194 | Ga0068866_10083559 | 3300005718 | Bacteria | 1721 |
| 195 | Ga0068861_100003797 | 3300005719 | Bacteria | 10084 |
| 196 | Ga0068861_100011486 | 3300005719 | Bacteria | 6161 |
| 197 | Ga0068861_100052536 | 3300005719 | Bacteria | 3097 |
| 198 | Ga0068861_100203806 | 3300005719 | Bacteria | 1662 |
| 199 | Ga0068851_10009258 | 3300005834 | Bacteria | 4572 |
| 200 | Ga0068851_10037167 | 3300005834 | Bacteria | 2441 |
| 201 | Ga0068870_10082591 | 3300005840 | Unclassified | 1780 |
| 202 | Ga0068870_10172388 | 3300005840 | Unclassified | 1292 |
| 203 | Ga0068863_100004861 | 3300005841 | Bacteria | 13239 |
| 204 | Ga0068863_100036418 | 3300005841 | Bacteria | 4687 |
| 205 | Ga0068863_100090771 | 3300005841 | Bacteria | 2897 |
| 206 | Ga0068863_100164964 | 3300005841 | Unclassified | 2124 |
| 207 | Ga0068863_100169040 | 3300005841 | Bacteria | 2097 |
| 208 | Ga0068858_100044720 | 3300005842 | Bacteria | 4104 |
| 209 | Ga0068860_100000026 | 3300005843 | Bacteria | 270483 |
| 210 | Ga0068860_100042549 | 3300005843 | Bacteria | 4336 |
| 211 | Ga0068860_100055973 | 3300005843 | Bacteria | 3750 |
| 212 | Ga0068860_100105829 | 3300005843 | Bacteria | 2687 |
| 213 | Ga0068860_100204261 | 3300005843 | Bacteria | 1915 |
| 214 | Ga0068862_100001498 | 3300005844 | Bacteria | 21421 |
| 215 | Ga0068862_100184520 | 3300005844 | Bacteria | 1874 |
| 216 | Ga0081539_10006670 | 3300005985 | Bacteria | 10924 |
| 217 | Ga0075366_10068132 | 3300006195 | Unclassified | 2118 |
| 218 | Ga0075366_10101241 | 3300006195 | Bacteria | 1729 |
| 219 | Ga0097621_100004149 | 3300006237 | Bacteria | 10051 |
| 220 | Ga0097621_100073484 | 3300006237 | Bacteria | 2830 |
| 221 | Ga0097621_100108847 | 3300006237 | Unclassified | 2340 |
| 222 | Ga0097621_100189059 | 3300006237 | Bacteria | 1782 |
| 223 | Ga0097621_100194787 | 3300006237 | Bacteria | 1757 |
| 224 | Ga0097621_100216223 | 3300006237 | Unclassified | 1668 |
| 225 | Ga0097621_100287177 | 3300006237 | Bacteria | 1449 |
| 226 | Ga0097621_100522810 | 3300006237 | Bacteria | 1077 |
| 227 | Ga0068871_100000089 | 3300006358 | Bacteria | 52827 |
| 228 | Ga0068871_100074089 | 3300006358 | Unclassified | 2808 |
| 229 | Ga0068871_100088559 | 3300006358 | Bacteria | 2576 |
| 230 | Ga0068871_100247379 | 3300006358 | Unclassified | 1552 |
| 231 | Ga0068871_100286050 | 3300006358 | Bacteria | 1443 |
| 232 | Ga0068871_100331889 | 3300006358 | Unclassified | 1341 |
| 233 | Ga0068871_100409642 | 3300006358 | Bacteria | 1209 |
| 234 | Ga0075428_100067024 | 3300006844 | Bacteria | 3930 |
| 235 | Ga0075428_100089533 | 3300006844 | Bacteria | 3357 |
| 236 | Ga0075428_100381314 | 3300006844 | Bacteria | 1511 |
| 237 | Ga0075431_100009249 | 3300006847 | Bacteria | 9890 |
| 238 | Ga0075431_100019516 | 3300006847 | Bacteria | 6914 |
| 239 | Ga0075431_100554708 | 3300006847 | Bacteria | 1136 |
| 240 | Ga0075434_100139353 | 3300006871 | Bacteria | 2445 |
| 241 | Ga0075429_100051372 | 3300006880 | Bacteria | 3587 |
| 242 | Ga0075429_100102408 | 3300006880 | Bacteria | 2500 |
| 243 | Ga0068865_100033153 | 3300006881 | Bacteria | 3456 |
| 244 | Ga0068865_100059581 | 3300006881 | Bacteria | 2671 |
| 245 | Ga0068865_100414337 | 3300006881 | Bacteria | 1106 |
| 246 | Ga0097620_100007240 | 3300006931 | Bacteria | 11254 |
| 247 | Ga0097620_100034486 | 3300006931 | Bacteria | 5079 |
| 248 | Ga0097620_100111253 | 3300006931 | Bacteria | 2801 |
| 249 | Ga0097620_100114950 | 3300006931 | Unclassified | 2755 |
| 250 | Ga0097620_100315984 | 3300006931 | Bacteria | 1656 |
| 251 | Ga0097620_100483213 | 3300006931 | Unclassified | 1334 |
| 252 | Ga0105240_10001556 | 3300009093 | Bacteria | 38962 |
| 253 | Ga0105240_10001801 | 3300009093 | Bacteria | 36072 |
| 254 | Ga0105240_10003107 | 3300009093 | Bacteria | 26115 |
| 255 | Ga0105240_10025973 | 3300009093 | Bacteria | 7692 |
| 256 | Ga0105240_10044252 | 3300009093 | Bacteria | 5659 |
| 257 | Ga0105240_10070450 | 3300009093 | Unclassified | 4326 |
| 258 | Ga0105240_10166385 | 3300009093 | Unclassified | 2615 |
| 259 | Ga0105240_10620999 | 3300009093 | Bacteria | 1188 |
| 260 | Ga0111539_10001550 | 3300009094 | Bacteria | 30595 |
| 261 | Ga0111539_10020594 | 3300009094 | Bacteria | 8122 |
| 262 | Ga0111539_10062099 | 3300009094 | Bacteria | 4424 |
| 263 | Ga0111539_10168622 | 3300009094 | Bacteria | 2558 |
| 264 | Ga0111539_10273246 | 3300009094 | Bacteria | 1967 |
| 265 | Ga0105247_10028561 | 3300009101 | Bacteria | 3376 |
| 266 | Ga0114129_10068944 | 3300009147 | Bacteria | 4930 |
| 267 | Ga0114129_10080244 | 3300009147 | Bacteria | 4535 |
| 268 | Ga0105243_10217617 | 3300009148 | Unclassified | 1686 |
| 269 | Ga0105243_10282209 | 3300009148 | Bacteria | 1496 |
| 270 | Ga0105241_10001155 | 3300009174 | Bacteria | 20097 |
| 271 | Ga0105241_10001477 | 3300009174 | Bacteria | 18004 |
| 272 | Ga0105241_10035287 | 3300009174 | Bacteria | 3761 |
| 273 | Ga0105241_10176234 | 3300009174 | Bacteria | 1770 |
| 274 | Ga0105241_10216697 | 3300009174 | Unclassified | 1607 |
| 275 | Ga0105242_10018807 | 3300009176 | Bacteria | 5407 |
| 276 | Ga0105242_10041000 | 3300009176 | Bacteria | 3731 |
| 277 | Ga0105242_10089793 | 3300009176 | Bacteria | 2584 |
| 278 | Ga0105242_10095569 | 3300009176 | Bacteria | 2509 |
| 279 | Ga0105248_10107617 | 3300009177 | Bacteria | 3144 |
| 280 | Ga0105237_10001522 | 3300009545 | Bacteria | 30383 |
| 281 | Ga0105237_10004392 | 3300009545 | Bacteria | 16347 |
| 282 | Ga0105237_10032033 | 3300009545 | Bacteria | 5324 |
| 283 | Ga0105237_10044973 | 3300009545 | Bacteria | 4445 |
| 284 | Ga0105237_10057283 | 3300009545 | Bacteria | 3900 |
| 285 | Ga0105237_10109193 | 3300009545 | Bacteria | 2758 |
| 286 | Ga0105238_10001372 | 3300009551 | Bacteria | 24425 |
| 287 | Ga0105238_10321646 | 3300009551 | Bacteria | 1533 |
| 288 | Ga0105249_10002391 | 3300009553 | Bacteria | 16292 |
| 289 | Ga0105249_10014121 | 3300009553 | Bacteria | 7060 |
| 290 | Ga0105249_10016618 | 3300009553 | Bacteria | 6532 |
| 291 | Ga0105249_10019593 | 3300009553 | Bacteria | 6038 |
| 292 | Ga0105249_10074316 | 3300009553 | Bacteria | 3146 |
| 293 | Ga0105249_10142889 | 3300009553 | Bacteria | 2296 |
| 294 | Ga0105249_10310318 | 3300009553 | Bacteria | 1585 |
| 295 | Ga0105239_10000591 | 3300010375 | Bacteria | 51658 |
| 296 | Ga0105239_10019985 | 3300010375 | Bacteria | 7392 |
| 297 | Ga0105239_10025533 | 3300010375 | Bacteria | 6504 |
| 298 | Ga0105239_10037158 | 3300010375 | Bacteria | 5341 |
| 299 | Ga0105239_10043080 | 3300010375 | Bacteria | 4946 |
| 300 | Ga0105239_10105702 | 3300010375 | Bacteria | 3118 |
| 301 | Ga0105239_10183764 | 3300010375 | Bacteria | 2339 |
| 302 | Ga0105239_10222130 | 3300010375 | Bacteria | 2119 |
| 303 | Ga0105239_10405340 | 3300010375 | Bacteria | 1543 |
| 304 | Ga0105239_10423077 | 3300010375 | Unclassified | 1509 |
| 305 | Ga0105239_10480495 | 3300010375 | Unclassified | 1411 |
| 306 | Ga0105246_10015217 | 3300011119 | Bacteria | 4853 |
| 307 | Ga0157373_10002354 | 3300013100 | Bacteria | 14349 |
| 308 | Ga0157373_10006316 | 3300013100 | Bacteria | 8850 |
| 309 | Ga0157373_10017906 | 3300013100 | Bacteria | 5158 |
| 310 | Ga0157373_10058730 | 3300013100 | Bacteria | 2726 |
| 311 | Ga0157373_10143621 | 3300013100 | Bacteria | 1678 |
| 312 | Ga0157373_10185267 | 3300013100 | Bacteria | 1466 |
| 313 | Ga0157371_10000704 | 3300013102 | Bacteria | 39266 |
| 314 | Ga0157371_10001124 | 3300013102 | Bacteria | 28910 |
| 315 | Ga0157371_10001784 | 3300013102 | Bacteria | 21756 |
| 316 | Ga0157371_10003113 | 3300013102 | Bacteria | 15341 |
| 317 | Ga0157371_10005851 | 3300013102 | Bacteria | 10279 |
| 318 | Ga0157371_10014709 | 3300013102 | Bacteria | 5890 |
| 319 | Ga0157371_10015148 | 3300013102 | Bacteria | 5792 |
| 320 | Ga0157371_10022772 | 3300013102 | Bacteria | 4583 |
| 321 | Ga0157371_10029140 | 3300013102 | Bacteria | 3996 |
| 322 | Ga0157371_10050713 | 3300013102 | Bacteria | 2949 |
| 323 | Ga0157371_10063018 | 3300013102 | Bacteria | 2628 |
| 324 | Ga0157371_10180309 | 3300013102 | Bacteria | 1511 |
| 325 | Ga0157371_10241142 | 3300013102 | Unclassified | 1300 |
| 326 | Ga0157371_10267873 | 3300013102 | Bacteria | 1232 |
| 327 | Ga0157370_10000083 | 3300013104 | Bacteria | 104313 |
| 328 | Ga0157370_10001361 | 3300013104 | Bacteria | 30267 |
| 329 | Ga0157370_10003700 | 3300013104 | Bacteria | 17871 |
| 330 | Ga0157370_10004793 | 3300013104 | Bacteria | 15377 |
| 331 | Ga0157370_10025903 | 3300013104 | Bacteria | 5799 |
| 332 | Ga0157370_10044375 | 3300013104 | Bacteria | 4273 |
| 333 | Ga0157370_10076484 | 3300013104 | Bacteria | 3153 |
| 334 | Ga0157370_10189011 | 3300013104 | Unclassified | 1912 |
| 335 | Ga0157370_10331737 | 3300013104 | Bacteria | 1402 |
| 336 | Ga0157369_10010084 | 3300013105 | Bacteria | 10789 |
| 337 | Ga0157369_10070619 | 3300013105 | Bacteria | 3751 |
| 338 | Ga0157369_10086225 | 3300013105 | Bacteria | 3353 |
| 339 | Ga0157369_10170645 | 3300013105 | Bacteria | 2292 |
| 340 | Ga0157369_10361519 | 3300013105 | Bacteria | 1507 |
| 341 | Ga0157374_10000500 | 3300013296 | Bacteria | 35513 |
| 342 | Ga0157374_10009640 | 3300013296 | Bacteria | 8294 |
| 343 | Ga0157374_10036592 | 3300013296 | Bacteria | 4497 |
| 344 | Ga0157374_10088666 | 3300013296 | Bacteria | 2947 |
| 345 | Ga0157374_10316849 | 3300013296 | Bacteria | 1545 |
| 346 | Ga0157374_10452607 | 3300013296 | Bacteria | 1285 |
| 347 | Ga0157374_10598070 | 3300013296 | Unclassified | 1113 |
| 348 | Ga0157374_10666262 | 3300013296 | Unclassified | 1053 |
| 349 | Ga0157378_10000623 | 3300013297 | Bacteria | 33314 |
| 350 | Ga0157378_10022790 | 3300013297 | Bacteria | 5512 |
| 351 | Ga0157378_10044946 | 3300013297 | Bacteria | 3923 |
| 352 | Ga0157378_10070034 | 3300013297 | Bacteria | 3148 |
| 353 | Ga0157378_10154016 | 3300013297 | Bacteria | 2144 |
| 354 | Ga0157378_10590684 | 3300013297 | Unclassified | 1120 |
| 355 | Ga0163162_10000241 | 3300013306 | Bacteria | 49773 |
| 356 | Ga0163162_10003046 | 3300013306 | Bacteria | 16013 |
| 357 | Ga0163162_10004340 | 3300013306 | Bacteria | 13649 |
| 358 | Ga0163162_10007999 | 3300013306 | Bacteria | 10312 |
| 359 | Ga0163162_10042375 | 3300013306 | Bacteria | 4556 |
| 360 | Ga0163162_10059116 | 3300013306 | Bacteria | 3864 |
| 361 | Ga0163162_10084483 | 3300013306 | Bacteria | 3250 |
| 362 | Ga0163162_10129767 | 3300013306 | Bacteria | 2629 |
| 363 | Ga0157372_10001284 | 3300013307 | Bacteria | 27122 |
| 364 | Ga0157372_10006492 | 3300013307 | Bacteria | 12447 |
| 365 | Ga0157372_10027114 | 3300013307 | Bacteria | 6236 |
| 366 | Ga0157372_10035783 | 3300013307 | Bacteria | 5467 |
| 367 | Ga0157372_10070036 | 3300013307 | Bacteria | 3945 |
| 368 | Ga0157372_10071448 | 3300013307 | Unclassified | 3908 |
| 369 | Ga0157372_10075023 | 3300013307 | Bacteria | 3815 |
| 370 | Ga0157372_10079361 | 3300013307 | Bacteria | 3712 |
| 371 | Ga0157372_10086580 | 3300013307 | Bacteria | 3554 |
| 372 | Ga0157372_10122722 | 3300013307 | Bacteria | 2986 |
| 373 | Ga0157372_10149242 | 3300013307 | Bacteria | 2697 |
| 374 | Ga0157372_10151194 | 3300013307 | Bacteria | 2680 |
| 375 | Ga0157372_10177201 | 3300013307 | Bacteria | 2467 |
| 376 | Ga0157372_10188272 | 3300013307 | Bacteria | 2390 |
| 377 | Ga0157372_10237736 | 3300013307 | Bacteria | 2113 |
| 378 | Ga0157372_10335554 | 3300013307 | Bacteria | 1761 |
| 379 | Ga0157372_10427468 | 3300013307 | Bacteria | 1544 |
| 380 | Ga0157372_10508158 | 3300013307 | Bacteria | 1405 |
| 381 | Ga0157372_10594420 | 3300013307 | Bacteria | 1290 |
| 382 | Ga0157375_10003999 | 3300013308 | Bacteria | 12787 |
| 383 | Ga0157375_10006480 | 3300013308 | Bacteria | 10198 |
| 384 | Ga0157375_10012255 | 3300013308 | Bacteria | 7600 |
| 385 | Ga0157375_10018353 | 3300013308 | Bacteria | 6343 |
| 386 | Ga0157375_10020277 | 3300013308 | Bacteria | 6068 |
| 387 | Ga0157375_10077486 | 3300013308 | Unclassified | 3354 |
| 388 | Ga0157375_10084821 | 3300013308 | Bacteria | 3217 |
| 389 | Ga0157375_10098814 | 3300013308 | Bacteria | 2996 |
| 390 | Ga0157375_10131128 | 3300013308 | Bacteria | 2626 |
| 391 | Ga0157375_10173190 | 3300013308 | Unclassified | 2307 |
| 392 | Ga0157375_10176834 | 3300013308 | Unclassified | 2284 |
| 393 | Ga0157375_10487401 | 3300013308 | Bacteria | 1398 |
| 394 | Ga0163163_10000198 | 3300014325 | Bacteria | 62120 |
| 395 | Ga0163163_10000204 | 3300014325 | Bacteria | 61513 |
| 396 | Ga0163163_10130342 | 3300014325 | Bacteria | 2555 |
| 397 | Ga0163163_10140701 | 3300014325 | Bacteria | 2455 |
| 398 | Ga0163163_10161825 | 3300014325 | Unclassified | 2284 |
| 399 | Ga0163163_10228319 | 3300014325 | Bacteria | 1910 |
| 400 | Ga0163163_10419904 | 3300014325 | Bacteria | 1396 |
| 401 | Ga0157380_10016451 | 3300014326 | Bacteria | 5456 |
| 402 | Ga0157380_10131438 | 3300014326 | Bacteria | 2136 |
| 403 | Ga0157380_10137028 | 3300014326 | Unclassified | 2097 |
| 404 | Ga0157380_10163608 | 3300014326 | Bacteria | 1936 |
| 405 | Ga0182008_10000022 | 3300014497 | Bacteria | 207052 |
| 406 | Ga0182008_10000104 | 3300014497 | Bacteria | 65446 |
| 407 | Ga0157377_10009480 | 3300014745 | Bacteria | 4777 |
| 408 | Ga0157377_10018566 | 3300014745 | Unclassified | 3616 |
| 409 | Ga0157377_10048064 | 3300014745 | Unclassified | 2392 |
| 410 | Ga0157377_10075257 | 3300014745 | Unclassified | 1961 |
| 411 | Ga0157377_10087381 | 3300014745 | Unclassified | 1834 |
| 412 | Ga0157379_10014138 | 3300014968 | Bacteria | 6998 |
| 413 | Ga0157379_10019150 | 3300014968 | Bacteria | 6043 |
| 414 | Ga0157379_10039701 | 3300014968 | Bacteria | 4200 |
| 415 | Ga0157379_10043530 | 3300014968 | Bacteria | 4009 |
| 416 | Ga0157379_10110523 | 3300014968 | Bacteria | 2468 |
| 417 | Ga0157379_10229625 | 3300014968 | Unclassified | 1682 |
| 418 | Ga0157376_10000365 | 3300014969 | Bacteria | 29732 |
| 419 | Ga0157376_10098558 | 3300014969 | Bacteria | 2548 |
| 420 | Ga0157376_10202034 | 3300014969 | Bacteria | 1829 |
| 421 | Ga0157376_10236131 | 3300014969 | Bacteria | 1701 |
| 422 | Ga0182006_1000279 | 3300015261 | Bacteria | 45379 |
| 423 | Ga0182006_1010075 | 3300015261 | Bacteria | 4212 |
| 424 | Ga0182005_1000582 | 3300015265 | Bacteria | 17962 |
| 425 | Ga0163161_10000828 | 3300017792 | Bacteria | 24173 |
| 426 | Ga0163161_10008078 | 3300017792 | Bacteria | 7275 |
| 427 | Ga0163161_10016797 | 3300017792 | Bacteria | 5117 |
| 428 | Ga0163161_10031280 | 3300017792 | Bacteria | 3791 |
| 429 | Ga0163161_10031383 | 3300017792 | Unclassified | 3786 |
| 430 | Ga0163161_10040005 | 3300017792 | Bacteria | 3367 |
| 431 | Ga0209436_101837 | 3300025208 | Bacteria | 6884 |
| 432 | Ga0209258_100326 | 3300025242 | Bacteria | 72066 |
| 433 | Ga0209646_1002394 | 3300025246 | Bacteria | 4191 |
| 434 | Ga0209148_1000157 | 3300025254 | Bacteria | 142367 |
| 435 | Ga0207426_1004602 | 3300025302 | Bacteria | 6651 |
| 436 | Ga0207697_10019471 | 3300025315 | Bacteria | 2780 |
| 437 | Ga0207682_10032311 | 3300025893 | Bacteria | 2103 |
| 438 | Ga0207642_10092623 | 3300025899 | Unclassified | 1497 |
| 439 | Ga0207710_10000852 | 3300025900 | Bacteria | 16442 |
| 440 | Ga0207688_10008735 | 3300025901 | Bacteria | 5512 |
| 441 | Ga0207680_10018075 | 3300025903 | Unclassified | 3739 |
| 442 | Ga0207680_10047092 | 3300025903 | Bacteria | 2553 |
| 443 | Ga0207647_10000485 | 3300025904 | Bacteria | 31915 |
| 444 | Ga0207647_10012309 | 3300025904 | Bacteria | 5960 |
| 445 | Ga0207647_10014774 | 3300025904 | Bacteria | 5372 |
| 446 | Ga0207647_10017140 | 3300025904 | Bacteria | 4930 |
| 447 | Ga0207647_10115100 | 3300025904 | Bacteria | 1588 |
| 448 | Ga0207645_10000306 | 3300025907 | Bacteria | 41222 |
| 449 | Ga0207645_10007634 | 3300025907 | Bacteria | 7620 |
| 450 | Ga0207645_10022021 | 3300025907 | Bacteria | 4150 |
| 451 | Ga0207645_10077211 | 3300025907 | Unclassified | 2134 |
| 452 | Ga0207645_10138435 | 3300025907 | Bacteria | 1586 |
| 453 | Ga0207643_10011315 | 3300025908 | Bacteria | 4818 |
| 454 | Ga0207643_10016982 | 3300025908 | Bacteria | 3972 |
| 455 | Ga0207705_10026123 | 3300025909 | Bacteria | 4166 |
| 456 | Ga0207654_10001045 | 3300025911 | Bacteria | 15109 |
| 457 | Ga0207654_10002081 | 3300025911 | Bacteria | 10259 |
| 458 | Ga0207654_10036350 | 3300025911 | Bacteria | 2751 |
| 459 | Ga0207707_10005500 | 3300025912 | Bacteria | 11076 |
| 460 | Ga0207707_10025371 | 3300025912 | Bacteria | 5185 |
| 461 | Ga0207707_10260566 | 3300025912 | Bacteria | 1505 |
| 462 | Ga0207695_10000486 | 3300025913 | Bacteria | 84856 |
| 463 | Ga0207695_10000681 | 3300025913 | Bacteria | 66668 |
| 464 | Ga0207695_10007678 | 3300025913 | Bacteria | 13660 |
| 465 | Ga0207695_10016877 | 3300025913 | Bacteria | 8521 |
| 466 | Ga0207695_10035512 | 3300025913 | Bacteria | 5405 |
| 467 | Ga0207695_10056539 | 3300025913 | Bacteria | 4081 |
| 468 | Ga0207695_10067276 | 3300025913 | Bacteria | 3675 |
| 469 | Ga0207671_10002974 | 3300025914 | Bacteria | 17406 |
| 470 | Ga0207671_10004223 | 3300025914 | Bacteria | 13841 |
| 471 | Ga0207671_10004504 | 3300025914 | Bacteria | 13262 |
| 472 | Ga0207671_10011287 | 3300025914 | Bacteria | 7285 |
| 473 | Ga0207671_10024178 | 3300025914 | Bacteria | 4571 |
| 474 | Ga0207671_10032172 | 3300025914 | Bacteria | 3905 |
| 475 | Ga0207671_10035762 | 3300025914 | Unclassified | 3683 |
| 476 | Ga0207671_10241200 | 3300025914 | Bacteria | 1420 |
| 477 | Ga0207660_10005607 | 3300025917 | Bacteria | 8151 |
| 478 | Ga0207662_10102327 | 3300025918 | Bacteria | 1776 |
| 479 | Ga0207662_10147602 | 3300025918 | Bacteria | 1494 |
| 480 | Ga0207657_10007433 | 3300025919 | Bacteria | 11237 |
| 481 | Ga0207657_10113237 | 3300025919 | Bacteria | 2238 |
| 482 | Ga0207657_10116779 | 3300025919 | Unclassified | 2198 |
| 483 | Ga0207649_10006712 | 3300025920 | Bacteria | 6252 |
| 484 | Ga0207649_10010447 | 3300025920 | Bacteria | 5101 |
| 485 | Ga0207649_10060819 | 3300025920 | Bacteria | 2375 |
| 486 | Ga0207649_10080298 | 3300025920 | Unclassified | 2109 |
| 487 | Ga0207649_10202185 | 3300025920 | Bacteria | 1404 |
| 488 | Ga0207652_10000144 | 3300025921 | Bacteria | 76507 |
| 489 | Ga0207652_10001497 | 3300025921 | Bacteria | 20642 |
| 490 | Ga0207652_10003454 | 3300025921 | Bacteria | 13033 |
| 491 | Ga0207652_10019246 | 3300025921 | Bacteria | 5612 |
| 492 | Ga0207652_10209206 | 3300025921 | Bacteria | 1756 |
| 493 | Ga0207681_10028255 | 3300025923 | Bacteria | 3632 |
| 494 | Ga0207681_10047308 | 3300025923 | Bacteria | 2897 |
| 495 | Ga0207694_10009415 | 3300025924 | Bacteria | 7366 |
| 496 | Ga0207650_10026595 | 3300025925 | Unclassified | 4129 |
| 497 | Ga0207650_10106147 | 3300025925 | Bacteria | 2169 |
| 498 | Ga0207650_10129047 | 3300025925 | Unclassified | 1976 |
| 499 | Ga0207650_10236102 | 3300025925 | Bacteria | 1476 |
| 500 | Ga0207659_10055728 | 3300025926 | Bacteria | 2828 |
| 501 | Ga0207659_10413266 | 3300025926 | Bacteria | 1130 |
| 502 | Ga0207644_10023411 | 3300025931 | Bacteria | 4230 |
| 503 | Ga0207644_10202990 | 3300025931 | Bacteria | 1564 |
| 504 | Ga0207644_10213151 | 3300025931 | Unclassified | 1528 |
| 505 | Ga0207690_10052958 | 3300025932 | Bacteria | 2721 |
| 506 | Ga0207690_10104539 | 3300025932 | Bacteria | 2029 |
| 507 | Ga0207690_10267059 | 3300025932 | Bacteria | 1328 |
| 508 | Ga0207706_10003022 | 3300025933 | Bacteria | 16211 |
| 509 | Ga0207706_10026639 | 3300025933 | Bacteria | 5174 |
| 510 | Ga0207706_10066425 | 3300025933 | Bacteria | 3174 |
| 511 | Ga0207706_10155703 | 3300025933 | Unclassified | 2010 |
| 512 | Ga0207706_10202881 | 3300025933 | Bacteria | 1739 |
| 513 | Ga0207686_10064526 | 3300025934 | Unclassified | 2332 |
| 514 | Ga0207686_10101937 | 3300025934 | Bacteria | 1918 |
| 515 | Ga0207669_10095637 | 3300025937 | Bacteria | 1948 |
| 516 | Ga0207704_10068739 | 3300025938 | Unclassified | 2234 |
| 517 | Ga0207704_10127246 | 3300025938 | Unclassified | 1756 |
| 518 | Ga0207704_10237458 | 3300025938 | Bacteria | 1359 |
| 519 | Ga0207704_10364128 | 3300025938 | Bacteria | 1130 |
| 520 | Ga0207691_10005363 | 3300025940 | Bacteria | 12375 |
| 521 | Ga0207691_10008512 | 3300025940 | Bacteria | 9855 |
| 522 | Ga0207691_10010779 | 3300025940 | Bacteria | 8774 |
| 523 | Ga0207691_10048084 | 3300025940 | Bacteria | 3912 |
| 524 | Ga0207691_10132183 | 3300025940 | Unclassified | 2203 |
| 525 | Ga0207691_10278963 | 3300025940 | Bacteria | 1438 |
| 526 | Ga0207711_10050580 | 3300025941 | Bacteria | 3558 |
| 527 | Ga0207689_10008686 | 3300025942 | Bacteria | 8840 |
| 528 | Ga0207689_10034312 | 3300025942 | Bacteria | 4215 |
| 529 | Ga0207689_10037842 | 3300025942 | Bacteria | 3999 |
| 530 | Ga0207689_10044618 | 3300025942 | Bacteria | 3666 |
| 531 | Ga0207689_10052629 | 3300025942 | Unclassified | 3354 |
| 532 | Ga0207689_10055197 | 3300025942 | Unclassified | 3270 |
| 533 | Ga0207689_10087359 | 3300025942 | Unclassified | 2562 |
| 534 | Ga0207689_10108462 | 3300025942 | Bacteria | 2282 |
| 535 | Ga0207661_10002894 | 3300025944 | Bacteria | 11867 |
| 536 | Ga0207661_10027299 | 3300025944 | Bacteria | 4360 |
| 537 | Ga0207661_10060306 | 3300025944 | Unclassified | 3060 |
| 538 | Ga0207661_10122823 | 3300025944 | Bacteria | 2213 |
| 539 | Ga0207661_10219786 | 3300025944 | Bacteria | 1679 |
| 540 | Ga0207679_10000727 | 3300025945 | Bacteria | 21875 |
| 541 | Ga0207679_10065613 | 3300025945 | Bacteria | 2717 |
| 542 | Ga0207679_10089945 | 3300025945 | Bacteria | 2371 |
| 543 | Ga0207667_10000180 | 3300025949 | Bacteria | 92094 |
| 544 | Ga0207667_10003610 | 3300025949 | Bacteria | 19086 |
| 545 | Ga0207667_10011547 | 3300025949 | Bacteria | 10259 |
| 546 | Ga0207667_10026734 | 3300025949 | Bacteria | 6298 |
| 547 | Ga0207667_10046893 | 3300025949 | Bacteria | 4575 |
| 548 | Ga0207667_10110691 | 3300025949 | Bacteria | 2833 |
| 549 | Ga0207667_10198462 | 3300025949 | Bacteria | 2058 |
| 550 | Ga0207667_10211697 | 3300025949 | Unclassified | 1987 |
| 551 | Ga0207667_10251570 | 3300025949 | Unclassified | 1808 |
| 552 | Ga0207667_10290877 | 3300025949 | Bacteria | 1669 |
| 553 | Ga0207667_10431776 | 3300025949 | Bacteria | 1340 |
| 554 | Ga0207651_10011427 | 3300025960 | Bacteria | 4973 |
| 555 | Ga0207651_10052122 | 3300025960 | Unclassified | 2788 |
| 556 | Ga0207651_10058309 | 3300025960 | Bacteria | 2668 |
| 557 | Ga0207651_10201830 | 3300025960 | Bacteria | 1594 |
| 558 | Ga0207712_10006482 | 3300025961 | Bacteria | 7381 |
| 559 | Ga0207712_10014700 | 3300025961 | Bacteria | 5041 |
| 560 | Ga0207712_10017059 | 3300025961 | Bacteria | 4711 |
| 561 | Ga0207712_10030255 | 3300025961 | Bacteria | 3638 |
| 562 | Ga0207712_10151480 | 3300025961 | Bacteria | 1792 |
| 563 | Ga0207668_10132587 | 3300025972 | Bacteria | 1904 |
| 564 | Ga0207668_10172114 | 3300025972 | Unclassified | 1699 |
| 565 | Ga0207640_10088002 | 3300025981 | Bacteria | 2143 |
| 566 | Ga0207640_10099526 | 3300025981 | Bacteria | 2035 |
| 567 | Ga0207640_10222398 | 3300025981 | Bacteria | 1446 |
| 568 | Ga0207640_10381673 | 3300025981 | Bacteria | 1142 |
| 569 | Ga0207658_10017476 | 3300025986 | Bacteria | 4943 |
| 570 | Ga0207658_10024283 | 3300025986 | Bacteria | 4240 |
| 571 | Ga0207658_10035883 | 3300025986 | Bacteria | 3553 |
| 572 | Ga0207677_10027849 | 3300026023 | Bacteria | 3566 |
| 573 | Ga0207677_10036442 | 3300026023 | Unclassified | 3206 |
| 574 | Ga0207677_10086408 | 3300026023 | Bacteria | 2267 |
| 575 | Ga0207677_10123090 | 3300026023 | Bacteria | 1955 |
| 576 | Ga0207677_10200765 | 3300026023 | Bacteria | 1585 |
| 577 | Ga0207703_10109284 | 3300026035 | Bacteria | 2357 |
| 578 | Ga0207703_10150478 | 3300026035 | Unclassified | 2029 |
| 579 | Ga0207639_10007663 | 3300026041 | Bacteria | 7370 |
| 580 | Ga0207639_10025552 | 3300026041 | Unclassified | 4282 |
| 581 | Ga0207639_10046174 | 3300026041 | Bacteria | 3285 |
| 582 | Ga0207639_10056473 | 3300026041 | Bacteria | 3009 |
| 583 | Ga0207639_10194620 | 3300026041 | Bacteria | 1734 |
| 584 | Ga0207639_10567606 | 3300026041 | Unclassified | 1043 |
| 585 | Ga0207678_10117342 | 3300026067 | Bacteria | 2271 |
| 586 | Ga0207708_10116262 | 3300026075 | Bacteria | 2081 |
| 587 | Ga0207702_10126685 | 3300026078 | Bacteria | 2294 |
| 588 | Ga0207702_10234585 | 3300026078 | Unclassified | 1716 |
| 589 | Ga0207641_10003797 | 3300026088 | Bacteria | 13249 |
| 590 | Ga0207641_10391330 | 3300026088 | Unclassified | 1333 |
| 591 | Ga0207648_10001646 | 3300026089 | Bacteria | 24478 |
| 592 | Ga0207648_10001977 | 3300026089 | Bacteria | 22375 |
| 593 | Ga0207648_10029228 | 3300026089 | Bacteria | 4887 |
| 594 | Ga0207648_10056469 | 3300026089 | Unclassified | 3426 |
| 595 | Ga0207648_10064058 | 3300026089 | Bacteria | 3204 |
| 596 | Ga0207648_10094465 | 3300026089 | Bacteria | 2615 |
| 597 | Ga0207648_10137065 | 3300026089 | Bacteria | 2156 |
| 598 | Ga0207648_10322720 | 3300026089 | Bacteria | 1388 |
| 599 | Ga0207648_10504834 | 3300026089 | Unclassified | 1107 |
| 600 | Ga0207676_10009152 | 3300026095 | Bacteria | 7052 |
| 601 | Ga0207676_10012044 | 3300026095 | Bacteria | 6188 |
| 602 | Ga0207676_10087668 | 3300026095 | Bacteria | 2546 |
| 603 | Ga0207676_10492908 | 3300026095 | Bacteria | 1162 |
| 604 | Ga0207674_10003467 | 3300026116 | Bacteria | 19288 |
| 605 | Ga0207674_10003537 | 3300026116 | Bacteria | 19078 |
| 606 | Ga0207674_10009196 | 3300026116 | Bacteria | 11326 |
| 607 | Ga0207674_10025384 | 3300026116 | Bacteria | 6321 |
| 608 | Ga0207674_10043512 | 3300026116 | Bacteria | 4630 |
| 609 | Ga0207674_10161905 | 3300026116 | Bacteria | 2192 |
| 610 | Ga0207674_10314403 | 3300026116 | Unclassified | 1515 |
| 611 | Ga0207675_100000095 | 3300026118 | Bacteria | 70192 |
| 612 | Ga0207675_100008062 | 3300026118 | Bacteria | 9924 |
| 613 | Ga0207675_100018554 | 3300026118 | Bacteria | 6490 |
| 614 | Ga0207675_100032792 | 3300026118 | Bacteria | 4839 |
| 615 | Ga0207675_100054920 | 3300026118 | Bacteria | 3716 |
| 616 | Ga0207675_100081001 | 3300026118 | Bacteria | 3044 |
| 617 | Ga0207675_100204100 | 3300026118 | Bacteria | 1899 |
| 618 | Ga0207683_10000574 | 3300026121 | Bacteria | 34037 |
| 619 | Ga0207683_10004460 | 3300026121 | Bacteria | 12085 |
| 620 | Ga0207683_10099068 | 3300026121 | Bacteria | 2601 |
| 621 | Ga0207683_10568817 | 3300026121 | Bacteria | 1048 |
| 622 | Ga0207683_10633230 | 3300026121 | Bacteria | 990 |
| 623 | Ga0207698_10066384 | 3300026142 | Bacteria | 2840 |
| 624 | Ga0207698_10147593 | 3300026142 | Bacteria | 2036 |
| 625 | Ga0207698_10188470 | 3300026142 | Bacteria | 1834 |
| 626 | Ga0207698_10310498 | 3300026142 | Bacteria | 1472 |
| 627 | Ga0209968_1015181 | 3300027526 | Bacteria | 1217 |
| 628 | Ga0207428_10006018 | 3300027907 | Bacteria | 11223 |
| 629 | Ga0207428_10041855 | 3300027907 | Bacteria | 3707 |
| 630 | Ga0268266_10000034 | 3300028379 | Bacteria | 354251 |
| 631 | Ga0268266_10058727 | 3300028379 | Bacteria | 3312 |
| 632 | Ga0268265_10293248 | 3300028380 | Bacteria | 1461 |
| 633 | Ga0268264_10000436 | 3300028381 | Bacteria | 57473 |
| 634 | Ga0268264_10017550 | 3300028381 | Bacteria | 5861 |
| 635 | Ga0268264_10138413 | 3300028381 | Bacteria | 2168 |
| 636 | Ga0268264_10233105 | 3300028381 | Bacteria | 1701 |
| 637 | Ga0307517_10001430 | 3300028786 | Bacteria | 40142 |
| 638 | Ga0307511_10000265 | 3300030521 | Bacteria | 54237 |
| 639 | Ga0265327_10013111 | 3300031251 | Bacteria | 5529 |
| 640 | Ga0307513_10114159 | 3300031456 | Bacteria | 2687 |
| 641 | Ga0307513_10229540 | 3300031456 | Bacteria | 1670 |
| 642 | Ga0307509_10068409 | 3300031507 | Bacteria | 3717 |
| 643 | Ga0307509_10170664 | 3300031507 | Bacteria | 2055 |
| 644 | Ga0307408_100037231 | 3300031548 | Bacteria | 3426 |
| 645 | Ga0265313_10066744 | 3300031595 | Bacteria | 1667 |
| 646 | Ga0307508_10011402 | 3300031616 | Bacteria | 8125 |
| 647 | Ga0307516_10006866 | 3300031730 | Bacteria | 13260 |
| 648 | Ga0307516_10043183 | 3300031730 | Bacteria | 4468 |
| 649 | Ga0307413_10115979 | 3300031824 | Bacteria | 1803 |
| 650 | Ga0307406_10216036 | 3300031901 | Bacteria | 1422 |
| 651 | Ga0307412_10000001 | 3300031911 | Bacteria | 822691 |
| 652 | Ga0307416_100371647 | 3300032002 | Bacteria | 1456 |
| 653 | Ga0307414_10000268 | 3300032004 | Bacteria | 32688 |
| 654 | Ga0307414_10000987 | 3300032004 | Bacteria | 14520 |
| 655 | Ga0307414_10017542 | 3300032004 | Bacteria | 4382 |
| 656 | Ga0307414_10088318 | 3300032004 | Bacteria | 2294 |
| 657 | Ga0307414_10290337 | 3300032004 | Bacteria | 1378 |
| 658 | Ga0307510_10024228 | 3300033180 | Bacteria | 7015 |
| 659 | Ga0373936_0022615 | 3300035113 | Bacteria | 2448 |
| 660 | Ga0373943_0132342 | 3300035170 | Unclassified | 1336 |
| 661 | Ga0373924_0014288 | 3300035410 | Unclassified | 2999 |
| 662 | Ga0373937_0076299 | 3300036401 | Bacteria | 3095 |
| 663 | Ga0395899_0003426 | 3300037312 | Bacteria | 12574 |
| 664 | Ga0395899_0005439 | 3300037312 | Bacteria | 9879 |
| 665 | Ga0395899_0009555 | 3300037312 | Bacteria | 7444 |
| 666 | Ga0395900_0010296 | 3300037418 | Bacteria | 9567 |
| 667 | Ga0395900_0010792 | 3300037418 | Bacteria | 9345 |
| 668 | Ga0395900_0070166 | 3300037418 | Bacteria | 3602 |
| 669 | Ga0395900_0181145 | 3300037418 | Bacteria | 2141 |
| 670 | Ga0395900_0244285 | 3300037418 | Bacteria | 1799 |
| 671 | Ga0395900_0274704 | 3300037418 | Bacteria | 1679 |
| 672 | Ga0395900_0374665 | 3300037418 | Bacteria | 1392 |
| 673 | Ga0395898_0011226 | 3300037466 | Bacteria | 9324 |
| 674 | Ga0395898_0019271 | 3300037466 | Bacteria | 6946 |
| 675 | Ga0395898_0042659 | 3300037466 | Bacteria | 4474 |
| 676 | Ga0395898_0204291 | 3300037466 | Bacteria | 1885 |
| 677 | Ga0395898_0209652 | 3300037466 | Bacteria | 1859 |
| 678 | Ga0395905_0009045 | 3300037471 | Bacteria | 9770 |
| 679 | Ga0395905_0017462 | 3300037471 | Bacteria | 6812 |
| 680 | Ga0395905_0081094 | 3300037471 | Bacteria | 3041 |
| 681 | Ga0395901_0014336 | 3300038443 | Bacteria | 8070 |
| 682 | Ga0395901_0039776 | 3300038443 | Bacteria | 4867 |
| 683 | Ga0395901_0065131 | 3300038443 | Bacteria | 3794 |
| 684 | Ga0395901_0181123 | 3300038443 | Bacteria | 2210 |
| 685 | Ga0395901_0224530 | 3300038443 | Bacteria | 1962 |
| 686 | Ga0395901_0340279 | 3300038443 | Bacteria | 1550 |
| 687 | Ga0439465_0047694 | 3300041413 | Unclassified | 1397 |
| 688 | Ga0439433_0033904 | 3300041999 | Unclassified | 1174 |
| 689 | Ga0439441_025232 | 3300042001 | Bacteria | 1121 |
| 690 | Ga0439432_063297 | 3300042006 | Unclassified | 1137 |
| 691 | Ga0439449_0017295 | 3300042007 | Bacteria | 2707 |
| 692 | Ga0439449_0064094 | 3300042007 | Bacteria | 1355 |
| 693 | Ga0439452_031950 | 3300042010 | Unclassified | 1289 |
| 694 | Ga0439457_013470 | 3300042014 | Bacteria | 1838 |
| 695 | Ga0439462_0036636 | 3300042015 | Bacteria | 1305 |
| 696 | Ga0450894_011541 | 3300042131 | Unclassified | 1151 |
| 697 | Ga0451577_0033602 | 3300042876 | Bacteria | 4624 |
| 698 | Ga0466969_0000109 | 3300044656 | Bacteria | 43750 |
| 699 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 700 | Ga0466972_0066001 | 3300044658 | Bacteria | 1730 |
| 701 | Ga0466972_0073749 | 3300044658 | Bacteria | 1626 |
| 702 | Ga0453683_0255378 | 3300044673 | Bacteria | 1117 |
| 703 | Ga0466965_0038717 | 3300044683 | Unclassified | 2343 |
| 704 | Ga0466966_0021272 | 3300044684 | Bacteria | 4260 |
| 705 | Ga0466966_0124624 | 3300044684 | Bacteria | 1580 |
| 706 | Ga0466964_0030692 | 3300044706 | Bacteria | 2128 |
| 707 | Ga0453684_0093037 | 3300044712 | Bacteria | 3714 |
| 708 | Ga0466971_0116542 | 3300044719 | Bacteria | 1235 |
| 709 | Ga0466968_0032063 | 3300044735 | Bacteria | 2184 |
| 710 | Ga0466970_0048019 | 3300044765 | Bacteria | 2276 |
| 711 | Ga0466957_0001763 | 3300044842 | Bacteria | 11385 |
| 712 | Ga0466959_0000380 | 3300045049 | Bacteria | 26260 |
| 713 | Ga0466959_0001334 | 3300045049 | Bacteria | 15018 |
| 714 | Ga0495603_0097352 | 3300046455 | Bacteria | 1719 |
| 715 | Ga0495638_0022965 | 3300046460 | Unclassified | 4087 |
| 716 | Ga0495638_0038094 | 3300046460 | Bacteria | 3058 |
| 717 | Ga0495650_0024591 | 3300046471 | Bacteria | 2842 |
| 718 | Ga0495580_0103621 | 3300046472 | Bacteria | 1978 |
| 719 | Ga0495580_0232834 | 3300046472 | Bacteria | 1264 |
| 720 | Ga0495606_0007030 | 3300046507 | Bacteria | 10205 |
| 721 | Ga0495608_0052942 | 3300046511 | Bacteria | 2686 |
| 722 | Ga0495630_0002806 | 3300046517 | Bacteria | 12087 |
| 723 | Ga0495632_0129522 | 3300046519 | Bacteria | 1175 |
| 724 | Ga0495632_0154684 | 3300046519 | Bacteria | 1059 |
| 725 | Ga0495648_0004897 | 3300046524 | Bacteria | 11264 |
| 726 | Ga0495668_0003016 | 3300046616 | Bacteria | 13130 |
| 727 | Ga0495611_0000702 | 3300046648 | Bacteria | 18959 |
| 728 | Ga0495625_0103084 | 3300046660 | Unclassified | 1957 |
| 729 | Ga0495635_0068998 | 3300046663 | Bacteria | 2424 |
| 730 | Ga0495672_0070333 | 3300047320 | Unclassified | 1983 |
| 731 | Ga0495676_0034872 | 3300047321 | Bacteria | 4216 |
| 732 | Ga0495687_000079 | 3300047443 | Bacteria | 147704 |
| 733 | Ga0495675_0302971 | 3300047444 | Bacteria | 949 |
| 734 | Ga0495686_0048144 | 3300047472 | Bacteria | 2689 |
| 735 | Ga0496100_0063790 | 3300048903 | Bacteria | 2436 |
| 736 | Ga0496104_0155824 | 3300048907 | Bacteria | 2192 |
| 737 | Ga0496114_0029611 | 3300048917 | Bacteria | 4503 |
| 738 | Ga0496115_0113749 | 3300048918 | Bacteria | 2224 |
| 739 | Ga0496121_0000028 | 3300048924 | Bacteria | 439193 |
| 740 | Ga0496122_0002421 | 3300048925 | Bacteria | 26557 |
| 741 | Ga0496123_0008155 | 3300048926 | Bacteria | 9665 |
| 742 | Ga0496125_0046265 | 3300048928 | Bacteria | 3652 |
| 743 | Ga0501306_003887 | 3300049127 | Bacteria | 1640 |
| 744 | Ga0501292_005404 | 3300049515 | Bacteria | 1780 |
| 745 | Ga0501293_002577 | 3300049516 | Bacteria | 1379 |
| 746 | Ga0501298_002860 | 3300049521 | Bacteria | 2647 |
| 747 | Ga0501315_022434 | 3300049531 | Unclassified | 860 |
| 748 | Ga0501031_0103979 | 3300049568 | Bacteria | 1853 |
| 749 | Ga0501032_0002473 | 3300049569 | Bacteria | 14427 |
| 750 | Ga0501032_0128221 | 3300049569 | Bacteria | 1675 |
| 751 | Ga0501034_0001745 | 3300049571 | Bacteria | 27911 |
| 752 | Ga0501034_0053972 | 3300049571 | Bacteria | 4046 |
| 753 | Ga0501034_0074067 | 3300049571 | Bacteria | 3414 |
| 754 | Ga0501034_0108841 | 3300049571 | Bacteria | 2762 |
| 755 | Ga0501034_0152277 | 3300049571 | Unclassified | 2288 |
| 756 | Ga0501034_0230209 | 3300049571 | Bacteria | 1802 |
| 757 | Ga0501037_0014175 | 3300049573 | Bacteria | 5869 |
| 758 | Ga0501038_0082526 | 3300049574 | Unclassified | 2706 |
| 759 | Ga0501038_0370008 | 3300049574 | Bacteria | 1113 |
| 760 | Ga0501039_0024775 | 3300049575 | Bacteria | 4609 |
| 761 | Ga0501039_0114661 | 3300049575 | Bacteria | 2108 |
| 762 | Ga0501043_0021185 | 3300049579 | Bacteria | 5096 |
| 763 | Ga0501043_0026748 | 3300049579 | Bacteria | 4526 |
| 764 | Ga0501043_0030127 | 3300049579 | Bacteria | 4263 |
| 765 | Ga0501043_0213430 | 3300049579 | Bacteria | 1495 |
| 766 | Ga0501047_0027824 | 3300049581 | Bacteria | 5448 |
| 767 | Ga0501047_0030221 | 3300049581 | Bacteria | 5224 |
| 768 | Ga0501047_0057040 | 3300049581 | Bacteria | 3777 |
| 769 | Ga0501047_0142010 | 3300049581 | Bacteria | 2279 |
| 770 | Ga0501047_0388179 | 3300049581 | Bacteria | 1230 |
| 771 | Ga0501067_0054155 | 3300049583 | Bacteria | 2223 |
| 772 | Ga0501069_0310568 | 3300049585 | Bacteria | 925 |
| 773 | Ga0501070_0035848 | 3300049586 | Bacteria | 4143 |
| 774 | Ga0501070_0402717 | 3300049586 | Bacteria | 1106 |
| 775 | Ga0501073_0011253 | 3300049589 | Bacteria | 6545 |
| 776 | Ga0501073_0013765 | 3300049589 | Bacteria | 5884 |
| 777 | Ga0501074_0019589 | 3300049590 | Bacteria | 4910 |
| 778 | Ga0501074_0210518 | 3300049590 | Bacteria | 1385 |
| 779 | Ga0501201_002844 | 3300049651 | Bacteria | 1581 |
| 780 | Ga0501202_003403 | 3300049652 | Bacteria | 2724 |
| 781 | Ga0501207_003879 | 3300049654 | Bacteria | 2015 |
| 782 | Ga0501217_001527 | 3300049661 | Bacteria | 4361 |
| 783 | Ga0501223_000496 | 3300049663 | Bacteria | 9542 |
| 784 | Ga0501235_000303 | 3300049669 | Bacteria | 9308 |
| 785 | Ga0501235_002609 | 3300049669 | Bacteria | 3877 |
| 786 | Ga0501242_003564 | 3300049674 | Bacteria | 1689 |
| 787 | Ga0501243_001562 | 3300049675 | Bacteria | 3286 |
| 788 | Ga0501251_001580 | 3300049681 | Bacteria | 2145 |
| 789 | Ga0501259_001348 | 3300049688 | Bacteria | 4113 |
| 790 | Ga0501261_002505 | 3300049690 | Bacteria | 2250 |
| 791 | Ga0501219_000430 | 3300049703 | Bacteria | 6850 |
| 792 | Ga0501221_002173 | 3300049704 | Bacteria | 3254 |
| 793 | Ga0501225_0013731 | 3300049705 | Bacteria | 2265 |
| 794 | Ga0501225_0018251 | 3300049705 | Bacteria | 1945 |
| 795 | Ga0501234_000249 | 3300049707 | Bacteria | 7807 |
| 796 | Ga0501245_005320 | 3300049708 | Bacteria | 1780 |
| 797 | Ga0501079_0372042 | 3300049741 | Bacteria | 1120 |
| 798 | Ga0501080_0197290 | 3300049742 | Bacteria | 1848 |
| 799 | Ga0501080_0301262 | 3300049742 | Bacteria | 1454 |
| 800 | Ga0501080_0489783 | 3300049742 | Bacteria | 1099 |
| 801 | Ga0501083_0030753 | 3300049744 | Bacteria | 3686 |
| 802 | Ga0501232_004704 | 3300049757 | Bacteria | 1320 |
| 803 | Ga0501241_008316 | 3300049758 | Bacteria | 1895 |
| 804 | Ga0501241_014070 | 3300049758 | Bacteria | 1453 |
| 805 | Ga0501268_012488 | 3300049765 | Bacteria | 1358 |
| 806 | Ga0501269_009992 | 3300049766 | Unclassified | 1151 |
| 807 | Ga0501280_012251 | 3300049776 | Bacteria | 1205 |
| 808 | Ga0501282_003770 | 3300049778 | Bacteria | 1628 |
| 809 | Ga0501283_004659 | 3300049779 | Bacteria | 1860 |
| 810 | Ga0501035_0039695 | 3300049822 | Bacteria | 4259 |
| 811 | Ga0501035_0174896 | 3300049822 | Bacteria | 1853 |
| 812 | Ga0501035_0201001 | 3300049822 | Bacteria | 1709 |
| 813 | Ga0501044_0008297 | 3300049823 | Bacteria | 11388 |
| 814 | Ga0501044_0012341 | 3300049823 | Bacteria | 9249 |
| 815 | Ga0501044_0014959 | 3300049823 | Bacteria | 8366 |
| 816 | Ga0501044_0067907 | 3300049823 | Bacteria | 3632 |
| 817 | Ga0501044_0406480 | 3300049823 | Unclassified | 1273 |
| 818 | Ga0501044_0598324 | 3300049823 | Bacteria | 996 |
| 819 | Ga0501212_001713 | 3300049851 | Bacteria | 2528 |
| 820 | Ga0501284_00039 | 3300050005 | Bacteria | 53400 |
| 821 | Ga0501284_00770 | 3300050005 | Bacteria | 1655 |
| 822 | nmdc:mga0k408_19301_c1 | 3300050493 | Bacteria | 3808 |
| 823 | nmdc:mga0k408_24934_c1 | 3300050493 | Bacteria | 3384 |
| 824 | nmdc:mga0k408_41294_c1 | 3300050493 | Bacteria | 2655 |
| 825 | nmdc:mga0k408_75017_c1 | 3300050493 | Bacteria | 1976 |
| 826 | nmdc:mga05p37_4228_c1 | 3300050507 | Bacteria | 16777 |
| 827 | nmdc:mga09592_156908_c1 | 3300050508 | Bacteria | 1965 |
| 828 | nmdc:mga0qj67_31022_c1 | 3300050509 | Bacteria | 4163 |
| 829 | nmdc:mga06r32_41639_c1 | 3300050510 | Bacteria | 4365 |
| 830 | nmdc:mga08y16_11583_c1 | 3300050511 | Bacteria | 9270 |
| 831 | nmdc:mga08y16_83384_c1 | 3300050511 | Bacteria | 3331 |
| 832 | nmdc:mga08y16_87847_c1 | 3300050511 | Bacteria | 3239 |
| 833 | nmdc:mga0n895_109055_c1 | 3300050512 | Bacteria | 2783 |
| 834 | Ga0500578_0000009 | 3300053086 | Bacteria | 219807 |
| 835 | Ga0500578_0118272 | 3300053086 | Bacteria | 1667 |
| 836 | Ga0500644_0000226 | 3300053088 | Bacteria | 32397 |
| 837 | Ga0500646_0004638 | 3300053090 | Bacteria | 3472 |
| 838 | Ga0500646_0004984 | 3300053090 | Bacteria | 3369 |
| 839 | Ga0500646_0036635 | 3300053090 | Bacteria | 1367 |
| 840 | Ga0500583_0000036 | 3300053092 | Bacteria | 95404 |
| 841 | Ga0500583_0001798 | 3300053092 | Bacteria | 6278 |
| 842 | Ga0500583_0002700 | 3300053092 | Bacteria | 5407 |
| 843 | Ga0500651_0001193 | 3300053093 | Bacteria | 12892 |
| 844 | Ga0500607_124200 | 3300053121 | Bacteria | 1243 |
| 845 | Ga0500642_0077176 | 3300053130 | Bacteria | 1525 |
| 846 | Ga0500652_024061 | 3300053131 | Bacteria | 2321 |
| 847 | Ga0500658_0033058 | 3300053134 | Bacteria | 2032 |
| 848 | Ga0500559_0046426 | 3300053136 | Bacteria | 1905 |
| 849 | Ga0500568_0004727 | 3300053139 | Bacteria | 7216 |
| 850 | Ga0500604_0008510 | 3300053151 | Bacteria | 2723 |
| 851 | Ga0500616_0029279 | 3300053153 | Bacteria | 3031 |
| 852 | Ga0500622_0149456 | 3300053156 | Bacteria | 1106 |
| 853 | Ga0500634_0082124 | 3300053161 | Bacteria | 1658 |
| 854 | Ga0500636_0178279 | 3300053177 | Bacteria | 1143 |
| 855 | Ga0500611_001300 | 3300053727 | Bacteria | 2708 |
| 856 | Ga0500645_065790 | 3300053730 | Bacteria | 1044 |
| 857 | Ga0500661_003423 | 3300055283 | Bacteria | 2977 |
| 858 | 2738726536 | 2738541278 | Bacteria | 9755573 |
| 859 | 2738758308 | 2738541283 | Bacteria | 7222293 |
| 860 | 2738763153 | 2738541284 | Bacteria | 5199923 |
| 861 | 2739303834 | 2738543023 | Bacteria | 6767879 |
| 862 | 2776616310 | 2775506987 | Bacteria | 5373360 |
| 863 | 2819572781 | 2818991442 | Bacteria | 8318214 |
| 864 | 2821139806 | 2821136567 | Bacteria | 8080116 |
| 865 | 2852629663 | 2852627209 | Bacteria | 5896285 |
| 866 | 2884794939 | 2884791551 | Bacteria | 8511252 |
| 867 | 2902051954 | 2902048731 | Bacteria | 4976191 |
| 868 | 2904473443 | 2904467357 | Bacteria | 8057758 |
| 869 | 2919191062 | 2919186247 | Bacteria | 6244071 |
| 870 | 2929244706 | 2929239360 | Bacteria | 7745570 |
| 871 | Ga0307406_10194559 | |||
| 872 | SwRhRL2b_contig_1653087 | |||
| 873 | JGI24744J21845_10008862 | |||
| 874 | JGI24751J29686_10000663 | |||
| 875 | rootH1_10001281 | |||
| 876 | rootH1_10023420 | |||
| 877 | rootH2_10010689 | |||
| 878 | rootH2_10010690 | |||
| 879 | rootH2_10042456 | |||
| 880 | rootL2_10010012 | |||
| 881 | rootL2_10268153 | |||
| 882 | rootH1_10007222 | |||
| 883 | Ga0055535_1001518 | |||
| 884 | Ga0055542_1004712 | |||
| 885 | Ga0065165_1004475 | |||
| 886 | Ga0065714_10003722 | |||
| 887 | Ga0065714_10006151 | |||
| 888 | Ga0065704_10000425 | |||
| 889 | Ga0065704_10113039 | |||
| 890 | Ga0065712_10003529 | |||
| 891 | Ga0065707_10236541 | |||
| 892 | Ga0070658_10013253 | |||
| 893 | Ga0070658_10079956 | |||
| 894 | Ga0070658_10093425 | |||
| 895 | Ga0070676_10007961 | |||
| 896 | Ga0070676_10012157 | |||
| 897 | Ga0070676_10026931 | |||
| 898 | Ga0070676_10035505 | |||
| 899 | Ga0070676_10135204 | |||
| 900 | Ga0070683_100000512 | |||
| 901 | Ga0070683_100025645 | |||
| 902 | Ga0070683_100059038 | |||
| 903 | Ga0070683_100164265 | |||
| 904 | Ga0070690_100038963 | |||
| 905 | Ga0070690_100179714 | |||
| 906 | Ga0070690_100308854 | |||
| 907 | Ga0070670_100015018 | |||
| 908 | Ga0070670_100050652 | |||
| 909 | Ga0070670_100097944 | |||
| 910 | Ga0070670_100136070 | |||
| 911 | Ga0070670_100246948 | |||
| 912 | Ga0070670_100275290 | |||
| 913 | Ga0070677_10007092 | |||
| 914 | Ga0070677_10020248 | |||
| 915 | Ga0068869_100009369 | |||
| 916 | Ga0068869_100024895 | |||
| 917 | Ga0068869_100035283 | |||
| 918 | Ga0068869_100035864 | |||
| 919 | Ga0068869_100043519 | |||
| 920 | Ga0068869_100115309 | |||
| 921 | Ga0068869_100158449 | |||
| 922 | Ga0070666_10060167 | |||
| 923 | Ga0070666_10168885 | |||
| 924 | Ga0070666_10168939 | |||
| 925 | Ga0070666_10265365 | |||
| 926 | Ga0070680_100002240 | |||
| 927 | Ga0070680_100021329 | |||
| 928 | Ga0070680_100172848 | |||
| 929 | Ga0070682_100007420 | |||
| 930 | Ga0068868_100006993 | |||
| 931 | Ga0068868_100033356 | |||
| 932 | Ga0068868_100047423 | |||
| 933 | Ga0068868_100052611 | |||
| 934 | Ga0070660_100003183 | |||
| 935 | Ga0070689_100013318 | |||
| 936 | Ga0070689_100026682 | |||
| 937 | Ga0070689_100033351 | |||
| 938 | Ga0070689_100065190 | |||
| 939 | Ga0070691_10020293 | |||
| 940 | Ga0070661_100000634 | |||
| 941 | Ga0070661_100059617 | |||
| 942 | Ga0070661_100113146 | |||
| 943 | Ga0070668_100027281 | |||
| 944 | Ga0070668_100058742 | |||
| 945 | Ga0070668_100427998 | |||
| 946 | Ga0070669_100001036 | |||
| 947 | Ga0070669_100016058 | |||
| 948 | Ga0070669_100048580 | |||
| 949 | Ga0070669_100145019 | |||
| 950 | Ga0070669_100205111 | |||
| 951 | Ga0070669_100230752 | |||
| 952 | Ga0070675_100015289 | |||
| 953 | Ga0070675_100041537 | |||
| 954 | Ga0070675_100106087 | |||
| 955 | Ga0070675_100143204 | |||
| 956 | Ga0070675_100383980 | |||
| 957 | Ga0070675_100404532 | |||
| 958 | Ga0070671_100037910 | |||
| 959 | Ga0070671_100128878 | |||
| 960 | Ga0070671_100258456 | |||
| 961 | Ga0070674_100015390 | |||
| 962 | Ga0070673_100009239 | |||
| 963 | Ga0070673_100010058 | |||
| 964 | Ga0070673_100042711 | |||
| 965 | Ga0070673_100345840 | |||
| 966 | Ga0070688_100001275 | |||
| 967 | Ga0070688_100230134 | |||
| 968 | Ga0070659_100007461 | |||
| 969 | Ga0070659_100052846 | |||
| 970 | Ga0070659_100087142 | |||
| 971 | Ga0070659_100230808 | |||
| 972 | Ga0070667_100056499 | |||
| 973 | Ga0070667_100079054 | |||
| 974 | Ga0070667_100097400 | |||
| 975 | Ga0070663_100097632 | |||
| 976 | Ga0070678_100006297 | |||
| 977 | Ga0070678_100035117 | |||
| 978 | Ga0070678_100088579 | |||
| 979 | Ga0070678_100371455 | |||
| 980 | Ga0070662_100006760 | |||
| 981 | Ga0070681_10001251 | |||
| 982 | Ga0068867_100036347 | |||
| 983 | Ga0068867_100068482 | |||
| 984 | Ga0068867_100096438 | |||
| 985 | Ga0068867_100198613 | |||
| 986 | Ga0068867_100263976 | |||
| 987 | Ga0070685_10012174 | |||
| 988 | Ga0070698_100005891 | |||
| 989 | Ga0070698_100007220 | |||
| 990 | Ga0070698_100224820 | |||
| 991 | Ga0070698_100272864 | |||
| 992 | Ga0070679_100006537 | |||
| 993 | Ga0070679_100050984 | |||
| 994 | Ga0070679_100082522 | |||
| 995 | Ga0070679_100174300 | |||
| 996 | Ga0070679_100198468 | |||
| 997 | Ga0070684_100000251 | |||
| 998 | Ga0070684_100031546 | |||
| 999 | Ga0070684_100125735 | |||
| 1000 | Ga0070684_100273092 | |||
| 1001 | Ga0070684_100361453 | |||
| 1002 | Ga0068853_100000201 | |||
| 1003 | Ga0068853_100039029 | |||
| 1004 | Ga0068853_100045528 | |||
| 1005 | Ga0068853_100051466 | |||
| 1006 | Ga0068853_100073146 | |||
| 1007 | Ga0068853_100082228 | |||
| 1008 | Ga0068853_100115291 | |||
| 1009 | Ga0070672_100037905 | |||
| 1010 | Ga0070672_100049845 | |||
| 1011 | Ga0070672_100111539 | |||
| 1012 | Ga0070672_100258380 | |||
| 1013 | Ga0070686_100212894 | |||
| 1014 | Ga0070665_100000016 | |||
| 1015 | Ga0070665_100020959 | |||
| 1016 | Ga0070665_100428216 | |||
| 1017 | Ga0070704_100110763 | |||
| 1018 | Ga0068855_100001845 | |||
| 1019 | Ga0068855_100022508 | |||
| 1020 | Ga0068855_100031682 | |||
| 1021 | Ga0068855_100037843 | |||
| 1022 | Ga0068855_100038248 | |||
| 1023 | Ga0068855_100105819 | |||
| 1024 | Ga0068855_100250298 | |||
| 1025 | Ga0068855_100286098 | |||
| 1026 | Ga0068855_100335243 | |||
| 1027 | Ga0070664_100175261 | |||
| 1028 | Ga0070664_100268493 | |||
| 1029 | Ga0070664_100272966 | |||
| 1030 | Ga0070664_100312514 | |||
| 1031 | Ga0068857_100003568 | |||
| 1032 | Ga0068857_100042339 | |||
| 1033 | Ga0068857_100047325 | |||
| 1034 | Ga0068857_100077502 | |||
| 1035 | Ga0068857_100113884 | |||
| 1036 | Ga0068857_100343719 | |||
| 1037 | Ga0068857_100376552 | |||
| 1038 | Ga0068857_100413914 | |||
| 1039 | Ga0068854_100006771 | |||
| 1040 | Ga0068854_100030233 | |||
| 1041 | Ga0068854_100167820 | |||
| 1042 | Ga0068856_100139537 | |||
| 1043 | Ga0068856_100184507 | |||
| 1044 | Ga0068856_100502098 | |||
| 1045 | Ga0070702_100028072 | |||
| 1046 | Ga0068852_100003450 | |||
| 1047 | Ga0068852_100006690 | |||
| 1048 | Ga0068852_100077233 | |||
| 1049 | Ga0068852_100115553 | |||
| 1050 | Ga0068852_100341434 | |||
| 1051 | Ga0068852_100415000 | |||
| 1052 | Ga0068859_100007240 | |||
| 1053 | Ga0068859_100034486 | |||
| 1054 | Ga0068859_100111254 | |||
| 1055 | Ga0068859_100114949 | |||
| 1056 | Ga0068859_100315988 | |||
| 1057 | Ga0068859_100483155 | |||
| 1058 | Ga0068864_100012029 | |||
| 1059 | Ga0068864_100033010 | |||
| 1060 | Ga0068864_100292922 | |||
| 1061 | Ga0068864_100581143 | |||
| 1062 | Ga0068866_10039250 | |||
| 1063 | Ga0068866_10048472 | |||
| 1064 | Ga0068866_10083559 | |||
| 1065 | Ga0068861_100003797 | |||
| 1066 | Ga0068861_100011486 | |||
| 1067 | Ga0068861_100052536 | |||
| 1068 | Ga0068861_100203806 | |||
| 1069 | Ga0068851_10009258 | |||
| 1070 | Ga0068851_10037167 | |||
| 1071 | Ga0068870_10082591 | |||
| 1072 | Ga0068870_10172388 | |||
| 1073 | Ga0068863_100004861 | |||
| 1074 | Ga0068863_100036418 | |||
| 1075 | Ga0068863_100090771 | |||
| 1076 | Ga0068863_100164964 | |||
| 1077 | Ga0068863_100169040 | |||
| 1078 | Ga0068858_100044720 | |||
| 1079 | Ga0068860_100000026 | |||
| 1080 | Ga0068860_100042549 | |||
| 1081 | Ga0068860_100055973 | |||
| 1082 | Ga0068860_100105829 | |||
| 1083 | Ga0068860_100204261 | |||
| 1084 | Ga0068862_100001498 | |||
| 1085 | Ga0068862_100184520 | |||
| 1086 | Ga0081539_10006670 | |||
| 1087 | Ga0075366_10068132 | |||
| 1088 | Ga0075366_10101241 | |||
| 1089 | Ga0097621_100004149 | |||
| 1090 | Ga0097621_100073484 | |||
| 1091 | Ga0097621_100108847 | |||
| 1092 | Ga0097621_100189059 | |||
| 1093 | Ga0097621_100194787 | |||
| 1094 | Ga0097621_100216223 | |||
| 1095 | Ga0097621_100287177 | |||
| 1096 | Ga0097621_100522810 | |||
| 1097 | Ga0068871_100000089 | |||
| 1098 | Ga0068871_100074089 | |||
| 1099 | Ga0068871_100088559 | |||
| 1100 | Ga0068871_100247379 | |||
| 1101 | Ga0068871_100286050 | |||
| 1102 | Ga0068871_100331889 | |||
| 1103 | Ga0068871_100409642 | |||
| 1104 | Ga0075428_100067024 | |||
| 1105 | Ga0075428_100089533 | |||
| 1106 | Ga0075428_100381314 | |||
| 1107 | Ga0075431_100009249 | |||
| 1108 | Ga0075431_100019516 | |||
| 1109 | Ga0075431_100554708 | |||
| 1110 | Ga0075434_100139353 | |||
| 1111 | Ga0075429_100051372 | |||
| 1112 | Ga0075429_100102408 | |||
| 1113 | Ga0068865_100033153 | |||
| 1114 | Ga0068865_100059581 | |||
| 1115 | Ga0068865_100414337 | |||
| 1116 | Ga0097620_100007240 | |||
| 1117 | Ga0097620_100034486 | |||
| 1118 | Ga0097620_100111253 | |||
| 1119 | Ga0097620_100114950 | |||
| 1120 | Ga0097620_100315984 | |||
| 1121 | Ga0097620_100483213 | |||
| 1122 | Ga0105240_10001556 | |||
| 1123 | Ga0105240_10001801 | |||
| 1124 | Ga0105240_10003107 | |||
| 1125 | Ga0105240_10025973 | |||
| 1126 | Ga0105240_10044252 | |||
| 1127 | Ga0105240_10070450 | |||
| 1128 | Ga0105240_10166385 | |||
| 1129 | Ga0105240_10620999 | |||
| 1130 | Ga0111539_10001550 | |||
| 1131 | Ga0111539_10020594 | |||
| 1132 | Ga0111539_10062099 | |||
| 1133 | Ga0111539_10168622 | |||
| 1134 | Ga0111539_10273246 | |||
| 1135 | Ga0105247_10028561 | |||
| 1136 | Ga0114129_10068944 | |||
| 1137 | Ga0114129_10080244 | |||
| 1138 | Ga0105243_10217617 | |||
| 1139 | Ga0105243_10282209 | |||
| 1140 | Ga0105241_10001155 | |||
| 1141 | Ga0105241_10001477 | |||
| 1142 | Ga0105241_10035287 | |||
| 1143 | Ga0105241_10176234 | |||
| 1144 | Ga0105241_10216697 | |||
| 1145 | Ga0105242_10018807 | |||
| 1146 | Ga0105242_10041000 | |||
| 1147 | Ga0105242_10089793 | |||
| 1148 | Ga0105242_10095569 | |||
| 1149 | Ga0105248_10107617 | |||
| 1150 | Ga0105237_10001522 | |||
| 1151 | Ga0105237_10004392 | |||
| 1152 | Ga0105237_10032033 | |||
| 1153 | Ga0105237_10044973 | |||
| 1154 | Ga0105237_10057283 | |||
| 1155 | Ga0105237_10109193 | |||
| 1156 | Ga0105238_10001372 | |||
| 1157 | Ga0105238_10321646 | |||
| 1158 | Ga0105249_10002391 | |||
| 1159 | Ga0105249_10014121 | |||
| 1160 | Ga0105249_10016618 | |||
| 1161 | Ga0105249_10019593 | |||
| 1162 | Ga0105249_10074316 | |||
| 1163 | Ga0105249_10142889 | |||
| 1164 | Ga0105249_10310318 | |||
| 1165 | Ga0105239_10000591 | |||
| 1166 | Ga0105239_10019985 | |||
| 1167 | Ga0105239_10025533 | |||
| 1168 | Ga0105239_10037158 | |||
| 1169 | Ga0105239_10043080 | |||
| 1170 | Ga0105239_10105702 | |||
| 1171 | Ga0105239_10183764 | |||
| 1172 | Ga0105239_10222130 | |||
| 1173 | Ga0105239_10405340 | |||
| 1174 | Ga0105239_10423077 | |||
| 1175 | Ga0105239_10480495 | |||
| 1176 | Ga0105246_10015217 | |||
| 1177 | Ga0157373_10002354 | |||
| 1178 | Ga0157373_10006316 | |||
| 1179 | Ga0157373_10017906 | |||
| 1180 | Ga0157373_10058730 | |||
| 1181 | Ga0157373_10143621 | |||
| 1182 | Ga0157373_10185267 | |||
| 1183 | Ga0157371_10000704 | |||
| 1184 | Ga0157371_10001124 | |||
| 1185 | Ga0157371_10001784 | |||
| 1186 | Ga0157371_10003113 | |||
| 1187 | Ga0157371_10005851 | |||
| 1188 | Ga0157371_10014709 | |||
| 1189 | Ga0157371_10015148 | |||
| 1190 | Ga0157371_10022772 | |||
| 1191 | Ga0157371_10029140 | |||
| 1192 | Ga0157371_10050713 | |||
| 1193 | Ga0157371_10063018 | |||
| 1194 | Ga0157371_10180309 | |||
| 1195 | Ga0157371_10241142 | |||
| 1196 | Ga0157371_10267873 | |||
| 1197 | Ga0157370_10000083 | |||
| 1198 | Ga0157370_10001361 | |||
| 1199 | Ga0157370_10003700 | |||
| 1200 | Ga0157370_10004793 | |||
| 1201 | Ga0157370_10025903 | |||
| 1202 | Ga0157370_10044375 | |||
| 1203 | Ga0157370_10076484 | |||
| 1204 | Ga0157370_10189011 | |||
| 1205 | Ga0157370_10331737 | |||
| 1206 | Ga0157369_10010084 | |||
| 1207 | Ga0157369_10070619 | |||
| 1208 | Ga0157369_10086225 | |||
| 1209 | Ga0157369_10170645 | |||
| 1210 | Ga0157369_10361519 | |||
| 1211 | Ga0157374_10000500 | |||
| 1212 | Ga0157374_10009640 | |||
| 1213 | Ga0157374_10036592 | |||
| 1214 | Ga0157374_10088666 | |||
| 1215 | Ga0157374_10316849 | |||
| 1216 | Ga0157374_10452607 | |||
| 1217 | Ga0157374_10598070 | |||
| 1218 | Ga0157374_10666262 | |||
| 1219 | Ga0157378_10000623 | |||
| 1220 | Ga0157378_10022790 | |||
| 1221 | Ga0157378_10044946 | |||
| 1222 | Ga0157378_10070034 | |||
| 1223 | Ga0157378_10154016 | |||
| 1224 | Ga0157378_10590684 | |||
| 1225 | Ga0163162_10000241 | |||
| 1226 | Ga0163162_10003046 | |||
| 1227 | Ga0163162_10004340 | |||
| 1228 | Ga0163162_10007999 | |||
| 1229 | Ga0163162_10042375 | |||
| 1230 | Ga0163162_10059116 | |||
| 1231 | Ga0163162_10084483 | |||
| 1232 | Ga0163162_10129767 | |||
| 1233 | Ga0157372_10001284 | |||
| 1234 | Ga0157372_10006492 | |||
| 1235 | Ga0157372_10027114 | |||
| 1236 | Ga0157372_10035783 | |||
| 1237 | Ga0157372_10070036 | |||
| 1238 | Ga0157372_10071448 | |||
| 1239 | Ga0157372_10075023 | |||
| 1240 | Ga0157372_10079361 | |||
| 1241 | Ga0157372_10086580 | |||
| 1242 | Ga0157372_10122722 | |||
| 1243 | Ga0157372_10149242 | |||
| 1244 | Ga0157372_10151194 | |||
| 1245 | Ga0157372_10177201 | |||
| 1246 | Ga0157372_10188272 | |||
| 1247 | Ga0157372_10237736 | |||
| 1248 | Ga0157372_10335554 | |||
| 1249 | Ga0157372_10427468 | |||
| 1250 | Ga0157372_10508158 | |||
| 1251 | Ga0157372_10594420 | |||
| 1252 | Ga0157375_10003999 | |||
| 1253 | Ga0157375_10006480 | |||
| 1254 | Ga0157375_10012255 | |||
| 1255 | Ga0157375_10018353 | |||
| 1256 | Ga0157375_10020277 | |||
| 1257 | Ga0157375_10077486 | |||
| 1258 | Ga0157375_10084821 | |||
| 1259 | Ga0157375_10098814 | |||
| 1260 | Ga0157375_10131128 | |||
| 1261 | Ga0157375_10173190 | |||
| 1262 | Ga0157375_10176834 | |||
| 1263 | Ga0157375_10487401 | |||
| 1264 | Ga0163163_10000198 | |||
| 1265 | Ga0163163_10000204 | |||
| 1266 | Ga0163163_10130342 | |||
| 1267 | Ga0163163_10140701 | |||
| 1268 | Ga0163163_10161825 | |||
| 1269 | Ga0163163_10228319 | |||
| 1270 | Ga0163163_10419904 | |||
| 1271 | Ga0157380_10016451 | |||
| 1272 | Ga0157380_10131438 | |||
| 1273 | Ga0157380_10137028 | |||
| 1274 | Ga0157380_10163608 | |||
| 1275 | Ga0182008_10000022 | |||
| 1276 | Ga0182008_10000104 | |||
| 1277 | Ga0157377_10009480 | |||
| 1278 | Ga0157377_10018566 | |||
| 1279 | Ga0157377_10048064 | |||
| 1280 | Ga0157377_10075257 | |||
| 1281 | Ga0157377_10087381 | |||
| 1282 | Ga0157379_10014138 | |||
| 1283 | Ga0157379_10019150 | |||
| 1284 | Ga0157379_10039701 | |||
| 1285 | Ga0157379_10043530 | |||
| 1286 | Ga0157379_10110523 | |||
| 1287 | Ga0157379_10229625 | |||
| 1288 | Ga0157376_10000365 | |||
| 1289 | Ga0157376_10098558 | |||
| 1290 | Ga0157376_10202034 | |||
| 1291 | Ga0157376_10236131 | |||
| 1292 | Ga0182006_1000279 | |||
| 1293 | Ga0182006_1010075 | |||
| 1294 | Ga0182005_1000582 | |||
| 1295 | Ga0163161_10000828 | |||
| 1296 | Ga0163161_10008078 | |||
| 1297 | Ga0163161_10016797 | |||
| 1298 | Ga0163161_10031280 | |||
| 1299 | Ga0163161_10031383 | |||
| 1300 | Ga0163161_10040005 | |||
| 1301 | Ga0209436_101837 | |||
| 1302 | Ga0209258_100326 | |||
| 1303 | Ga0209646_1002394 | |||
| 1304 | Ga0209148_1000157 | |||
| 1305 | Ga0207426_1004602 | |||
| 1306 | Ga0207697_10019471 | |||
| 1307 | Ga0207682_10032311 | |||
| 1308 | Ga0207642_10092623 | |||
| 1309 | Ga0207710_10000852 | |||
| 1310 | Ga0207688_10008735 | |||
| 1311 | Ga0207680_10018075 | |||
| 1312 | Ga0207680_10047092 | |||
| 1313 | Ga0207647_10000485 | |||
| 1314 | Ga0207647_10012309 | |||
| 1315 | Ga0207647_10014774 | |||
| 1316 | Ga0207647_10017140 | |||
| 1317 | Ga0207647_10115100 | |||
| 1318 | Ga0207645_10000306 | |||
| 1319 | Ga0207645_10007634 | |||
| 1320 | Ga0207645_10022021 | |||
| 1321 | Ga0207645_10077211 | |||
| 1322 | Ga0207645_10138435 | |||
| 1323 | Ga0207643_10011315 | |||
| 1324 | Ga0207643_10016982 | |||
| 1325 | Ga0207705_10026123 | |||
| 1326 | Ga0207654_10001045 | |||
| 1327 | Ga0207654_10002081 | |||
| 1328 | Ga0207654_10036350 | |||
| 1329 | Ga0207707_10005500 | |||
| 1330 | Ga0207707_10025371 | |||
| 1331 | Ga0207707_10260566 | |||
| 1332 | Ga0207695_10000486 | |||
| 1333 | Ga0207695_10000681 | |||
| 1334 | Ga0207695_10007678 | |||
| 1335 | Ga0207695_10016877 | |||
| 1336 | Ga0207695_10035512 | |||
| 1337 | Ga0207695_10056539 | |||
| 1338 | Ga0207695_10067276 | |||
| 1339 | Ga0207671_10002974 | |||
| 1340 | Ga0207671_10004223 | |||
| 1341 | Ga0207671_10004504 | |||
| 1342 | Ga0207671_10011287 | |||
| 1343 | Ga0207671_10024178 | |||
| 1344 | Ga0207671_10032172 | |||
| 1345 | Ga0207671_10035762 | |||
| 1346 | Ga0207671_10241200 | |||
| 1347 | Ga0207660_10005607 | |||
| 1348 | Ga0207662_10102327 | |||
| 1349 | Ga0207662_10147602 | |||
| 1350 | Ga0207657_10007433 | |||
| 1351 | Ga0207657_10113237 | |||
| 1352 | Ga0207657_10116779 | |||
| 1353 | Ga0207649_10006712 | |||
| 1354 | Ga0207649_10010447 | |||
| 1355 | Ga0207649_10060819 | |||
| 1356 | Ga0207649_10080298 | |||
| 1357 | Ga0207649_10202185 | |||
| 1358 | Ga0207652_10000144 | |||
| 1359 | Ga0207652_10001497 | |||
| 1360 | Ga0207652_10003454 | |||
| 1361 | Ga0207652_10019246 | |||
| 1362 | Ga0207652_10209206 | |||
| 1363 | Ga0207681_10028255 | |||
| 1364 | Ga0207681_10047308 | |||
| 1365 | Ga0207694_10009415 | |||
| 1366 | Ga0207650_10026595 | |||
| 1367 | Ga0207650_10106147 | |||
| 1368 | Ga0207650_10129047 | |||
| 1369 | Ga0207650_10236102 | |||
| 1370 | Ga0207659_10055728 | |||
| 1371 | Ga0207659_10413266 | |||
| 1372 | Ga0207644_10023411 | |||
| 1373 | Ga0207644_10202990 | |||
| 1374 | Ga0207644_10213151 | |||
| 1375 | Ga0207690_10052958 | |||
| 1376 | Ga0207690_10104539 | |||
| 1377 | Ga0207690_10267059 | |||
| 1378 | Ga0207706_10003022 | |||
| 1379 | Ga0207706_10026639 | |||
| 1380 | Ga0207706_10066425 | |||
| 1381 | Ga0207706_10155703 | |||
| 1382 | Ga0207706_10202881 | |||
| 1383 | Ga0207686_10064526 | |||
| 1384 | Ga0207686_10101937 | |||
| 1385 | Ga0207669_10095637 | |||
| 1386 | Ga0207704_10068739 | |||
| 1387 | Ga0207704_10127246 | |||
| 1388 | Ga0207704_10237458 | |||
| 1389 | Ga0207704_10364128 | |||
| 1390 | Ga0207691_10005363 | |||
| 1391 | Ga0207691_10008512 | |||
| 1392 | Ga0207691_10010779 | |||
| 1393 | Ga0207691_10048084 | |||
| 1394 | Ga0207691_10132183 | |||
| 1395 | Ga0207691_10278963 | |||
| 1396 | Ga0207711_10050580 | |||
| 1397 | Ga0207689_10008686 | |||
| 1398 | Ga0207689_10034312 | |||
| 1399 | Ga0207689_10037842 | |||
| 1400 | Ga0207689_10044618 | |||
| 1401 | Ga0207689_10052629 | |||
| 1402 | Ga0207689_10055197 | |||
| 1403 | Ga0207689_10087359 | |||
| 1404 | Ga0207689_10108462 | |||
| 1405 | Ga0207661_10002894 | |||
| 1406 | Ga0207661_10027299 | |||
| 1407 | Ga0207661_10060306 | |||
| 1408 | Ga0207661_10122823 | |||
| 1409 | Ga0207661_10219786 | |||
| 1410 | Ga0207679_10000727 | |||
| 1411 | Ga0207679_10065613 | |||
| 1412 | Ga0207679_10089945 | |||
| 1413 | Ga0207667_10000180 | |||
| 1414 | Ga0207667_10003610 | |||
| 1415 | Ga0207667_10011547 | |||
| 1416 | Ga0207667_10026734 | |||
| 1417 | Ga0207667_10046893 | |||
| 1418 | Ga0207667_10110691 | |||
| 1419 | Ga0207667_10198462 | |||
| 1420 | Ga0207667_10211697 | |||
| 1421 | Ga0207667_10251570 | |||
| 1422 | Ga0207667_10290877 | |||
| 1423 | Ga0207667_10431776 | |||
| 1424 | Ga0207651_10011427 | |||
| 1425 | Ga0207651_10052122 | |||
| 1426 | Ga0207651_10058309 | |||
| 1427 | Ga0207651_10201830 | |||
| 1428 | Ga0207712_10006482 | |||
| 1429 | Ga0207712_10014700 | |||
| 1430 | Ga0207712_10017059 | |||
| 1431 | Ga0207712_10030255 | |||
| 1432 | Ga0207712_10151480 | |||
| 1433 | Ga0207668_10132587 | |||
| 1434 | Ga0207668_10172114 | |||
| 1435 | Ga0207640_10088002 | |||
| 1436 | Ga0207640_10099526 | |||
| 1437 | Ga0207640_10222398 | |||
| 1438 | Ga0207640_10381673 | |||
| 1439 | Ga0207658_10017476 | |||
| 1440 | Ga0207658_10024283 | |||
| 1441 | Ga0207658_10035883 | |||
| 1442 | Ga0207677_10027849 | |||
| 1443 | Ga0207677_10036442 | |||
| 1444 | Ga0207677_10086408 | |||
| 1445 | Ga0207677_10123090 | |||
| 1446 | Ga0207677_10200765 | |||
| 1447 | Ga0207703_10109284 | |||
| 1448 | Ga0207703_10150478 | |||
| 1449 | Ga0207639_10007663 | |||
| 1450 | Ga0207639_10025552 | |||
| 1451 | Ga0207639_10046174 | |||
| 1452 | Ga0207639_10056473 | |||
| 1453 | Ga0207639_10194620 | |||
| 1454 | Ga0207639_10567606 | |||
| 1455 | Ga0207678_10117342 | |||
| 1456 | Ga0207708_10116262 | |||
| 1457 | Ga0207702_10126685 | |||
| 1458 | Ga0207702_10234585 | |||
| 1459 | Ga0207641_10003797 | |||
| 1460 | Ga0207641_10391330 | |||
| 1461 | Ga0207648_10001646 | |||
| 1462 | Ga0207648_10001977 | |||
| 1463 | Ga0207648_10029228 | |||
| 1464 | Ga0207648_10056469 | |||
| 1465 | Ga0207648_10064058 | |||
| 1466 | Ga0207648_10094465 | |||
| 1467 | Ga0207648_10137065 | |||
| 1468 | Ga0207648_10322720 | |||
| 1469 | Ga0207648_10504834 | |||
| 1470 | Ga0207676_10009152 | |||
| 1471 | Ga0207676_10012044 | |||
| 1472 | Ga0207676_10087668 | |||
| 1473 | Ga0207676_10492908 | |||
| 1474 | Ga0207674_10003467 | |||
| 1475 | Ga0207674_10003537 | |||
| 1476 | Ga0207674_10009196 | |||
| 1477 | Ga0207674_10025384 | |||
| 1478 | Ga0207674_10043512 | |||
| 1479 | Ga0207674_10161905 | |||
| 1480 | Ga0207674_10314403 | |||
| 1481 | Ga0207675_100000095 | |||
| 1482 | Ga0207675_100008062 | |||
| 1483 | Ga0207675_100018554 | |||
| 1484 | Ga0207675_100032792 | |||
| 1485 | Ga0207675_100054920 | |||
| 1486 | Ga0207675_100081001 | |||
| 1487 | Ga0207675_100204100 | |||
| 1488 | Ga0207683_10000574 | |||
| 1489 | Ga0207683_10004460 | |||
| 1490 | Ga0207683_10099068 | |||
| 1491 | Ga0207683_10568817 | |||
| 1492 | Ga0207683_10633230 | |||
| 1493 | Ga0207698_10066384 | |||
| 1494 | Ga0207698_10147593 | |||
| 1495 | Ga0207698_10188470 | |||
| 1496 | Ga0207698_10310498 | |||
| 1497 | Ga0209968_1015181 | |||
| 1498 | Ga0207428_10006018 | |||
| 1499 | Ga0207428_10041855 | |||
| 1500 | Ga0268266_10000034 | |||
| 1501 | Ga0268266_10058727 | |||
| 1502 | Ga0268265_10293248 | |||
| 1503 | Ga0268264_10000436 | |||
| 1504 | Ga0268264_10017550 | |||
| 1505 | Ga0268264_10138413 | |||
| 1506 | Ga0268264_10233105 | |||
| 1507 | Ga0307517_10001430 | |||
| 1508 | Ga0307511_10000265 | |||
| 1509 | Ga0265327_10013111 | |||
| 1510 | Ga0307513_10114159 | |||
| 1511 | Ga0307513_10229540 | |||
| 1512 | Ga0307509_10068409 | |||
| 1513 | Ga0307509_10170664 | |||
| 1514 | Ga0307408_100037231 | |||
| 1515 | Ga0265313_10066744 | |||
| 1516 | Ga0307508_10011402 | |||
| 1517 | Ga0307516_10006866 | |||
| 1518 | Ga0307516_10043183 | |||
| 1519 | Ga0307413_10115979 | |||
| 1520 | Ga0307406_10216036 | |||
| 1521 | Ga0307412_10000001 | |||
| 1522 | Ga0307416_100371647 | |||
| 1523 | Ga0307414_10000268 | |||
| 1524 | Ga0307414_10000987 | |||
| 1525 | Ga0307414_10017542 | |||
| 1526 | Ga0307414_10088318 | |||
| 1527 | Ga0307414_10290337 | |||
| 1528 | Ga0307510_10024228 | |||
| 1529 | Ga0373936_0022615 | |||
| 1530 | Ga0373943_0132342 | |||
| 1531 | Ga0373924_0014288 | |||
| 1532 | Ga0373937_0076299 | |||
| 1533 | Ga0395899_0003426 | |||
| 1534 | Ga0395899_0005439 | |||
| 1535 | Ga0395899_0009555 | |||
| 1536 | Ga0395900_0010296 | |||
| 1537 | Ga0395900_0010792 | |||
| 1538 | Ga0395900_0070166 | |||
| 1539 | Ga0395900_0181145 | |||
| 1540 | Ga0395900_0244285 | |||
| 1541 | Ga0395900_0274704 | |||
| 1542 | Ga0395900_0374665 | |||
| 1543 | Ga0395898_0011226 | |||
| 1544 | Ga0395898_0019271 | |||
| 1545 | Ga0395898_0042659 | |||
| 1546 | Ga0395898_0204291 | |||
| 1547 | Ga0395898_0209652 | |||
| 1548 | Ga0395905_0009045 | |||
| 1549 | Ga0395905_0017462 | |||
| 1550 | Ga0395905_0081094 | |||
| 1551 | Ga0395901_0014336 | |||
| 1552 | Ga0395901_0039776 | |||
| 1553 | Ga0395901_0065131 | |||
| 1554 | Ga0395901_0181123 | |||
| 1555 | Ga0395901_0224530 | |||
| 1556 | Ga0395901_0340279 | |||
| 1557 | Ga0439465_0047694 | |||
| 1558 | Ga0439433_0033904 | |||
| 1559 | Ga0439441_025232 | |||
| 1560 | Ga0439432_063297 | |||
| 1561 | Ga0439449_0017295 | |||
| 1562 | Ga0439449_0064094 | |||
| 1563 | Ga0439452_031950 | |||
| 1564 | Ga0439457_013470 | |||
| 1565 | Ga0439462_0036636 | |||
| 1566 | Ga0450894_011541 | |||
| 1567 | Ga0451577_0033602 | |||
| 1568 | Ga0466969_0000109 | |||
| 1569 | Ga0466972_0000038 | |||
| 1570 | Ga0466972_0066001 | |||
| 1571 | Ga0466972_0073749 | |||
| 1572 | Ga0453683_0255378 | |||
| 1573 | Ga0466965_0038717 | |||
| 1574 | Ga0466966_0021272 | |||
| 1575 | Ga0466966_0124624 | |||
| 1576 | Ga0466964_0030692 | |||
| 1577 | Ga0453684_0093037 | |||
| 1578 | Ga0466971_0116542 | |||
| 1579 | Ga0466968_0032063 | |||
| 1580 | Ga0466970_0048019 | |||
| 1581 | Ga0466957_0001763 | |||
| 1582 | Ga0466959_0000380 | |||
| 1583 | Ga0466959_0001334 | |||
| 1584 | Ga0495603_0097352 | |||
| 1585 | Ga0495638_0022965 | |||
| 1586 | Ga0495638_0038094 | |||
| 1587 | Ga0495650_0024591 | |||
| 1588 | Ga0495580_0103621 | |||
| 1589 | Ga0495580_0232834 | |||
| 1590 | Ga0495606_0007030 | |||
| 1591 | Ga0495608_0052942 | |||
| 1592 | Ga0495630_0002806 | |||
| 1593 | Ga0495632_0129522 | |||
| 1594 | Ga0495632_0154684 | |||
| 1595 | Ga0495648_0004897 | |||
| 1596 | Ga0495668_0003016 | |||
| 1597 | Ga0495611_0000702 | |||
| 1598 | Ga0495625_0103084 | |||
| 1599 | Ga0495635_0068998 | |||
| 1600 | Ga0495672_0070333 | |||
| 1601 | Ga0495676_0034872 | |||
| 1602 | Ga0495687_000079 | |||
| 1603 | Ga0495675_0302971 | |||
| 1604 | Ga0495686_0048144 | |||
| 1605 | Ga0496100_0063790 | |||
| 1606 | Ga0496104_0155824 | |||
| 1607 | Ga0496114_0029611 | |||
| 1608 | Ga0496115_0113749 | |||
| 1609 | Ga0496121_0000028 | |||
| 1610 | Ga0496122_0002421 | |||
| 1611 | Ga0496123_0008155 | |||
| 1612 | Ga0496125_0046265 | |||
| 1613 | Ga0501306_003887 | |||
| 1614 | Ga0501292_005404 | |||
| 1615 | Ga0501293_002577 | |||
| 1616 | Ga0501298_002860 | |||
| 1617 | Ga0501315_022434 | |||
| 1618 | Ga0501031_0103979 | |||
| 1619 | Ga0501032_0002473 | |||
| 1620 | Ga0501032_0128221 | |||
| 1621 | Ga0501034_0001745 | |||
| 1622 | Ga0501034_0053972 | |||
| 1623 | Ga0501034_0074067 | |||
| 1624 | Ga0501034_0108841 | |||
| 1625 | Ga0501034_0152277 | |||
| 1626 | Ga0501034_0230209 | |||
| 1627 | Ga0501037_0014175 | |||
| 1628 | Ga0501038_0082526 | |||
| 1629 | Ga0501038_0370008 | |||
| 1630 | Ga0501039_0024775 | |||
| 1631 | Ga0501039_0114661 | |||
| 1632 | Ga0501043_0021185 | |||
| 1633 | Ga0501043_0026748 | |||
| 1634 | Ga0501043_0030127 | |||
| 1635 | Ga0501043_0213430 | |||
| 1636 | Ga0501047_0027824 | |||
| 1637 | Ga0501047_0030221 | |||
| 1638 | Ga0501047_0057040 | |||
| 1639 | Ga0501047_0142010 | |||
| 1640 | Ga0501047_0388179 | |||
| 1641 | Ga0501067_0054155 | |||
| 1642 | Ga0501069_0310568 | |||
| 1643 | Ga0501070_0035848 | |||
| 1644 | Ga0501070_0402717 | |||
| 1645 | Ga0501073_0011253 | |||
| 1646 | Ga0501073_0013765 | |||
| 1647 | Ga0501074_0019589 | |||
| 1648 | Ga0501074_0210518 | |||
| 1649 | Ga0501201_002844 | |||
| 1650 | Ga0501202_003403 | |||
| 1651 | Ga0501207_003879 | |||
| 1652 | Ga0501217_001527 | |||
| 1653 | Ga0501223_000496 | |||
| 1654 | Ga0501235_000303 | |||
| 1655 | Ga0501235_002609 | |||
| 1656 | Ga0501242_003564 | |||
| 1657 | Ga0501243_001562 | |||
| 1658 | Ga0501251_001580 | |||
| 1659 | Ga0501259_001348 | |||
| 1660 | Ga0501261_002505 | |||
| 1661 | Ga0501219_000430 | |||
| 1662 | Ga0501221_002173 | |||
| 1663 | Ga0501225_0013731 | |||
| 1664 | Ga0501225_0018251 | |||
| 1665 | Ga0501234_000249 | |||
| 1666 | Ga0501245_005320 | |||
| 1667 | Ga0501079_0372042 | |||
| 1668 | Ga0501080_0197290 | |||
| 1669 | Ga0501080_0301262 | |||
| 1670 | Ga0501080_0489783 | |||
| 1671 | Ga0501083_0030753 | |||
| 1672 | Ga0501232_004704 | |||
| 1673 | Ga0501241_008316 | |||
| 1674 | Ga0501241_014070 | |||
| 1675 | Ga0501268_012488 | |||
| 1676 | Ga0501269_009992 | |||
| 1677 | Ga0501280_012251 | |||
| 1678 | Ga0501282_003770 | |||
| 1679 | Ga0501283_004659 | |||
| 1680 | Ga0501035_0039695 | |||
| 1681 | Ga0501035_0174896 | |||
| 1682 | Ga0501035_0201001 | |||
| 1683 | Ga0501044_0008297 | |||
| 1684 | Ga0501044_0012341 | |||
| 1685 | Ga0501044_0014959 | |||
| 1686 | Ga0501044_0067907 | |||
| 1687 | Ga0501044_0406480 | |||
| 1688 | Ga0501044_0598324 | |||
| 1689 | Ga0501212_001713 | |||
| 1690 | Ga0501284_00039 | |||
| 1691 | Ga0501284_00770 | |||
| 1692 | nmdc:mga0k408_19301_c1 | |||
| 1693 | nmdc:mga0k408_24934_c1 | |||
| 1694 | nmdc:mga0k408_41294_c1 | |||
| 1695 | nmdc:mga0k408_75017_c1 | |||
| 1696 | nmdc:mga05p37_4228_c1 | |||
| 1697 | nmdc:mga09592_156908_c1 | |||
| 1698 | nmdc:mga0qj67_31022_c1 | |||
| 1699 | nmdc:mga06r32_41639_c1 | |||
| 1700 | nmdc:mga08y16_11583_c1 | |||
| 1701 | nmdc:mga08y16_83384_c1 | |||
| 1702 | nmdc:mga08y16_87847_c1 | |||
| 1703 | nmdc:mga0n895_109055_c1 | |||
| 1704 | Ga0500578_0000009 | |||
| 1705 | Ga0500578_0118272 | |||
| 1706 | Ga0500644_0000226 | |||
| 1707 | Ga0500646_0004638 | |||
| 1708 | Ga0500646_0004984 | |||
| 1709 | Ga0500646_0036635 | |||
| 1710 | Ga0500583_0000036 | |||
| 1711 | Ga0500583_0001798 | |||
| 1712 | Ga0500583_0002700 | |||
| 1713 | Ga0500651_0001193 | |||
| 1714 | Ga0500607_124200 | |||
| 1715 | Ga0500642_0077176 | |||
| 1716 | Ga0500652_024061 | |||
| 1717 | Ga0500658_0033058 | |||
| 1718 | Ga0500559_0046426 | |||
| 1719 | Ga0500568_0004727 | |||
| 1720 | Ga0500604_0008510 | |||
| 1721 | Ga0500616_0029279 | |||
| 1722 | Ga0500622_0149456 | |||
| 1723 | Ga0500634_0082124 | |||
| 1724 | Ga0500636_0178279 | |||
| 1725 | Ga0500611_001300 | |||
| 1726 | Ga0500645_065790 | |||
| 1727 | Ga0500661_003423 | |||
| 1728 | 2738726536 | |||
| 1729 | 2738758308 | |||
| 1730 | 2738763153 | |||
| 1731 | 2739303834 | |||
| 1732 | 2776616310 | |||
| 1733 | 2819572781 | |||
| 1734 | 2821139806 | |||
| 1735 | 2852629663 | |||
| 1736 | 2884794939 | |||
| 1737 | 2902051954 | |||
| 1738 | 2904473443 | |||
| 1739 | 2919191062 | |||
| 1740 | 2929244706 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vi1-assembly2.cif.gz_B | crystal structure of a fatty acid/phospholipid synthesis protein | 0.9341 | 1 | 313 |
| 1vi1-assembly2.cif.gz_B | crystal structure of a fatty acid/phospholipid synthesis protein | 0.9312 | 1 | 313 |
| 1vi1-assembly1.cif.gz_A | crystal structure of a fatty acid/phospholipid synthesis protein | 0.9276 | 1 | 311 |
| 6a1k-assembly1.cif.gz_B | phosphate acyltransferase plsx from b.subtilis | 0.9272 | 1 | 309 |
| 1vi1-assembly1.cif.gz_A | crystal structure of a fatty acid/phospholipid synthesis protein | 0.9198 | 1 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P27247_3_343_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.9001 | 1 | 309 | 3.40.718.10 |
| af_P27247_3_343_3.40.718.10 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8864 | 1 | 309 | 3.40.718.10 |
| 1u7nB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8707 | 3 | 309 | 3.40.718.10 |
| 1u7nB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8598 | 3 | 309 | 3.40.718.10 |
| 3u9eA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.711 | 3 | 304 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G4U268-F1-model_v4 | Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) | 0.9893 | 1 | 311 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A4Q3GVF5-F1-model_v4 | deleted | 0.9862 | 160 | 312 |
|
| AF-A0A1Q6EYW8-F1-model_v4 | phosphate acyltransferase (EC 2.3.1.274) | 0.9834 | 8 | 279 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A1G4U268-F1-model_v4 | Phosphate acyltransferase (EC 2.3.1.274) (Acyl-ACP phosphotransacylase) (Acyl-[acyl-carrier-protein]--phosphate acyltransferase) (Phosphate-acyl-ACP acyltransferase) | 0.9831 | 1 | 311 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |
| AF-A0A3C0IPK7-F1-model_v4 | phosphate acyltransferase (EC 2.3.1.274) | 0.9811 | 87 | 272 |
GO:0005737
GO:0006633 GO:0008654 GO:0043811 |