F484008

General Info

Members Datasets Scaffolds Average Seq Length
865 385 1730 146

Family's Representative Sequence

Representative Sequence 3300049541|Ga0501325_008401|Ga0501325_008401_60_572
Length 170
Sequence MKLILTQEIDGLGAPGDVVEVKDGYGRNYLIPRGVAIRWTRGGEKTVESIKKARTSRAVRDHDHAGEIQKKLESAPVSVKVRSGEGGRLFGAVTVSEIAAAIADVSGQQVDKRTIAVKNPIKSLGSHVVLVRLHDEVTATVALNVIPVQTRRRARQEAQCHKRRAVNAER

Samples

Sample ID Description Type Environment
1 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
90 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
191 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
192 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
284 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
328 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
329 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
350 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
351 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
352 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
355 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
356 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
367 2643221561 Nocardioides sp. Root151 Isolate Unclassified
368 2643221604 Nocardioides sp. Root190 Isolate Unclassified
369 2643221641 Nocardioides sp. Root122 Isolate Unclassified
370 2643221696 Nocardioides sp. Root140 Isolate Unclassified
371 2738541305 Nocardioides sp. CF167 Isolate Unclassified
372 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
373 2739367898 Nocardioides sp. CF479 Isolate Unclassified
374 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
375 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
376 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
377 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
378 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
379 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
380 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
381 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
382 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
383 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
384 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
385 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.47
Metatranscriptomes 11.33
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 4.28
Nodule 0.12
Rhizoplane 9.25
Rhizosphere 80.92
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501325_008401 3300049541 Bacteria 896
2 LJQas_1000912 3300000549 Bacteria 4588
3 JGI24743J22301_10035349 3300001991 Bacteria 993
4 JGI24745J21846_1007099 3300002073 Bacteria 1253
5 JGI24744J21845_10006602 3300002077 Bacteria 2405
6 Ga0070658_10006341 3300005327 Bacteria 9585
7 Ga0070658_10349433 3300005327 Bacteria 1265
8 Ga0070683_100259945 3300005329 Bacteria 1651
9 Ga0070683_101418262 3300005329 Bacteria 667
10 Ga0070670_100604449 3300005331 Bacteria 982
11 Ga0070677_10228512 3300005333 Bacteria 913
12 Ga0068869_100730256 3300005334 Bacteria 846
13 Ga0070680_100796129 3300005336 Bacteria 814
14 Ga0070682_100010325 3300005337 Bacteria 5299
15 Ga0070682_100275321 3300005337 Bacteria 1224
16 Ga0070682_100527915 3300005337 Bacteria 919
17 Ga0070682_101136941 3300005337 Bacteria 656
18 Ga0068868_100262936 3300005338 Bacteria 1456
19 Ga0068868_100932878 3300005338 Bacteria 791
20 Ga0068868_101140954 3300005338 Bacteria 718
21 Ga0068868_102011563 3300005338 Bacteria 548
22 Ga0070660_100229451 3300005339 Bacteria 1510
23 Ga0070660_100746656 3300005339 Bacteria 822
24 Ga0070687_100144599 3300005343 Bacteria 1389
25 Ga0070687_100299576 3300005343 Bacteria 1020
26 Ga0070661_100651925 3300005344 Bacteria 855
27 Ga0070692_10114198 3300005345 Bacteria 1498
28 Ga0070668_100010096 3300005347 Bacteria 6999
29 Ga0070668_100396819 3300005347 Bacteria 1177
30 Ga0070668_100443761 3300005347 Bacteria 1114
31 Ga0070669_100003361 3300005353 Bacteria 11502
32 Ga0070675_100067313 3300005354 Bacteria 2964
33 Ga0070675_100212056 3300005354 Bacteria 1684
34 Ga0070671_100546502 3300005355 Bacteria 999
35 Ga0070671_100657433 3300005355 Bacteria 908
36 Ga0070671_101585745 3300005355 Bacteria 580
37 Ga0070688_100241294 3300005365 Bacteria 1283
38 Ga0070688_100346447 3300005365 Bacteria 1086
39 Ga0070659_100056198 3300005366 Bacteria 3103
40 Ga0070659_101281547 3300005366 Bacteria 649
41 Ga0070667_100000432 3300005367 Bacteria 44053
42 Ga0070667_100159320 3300005367 Bacteria 1987
43 Ga0070701_10169722 3300005438 Bacteria 1270
44 Ga0070700_100022907 3300005441 Bacteria 3649
45 Ga0070700_100625453 3300005441 Bacteria 847
46 Ga0070700_101513458 3300005441 Bacteria 571
47 Ga0070694_100313099 3300005444 Bacteria 1206
48 Ga0070663_100286379 3300005455 Bacteria 1314
49 Ga0070663_100810117 3300005455 Bacteria 803
50 Ga0070681_10363518 3300005458 Bacteria 1357
51 Ga0070681_10939920 3300005458 Bacteria 783
52 Ga0068867_100168502 3300005459 Bacteria 1733
53 Ga0070685_10021075 3300005466 Bacteria 3538
54 Ga0070685_10824124 3300005466 Bacteria 686
55 Ga0070679_100059219 3300005530 Bacteria 3817
56 Ga0070679_100694056 3300005530 Bacteria 960
57 Ga0070684_100003524 3300005535 Bacteria 11761
58 Ga0070684_100217339 3300005535 Bacteria 1743
59 Ga0070684_100609313 3300005535 Bacteria 1015
60 Ga0070684_101153488 3300005535 Bacteria 728
61 Ga0070684_101235475 3300005535 Bacteria 703
62 Ga0068853_100567994 3300005539 Bacteria 1076
63 Ga0068853_100681803 3300005539 Bacteria 979
64 Ga0068853_101010953 3300005539 Bacteria 800
65 Ga0070672_100286558 3300005543 Bacteria 1394
66 Ga0070672_101263041 3300005543 Bacteria 659
67 Ga0070686_100278892 3300005544 Bacteria 1232
68 Ga0070686_100471728 3300005544 Bacteria 969
69 Ga0070693_100248248 3300005547 Bacteria 1179
70 Ga0070693_100424049 3300005547 Bacteria 928
71 Ga0070693_101158774 3300005547 Bacteria 592
72 Ga0070665_100042384 3300005548 Bacteria 4575
73 Ga0070665_100120151 3300005548 Bacteria 2630
74 Ga0070665_100290442 3300005548 Bacteria 1637
75 Ga0070665_100291386 3300005548 Bacteria 1635
76 Ga0068855_100267083 3300005563 Bacteria 1904
77 Ga0070664_100218826 3300005564 Bacteria 1703
78 Ga0070664_100410291 3300005564 Bacteria 1239
79 Ga0070664_100485871 3300005564 Bacteria 1137
80 Ga0070664_100667758 3300005564 Bacteria 966
81 Ga0070664_101005729 3300005564 Bacteria 784
82 Ga0068857_100039278 3300005577 Bacteria 4192
83 Ga0068857_100560933 3300005577 Bacteria 1077
84 Ga0068854_100184745 3300005578 Bacteria 1630
85 Ga0068856_100051542 3300005614 Bacteria 4057
86 Ga0070702_100076638 3300005615 Bacteria 1990
87 Ga0070702_100166339 3300005615 Bacteria 1430
88 Ga0070702_100183340 3300005615 Bacteria 1371
89 Ga0068852_100249938 3300005616 Bacteria 1699
90 Ga0068852_100627398 3300005616 Bacteria 1081
91 Ga0068859_100032205 3300005617 Bacteria 5266
92 Ga0068859_100257908 3300005617 Bacteria 1834
93 Ga0068859_100422240 3300005617 Bacteria 1430
94 Ga0068859_101754097 3300005617 Bacteria 686
95 Ga0068864_100086949 3300005618 Bacteria 2751
96 Ga0068864_100644803 3300005618 Bacteria 1031
97 Ga0068864_100854460 3300005618 Bacteria 897
98 Ga0068866_10369475 3300005718 Bacteria 917
99 Ga0068866_10682626 3300005718 Bacteria 702
100 Ga0068861_100172731 3300005719 Bacteria 1793
101 Ga0068861_100212407 3300005719 Bacteria 1630
102 Ga0068861_100376667 3300005719 Bacteria 1253
103 Ga0068861_100588169 3300005719 Bacteria 1020
104 Ga0068851_10290397 3300005834 Bacteria 937
105 Ga0068851_10425587 3300005834 Bacteria 785
106 Ga0068870_10243976 3300005840 Bacteria 1110
107 Ga0068863_100001815 3300005841 Bacteria 21207
108 Ga0068863_100056451 3300005841 Bacteria 3717
109 Ga0068863_101576294 3300005841 Bacteria 666
110 Ga0068858_100006606 3300005842 Bacteria 11284
111 Ga0068858_100019647 3300005842 Bacteria 6316
112 Ga0068858_100091789 3300005842 Bacteria 2826
113 Ga0068858_100911476 3300005842 Bacteria 860
114 Ga0068860_100000140 3300005843 Bacteria 118729
115 Ga0068860_100081601 3300005843 Bacteria 3075
116 Ga0068862_100000034 3300005844 Bacteria 176511
117 Ga0068862_100141255 3300005844 Bacteria 2137
118 Ga0081455_10005208 3300005937 Bacteria 14306
119 Ga0081455_10008436 3300005937 Bacteria 10717
120 Ga0081455_10023824 3300005937 Bacteria 5687
121 Ga0081455_10105170 3300005937 Bacteria 2256
122 Ga0081540_1017822 3300005983 Bacteria 4381
123 Ga0081539_10003389 3300005985 Bacteria 19712
124 Ga0081539_10162290 3300005985 Bacteria 1064
125 Ga0075365_10000512 3300006038 Bacteria 14786
126 Ga0075365_10004406 3300006038 Bacteria 7454
127 Ga0075365_10311391 3300006038 Bacteria 1108
128 Ga0075365_10398331 3300006038 Bacteria 971
129 Ga0075368_10133693 3300006042 Bacteria 1031
130 Ga0075363_100031624 3300006048 Bacteria 2745
131 Ga0075363_100169960 3300006048 Bacteria 1237
132 Ga0075363_100261095 3300006048 Bacteria 999
133 Ga0075363_100523830 3300006048 Bacteria 705
134 Ga0075364_10685415 3300006051 Bacteria 699
135 Ga0070715_10287920 3300006163 Bacteria 874
136 Ga0075362_10172277 3300006177 Bacteria 1046
137 Ga0075367_10373970 3300006178 Bacteria 900
138 Ga0075367_10591898 3300006178 Bacteria 705
139 Ga0075370_10100217 3300006353 Bacteria 1676
140 Ga0068871_100643194 3300006358 Bacteria 968
141 Ga0075428_100573065 3300006844 Bacteria 1206
142 Ga0075430_100004635 3300006846 Bacteria 11566
143 Ga0075431_100025721 3300006847 Bacteria 6032
144 Ga0075431_100897479 3300006847 Bacteria 856
145 Ga0075429_100002834 3300006880 Bacteria 14675
146 Ga0068865_100009402 3300006881 Bacteria 6061
147 Ga0068865_101343163 3300006881 Bacteria 637
148 Ga0097620_100032205 3300006931 Bacteria 5266
149 Ga0097620_100257909 3300006931 Bacteria 1834
150 Ga0097620_100422226 3300006931 Bacteria 1430
151 Ga0097620_101754221 3300006931 Bacteria 686
152 Ga0105251_10271334 3300009011 Bacteria 766
153 Ga0105244_10200279 3300009036 Bacteria 942
154 Ga0111539_12197983 3300009094 Bacteria 640
155 Ga0105245_10049423 3300009098 Bacteria 3766
156 Ga0105245_10121541 3300009098 Bacteria 2440
157 Ga0105245_10286270 3300009098 Bacteria 1613
158 Ga0105245_10693758 3300009098 Bacteria 1051
159 Ga0105245_11968521 3300009098 Bacteria 638
160 Ga0105247_10000065 3300009101 Bacteria 122503
161 Ga0105247_10082542 3300009101 Bacteria 2029
162 Ga0105247_10157390 3300009101 Bacteria 1501
163 Ga0105247_10977683 3300009101 Bacteria 659
164 Ga0114129_10063703 3300009147 Bacteria 5146
165 Ga0114129_11049491 3300009147 Bacteria 1023
166 Ga0114129_11318244 3300009147 Bacteria 894
167 Ga0105243_10062246 3300009148 Bacteria 2987
168 Ga0105243_10079772 3300009148 Bacteria 2668
169 Ga0105243_10100460 3300009148 Bacteria 2400
170 Ga0105243_10635656 3300009148 Bacteria 1032
171 Ga0105243_10778341 3300009148 Bacteria 941
172 Ga0105243_11237979 3300009148 Bacteria 761
173 Ga0105243_11632457 3300009148 Bacteria 672
174 Ga0105241_10684221 3300009174 Bacteria 935
175 Ga0105241_10817677 3300009174 Bacteria 859
176 Ga0105242_12098112 3300009176 Bacteria 609
177 Ga0105248_10000067 3300009177 Bacteria 121245
178 Ga0105248_10128116 3300009177 Bacteria 2863
179 Ga0105248_10147229 3300009177 Bacteria 2657
180 Ga0105248_10777106 3300009177 Bacteria 1081
181 Ga0105237_10014123 3300009545 Bacteria 8357
182 Ga0105237_11399045 3300009545 Bacteria 706
183 Ga0105238_10539382 3300009551 Bacteria 1170
184 Ga0105238_10756027 3300009551 Bacteria 986
185 Ga0105238_10990769 3300009551 Bacteria 861
186 Ga0105249_10000051 3300009553 Bacteria 169445
187 Ga0105249_10174574 3300009553 Bacteria 2086
188 Ga0105249_10229480 3300009553 Bacteria 1830
189 Ga0105239_10017001 3300010375 Bacteria 8041
190 Ga0105239_10107810 3300010375 Bacteria 3086
191 Ga0105239_10135079 3300010375 Bacteria 2746
192 Ga0105239_11812853 3300010375 Bacteria 707
193 Ga0105246_10005334 3300011119 Bacteria 7828
194 Ga0105246_10754512 3300011119 Bacteria 859
195 Ga0105246_11279175 3300011119 Bacteria 679
196 Ga0157328_1012475 3300012478 Bacteria 617
197 Ga0157322_1024428 3300012490 Bacteria 605
198 Ga0157371_10943450 3300013102 Bacteria 656
199 Ga0157369_10437358 3300013105 Bacteria 1355
200 Ga0157369_10759209 3300013105 Bacteria 997
201 Ga0157374_10002631 3300013296 Bacteria 15135
202 Ga0157374_10739751 3300013296 Bacteria 998
203 Ga0157374_11252365 3300013296 Bacteria 763
204 Ga0157378_10605632 3300013297 Bacteria 1107
205 Ga0163162_10060396 3300013306 Bacteria 3826
206 Ga0163162_10230348 3300013306 Bacteria 1983
207 Ga0163162_10251329 3300013306 Bacteria 1900
208 Ga0163162_10415130 3300013306 Bacteria 1478
209 Ga0163162_10651708 3300013306 Bacteria 1177
210 Ga0163162_10672381 3300013306 Bacteria 1158
211 Ga0163162_12365802 3300013306 Bacteria 611
212 Ga0157372_10016137 3300013307 Bacteria 8013
213 Ga0157372_10377116 3300013307 Bacteria 1653
214 Ga0157372_10835470 3300013307 Bacteria 1069
215 Ga0157375_10043714 3300013308 Bacteria 4347
216 Ga0157375_10176786 3300013308 Bacteria 2284
217 Ga0157375_10645500 3300013308 Bacteria 1215
218 Ga0157375_11349356 3300013308 Bacteria 839
219 Ga0157375_11411888 3300013308 Bacteria 820
220 Ga0157375_13277522 3300013308 Bacteria 540
221 Ga0163163_10169117 3300014325 Bacteria 2232
222 Ga0163163_10193215 3300014325 Bacteria 2083
223 Ga0163163_10468376 3300014325 Bacteria 1321
224 Ga0163163_10633812 3300014325 Bacteria 1132
225 Ga0163163_10657011 3300014325 Bacteria 1112
226 Ga0157380_10038706 3300014326 Bacteria 3704
227 Ga0157380_11178472 3300014326 Bacteria 809
228 Ga0157380_11276242 3300014326 Bacteria 781
229 Ga0157380_12745482 3300014326 Bacteria 559
230 Ga0157380_12946312 3300014326 Bacteria 542
231 Ga0157377_10256865 3300014745 Bacteria 1135
232 Ga0157377_11119613 3300014745 Bacteria 604
233 Ga0157379_10047850 3300014968 Bacteria 3816
234 Ga0157379_10415711 3300014968 Bacteria 1238
235 Ga0157379_10616215 3300014968 Bacteria 1014
236 Ga0157379_10893363 3300014968 Bacteria 842
237 Ga0157376_10300034 3300014969 Bacteria 1520
238 Ga0157376_10701739 3300014969 Bacteria 1017
239 Ga0157376_12654233 3300014969 Bacteria 541
240 Ga0163161_10025668 3300017792 Bacteria 4172
241 Ga0163161_10523728 3300017792 Bacteria 968
242 Ga0163161_10800911 3300017792 Bacteria 792
243 Ga0197907_11437332 3300020069 Bacteria 543
244 Ga0206355_1537635 3300020076 Bacteria 995
245 Ga0206355_1666784 3300020076 Bacteria 1564
246 Ga0206352_10467026 3300020078 Bacteria 632
247 Ga0206354_10237669 3300020081 Bacteria 632
248 Ga0206354_10488921 3300020081 Bacteria 761
249 Ga0206353_10446262 3300020082 Bacteria 843
250 Ga0206353_10590081 3300020082 Bacteria 8878
251 Ga0154015_1046720 3300020610 Bacteria 1005
252 Ga0213875_10024669 3300021388 Bacteria 2867
253 Ga0224712_10173611 3300022467 Bacteria 968
254 Ga0207642_10187534 3300025899 Bacteria 1132
255 Ga0207642_10235959 3300025899 Bacteria 1030
256 Ga0207642_10292463 3300025899 Bacteria 941
257 Ga0207642_10372595 3300025899 Bacteria 848
258 Ga0207710_10000089 3300025900 Bacteria 122497
259 Ga0207688_10013848 3300025901 Bacteria 4384
260 Ga0207688_10017436 3300025901 Bacteria 3901
261 Ga0207688_10343754 3300025901 Bacteria 918
262 Ga0207647_10039445 3300025904 Bacteria 2979
263 Ga0207645_10039602 3300025907 Bacteria 3019
264 Ga0207643_10005026 3300025908 Bacteria 7085
265 Ga0207643_10055690 3300025908 Bacteria 2249
266 Ga0207705_10088468 3300025909 Bacteria 2266
267 Ga0207705_10105475 3300025909 Bacteria 2077
268 Ga0207705_10380331 3300025909 Bacteria 1090
269 Ga0207707_10133987 3300025912 Bacteria 2167
270 Ga0207707_10865211 3300025912 Bacteria 749
271 Ga0207671_10029794 3300025914 Bacteria 4074
272 Ga0207671_10684716 3300025914 Bacteria 816
273 Ga0207662_10281644 3300025918 Bacteria 1100
274 Ga0207662_10392598 3300025918 Bacteria 939
275 Ga0207657_10191883 3300025919 Bacteria 1647
276 Ga0207657_10623205 3300025919 Bacteria 841
277 Ga0207657_10878542 3300025919 Bacteria 691
278 Ga0207657_11488479 3300025919 Bacteria 506
279 Ga0207652_10006742 3300025921 Bacteria 9256
280 Ga0207681_10000955 3300025923 Bacteria 18866
281 Ga0207694_10292001 3300025924 Bacteria 1341
282 Ga0207694_11303163 3300025924 Bacteria 614
283 Ga0207650_10986911 3300025925 Bacteria 716
284 Ga0207659_10090071 3300025926 Bacteria 2289
285 Ga0207659_10517242 3300025926 Bacteria 1012
286 Ga0207687_10025363 3300025927 Bacteria 3967
287 Ga0207687_10122377 3300025927 Bacteria 1948
288 Ga0207687_11025168 3300025927 Bacteria 708
289 Ga0207644_10267918 3300025931 Bacteria 1368
290 Ga0207690_10065216 3300025932 Bacteria 2489
291 Ga0207690_10161503 3300025932 Bacteria 1670
292 Ga0207706_10196692 3300025933 Bacteria 1769
293 Ga0207706_10453659 3300025933 Bacteria 1109
294 Ga0207709_10416760 3300025935 Bacteria 1031
295 Ga0207704_10374667 3300025938 Bacteria 1116
296 Ga0207704_10684678 3300025938 Bacteria 847
297 Ga0207711_10000091 3300025941 Bacteria 96789
298 Ga0207711_10231583 3300025941 Bacteria 1692
299 Ga0207711_10410525 3300025941 Bacteria 1259
300 Ga0207689_10012353 3300025942 Bacteria 7306
301 Ga0207661_10477025 3300025944 Bacteria 1138
302 Ga0207661_10631246 3300025944 Bacteria 984
303 Ga0207661_10651542 3300025944 Bacteria 968
304 Ga0207661_11884116 3300025944 Bacteria 544
305 Ga0207679_11135132 3300025945 Bacteria 717
306 Ga0207679_11777126 3300025945 Bacteria 564
307 Ga0207667_11583965 3300025949 Bacteria 624
308 Ga0207712_10000043 3300025961 Bacteria 173580
309 Ga0207712_10058830 3300025961 Bacteria 2717
310 Ga0207668_10015963 3300025972 Bacteria 4677
311 Ga0207668_10227696 3300025972 Bacteria 1501
312 Ga0207668_10970912 3300025972 Bacteria 758
313 Ga0207640_11848502 3300025981 Bacteria 546
314 Ga0207658_10002150 3300025986 Bacteria 14650
315 Ga0207658_10086104 3300025986 Bacteria 2422
316 Ga0207658_10494224 3300025986 Bacteria 1089
317 Ga0207658_11537262 3300025986 Bacteria 609
318 Ga0207677_10524221 3300026023 Bacteria 1028
319 Ga0207677_10524946 3300026023 Bacteria 1028
320 Ga0207703_10187530 3300026035 Bacteria 1829
321 Ga0207703_10258374 3300026035 Bacteria 1573
322 Ga0207703_10496429 3300026035 Bacteria 1145
323 Ga0207703_10933190 3300026035 Bacteria 832
324 Ga0207639_11121263 3300026041 Bacteria 738
325 Ga0207639_11188568 3300026041 Bacteria 716
326 Ga0207678_10094057 3300026067 Bacteria 2560
327 Ga0207678_10586918 3300026067 Bacteria 976
328 Ga0207708_10019119 3300026075 Bacteria 5159
329 Ga0207708_10044344 3300026075 Bacteria 3389
330 Ga0207708_10054943 3300026075 Bacteria 3036
331 Ga0207708_10888195 3300026075 Bacteria 771
332 Ga0207708_11323869 3300026075 Bacteria 631
333 Ga0207702_10307793 3300026078 Bacteria 1505
334 Ga0207702_11132617 3300026078 Bacteria 776
335 Ga0207641_10064158 3300026088 Bacteria 3139
336 Ga0207641_10082249 3300026088 Bacteria 2797
337 Ga0207641_10183619 3300026088 Bacteria 1917
338 Ga0207648_10077261 3300026089 Bacteria 2902
339 Ga0207676_10562121 3300026095 Bacteria 1091
340 Ga0207676_10684026 3300026095 Bacteria 993
341 Ga0207676_11012966 3300026095 Bacteria 819
342 Ga0207676_11089325 3300026095 Bacteria 789
343 Ga0207674_10016969 3300026116 Bacteria 7950
344 Ga0207674_10202943 3300026116 Bacteria 1932
345 Ga0207674_10276026 3300026116 Bacteria 1628
346 Ga0207674_11176582 3300026116 Bacteria 736
347 Ga0207675_100092181 3300026118 Bacteria 2849
348 Ga0207675_100136680 3300026118 Bacteria 2326
349 Ga0207675_100366322 3300026118 Bacteria 1415
350 Ga0207675_100941777 3300026118 Bacteria 881
351 Ga0207683_10029382 3300026121 Bacteria 4759
352 Ga0207683_10048530 3300026121 Bacteria 3717
353 Ga0207683_10259622 3300026121 Bacteria 1586
354 Ga0207698_10605420 3300026142 Bacteria 1081
355 Ga0209813_10177766 3300027866 Bacteria 777
356 Ga0209974_10003307 3300027876 Bacteria 5821
357 Ga0268266_10014521 3300028379 Bacteria 6770
358 Ga0268266_10084735 3300028379 Bacteria 2768
359 Ga0268266_10196577 3300028379 Bacteria 1844
360 Ga0268265_10000027 3300028380 Bacteria 240507
361 Ga0268265_11019790 3300028380 Bacteria 818
362 Ga0268264_10000127 3300028381 Bacteria 185112
363 Ga0268264_10055903 3300028381 Bacteria 3299
364 Ga0268264_11537199 3300028381 Bacteria 676
365 Ga0316180_1179688 3300030736 Bacteria 625
366 Ga0307513_10650260 3300031456 Bacteria 761
367 Ga0307408_100004108 3300031548 Bacteria 9934
368 Ga0307408_100707667 3300031548 Bacteria 906
369 Ga0307408_100911274 3300031548 Bacteria 805
370 Ga0265314_10010611 3300031711 Bacteria 7665
371 Ga0307516_10361035 3300031730 Bacteria 1117
372 Ga0307405_10007098 3300031731 Bacteria 5570
373 Ga0307405_10134083 3300031731 Bacteria 1716
374 Ga0307405_10653106 3300031731 Bacteria 865
375 Ga0307413_10040543 3300031824 Bacteria 2718
376 Ga0307413_10114308 3300031824 Bacteria 1814
377 Ga0307413_10616921 3300031824 Bacteria 890
378 Ga0307413_10627508 3300031824 Bacteria 883
379 Ga0307413_10753871 3300031824 Bacteria 814
380 Ga0307413_10866558 3300031824 Bacteria 764
381 Ga0307413_10998179 3300031824 Bacteria 717
382 Ga0307410_10096546 3300031852 Bacteria 2110
383 Ga0307410_10149722 3300031852 Bacteria 1736
384 Ga0307410_10235418 3300031852 Bacteria 1416
385 Ga0307410_10382038 3300031852 Bacteria 1133
386 Ga0326468_10026058 3300031889 Bacteria 739
387 Ga0307406_10000351 3300031901 Bacteria 26871
388 Ga0307406_10134669 3300031901 Bacteria 1739
389 Ga0307407_10011368 3300031903 Bacteria 4235
390 Ga0307407_10060954 3300031903 Bacteria 2203
391 Ga0307407_10266633 3300031903 Bacteria 1180
392 Ga0307407_10313732 3300031903 Bacteria 1098
393 Ga0307407_10343687 3300031903 Bacteria 1054
394 Ga0307407_10440523 3300031903 Bacteria 943
395 Ga0307407_10727769 3300031903 Bacteria 749
396 Ga0307412_10007532 3300031911 Bacteria 6181
397 Ga0307412_10074713 3300031911 Bacteria 2323
398 Ga0307412_10113443 3300031911 Bacteria 1939
399 Ga0307412_10221032 3300031911 Bacteria 1452
400 Ga0307412_10262109 3300031911 Bacteria 1348
401 Ga0307409_100000384 3300031995 Bacteria 18744
402 Ga0307409_100006886 3300031995 Bacteria 6736
403 Ga0307409_100197467 3300031995 Bacteria 1797
404 Ga0307409_100224734 3300031995 Bacteria 1697
405 Ga0307409_100360284 3300031995 Bacteria 1375
406 Ga0307409_100360996 3300031995 Bacteria 1374
407 Ga0307409_100399290 3300031995 Bacteria 1313
408 Ga0307409_100524765 3300031995 Bacteria 1157
409 Ga0307409_101257554 3300031995 Bacteria 764
410 Ga0307409_101299681 3300031995 Bacteria 752
411 Ga0307409_101614947 3300031995 Bacteria 677
412 Ga0307416_100000202 3300032002 Bacteria 31241
413 Ga0307416_100076047 3300032002 Bacteria 2812
414 Ga0307416_100296926 3300032002 Bacteria 1603
415 Ga0307416_100406094 3300032002 Bacteria 1401
416 Ga0307416_100472994 3300032002 Bacteria 1311
417 Ga0307416_100712150 3300032002 Bacteria 1094
418 Ga0307416_103346912 3300032002 Bacteria 536
419 Ga0307414_10066607 3300032004 Bacteria 2575
420 Ga0307414_10433920 3300032004 Bacteria 1148
421 Ga0307414_10646795 3300032004 Bacteria 953
422 Ga0307414_11290917 3300032004 Bacteria 677
423 Ga0307414_11422459 3300032004 Bacteria 645
424 Ga0307411_10109275 3300032005 Bacteria 1975
425 Ga0307411_10130483 3300032005 Bacteria 1836
426 Ga0307411_10200572 3300032005 Bacteria 1532
427 Ga0307411_10387683 3300032005 Bacteria 1151
428 Ga0307415_100008086 3300032126 Bacteria 5808
429 Ga0307415_100047581 3300032126 Bacteria 2887
430 Ga0307415_100330591 3300032126 Bacteria 1275
431 Ga0307415_100798146 3300032126 Bacteria 861
432 Ga0307415_101537599 3300032126 Bacteria 637
433 Ga0307415_101697499 3300032126 Bacteria 609
434 Ga0307415_102293703 3300032126 Bacteria 529
435 Ga0316593_10297345 3300032168 Bacteria 610
436 Ga0307507_10082385 3300033179 Bacteria 2821
437 Ga0316212_1006312 3300033547 Bacteria 1719
438 Ga0373940_0024685 3300035088 Bacteria 1560
439 Ga0373951_0000111 3300035091 Bacteria 31636
440 Ga0373939_0164298 3300035114 Bacteria 817
441 Ga0373956_0004902 3300035119 Bacteria 5358
442 Ga0373942_0000618 3300035207 Bacteria 9957
443 Ga0395898_0900844 3300037466 Bacteria 823
444 Ga0395898_1909934 3300037466 Bacteria 514
445 Ga0436364_0370199 3300037853 Bacteria 6562
446 Ga0436364_0800302 3300037853 Bacteria 17536
447 Ga0400486_10057 3300038742 Bacteria 45646
448 Ga0436365_0229193 3300039437 Bacteria 608
449 Ga0436365_1721535 3300039437 Bacteria 2537
450 Ga0439461_0006261 3300041410 Bacteria 2067
451 Ga0439461_0116314 3300041410 Bacteria 665
452 Ga0439465_0007956 3300041413 Bacteria 3355
453 Ga0451787_707672 3300041441 Bacteria 849
454 Ga0451789_0786992 3300041443 Bacteria 914
455 Ga0451794_38020 3300041446 Bacteria 675
456 Ga0451793_1877998 3300041452 Bacteria 2337
457 Ga0451797_0867144 3300041453 Bacteria 1057
458 Ga0451795_0104097 3300041456 Bacteria 570
459 Ga0451833_1383050 3300041491 Bacteria 514
460 Ga0451835_1256974 3300041492 Bacteria 953
461 Ga0451841_1378285 3300041498 Bacteria 1289
462 Ga0451849_1036751 3300041505 Bacteria 607
463 Ga0451849_1244970 3300041505 Bacteria 1345
464 Ga0439431_0075201 3300041997 Bacteria 905
465 Ga0439433_0110734 3300041999 Bacteria 687
466 Ga0439448_0109178 3300042005 Unclassified 944
467 Ga0439459_0115643 3300042438 Unclassified 671
468 Ga0466969_0122213 3300044656 Bacteria 1211
469 Ga0466965_0007987 3300044683 Bacteria 4881
470 Ga0466965_0038050 3300044683 Bacteria 2363
471 Ga0466966_0018089 3300044684 Bacteria 4652
472 Ga0466966_0141483 3300044684 Bacteria 1470
473 Ga0466961_0008483 3300044693 Bacteria 6546
474 Ga0466961_0023991 3300044693 Bacteria 3924
475 Ga0466963_0023550 3300044694 Bacteria 3912
476 Ga0466963_0341526 3300044694 Bacteria 1054
477 Ga0466963_1283544 3300044694 Bacteria 514
478 Ga0466964_0009950 3300044706 Bacteria 3581
479 Ga0466964_0268515 3300044706 Bacteria 848
480 Ga0466971_0088526 3300044719 Bacteria 1416
481 Ga0466970_0001442 3300044765 Bacteria 11509
482 Ga0466957_0015711 3300044842 Bacteria 4423
483 Ga0466957_0043411 3300044842 Bacteria 2722
484 Ga0466960_0001275 3300044901 Bacteria 9124
485 Ga0466960_0108019 3300044901 Bacteria 1442
486 Ga0466960_0112553 3300044901 Bacteria 1416
487 Ga0466960_0596248 3300044901 Bacteria 655
488 Ga0466959_0081309 3300045049 Bacteria 2335
489 Ga0451576_0041977 3300045051 Bacteria 4831
490 Ga0466958_0002161 3300045836 Bacteria 9788
491 Ga0466958_0077654 3300045836 Bacteria 2039
492 Ga0466967_0002113 3300045976 Bacteria 12194
493 Ga0466967_0042860 3300045976 Bacteria 3914
494 Ga0466967_0069744 3300045976 Bacteria 3142
495 Ga0466967_0138337 3300045976 Bacteria 2266
496 Ga0466967_0167722 3300045976 Bacteria 2064
497 Ga0466967_0307707 3300045976 Bacteria 1526
498 Ga0466967_0402211 3300045976 Bacteria 1332
499 Ga0495603_0237117 3300046455 Bacteria 1051
500 Ga0495629_0212728 3300046459 Bacteria 1335
501 Ga0495651_0134004 3300046462 Bacteria 1805
502 Ga0495662_0153997 3300046476 Bacteria 1132
503 Ga0495596_0161149 3300046500 Bacteria 872
504 Ga0495596_0179583 3300046500 Bacteria 823
505 Ga0495583_0133698 3300046506 Bacteria 1036
506 Ga0495606_0007788 3300046507 Bacteria 9479
507 Ga0495608_0449067 3300046511 Bacteria 785
508 Ga0495620_0174958 3300046515 Bacteria 831
509 Ga0495632_0015091 3300046519 Bacteria 4343
510 Ga0495637_0098686 3300046520 Bacteria 1144
511 Ga0495648_0013828 3300046524 Bacteria 5945
512 Ga0495663_0045274 3300046525 Bacteria 1349
513 Ga0495652_0391189 3300046529 Bacteria 987
514 Ga0495640_0237143 3300046533 Bacteria 1146
515 Ga0495667_0250256 3300046559 Bacteria 1128
516 Ga0495656_0018756 3300046615 Bacteria 2663
517 Ga0495656_0415778 3300046615 Bacteria 705
518 Ga0495668_0029298 3300046616 Bacteria 3111
519 Ga0495668_0229007 3300046616 Bacteria 1018
520 Ga0495611_0111418 3300046648 Bacteria 1274
521 Ga0495635_0029079 3300046663 Bacteria 3842
522 Ga0495661_0252072 3300046665 Bacteria 901
523 Ga0495588_0598872 3300046674 Bacteria 577
524 Ga0495670_0081207 3300046691 Bacteria 1652
525 Ga0495670_0692177 3300046691 Bacteria 556
526 Ga0495671_0101447 3300046692 Bacteria 1407
527 Ga0495600_0157895 3300046809 Bacteria 1467
528 Ga0495600_0463744 3300046809 Bacteria 782
529 Ga0495674_0734035 3300047319 Bacteria 773
530 Ga0495672_0002575 3300047320 Bacteria 16485
531 Ga0495672_0034233 3300047320 Bacteria 3141
532 Ga0495680_0121473 3300047322 Bacteria 1928
533 Ga0495680_0219498 3300047322 Bacteria 1358
534 Ga0495673_0000444 3300047469 Bacteria 45563
535 Ga0495686_0267361 3300047472 Bacteria 955
536 Ga0496100_0328605 3300048903 Bacteria 1150
537 Ga0496100_0434550 3300048903 Bacteria 1004
538 Ga0496100_0548776 3300048903 Bacteria 894
539 Ga0496100_0775642 3300048903 Bacteria 750
540 Ga0496101_0000026 3300048904 Bacteria 199963
541 Ga0496101_0057138 3300048904 Bacteria 2822
542 Ga0496102_0000031 3300048905 Bacteria 217389
543 Ga0496102_0001061 3300048905 Bacteria 25475
544 Ga0496102_0008531 3300048905 Bacteria 8787
545 Ga0496102_0010274 3300048905 Bacteria 8048
546 Ga0496102_0413858 3300048905 Bacteria 1266
547 Ga0496102_1188322 3300048905 Bacteria 682
548 Ga0496102_1677600 3300048905 Bacteria 553
549 Ga0496103_0000025 3300048906 Bacteria 221144
550 Ga0496103_0000521 3300048906 Bacteria 31557
551 Ga0496103_0639552 3300048906 Bacteria 676
552 Ga0496104_0001896 3300048907 Bacteria 18117
553 Ga0496104_0081732 3300048907 Bacteria 3081
554 Ga0496104_0217587 3300048907 Bacteria 1822
555 Ga0496104_0470074 3300048907 Bacteria 1169
556 Ga0496104_0718243 3300048907 Bacteria 907
557 Ga0496105_0002045 3300048908 Bacteria 14588
558 Ga0496105_0077224 3300048908 Bacteria 2750
559 Ga0496105_0493623 3300048908 Bacteria 962
560 Ga0496106_0020434 3300048909 Bacteria 4914
561 Ga0496106_0410220 3300048909 Bacteria 1089
562 Ga0496106_0784192 3300048909 Bacteria 756
563 Ga0496106_1074722 3300048909 Bacteria 631
564 Ga0496107_0020405 3300048910 Bacteria 4680
565 Ga0496107_0095336 3300048910 Bacteria 2177
566 Ga0496107_0105175 3300048910 Bacteria 2072
567 Ga0496107_0584415 3300048910 Bacteria 826
568 Ga0496107_0590546 3300048910 Bacteria 821
569 Ga0496107_0777917 3300048910 Bacteria 701
570 Ga0496108_0018135 3300048911 Bacteria 5759
571 Ga0496108_0077705 3300048911 Bacteria 2808
572 Ga0496108_0244927 3300048911 Bacteria 1559
573 Ga0496108_0505388 3300048911 Bacteria 1055
574 Ga0496108_0531196 3300048911 Bacteria 1027
575 Ga0496109_0035352 3300048912 Bacteria 4506
576 Ga0496109_0057643 3300048912 Bacteria 3546
577 Ga0496109_0179239 3300048912 Bacteria 1989
578 Ga0496109_0191225 3300048912 Bacteria 1923
579 Ga0496109_0336942 3300048912 Bacteria 1424
580 Ga0496109_0437796 3300048912 Bacteria 1235
581 Ga0496109_0635552 3300048912 Bacteria 1004
582 Ga0496109_0929944 3300048912 Bacteria 807
583 Ga0496109_1111628 3300048912 Bacteria 727
584 Ga0496109_1375430 3300048912 Bacteria 641
585 Ga0496109_1494225 3300048912 Bacteria 610
586 Ga0496110_0041681 3300048913 Bacteria 4006
587 Ga0496110_0088233 3300048913 Bacteria 2770
588 Ga0496110_0299734 3300048913 Bacteria 1464
589 Ga0496110_0408581 3300048913 Bacteria 1238
590 Ga0496110_0567035 3300048913 Bacteria 1031
591 Ga0496110_0740835 3300048913 Bacteria 885
592 Ga0496111_0002344 3300048914 Bacteria 11413
593 Ga0496111_0152242 3300048914 Bacteria 1716
594 Ga0496111_0476066 3300048914 Bacteria 920
595 Ga0496111_1129723 3300048914 Bacteria 557
596 Ga0496111_1130455 3300048914 Bacteria 557
597 Ga0496112_0076570 3300048915 Bacteria 3308
598 Ga0496112_0102024 3300048915 Bacteria 2839
599 Ga0496112_1922357 3300048915 Bacteria 503
600 Ga0496113_0027694 3300048916 Bacteria 4066
601 Ga0496113_0373317 3300048916 Bacteria 1145
602 Ga0496113_0784230 3300048916 Bacteria 758
603 Ga0496113_0965282 3300048916 Bacteria 672
604 Ga0496113_1548954 3300048916 Bacteria 511
605 Ga0496114_0019400 3300048917 Bacteria 5509
606 Ga0496114_0049962 3300048917 Bacteria 3480
607 Ga0496114_0549306 3300048917 Bacteria 1020
608 Ga0496114_1124850 3300048917 Bacteria 670
609 Ga0496115_0102404 3300048918 Bacteria 2348
610 Ga0496116_0000084 3300048919 Bacteria 219579
611 Ga0496116_0012299 3300048919 Bacteria 6997
612 Ga0496117_0000018 3300048920 Bacteria 479613
613 Ga0496117_0003175 3300048920 Bacteria 19539
614 Ga0496118_0000013 3300048921 Bacteria 574008
615 Ga0496118_0001120 3300048921 Bacteria 41519
616 Ga0496119_0001033 3300048922 Bacteria 35640
617 Ga0496119_0009526 3300048922 Bacteria 8318
618 Ga0496119_0096382 3300048922 Bacteria 1669
619 Ga0496120_0000418 3300048923 Bacteria 67915
620 Ga0496120_0006102 3300048923 Bacteria 9347
621 Ga0496121_0000056 3300048924 Bacteria 296250
622 Ga0496121_0008270 3300048924 Bacteria 12309
623 Ga0496124_0067027 3300048927 Bacteria 2987
624 Ga0496125_0009200 3300048928 Bacteria 10206
625 Ga0496126_0002664 3300048929 Bacteria 23643
626 Ga0501306_008094 3300049127 Bacteria 1275
627 Ga0501306_013711 3300049127 Bacteria 1061
628 Ga0501306_026237 3300049127 Bacteria 843
629 Ga0501306_035627 3300049127 Bacteria 756
630 Ga0501306_100055 3300049127 Bacteria 518
631 Ga0501308_023215 3300049128 Bacteria 790
632 Ga0501308_078777 3300049128 Bacteria 522
633 Ga0501309_009803 3300049129 Bacteria 1227
634 Ga0501309_036569 3300049129 Bacteria 740
635 Ga0501309_059324 3300049129 Bacteria 613
636 Ga0501309_098013 3300049129 Bacteria 506
637 Ga0501310_000128 3300049130 Bacteria 7517
638 Ga0501310_012829 3300049130 Bacteria 965
639 Ga0501310_017530 3300049130 Bacteria 867
640 Ga0501310_022786 3300049130 Bacteria 792
641 Ga0501310_025747 3300049130 Bacteria 759
642 Ga0501310_035918 3300049130 Bacteria 674
643 Ga0501310_042492 3300049130 Bacteria 637
644 Ga0501310_044254 3300049130 Bacteria 628
645 Ga0501310_053390 3300049130 Bacteria 589
646 Ga0501341_07290 3300049131 Bacteria 691
647 Ga0501304_008579 3300049160 Bacteria 863
648 Ga0501304_015143 3300049160 Bacteria 720
649 Ga0501305_003880 3300049161 Bacteria 1724
650 Ga0501305_039832 3300049161 Bacteria 761
651 Ga0501305_055843 3300049161 Bacteria 671
652 Ga0501305_064617 3300049161 Bacteria 635
653 Ga0501305_108569 3300049161 Bacteria 523
654 Ga0501307_004015 3300049162 Bacteria 1478
655 Ga0501307_030126 3300049162 Bacteria 749
656 Ga0501307_055754 3300049162 Bacteria 603
657 Ga0501291_024418 3300049514 Bacteria 983
658 Ga0501311_005386 3300049527 Bacteria 1401
659 Ga0501311_091285 3300049527 Bacteria 529
660 Ga0501312_037887 3300049528 Bacteria 779
661 Ga0501312_084136 3300049528 Bacteria 579
662 Ga0501312_088491 3300049528 Bacteria 569
663 Ga0501312_098031 3300049528 Bacteria 547
664 Ga0501312_120633 3300049528 Bacteria 507
665 Ga0501313_068268 3300049529 Bacteria 512
666 Ga0501314_021685 3300049530 Bacteria 671
667 Ga0501315_013456 3300049531 Bacteria 1024
668 Ga0501315_016671 3300049531 Bacteria 953
669 Ga0501315_044349 3300049531 Bacteria 682
670 Ga0501316_024524 3300049532 Bacteria 780
671 Ga0501316_047792 3300049532 Bacteria 610
672 Ga0501316_066454 3300049532 Bacteria 540
673 Ga0501317_005721 3300049533 Bacteria 1343
674 Ga0501317_015307 3300049533 Bacteria 982
675 Ga0501317_017476 3300049533 Bacteria 941
676 Ga0501317_034541 3300049533 Bacteria 749
677 Ga0501317_039754 3300049533 Bacteria 714
678 Ga0501317_047493 3300049533 Bacteria 673
679 Ga0501317_068984 3300049533 Bacteria 593
680 Ga0501317_078681 3300049533 Bacteria 567
681 Ga0501318_006622 3300049534 Bacteria 1188
682 Ga0501318_007610 3300049534 Bacteria 1137
683 Ga0501318_015169 3300049534 Bacteria 917
684 Ga0501318_063571 3300049534 Bacteria 571
685 Ga0501320_013294 3300049536 Bacteria 877
686 Ga0501321_002857 3300049537 Bacteria 1537
687 Ga0501321_006525 3300049537 Bacteria 1189
688 Ga0501321_011649 3300049537 Bacteria 984
689 Ga0501321_026875 3300049537 Bacteria 749
690 Ga0501321_032037 3300049537 Bacteria 707
691 Ga0501321_074251 3300049537 Bacteria 534
692 Ga0501321_079861 3300049537 Bacteria 520
693 Ga0501322_002466 3300049538 Bacteria 1137
694 Ga0501323_005780 3300049539 Bacteria 1366
695 Ga0501323_012824 3300049539 Bacteria 1028
696 Ga0501323_071541 3300049539 Bacteria 555
697 Ga0501325_001770 3300049541 Bacteria 1386
698 Ga0501325_038963 3300049541 Bacteria 572
699 Ga0501330_006144 3300049546 Bacteria 780
700 Ga0501331_00744 3300049547 Bacteria 1430
701 Ga0501332_12510 3300049548 Bacteria 584
702 Ga0501336_005035 3300049552 Bacteria 945
703 Ga0501340_005401 3300049556 Bacteria 832
704 Ga0501031_0012399 3300049568 Bacteria 5558
705 Ga0501031_0319283 3300049568 Bacteria 1006
706 Ga0501032_0022265 3300049569 Bacteria 4394
707 Ga0501032_0148063 3300049569 Bacteria 1545
708 Ga0501033_0109174 3300049570 Bacteria 2015
709 Ga0501033_0649696 3300049570 Bacteria 721
710 Ga0501034_0060431 3300049571 Bacteria 3806
711 Ga0501034_0157108 3300049571 Bacteria 2247
712 Ga0501034_0600641 3300049571 Bacteria 1006
713 Ga0501036_0003887 3300049572 Bacteria 11989
714 Ga0501036_0075150 3300049572 Bacteria 2858
715 Ga0501036_0126363 3300049572 Bacteria 2159
716 Ga0501036_0578496 3300049572 Bacteria 932
717 Ga0501037_0001404 3300049573 Bacteria 17665
718 Ga0501037_0011156 3300049573 Bacteria 6613
719 Ga0501037_0281657 3300049573 Bacteria 1158
720 Ga0501038_0000759 3300049574 Bacteria 28718
721 Ga0501038_0034435 3300049574 Bacteria 4453
722 Ga0501038_0471536 3300049574 Bacteria 963
723 Ga0501039_0023422 3300049575 Bacteria 4739
724 Ga0501039_0080671 3300049575 Bacteria 2532
725 Ga0501039_0780899 3300049575 Bacteria 745
726 Ga0501040_0007280 3300049576 Bacteria 7171
727 Ga0501040_0511777 3300049576 Bacteria 865
728 Ga0501040_0537189 3300049576 Bacteria 843
729 Ga0501040_0582582 3300049576 Bacteria 808
730 Ga0501041_0002242 3300049577 Bacteria 10927
731 Ga0501041_0130299 3300049577 Bacteria 1567
732 Ga0501042_0010005 3300049578 Bacteria 6342
733 Ga0501042_0050735 3300049578 Bacteria 2959
734 Ga0501042_0295372 3300049578 Bacteria 1170
735 Ga0501042_0680117 3300049578 Bacteria 748
736 Ga0501043_0000624 3300049579 Bacteria 31242
737 Ga0501043_0043377 3300049579 Bacteria 3535
738 Ga0501043_0596299 3300049579 Bacteria 817
739 Ga0501046_0043263 3300049580 Bacteria 3586
740 Ga0501046_0488780 3300049580 Bacteria 882
741 Ga0501047_0008218 3300049581 Bacteria 9850
742 Ga0501048_0002565 3300049582 Bacteria 13916
743 Ga0501048_0016909 3300049582 Bacteria 5376
744 Ga0501048_0085034 3300049582 Bacteria 2231
745 Ga0501048_0407001 3300049582 Bacteria 973
746 Ga0501048_0507037 3300049582 Bacteria 865
747 Ga0501067_0254514 3300049583 Bacteria 977
748 Ga0501068_0159499 3300049584 Bacteria 1421
749 Ga0501068_0455787 3300049584 Bacteria 827
750 Ga0501068_0638804 3300049584 Bacteria 694
751 Ga0501069_0021713 3300049585 Bacteria 3487
752 Ga0501069_0064505 3300049585 Bacteria 2047
753 Ga0501069_0110210 3300049585 Bacteria 1567
754 Ga0501069_0559815 3300049585 Bacteria 684
755 Ga0501070_0000743 3300049586 Bacteria 29764
756 Ga0501070_0141145 3300049586 Bacteria 1989
757 Ga0501070_0505636 3300049586 Bacteria 970
758 Ga0501070_0635443 3300049586 Bacteria 848
759 Ga0501071_0003883 3300049587 Bacteria 9414
760 Ga0501071_0764603 3300049587 Bacteria 744
761 Ga0501071_1005336 3300049587 Bacteria 644
762 Ga0501071_1143468 3300049587 Bacteria 601
763 Ga0501072_0001887 3300049588 Bacteria 15611
764 Ga0501072_0091792 3300049588 Bacteria 2411
765 Ga0501072_0349927 3300049588 Bacteria 1173
766 Ga0501073_0019467 3300049589 Bacteria 4900
767 Ga0501073_0055586 3300049589 Bacteria 2769
768 Ga0501073_0138290 3300049589 Bacteria 1688
769 Ga0501073_0138625 3300049589 Bacteria 1685
770 Ga0501073_0549000 3300049589 Bacteria 798
771 Ga0501074_0001922 3300049590 Bacteria 14276
772 Ga0501074_0005993 3300049590 Bacteria 8770
773 Ga0501074_0030459 3300049590 Bacteria 3910
774 Ga0501074_0551991 3300049590 Bacteria 815
775 Ga0501075_0217304 3300049591 Bacteria 1458
776 Ga0501076_0004239 3300049592 Bacteria 10147
777 Ga0501076_0268866 3300049592 Bacteria 1396
778 Ga0501076_0303671 3300049592 Bacteria 1309
779 Ga0501077_0082549 3300049593 Bacteria 2036
780 Ga0501077_0197062 3300049593 Bacteria 1279
781 Ga0501214_020069 3300049659 Bacteria 841
782 Ga0501243_137586 3300049675 Bacteria 514
783 Ga0501253_058829 3300049683 Bacteria 823
784 Ga0501079_0003642 3300049741 Bacteria 11347
785 Ga0501079_0271966 3300049741 Bacteria 1324
786 Ga0501079_0317096 3300049741 Bacteria 1220
787 Ga0501079_0432705 3300049741 Bacteria 1033
788 Ga0501079_0450305 3300049741 Bacteria 1011
789 Ga0501080_0039146 3300049742 Bacteria 4425
790 Ga0501080_0326470 3300049742 Bacteria 1388
791 Ga0501080_0739870 3300049742 Bacteria 865
792 Ga0501080_0791760 3300049742 Bacteria 832
793 Ga0501081_0069864 3300049743 Bacteria 2447
794 Ga0501083_0035666 3300049744 Bacteria 3396
795 Ga0501035_0015863 3300049822 Bacteria 6951
796 Ga0501044_0101358 3300049823 Bacteria 2896
797 Ga0501044_0331718 3300049823 Bacteria 1444
798 Ga0501044_0437965 3300049823 Bacteria 1215
799 Ga0501044_0848771 3300049823 Bacteria 790
800 Ga0501044_0862690 3300049823 Bacteria 782
801 Ga0501044_0870958 3300049823 Bacteria 777
802 Ga0501045_0006408 3300049824 Bacteria 8150
803 Ga0501045_0340365 3300049824 Bacteria 1116
804 nmdc:mga03683_151531_c1 3300050489 Bacteria 1046
805 nmdc:mga03n38_37536_c1 3300050490 Bacteria 2090
806 nmdc:mga03n38_697536_c1 3300050490 Bacteria 585
807 nmdc:mga00v17_114942_c1 3300050491 Bacteria 1710
808 nmdc:mga0yw44_122880_c1 3300050492 Bacteria 1674
809 nmdc:mga0yw44_19236_c1 3300050492 Bacteria 3761
810 nmdc:mga0yw44_29668_c1 3300050492 Bacteria 3160
811 nmdc:mga0yw44_319468_c1 3300050492 Bacteria 1042
812 nmdc:mga0yw44_5193_c1 3300050492 Bacteria 6105
813 nmdc:mga0yw44_6588_c1 3300050492 Bacteria 5624
814 nmdc:mga06z11_404907_c1 3300050494 Bacteria 821
815 nmdc:mga04h51_126501_c1 3300050495 Bacteria 957
816 nmdc:mga07m45_103753_c1 3300050496 Bacteria 1634
817 nmdc:mga09592_107261_c1 3300050508 Bacteria 2396
818 nmdc:mga0qj67_56091_c1 3300050509 Bacteria 3123
819 Ga0500635_0007481 3300053080 Bacteria 2961
820 Ga0495655_0231897 3300053083 Bacteria 615
821 Ga0495619_0051747 3300053085 Bacteria 2715
822 Ga0500643_012033 3300053087 Bacteria 3118
823 Ga0500591_160439 3300053115 Bacteria 851
824 Ga0500652_001762 3300053131 Bacteria 6564
825 Ga0500573_0015258 3300053140 Bacteria 4352
826 Ga0500616_0009295 3300053153 Bacteria 5988
827 Ga0500620_027847 3300053155 Bacteria 1762
828 Ga0500624_022288 3300053157 Bacteria 1029
829 Ga0500637_0012957 3300053178 Bacteria 4356
830 Ga0501084_0014898 3300054114 Bacteria 6447
831 Ga0501084_0054959 3300054114 Bacteria 3331
832 Ga0501084_0221023 3300054114 Bacteria 1598
833 Ga0587083_0075499 3300059505 Bacteria 792
834 Ga0587083_0165833 3300059505 Bacteria 608
835 Ga0587090_083790 3300059510 Bacteria 643
836 Ga0587098_024866 3300059604 Bacteria 787
837 Ga0587128_032896 3300059630 Bacteria 869
838 Ga0587068_029138 3300059641 Bacteria 948
839 Ga0587068_069272 3300059641 Bacteria 693
840 Ga0587107_085251 3300059652 Bacteria 601
841 Ga0501082_0024137 3300060353 Bacteria 5245
842 Ga0501082_0116180 3300060353 Bacteria 2317
843 Ga0501082_0165797 3300060353 Bacteria 1920
844 Ga0466962_0027951 3300061719 Bacteria 2703
845 Ga0530510_0002923 3300061734 Bacteria 11719
846 Ga0530510_0089022 3300061734 Bacteria 2251
847 2643827093 2643221561 Bacteria 4984412
848 2644035102 2643221604 Bacteria 5014917
849 2644231726 2643221641 Bacteria 4490190
850 2644534446 2643221696 Bacteria 5431823
851 2738868853 2738541305 Bacteria 4910150
852 2739365734 2738543034 Bacteria 6084756
853 2740165457 2739367898 Bacteria 4367674
854 2812372654 2811994882 Bacteria 4688362
855 2819689853 2818991462 Bacteria 4320267
856 2819726591 2818991469 Bacteria 4644110
857 2832008891 2832004796 Bacteria 6538017
858 2842892623 2842888712 Bacteria 4279094
859 2855388535 2855386786 Bacteria 4752232
860 2857486171 2857481737 Bacteria 4761446
861 2866071152 2866065130 Bacteria 6518152
862 2902792439 2902792274 Bacteria 7270173
863 2974319879 2974315732 Bacteria 4602776
864 2984523751 2984523437 Bacteria 4508481
865 8054611848 8054609563 Bacteria 5170090
866 Ga0501325_008401
867 LJQas_1000912
868 JGI24743J22301_10035349
869 JGI24745J21846_1007099
870 JGI24744J21845_10006602
871 Ga0070658_10006341
872 Ga0070658_10349433
873 Ga0070683_100259945
874 Ga0070683_101418262
875 Ga0070670_100604449
876 Ga0070677_10228512
877 Ga0068869_100730256
878 Ga0070680_100796129
879 Ga0070682_100010325
880 Ga0070682_100275321
881 Ga0070682_100527915
882 Ga0070682_101136941
883 Ga0068868_100262936
884 Ga0068868_100932878
885 Ga0068868_101140954
886 Ga0068868_102011563
887 Ga0070660_100229451
888 Ga0070660_100746656
889 Ga0070687_100144599
890 Ga0070687_100299576
891 Ga0070661_100651925
892 Ga0070692_10114198
893 Ga0070668_100010096
894 Ga0070668_100396819
895 Ga0070668_100443761
896 Ga0070669_100003361
897 Ga0070675_100067313
898 Ga0070675_100212056
899 Ga0070671_100546502
900 Ga0070671_100657433
901 Ga0070671_101585745
902 Ga0070688_100241294
903 Ga0070688_100346447
904 Ga0070659_100056198
905 Ga0070659_101281547
906 Ga0070667_100000432
907 Ga0070667_100159320
908 Ga0070701_10169722
909 Ga0070700_100022907
910 Ga0070700_100625453
911 Ga0070700_101513458
912 Ga0070694_100313099
913 Ga0070663_100286379
914 Ga0070663_100810117
915 Ga0070681_10363518
916 Ga0070681_10939920
917 Ga0068867_100168502
918 Ga0070685_10021075
919 Ga0070685_10824124
920 Ga0070679_100059219
921 Ga0070679_100694056
922 Ga0070684_100003524
923 Ga0070684_100217339
924 Ga0070684_100609313
925 Ga0070684_101153488
926 Ga0070684_101235475
927 Ga0068853_100567994
928 Ga0068853_100681803
929 Ga0068853_101010953
930 Ga0070672_100286558
931 Ga0070672_101263041
932 Ga0070686_100278892
933 Ga0070686_100471728
934 Ga0070693_100248248
935 Ga0070693_100424049
936 Ga0070693_101158774
937 Ga0070665_100042384
938 Ga0070665_100120151
939 Ga0070665_100290442
940 Ga0070665_100291386
941 Ga0068855_100267083
942 Ga0070664_100218826
943 Ga0070664_100410291
944 Ga0070664_100485871
945 Ga0070664_100667758
946 Ga0070664_101005729
947 Ga0068857_100039278
948 Ga0068857_100560933
949 Ga0068854_100184745
950 Ga0068856_100051542
951 Ga0070702_100076638
952 Ga0070702_100166339
953 Ga0070702_100183340
954 Ga0068852_100249938
955 Ga0068852_100627398
956 Ga0068859_100032205
957 Ga0068859_100257908
958 Ga0068859_100422240
959 Ga0068859_101754097
960 Ga0068864_100086949
961 Ga0068864_100644803
962 Ga0068864_100854460
963 Ga0068866_10369475
964 Ga0068866_10682626
965 Ga0068861_100172731
966 Ga0068861_100212407
967 Ga0068861_100376667
968 Ga0068861_100588169
969 Ga0068851_10290397
970 Ga0068851_10425587
971 Ga0068870_10243976
972 Ga0068863_100001815
973 Ga0068863_100056451
974 Ga0068863_101576294
975 Ga0068858_100006606
976 Ga0068858_100019647
977 Ga0068858_100091789
978 Ga0068858_100911476
979 Ga0068860_100000140
980 Ga0068860_100081601
981 Ga0068862_100000034
982 Ga0068862_100141255
983 Ga0081455_10005208
984 Ga0081455_10008436
985 Ga0081455_10023824
986 Ga0081455_10105170
987 Ga0081540_1017822
988 Ga0081539_10003389
989 Ga0081539_10162290
990 Ga0075365_10000512
991 Ga0075365_10004406
992 Ga0075365_10311391
993 Ga0075365_10398331
994 Ga0075368_10133693
995 Ga0075363_100031624
996 Ga0075363_100169960
997 Ga0075363_100261095
998 Ga0075363_100523830
999 Ga0075364_10685415
1000 Ga0070715_10287920
1001 Ga0075362_10172277
1002 Ga0075367_10373970
1003 Ga0075367_10591898
1004 Ga0075370_10100217
1005 Ga0068871_100643194
1006 Ga0075428_100573065
1007 Ga0075430_100004635
1008 Ga0075431_100025721
1009 Ga0075431_100897479
1010 Ga0075429_100002834
1011 Ga0068865_100009402
1012 Ga0068865_101343163
1013 Ga0097620_100032205
1014 Ga0097620_100257909
1015 Ga0097620_100422226
1016 Ga0097620_101754221
1017 Ga0105251_10271334
1018 Ga0105244_10200279
1019 Ga0111539_12197983
1020 Ga0105245_10049423
1021 Ga0105245_10121541
1022 Ga0105245_10286270
1023 Ga0105245_10693758
1024 Ga0105245_11968521
1025 Ga0105247_10000065
1026 Ga0105247_10082542
1027 Ga0105247_10157390
1028 Ga0105247_10977683
1029 Ga0114129_10063703
1030 Ga0114129_11049491
1031 Ga0114129_11318244
1032 Ga0105243_10062246
1033 Ga0105243_10079772
1034 Ga0105243_10100460
1035 Ga0105243_10635656
1036 Ga0105243_10778341
1037 Ga0105243_11237979
1038 Ga0105243_11632457
1039 Ga0105241_10684221
1040 Ga0105241_10817677
1041 Ga0105242_12098112
1042 Ga0105248_10000067
1043 Ga0105248_10128116
1044 Ga0105248_10147229
1045 Ga0105248_10777106
1046 Ga0105237_10014123
1047 Ga0105237_11399045
1048 Ga0105238_10539382
1049 Ga0105238_10756027
1050 Ga0105238_10990769
1051 Ga0105249_10000051
1052 Ga0105249_10174574
1053 Ga0105249_10229480
1054 Ga0105239_10017001
1055 Ga0105239_10107810
1056 Ga0105239_10135079
1057 Ga0105239_11812853
1058 Ga0105246_10005334
1059 Ga0105246_10754512
1060 Ga0105246_11279175
1061 Ga0157328_1012475
1062 Ga0157322_1024428
1063 Ga0157371_10943450
1064 Ga0157369_10437358
1065 Ga0157369_10759209
1066 Ga0157374_10002631
1067 Ga0157374_10739751
1068 Ga0157374_11252365
1069 Ga0157378_10605632
1070 Ga0163162_10060396
1071 Ga0163162_10230348
1072 Ga0163162_10251329
1073 Ga0163162_10415130
1074 Ga0163162_10651708
1075 Ga0163162_10672381
1076 Ga0163162_12365802
1077 Ga0157372_10016137
1078 Ga0157372_10377116
1079 Ga0157372_10835470
1080 Ga0157375_10043714
1081 Ga0157375_10176786
1082 Ga0157375_10645500
1083 Ga0157375_11349356
1084 Ga0157375_11411888
1085 Ga0157375_13277522
1086 Ga0163163_10169117
1087 Ga0163163_10193215
1088 Ga0163163_10468376
1089 Ga0163163_10633812
1090 Ga0163163_10657011
1091 Ga0157380_10038706
1092 Ga0157380_11178472
1093 Ga0157380_11276242
1094 Ga0157380_12745482
1095 Ga0157380_12946312
1096 Ga0157377_10256865
1097 Ga0157377_11119613
1098 Ga0157379_10047850
1099 Ga0157379_10415711
1100 Ga0157379_10616215
1101 Ga0157379_10893363
1102 Ga0157376_10300034
1103 Ga0157376_10701739
1104 Ga0157376_12654233
1105 Ga0163161_10025668
1106 Ga0163161_10523728
1107 Ga0163161_10800911
1108 Ga0197907_11437332
1109 Ga0206355_1537635
1110 Ga0206355_1666784
1111 Ga0206352_10467026
1112 Ga0206354_10237669
1113 Ga0206354_10488921
1114 Ga0206353_10446262
1115 Ga0206353_10590081
1116 Ga0154015_1046720
1117 Ga0213875_10024669
1118 Ga0224712_10173611
1119 Ga0207642_10187534
1120 Ga0207642_10235959
1121 Ga0207642_10292463
1122 Ga0207642_10372595
1123 Ga0207710_10000089
1124 Ga0207688_10013848
1125 Ga0207688_10017436
1126 Ga0207688_10343754
1127 Ga0207647_10039445
1128 Ga0207645_10039602
1129 Ga0207643_10005026
1130 Ga0207643_10055690
1131 Ga0207705_10088468
1132 Ga0207705_10105475
1133 Ga0207705_10380331
1134 Ga0207707_10133987
1135 Ga0207707_10865211
1136 Ga0207671_10029794
1137 Ga0207671_10684716
1138 Ga0207662_10281644
1139 Ga0207662_10392598
1140 Ga0207657_10191883
1141 Ga0207657_10623205
1142 Ga0207657_10878542
1143 Ga0207657_11488479
1144 Ga0207652_10006742
1145 Ga0207681_10000955
1146 Ga0207694_10292001
1147 Ga0207694_11303163
1148 Ga0207650_10986911
1149 Ga0207659_10090071
1150 Ga0207659_10517242
1151 Ga0207687_10025363
1152 Ga0207687_10122377
1153 Ga0207687_11025168
1154 Ga0207644_10267918
1155 Ga0207690_10065216
1156 Ga0207690_10161503
1157 Ga0207706_10196692
1158 Ga0207706_10453659
1159 Ga0207709_10416760
1160 Ga0207704_10374667
1161 Ga0207704_10684678
1162 Ga0207711_10000091
1163 Ga0207711_10231583
1164 Ga0207711_10410525
1165 Ga0207689_10012353
1166 Ga0207661_10477025
1167 Ga0207661_10631246
1168 Ga0207661_10651542
1169 Ga0207661_11884116
1170 Ga0207679_11135132
1171 Ga0207679_11777126
1172 Ga0207667_11583965
1173 Ga0207712_10000043
1174 Ga0207712_10058830
1175 Ga0207668_10015963
1176 Ga0207668_10227696
1177 Ga0207668_10970912
1178 Ga0207640_11848502
1179 Ga0207658_10002150
1180 Ga0207658_10086104
1181 Ga0207658_10494224
1182 Ga0207658_11537262
1183 Ga0207677_10524221
1184 Ga0207677_10524946
1185 Ga0207703_10187530
1186 Ga0207703_10258374
1187 Ga0207703_10496429
1188 Ga0207703_10933190
1189 Ga0207639_11121263
1190 Ga0207639_11188568
1191 Ga0207678_10094057
1192 Ga0207678_10586918
1193 Ga0207708_10019119
1194 Ga0207708_10044344
1195 Ga0207708_10054943
1196 Ga0207708_10888195
1197 Ga0207708_11323869
1198 Ga0207702_10307793
1199 Ga0207702_11132617
1200 Ga0207641_10064158
1201 Ga0207641_10082249
1202 Ga0207641_10183619
1203 Ga0207648_10077261
1204 Ga0207676_10562121
1205 Ga0207676_10684026
1206 Ga0207676_11012966
1207 Ga0207676_11089325
1208 Ga0207674_10016969
1209 Ga0207674_10202943
1210 Ga0207674_10276026
1211 Ga0207674_11176582
1212 Ga0207675_100092181
1213 Ga0207675_100136680
1214 Ga0207675_100366322
1215 Ga0207675_100941777
1216 Ga0207683_10029382
1217 Ga0207683_10048530
1218 Ga0207683_10259622
1219 Ga0207698_10605420
1220 Ga0209813_10177766
1221 Ga0209974_10003307
1222 Ga0268266_10014521
1223 Ga0268266_10084735
1224 Ga0268266_10196577
1225 Ga0268265_10000027
1226 Ga0268265_11019790
1227 Ga0268264_10000127
1228 Ga0268264_10055903
1229 Ga0268264_11537199
1230 Ga0316180_1179688
1231 Ga0307513_10650260
1232 Ga0307408_100004108
1233 Ga0307408_100707667
1234 Ga0307408_100911274
1235 Ga0265314_10010611
1236 Ga0307516_10361035
1237 Ga0307405_10007098
1238 Ga0307405_10134083
1239 Ga0307405_10653106
1240 Ga0307413_10040543
1241 Ga0307413_10114308
1242 Ga0307413_10616921
1243 Ga0307413_10627508
1244 Ga0307413_10753871
1245 Ga0307413_10866558
1246 Ga0307413_10998179
1247 Ga0307410_10096546
1248 Ga0307410_10149722
1249 Ga0307410_10235418
1250 Ga0307410_10382038
1251 Ga0326468_10026058
1252 Ga0307406_10000351
1253 Ga0307406_10134669
1254 Ga0307407_10011368
1255 Ga0307407_10060954
1256 Ga0307407_10266633
1257 Ga0307407_10313732
1258 Ga0307407_10343687
1259 Ga0307407_10440523
1260 Ga0307407_10727769
1261 Ga0307412_10007532
1262 Ga0307412_10074713
1263 Ga0307412_10113443
1264 Ga0307412_10221032
1265 Ga0307412_10262109
1266 Ga0307409_100000384
1267 Ga0307409_100006886
1268 Ga0307409_100197467
1269 Ga0307409_100224734
1270 Ga0307409_100360284
1271 Ga0307409_100360996
1272 Ga0307409_100399290
1273 Ga0307409_100524765
1274 Ga0307409_101257554
1275 Ga0307409_101299681
1276 Ga0307409_101614947
1277 Ga0307416_100000202
1278 Ga0307416_100076047
1279 Ga0307416_100296926
1280 Ga0307416_100406094
1281 Ga0307416_100472994
1282 Ga0307416_100712150
1283 Ga0307416_103346912
1284 Ga0307414_10066607
1285 Ga0307414_10433920
1286 Ga0307414_10646795
1287 Ga0307414_11290917
1288 Ga0307414_11422459
1289 Ga0307411_10109275
1290 Ga0307411_10130483
1291 Ga0307411_10200572
1292 Ga0307411_10387683
1293 Ga0307415_100008086
1294 Ga0307415_100047581
1295 Ga0307415_100330591
1296 Ga0307415_100798146
1297 Ga0307415_101537599
1298 Ga0307415_101697499
1299 Ga0307415_102293703
1300 Ga0316593_10297345
1301 Ga0307507_10082385
1302 Ga0316212_1006312
1303 Ga0373940_0024685
1304 Ga0373951_0000111
1305 Ga0373939_0164298
1306 Ga0373956_0004902
1307 Ga0373942_0000618
1308 Ga0395898_0900844
1309 Ga0395898_1909934
1310 Ga0436364_0370199
1311 Ga0436364_0800302
1312 Ga0400486_10057
1313 Ga0436365_0229193
1314 Ga0436365_1721535
1315 Ga0439461_0006261
1316 Ga0439461_0116314
1317 Ga0439465_0007956
1318 Ga0451787_707672
1319 Ga0451789_0786992
1320 Ga0451794_38020
1321 Ga0451793_1877998
1322 Ga0451797_0867144
1323 Ga0451795_0104097
1324 Ga0451833_1383050
1325 Ga0451835_1256974
1326 Ga0451841_1378285
1327 Ga0451849_1036751
1328 Ga0451849_1244970
1329 Ga0439431_0075201
1330 Ga0439433_0110734
1331 Ga0439448_0109178
1332 Ga0439459_0115643
1333 Ga0466969_0122213
1334 Ga0466965_0007987
1335 Ga0466965_0038050
1336 Ga0466966_0018089
1337 Ga0466966_0141483
1338 Ga0466961_0008483
1339 Ga0466961_0023991
1340 Ga0466963_0023550
1341 Ga0466963_0341526
1342 Ga0466963_1283544
1343 Ga0466964_0009950
1344 Ga0466964_0268515
1345 Ga0466971_0088526
1346 Ga0466970_0001442
1347 Ga0466957_0015711
1348 Ga0466957_0043411
1349 Ga0466960_0001275
1350 Ga0466960_0108019
1351 Ga0466960_0112553
1352 Ga0466960_0596248
1353 Ga0466959_0081309
1354 Ga0451576_0041977
1355 Ga0466958_0002161
1356 Ga0466958_0077654
1357 Ga0466967_0002113
1358 Ga0466967_0042860
1359 Ga0466967_0069744
1360 Ga0466967_0138337
1361 Ga0466967_0167722
1362 Ga0466967_0307707
1363 Ga0466967_0402211
1364 Ga0495603_0237117
1365 Ga0495629_0212728
1366 Ga0495651_0134004
1367 Ga0495662_0153997
1368 Ga0495596_0161149
1369 Ga0495596_0179583
1370 Ga0495583_0133698
1371 Ga0495606_0007788
1372 Ga0495608_0449067
1373 Ga0495620_0174958
1374 Ga0495632_0015091
1375 Ga0495637_0098686
1376 Ga0495648_0013828
1377 Ga0495663_0045274
1378 Ga0495652_0391189
1379 Ga0495640_0237143
1380 Ga0495667_0250256
1381 Ga0495656_0018756
1382 Ga0495656_0415778
1383 Ga0495668_0029298
1384 Ga0495668_0229007
1385 Ga0495611_0111418
1386 Ga0495635_0029079
1387 Ga0495661_0252072
1388 Ga0495588_0598872
1389 Ga0495670_0081207
1390 Ga0495670_0692177
1391 Ga0495671_0101447
1392 Ga0495600_0157895
1393 Ga0495600_0463744
1394 Ga0495674_0734035
1395 Ga0495672_0002575
1396 Ga0495672_0034233
1397 Ga0495680_0121473
1398 Ga0495680_0219498
1399 Ga0495673_0000444
1400 Ga0495686_0267361
1401 Ga0496100_0328605
1402 Ga0496100_0434550
1403 Ga0496100_0548776
1404 Ga0496100_0775642
1405 Ga0496101_0000026
1406 Ga0496101_0057138
1407 Ga0496102_0000031
1408 Ga0496102_0001061
1409 Ga0496102_0008531
1410 Ga0496102_0010274
1411 Ga0496102_0413858
1412 Ga0496102_1188322
1413 Ga0496102_1677600
1414 Ga0496103_0000025
1415 Ga0496103_0000521
1416 Ga0496103_0639552
1417 Ga0496104_0001896
1418 Ga0496104_0081732
1419 Ga0496104_0217587
1420 Ga0496104_0470074
1421 Ga0496104_0718243
1422 Ga0496105_0002045
1423 Ga0496105_0077224
1424 Ga0496105_0493623
1425 Ga0496106_0020434
1426 Ga0496106_0410220
1427 Ga0496106_0784192
1428 Ga0496106_1074722
1429 Ga0496107_0020405
1430 Ga0496107_0095336
1431 Ga0496107_0105175
1432 Ga0496107_0584415
1433 Ga0496107_0590546
1434 Ga0496107_0777917
1435 Ga0496108_0018135
1436 Ga0496108_0077705
1437 Ga0496108_0244927
1438 Ga0496108_0505388
1439 Ga0496108_0531196
1440 Ga0496109_0035352
1441 Ga0496109_0057643
1442 Ga0496109_0179239
1443 Ga0496109_0191225
1444 Ga0496109_0336942
1445 Ga0496109_0437796
1446 Ga0496109_0635552
1447 Ga0496109_0929944
1448 Ga0496109_1111628
1449 Ga0496109_1375430
1450 Ga0496109_1494225
1451 Ga0496110_0041681
1452 Ga0496110_0088233
1453 Ga0496110_0299734
1454 Ga0496110_0408581
1455 Ga0496110_0567035
1456 Ga0496110_0740835
1457 Ga0496111_0002344
1458 Ga0496111_0152242
1459 Ga0496111_0476066
1460 Ga0496111_1129723
1461 Ga0496111_1130455
1462 Ga0496112_0076570
1463 Ga0496112_0102024
1464 Ga0496112_1922357
1465 Ga0496113_0027694
1466 Ga0496113_0373317
1467 Ga0496113_0784230
1468 Ga0496113_0965282
1469 Ga0496113_1548954
1470 Ga0496114_0019400
1471 Ga0496114_0049962
1472 Ga0496114_0549306
1473 Ga0496114_1124850
1474 Ga0496115_0102404
1475 Ga0496116_0000084
1476 Ga0496116_0012299
1477 Ga0496117_0000018
1478 Ga0496117_0003175
1479 Ga0496118_0000013
1480 Ga0496118_0001120
1481 Ga0496119_0001033
1482 Ga0496119_0009526
1483 Ga0496119_0096382
1484 Ga0496120_0000418
1485 Ga0496120_0006102
1486 Ga0496121_0000056
1487 Ga0496121_0008270
1488 Ga0496124_0067027
1489 Ga0496125_0009200
1490 Ga0496126_0002664
1491 Ga0501306_008094
1492 Ga0501306_013711
1493 Ga0501306_026237
1494 Ga0501306_035627
1495 Ga0501306_100055
1496 Ga0501308_023215
1497 Ga0501308_078777
1498 Ga0501309_009803
1499 Ga0501309_036569
1500 Ga0501309_059324
1501 Ga0501309_098013
1502 Ga0501310_000128
1503 Ga0501310_012829
1504 Ga0501310_017530
1505 Ga0501310_022786
1506 Ga0501310_025747
1507 Ga0501310_035918
1508 Ga0501310_042492
1509 Ga0501310_044254
1510 Ga0501310_053390
1511 Ga0501341_07290
1512 Ga0501304_008579
1513 Ga0501304_015143
1514 Ga0501305_003880
1515 Ga0501305_039832
1516 Ga0501305_055843
1517 Ga0501305_064617
1518 Ga0501305_108569
1519 Ga0501307_004015
1520 Ga0501307_030126
1521 Ga0501307_055754
1522 Ga0501291_024418
1523 Ga0501311_005386
1524 Ga0501311_091285
1525 Ga0501312_037887
1526 Ga0501312_084136
1527 Ga0501312_088491
1528 Ga0501312_098031
1529 Ga0501312_120633
1530 Ga0501313_068268
1531 Ga0501314_021685
1532 Ga0501315_013456
1533 Ga0501315_016671
1534 Ga0501315_044349
1535 Ga0501316_024524
1536 Ga0501316_047792
1537 Ga0501316_066454
1538 Ga0501317_005721
1539 Ga0501317_015307
1540 Ga0501317_017476
1541 Ga0501317_034541
1542 Ga0501317_039754
1543 Ga0501317_047493
1544 Ga0501317_068984
1545 Ga0501317_078681
1546 Ga0501318_006622
1547 Ga0501318_007610
1548 Ga0501318_015169
1549 Ga0501318_063571
1550 Ga0501320_013294
1551 Ga0501321_002857
1552 Ga0501321_006525
1553 Ga0501321_011649
1554 Ga0501321_026875
1555 Ga0501321_032037
1556 Ga0501321_074251
1557 Ga0501321_079861
1558 Ga0501322_002466
1559 Ga0501323_005780
1560 Ga0501323_012824
1561 Ga0501323_071541
1562 Ga0501325_001770
1563 Ga0501325_038963
1564 Ga0501330_006144
1565 Ga0501331_00744
1566 Ga0501332_12510
1567 Ga0501336_005035
1568 Ga0501340_005401
1569 Ga0501031_0012399
1570 Ga0501031_0319283
1571 Ga0501032_0022265
1572 Ga0501032_0148063
1573 Ga0501033_0109174
1574 Ga0501033_0649696
1575 Ga0501034_0060431
1576 Ga0501034_0157108
1577 Ga0501034_0600641
1578 Ga0501036_0003887
1579 Ga0501036_0075150
1580 Ga0501036_0126363
1581 Ga0501036_0578496
1582 Ga0501037_0001404
1583 Ga0501037_0011156
1584 Ga0501037_0281657
1585 Ga0501038_0000759
1586 Ga0501038_0034435
1587 Ga0501038_0471536
1588 Ga0501039_0023422
1589 Ga0501039_0080671
1590 Ga0501039_0780899
1591 Ga0501040_0007280
1592 Ga0501040_0511777
1593 Ga0501040_0537189
1594 Ga0501040_0582582
1595 Ga0501041_0002242
1596 Ga0501041_0130299
1597 Ga0501042_0010005
1598 Ga0501042_0050735
1599 Ga0501042_0295372
1600 Ga0501042_0680117
1601 Ga0501043_0000624
1602 Ga0501043_0043377
1603 Ga0501043_0596299
1604 Ga0501046_0043263
1605 Ga0501046_0488780
1606 Ga0501047_0008218
1607 Ga0501048_0002565
1608 Ga0501048_0016909
1609 Ga0501048_0085034
1610 Ga0501048_0407001
1611 Ga0501048_0507037
1612 Ga0501067_0254514
1613 Ga0501068_0159499
1614 Ga0501068_0455787
1615 Ga0501068_0638804
1616 Ga0501069_0021713
1617 Ga0501069_0064505
1618 Ga0501069_0110210
1619 Ga0501069_0559815
1620 Ga0501070_0000743
1621 Ga0501070_0141145
1622 Ga0501070_0505636
1623 Ga0501070_0635443
1624 Ga0501071_0003883
1625 Ga0501071_0764603
1626 Ga0501071_1005336
1627 Ga0501071_1143468
1628 Ga0501072_0001887
1629 Ga0501072_0091792
1630 Ga0501072_0349927
1631 Ga0501073_0019467
1632 Ga0501073_0055586
1633 Ga0501073_0138290
1634 Ga0501073_0138625
1635 Ga0501073_0549000
1636 Ga0501074_0001922
1637 Ga0501074_0005993
1638 Ga0501074_0030459
1639 Ga0501074_0551991
1640 Ga0501075_0217304
1641 Ga0501076_0004239
1642 Ga0501076_0268866
1643 Ga0501076_0303671
1644 Ga0501077_0082549
1645 Ga0501077_0197062
1646 Ga0501214_020069
1647 Ga0501243_137586
1648 Ga0501253_058829
1649 Ga0501079_0003642
1650 Ga0501079_0271966
1651 Ga0501079_0317096
1652 Ga0501079_0432705
1653 Ga0501079_0450305
1654 Ga0501080_0039146
1655 Ga0501080_0326470
1656 Ga0501080_0739870
1657 Ga0501080_0791760
1658 Ga0501081_0069864
1659 Ga0501083_0035666
1660 Ga0501035_0015863
1661 Ga0501044_0101358
1662 Ga0501044_0331718
1663 Ga0501044_0437965
1664 Ga0501044_0848771
1665 Ga0501044_0862690
1666 Ga0501044_0870958
1667 Ga0501045_0006408
1668 Ga0501045_0340365
1669 nmdc:mga03683_151531_c1
1670 nmdc:mga03n38_37536_c1
1671 nmdc:mga03n38_697536_c1
1672 nmdc:mga00v17_114942_c1
1673 nmdc:mga0yw44_122880_c1
1674 nmdc:mga0yw44_19236_c1
1675 nmdc:mga0yw44_29668_c1
1676 nmdc:mga0yw44_319468_c1
1677 nmdc:mga0yw44_5193_c1
1678 nmdc:mga0yw44_6588_c1
1679 nmdc:mga06z11_404907_c1
1680 nmdc:mga04h51_126501_c1
1681 nmdc:mga07m45_103753_c1
1682 nmdc:mga09592_107261_c1
1683 nmdc:mga0qj67_56091_c1
1684 Ga0500635_0007481
1685 Ga0495655_0231897
1686 Ga0495619_0051747
1687 Ga0500643_012033
1688 Ga0500591_160439
1689 Ga0500652_001762
1690 Ga0500573_0015258
1691 Ga0500616_0009295
1692 Ga0500620_027847
1693 Ga0500624_022288
1694 Ga0500637_0012957
1695 Ga0501084_0014898
1696 Ga0501084_0054959
1697 Ga0501084_0221023
1698 Ga0587083_0075499
1699 Ga0587083_0165833
1700 Ga0587090_083790
1701 Ga0587098_024866
1702 Ga0587128_032896
1703 Ga0587068_029138
1704 Ga0587068_069272
1705 Ga0587107_085251
1706 Ga0501082_0024137
1707 Ga0501082_0116180
1708 Ga0501082_0165797
1709 Ga0466962_0027951
1710 Ga0530510_0002923
1711 Ga0530510_0089022
1712 2643827093
1713 2644035102
1714 2644231726
1715 2644534446
1716 2738868853
1717 2739365734
1718 2740165457
1719 2812372654
1720 2819689853
1721 2819726591
1722 2832008891
1723 2842892623
1724 2855388535
1725 2857486171
1726 2866071152
1727 2902792439
1728 2974319879
1729 2984523751
1730 8054611848

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

63

147

0.97

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

1

47

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 0.9886 1 41
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 0.9885 1 41
8aye-assembly1.cif.gz_h e. coli 70s ribosome bound to thermorubin and fmet-trna 0.9875 1 41
8cgk-assembly1.cif.gz_h lincomycin and avilamycin bound to the 50s subunit 0.981 1 41
8ceu-assembly1.cif.gz_h retapamulin and capreomycin bound to the 50s subunit 0.9807 1 41
ID Description Score Start End Superfamily
af_A0A1D6HNM4_48_91_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.957 3 43 3.40.5.10
af_P0A7R1_1_50_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9415 1 49 3.40.5.10
4kj5H00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9222 1 49 3.40.5.10
3j7zH00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9172 1 49 3.40.5.10
af_Q54QM2_41_88_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9142 3 48 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A0G0T2A4-F1-model_v4 Large ribosomal subunit protein bL9 0.8888 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G0T2A4-F1-model_v4 Large ribosomal subunit protein bL9 0.8834 1 148 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6B0Z4J3-F1-model_v4 Large ribosomal subunit protein bL9 0.8733 1 147 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6B0Z4J3-F1-model_v4 Large ribosomal subunit protein bL9 0.8627 1 147 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E0VTH1-F1-model_v4 Large ribosomal subunit protein bL9 0.8593 1 147 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map