F484008
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 865 | 385 | 1730 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300049541|Ga0501325_008401|Ga0501325_008401_60_572 |
| Length | 170 |
| Sequence | MKLILTQEIDGLGAPGDVVEVKDGYGRNYLIPRGVAIRWTRGGEKTVESIKKARTSRAVRDHDHAGEIQKKLESAPVSVKVRSGEGGRLFGAVTVSEIAAAIADVSGQQVDKRTIAVKNPIKSLGSHVVLVRLHDEVTATVALNVIPVQTRRRARQEAQCHKRRAVNAER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 90 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 106 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 180 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 181 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 191 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 192 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 199 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 200 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 201 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 202 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 203 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 284 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 328 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 329 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 330 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 347 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 350 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 351 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 352 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 355 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 356 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 357 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 367 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 368 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 369 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 370 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 371 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 372 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 373 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 374 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 375 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 376 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 377 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 378 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 379 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 380 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 381 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 382 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 383 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 384 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 385 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.47 |
| Metatranscriptomes | 11.33 |
| Isolates | 2.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 4.28 |
| Nodule | 0.12 |
| Rhizoplane | 9.25 |
| Rhizosphere | 80.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501325_008401 | 3300049541 | Bacteria | 896 |
| 2 | LJQas_1000912 | 3300000549 | Bacteria | 4588 |
| 3 | JGI24743J22301_10035349 | 3300001991 | Bacteria | 993 |
| 4 | JGI24745J21846_1007099 | 3300002073 | Bacteria | 1253 |
| 5 | JGI24744J21845_10006602 | 3300002077 | Bacteria | 2405 |
| 6 | Ga0070658_10006341 | 3300005327 | Bacteria | 9585 |
| 7 | Ga0070658_10349433 | 3300005327 | Bacteria | 1265 |
| 8 | Ga0070683_100259945 | 3300005329 | Bacteria | 1651 |
| 9 | Ga0070683_101418262 | 3300005329 | Bacteria | 667 |
| 10 | Ga0070670_100604449 | 3300005331 | Bacteria | 982 |
| 11 | Ga0070677_10228512 | 3300005333 | Bacteria | 913 |
| 12 | Ga0068869_100730256 | 3300005334 | Bacteria | 846 |
| 13 | Ga0070680_100796129 | 3300005336 | Bacteria | 814 |
| 14 | Ga0070682_100010325 | 3300005337 | Bacteria | 5299 |
| 15 | Ga0070682_100275321 | 3300005337 | Bacteria | 1224 |
| 16 | Ga0070682_100527915 | 3300005337 | Bacteria | 919 |
| 17 | Ga0070682_101136941 | 3300005337 | Bacteria | 656 |
| 18 | Ga0068868_100262936 | 3300005338 | Bacteria | 1456 |
| 19 | Ga0068868_100932878 | 3300005338 | Bacteria | 791 |
| 20 | Ga0068868_101140954 | 3300005338 | Bacteria | 718 |
| 21 | Ga0068868_102011563 | 3300005338 | Bacteria | 548 |
| 22 | Ga0070660_100229451 | 3300005339 | Bacteria | 1510 |
| 23 | Ga0070660_100746656 | 3300005339 | Bacteria | 822 |
| 24 | Ga0070687_100144599 | 3300005343 | Bacteria | 1389 |
| 25 | Ga0070687_100299576 | 3300005343 | Bacteria | 1020 |
| 26 | Ga0070661_100651925 | 3300005344 | Bacteria | 855 |
| 27 | Ga0070692_10114198 | 3300005345 | Bacteria | 1498 |
| 28 | Ga0070668_100010096 | 3300005347 | Bacteria | 6999 |
| 29 | Ga0070668_100396819 | 3300005347 | Bacteria | 1177 |
| 30 | Ga0070668_100443761 | 3300005347 | Bacteria | 1114 |
| 31 | Ga0070669_100003361 | 3300005353 | Bacteria | 11502 |
| 32 | Ga0070675_100067313 | 3300005354 | Bacteria | 2964 |
| 33 | Ga0070675_100212056 | 3300005354 | Bacteria | 1684 |
| 34 | Ga0070671_100546502 | 3300005355 | Bacteria | 999 |
| 35 | Ga0070671_100657433 | 3300005355 | Bacteria | 908 |
| 36 | Ga0070671_101585745 | 3300005355 | Bacteria | 580 |
| 37 | Ga0070688_100241294 | 3300005365 | Bacteria | 1283 |
| 38 | Ga0070688_100346447 | 3300005365 | Bacteria | 1086 |
| 39 | Ga0070659_100056198 | 3300005366 | Bacteria | 3103 |
| 40 | Ga0070659_101281547 | 3300005366 | Bacteria | 649 |
| 41 | Ga0070667_100000432 | 3300005367 | Bacteria | 44053 |
| 42 | Ga0070667_100159320 | 3300005367 | Bacteria | 1987 |
| 43 | Ga0070701_10169722 | 3300005438 | Bacteria | 1270 |
| 44 | Ga0070700_100022907 | 3300005441 | Bacteria | 3649 |
| 45 | Ga0070700_100625453 | 3300005441 | Bacteria | 847 |
| 46 | Ga0070700_101513458 | 3300005441 | Bacteria | 571 |
| 47 | Ga0070694_100313099 | 3300005444 | Bacteria | 1206 |
| 48 | Ga0070663_100286379 | 3300005455 | Bacteria | 1314 |
| 49 | Ga0070663_100810117 | 3300005455 | Bacteria | 803 |
| 50 | Ga0070681_10363518 | 3300005458 | Bacteria | 1357 |
| 51 | Ga0070681_10939920 | 3300005458 | Bacteria | 783 |
| 52 | Ga0068867_100168502 | 3300005459 | Bacteria | 1733 |
| 53 | Ga0070685_10021075 | 3300005466 | Bacteria | 3538 |
| 54 | Ga0070685_10824124 | 3300005466 | Bacteria | 686 |
| 55 | Ga0070679_100059219 | 3300005530 | Bacteria | 3817 |
| 56 | Ga0070679_100694056 | 3300005530 | Bacteria | 960 |
| 57 | Ga0070684_100003524 | 3300005535 | Bacteria | 11761 |
| 58 | Ga0070684_100217339 | 3300005535 | Bacteria | 1743 |
| 59 | Ga0070684_100609313 | 3300005535 | Bacteria | 1015 |
| 60 | Ga0070684_101153488 | 3300005535 | Bacteria | 728 |
| 61 | Ga0070684_101235475 | 3300005535 | Bacteria | 703 |
| 62 | Ga0068853_100567994 | 3300005539 | Bacteria | 1076 |
| 63 | Ga0068853_100681803 | 3300005539 | Bacteria | 979 |
| 64 | Ga0068853_101010953 | 3300005539 | Bacteria | 800 |
| 65 | Ga0070672_100286558 | 3300005543 | Bacteria | 1394 |
| 66 | Ga0070672_101263041 | 3300005543 | Bacteria | 659 |
| 67 | Ga0070686_100278892 | 3300005544 | Bacteria | 1232 |
| 68 | Ga0070686_100471728 | 3300005544 | Bacteria | 969 |
| 69 | Ga0070693_100248248 | 3300005547 | Bacteria | 1179 |
| 70 | Ga0070693_100424049 | 3300005547 | Bacteria | 928 |
| 71 | Ga0070693_101158774 | 3300005547 | Bacteria | 592 |
| 72 | Ga0070665_100042384 | 3300005548 | Bacteria | 4575 |
| 73 | Ga0070665_100120151 | 3300005548 | Bacteria | 2630 |
| 74 | Ga0070665_100290442 | 3300005548 | Bacteria | 1637 |
| 75 | Ga0070665_100291386 | 3300005548 | Bacteria | 1635 |
| 76 | Ga0068855_100267083 | 3300005563 | Bacteria | 1904 |
| 77 | Ga0070664_100218826 | 3300005564 | Bacteria | 1703 |
| 78 | Ga0070664_100410291 | 3300005564 | Bacteria | 1239 |
| 79 | Ga0070664_100485871 | 3300005564 | Bacteria | 1137 |
| 80 | Ga0070664_100667758 | 3300005564 | Bacteria | 966 |
| 81 | Ga0070664_101005729 | 3300005564 | Bacteria | 784 |
| 82 | Ga0068857_100039278 | 3300005577 | Bacteria | 4192 |
| 83 | Ga0068857_100560933 | 3300005577 | Bacteria | 1077 |
| 84 | Ga0068854_100184745 | 3300005578 | Bacteria | 1630 |
| 85 | Ga0068856_100051542 | 3300005614 | Bacteria | 4057 |
| 86 | Ga0070702_100076638 | 3300005615 | Bacteria | 1990 |
| 87 | Ga0070702_100166339 | 3300005615 | Bacteria | 1430 |
| 88 | Ga0070702_100183340 | 3300005615 | Bacteria | 1371 |
| 89 | Ga0068852_100249938 | 3300005616 | Bacteria | 1699 |
| 90 | Ga0068852_100627398 | 3300005616 | Bacteria | 1081 |
| 91 | Ga0068859_100032205 | 3300005617 | Bacteria | 5266 |
| 92 | Ga0068859_100257908 | 3300005617 | Bacteria | 1834 |
| 93 | Ga0068859_100422240 | 3300005617 | Bacteria | 1430 |
| 94 | Ga0068859_101754097 | 3300005617 | Bacteria | 686 |
| 95 | Ga0068864_100086949 | 3300005618 | Bacteria | 2751 |
| 96 | Ga0068864_100644803 | 3300005618 | Bacteria | 1031 |
| 97 | Ga0068864_100854460 | 3300005618 | Bacteria | 897 |
| 98 | Ga0068866_10369475 | 3300005718 | Bacteria | 917 |
| 99 | Ga0068866_10682626 | 3300005718 | Bacteria | 702 |
| 100 | Ga0068861_100172731 | 3300005719 | Bacteria | 1793 |
| 101 | Ga0068861_100212407 | 3300005719 | Bacteria | 1630 |
| 102 | Ga0068861_100376667 | 3300005719 | Bacteria | 1253 |
| 103 | Ga0068861_100588169 | 3300005719 | Bacteria | 1020 |
| 104 | Ga0068851_10290397 | 3300005834 | Bacteria | 937 |
| 105 | Ga0068851_10425587 | 3300005834 | Bacteria | 785 |
| 106 | Ga0068870_10243976 | 3300005840 | Bacteria | 1110 |
| 107 | Ga0068863_100001815 | 3300005841 | Bacteria | 21207 |
| 108 | Ga0068863_100056451 | 3300005841 | Bacteria | 3717 |
| 109 | Ga0068863_101576294 | 3300005841 | Bacteria | 666 |
| 110 | Ga0068858_100006606 | 3300005842 | Bacteria | 11284 |
| 111 | Ga0068858_100019647 | 3300005842 | Bacteria | 6316 |
| 112 | Ga0068858_100091789 | 3300005842 | Bacteria | 2826 |
| 113 | Ga0068858_100911476 | 3300005842 | Bacteria | 860 |
| 114 | Ga0068860_100000140 | 3300005843 | Bacteria | 118729 |
| 115 | Ga0068860_100081601 | 3300005843 | Bacteria | 3075 |
| 116 | Ga0068862_100000034 | 3300005844 | Bacteria | 176511 |
| 117 | Ga0068862_100141255 | 3300005844 | Bacteria | 2137 |
| 118 | Ga0081455_10005208 | 3300005937 | Bacteria | 14306 |
| 119 | Ga0081455_10008436 | 3300005937 | Bacteria | 10717 |
| 120 | Ga0081455_10023824 | 3300005937 | Bacteria | 5687 |
| 121 | Ga0081455_10105170 | 3300005937 | Bacteria | 2256 |
| 122 | Ga0081540_1017822 | 3300005983 | Bacteria | 4381 |
| 123 | Ga0081539_10003389 | 3300005985 | Bacteria | 19712 |
| 124 | Ga0081539_10162290 | 3300005985 | Bacteria | 1064 |
| 125 | Ga0075365_10000512 | 3300006038 | Bacteria | 14786 |
| 126 | Ga0075365_10004406 | 3300006038 | Bacteria | 7454 |
| 127 | Ga0075365_10311391 | 3300006038 | Bacteria | 1108 |
| 128 | Ga0075365_10398331 | 3300006038 | Bacteria | 971 |
| 129 | Ga0075368_10133693 | 3300006042 | Bacteria | 1031 |
| 130 | Ga0075363_100031624 | 3300006048 | Bacteria | 2745 |
| 131 | Ga0075363_100169960 | 3300006048 | Bacteria | 1237 |
| 132 | Ga0075363_100261095 | 3300006048 | Bacteria | 999 |
| 133 | Ga0075363_100523830 | 3300006048 | Bacteria | 705 |
| 134 | Ga0075364_10685415 | 3300006051 | Bacteria | 699 |
| 135 | Ga0070715_10287920 | 3300006163 | Bacteria | 874 |
| 136 | Ga0075362_10172277 | 3300006177 | Bacteria | 1046 |
| 137 | Ga0075367_10373970 | 3300006178 | Bacteria | 900 |
| 138 | Ga0075367_10591898 | 3300006178 | Bacteria | 705 |
| 139 | Ga0075370_10100217 | 3300006353 | Bacteria | 1676 |
| 140 | Ga0068871_100643194 | 3300006358 | Bacteria | 968 |
| 141 | Ga0075428_100573065 | 3300006844 | Bacteria | 1206 |
| 142 | Ga0075430_100004635 | 3300006846 | Bacteria | 11566 |
| 143 | Ga0075431_100025721 | 3300006847 | Bacteria | 6032 |
| 144 | Ga0075431_100897479 | 3300006847 | Bacteria | 856 |
| 145 | Ga0075429_100002834 | 3300006880 | Bacteria | 14675 |
| 146 | Ga0068865_100009402 | 3300006881 | Bacteria | 6061 |
| 147 | Ga0068865_101343163 | 3300006881 | Bacteria | 637 |
| 148 | Ga0097620_100032205 | 3300006931 | Bacteria | 5266 |
| 149 | Ga0097620_100257909 | 3300006931 | Bacteria | 1834 |
| 150 | Ga0097620_100422226 | 3300006931 | Bacteria | 1430 |
| 151 | Ga0097620_101754221 | 3300006931 | Bacteria | 686 |
| 152 | Ga0105251_10271334 | 3300009011 | Bacteria | 766 |
| 153 | Ga0105244_10200279 | 3300009036 | Bacteria | 942 |
| 154 | Ga0111539_12197983 | 3300009094 | Bacteria | 640 |
| 155 | Ga0105245_10049423 | 3300009098 | Bacteria | 3766 |
| 156 | Ga0105245_10121541 | 3300009098 | Bacteria | 2440 |
| 157 | Ga0105245_10286270 | 3300009098 | Bacteria | 1613 |
| 158 | Ga0105245_10693758 | 3300009098 | Bacteria | 1051 |
| 159 | Ga0105245_11968521 | 3300009098 | Bacteria | 638 |
| 160 | Ga0105247_10000065 | 3300009101 | Bacteria | 122503 |
| 161 | Ga0105247_10082542 | 3300009101 | Bacteria | 2029 |
| 162 | Ga0105247_10157390 | 3300009101 | Bacteria | 1501 |
| 163 | Ga0105247_10977683 | 3300009101 | Bacteria | 659 |
| 164 | Ga0114129_10063703 | 3300009147 | Bacteria | 5146 |
| 165 | Ga0114129_11049491 | 3300009147 | Bacteria | 1023 |
| 166 | Ga0114129_11318244 | 3300009147 | Bacteria | 894 |
| 167 | Ga0105243_10062246 | 3300009148 | Bacteria | 2987 |
| 168 | Ga0105243_10079772 | 3300009148 | Bacteria | 2668 |
| 169 | Ga0105243_10100460 | 3300009148 | Bacteria | 2400 |
| 170 | Ga0105243_10635656 | 3300009148 | Bacteria | 1032 |
| 171 | Ga0105243_10778341 | 3300009148 | Bacteria | 941 |
| 172 | Ga0105243_11237979 | 3300009148 | Bacteria | 761 |
| 173 | Ga0105243_11632457 | 3300009148 | Bacteria | 672 |
| 174 | Ga0105241_10684221 | 3300009174 | Bacteria | 935 |
| 175 | Ga0105241_10817677 | 3300009174 | Bacteria | 859 |
| 176 | Ga0105242_12098112 | 3300009176 | Bacteria | 609 |
| 177 | Ga0105248_10000067 | 3300009177 | Bacteria | 121245 |
| 178 | Ga0105248_10128116 | 3300009177 | Bacteria | 2863 |
| 179 | Ga0105248_10147229 | 3300009177 | Bacteria | 2657 |
| 180 | Ga0105248_10777106 | 3300009177 | Bacteria | 1081 |
| 181 | Ga0105237_10014123 | 3300009545 | Bacteria | 8357 |
| 182 | Ga0105237_11399045 | 3300009545 | Bacteria | 706 |
| 183 | Ga0105238_10539382 | 3300009551 | Bacteria | 1170 |
| 184 | Ga0105238_10756027 | 3300009551 | Bacteria | 986 |
| 185 | Ga0105238_10990769 | 3300009551 | Bacteria | 861 |
| 186 | Ga0105249_10000051 | 3300009553 | Bacteria | 169445 |
| 187 | Ga0105249_10174574 | 3300009553 | Bacteria | 2086 |
| 188 | Ga0105249_10229480 | 3300009553 | Bacteria | 1830 |
| 189 | Ga0105239_10017001 | 3300010375 | Bacteria | 8041 |
| 190 | Ga0105239_10107810 | 3300010375 | Bacteria | 3086 |
| 191 | Ga0105239_10135079 | 3300010375 | Bacteria | 2746 |
| 192 | Ga0105239_11812853 | 3300010375 | Bacteria | 707 |
| 193 | Ga0105246_10005334 | 3300011119 | Bacteria | 7828 |
| 194 | Ga0105246_10754512 | 3300011119 | Bacteria | 859 |
| 195 | Ga0105246_11279175 | 3300011119 | Bacteria | 679 |
| 196 | Ga0157328_1012475 | 3300012478 | Bacteria | 617 |
| 197 | Ga0157322_1024428 | 3300012490 | Bacteria | 605 |
| 198 | Ga0157371_10943450 | 3300013102 | Bacteria | 656 |
| 199 | Ga0157369_10437358 | 3300013105 | Bacteria | 1355 |
| 200 | Ga0157369_10759209 | 3300013105 | Bacteria | 997 |
| 201 | Ga0157374_10002631 | 3300013296 | Bacteria | 15135 |
| 202 | Ga0157374_10739751 | 3300013296 | Bacteria | 998 |
| 203 | Ga0157374_11252365 | 3300013296 | Bacteria | 763 |
| 204 | Ga0157378_10605632 | 3300013297 | Bacteria | 1107 |
| 205 | Ga0163162_10060396 | 3300013306 | Bacteria | 3826 |
| 206 | Ga0163162_10230348 | 3300013306 | Bacteria | 1983 |
| 207 | Ga0163162_10251329 | 3300013306 | Bacteria | 1900 |
| 208 | Ga0163162_10415130 | 3300013306 | Bacteria | 1478 |
| 209 | Ga0163162_10651708 | 3300013306 | Bacteria | 1177 |
| 210 | Ga0163162_10672381 | 3300013306 | Bacteria | 1158 |
| 211 | Ga0163162_12365802 | 3300013306 | Bacteria | 611 |
| 212 | Ga0157372_10016137 | 3300013307 | Bacteria | 8013 |
| 213 | Ga0157372_10377116 | 3300013307 | Bacteria | 1653 |
| 214 | Ga0157372_10835470 | 3300013307 | Bacteria | 1069 |
| 215 | Ga0157375_10043714 | 3300013308 | Bacteria | 4347 |
| 216 | Ga0157375_10176786 | 3300013308 | Bacteria | 2284 |
| 217 | Ga0157375_10645500 | 3300013308 | Bacteria | 1215 |
| 218 | Ga0157375_11349356 | 3300013308 | Bacteria | 839 |
| 219 | Ga0157375_11411888 | 3300013308 | Bacteria | 820 |
| 220 | Ga0157375_13277522 | 3300013308 | Bacteria | 540 |
| 221 | Ga0163163_10169117 | 3300014325 | Bacteria | 2232 |
| 222 | Ga0163163_10193215 | 3300014325 | Bacteria | 2083 |
| 223 | Ga0163163_10468376 | 3300014325 | Bacteria | 1321 |
| 224 | Ga0163163_10633812 | 3300014325 | Bacteria | 1132 |
| 225 | Ga0163163_10657011 | 3300014325 | Bacteria | 1112 |
| 226 | Ga0157380_10038706 | 3300014326 | Bacteria | 3704 |
| 227 | Ga0157380_11178472 | 3300014326 | Bacteria | 809 |
| 228 | Ga0157380_11276242 | 3300014326 | Bacteria | 781 |
| 229 | Ga0157380_12745482 | 3300014326 | Bacteria | 559 |
| 230 | Ga0157380_12946312 | 3300014326 | Bacteria | 542 |
| 231 | Ga0157377_10256865 | 3300014745 | Bacteria | 1135 |
| 232 | Ga0157377_11119613 | 3300014745 | Bacteria | 604 |
| 233 | Ga0157379_10047850 | 3300014968 | Bacteria | 3816 |
| 234 | Ga0157379_10415711 | 3300014968 | Bacteria | 1238 |
| 235 | Ga0157379_10616215 | 3300014968 | Bacteria | 1014 |
| 236 | Ga0157379_10893363 | 3300014968 | Bacteria | 842 |
| 237 | Ga0157376_10300034 | 3300014969 | Bacteria | 1520 |
| 238 | Ga0157376_10701739 | 3300014969 | Bacteria | 1017 |
| 239 | Ga0157376_12654233 | 3300014969 | Bacteria | 541 |
| 240 | Ga0163161_10025668 | 3300017792 | Bacteria | 4172 |
| 241 | Ga0163161_10523728 | 3300017792 | Bacteria | 968 |
| 242 | Ga0163161_10800911 | 3300017792 | Bacteria | 792 |
| 243 | Ga0197907_11437332 | 3300020069 | Bacteria | 543 |
| 244 | Ga0206355_1537635 | 3300020076 | Bacteria | 995 |
| 245 | Ga0206355_1666784 | 3300020076 | Bacteria | 1564 |
| 246 | Ga0206352_10467026 | 3300020078 | Bacteria | 632 |
| 247 | Ga0206354_10237669 | 3300020081 | Bacteria | 632 |
| 248 | Ga0206354_10488921 | 3300020081 | Bacteria | 761 |
| 249 | Ga0206353_10446262 | 3300020082 | Bacteria | 843 |
| 250 | Ga0206353_10590081 | 3300020082 | Bacteria | 8878 |
| 251 | Ga0154015_1046720 | 3300020610 | Bacteria | 1005 |
| 252 | Ga0213875_10024669 | 3300021388 | Bacteria | 2867 |
| 253 | Ga0224712_10173611 | 3300022467 | Bacteria | 968 |
| 254 | Ga0207642_10187534 | 3300025899 | Bacteria | 1132 |
| 255 | Ga0207642_10235959 | 3300025899 | Bacteria | 1030 |
| 256 | Ga0207642_10292463 | 3300025899 | Bacteria | 941 |
| 257 | Ga0207642_10372595 | 3300025899 | Bacteria | 848 |
| 258 | Ga0207710_10000089 | 3300025900 | Bacteria | 122497 |
| 259 | Ga0207688_10013848 | 3300025901 | Bacteria | 4384 |
| 260 | Ga0207688_10017436 | 3300025901 | Bacteria | 3901 |
| 261 | Ga0207688_10343754 | 3300025901 | Bacteria | 918 |
| 262 | Ga0207647_10039445 | 3300025904 | Bacteria | 2979 |
| 263 | Ga0207645_10039602 | 3300025907 | Bacteria | 3019 |
| 264 | Ga0207643_10005026 | 3300025908 | Bacteria | 7085 |
| 265 | Ga0207643_10055690 | 3300025908 | Bacteria | 2249 |
| 266 | Ga0207705_10088468 | 3300025909 | Bacteria | 2266 |
| 267 | Ga0207705_10105475 | 3300025909 | Bacteria | 2077 |
| 268 | Ga0207705_10380331 | 3300025909 | Bacteria | 1090 |
| 269 | Ga0207707_10133987 | 3300025912 | Bacteria | 2167 |
| 270 | Ga0207707_10865211 | 3300025912 | Bacteria | 749 |
| 271 | Ga0207671_10029794 | 3300025914 | Bacteria | 4074 |
| 272 | Ga0207671_10684716 | 3300025914 | Bacteria | 816 |
| 273 | Ga0207662_10281644 | 3300025918 | Bacteria | 1100 |
| 274 | Ga0207662_10392598 | 3300025918 | Bacteria | 939 |
| 275 | Ga0207657_10191883 | 3300025919 | Bacteria | 1647 |
| 276 | Ga0207657_10623205 | 3300025919 | Bacteria | 841 |
| 277 | Ga0207657_10878542 | 3300025919 | Bacteria | 691 |
| 278 | Ga0207657_11488479 | 3300025919 | Bacteria | 506 |
| 279 | Ga0207652_10006742 | 3300025921 | Bacteria | 9256 |
| 280 | Ga0207681_10000955 | 3300025923 | Bacteria | 18866 |
| 281 | Ga0207694_10292001 | 3300025924 | Bacteria | 1341 |
| 282 | Ga0207694_11303163 | 3300025924 | Bacteria | 614 |
| 283 | Ga0207650_10986911 | 3300025925 | Bacteria | 716 |
| 284 | Ga0207659_10090071 | 3300025926 | Bacteria | 2289 |
| 285 | Ga0207659_10517242 | 3300025926 | Bacteria | 1012 |
| 286 | Ga0207687_10025363 | 3300025927 | Bacteria | 3967 |
| 287 | Ga0207687_10122377 | 3300025927 | Bacteria | 1948 |
| 288 | Ga0207687_11025168 | 3300025927 | Bacteria | 708 |
| 289 | Ga0207644_10267918 | 3300025931 | Bacteria | 1368 |
| 290 | Ga0207690_10065216 | 3300025932 | Bacteria | 2489 |
| 291 | Ga0207690_10161503 | 3300025932 | Bacteria | 1670 |
| 292 | Ga0207706_10196692 | 3300025933 | Bacteria | 1769 |
| 293 | Ga0207706_10453659 | 3300025933 | Bacteria | 1109 |
| 294 | Ga0207709_10416760 | 3300025935 | Bacteria | 1031 |
| 295 | Ga0207704_10374667 | 3300025938 | Bacteria | 1116 |
| 296 | Ga0207704_10684678 | 3300025938 | Bacteria | 847 |
| 297 | Ga0207711_10000091 | 3300025941 | Bacteria | 96789 |
| 298 | Ga0207711_10231583 | 3300025941 | Bacteria | 1692 |
| 299 | Ga0207711_10410525 | 3300025941 | Bacteria | 1259 |
| 300 | Ga0207689_10012353 | 3300025942 | Bacteria | 7306 |
| 301 | Ga0207661_10477025 | 3300025944 | Bacteria | 1138 |
| 302 | Ga0207661_10631246 | 3300025944 | Bacteria | 984 |
| 303 | Ga0207661_10651542 | 3300025944 | Bacteria | 968 |
| 304 | Ga0207661_11884116 | 3300025944 | Bacteria | 544 |
| 305 | Ga0207679_11135132 | 3300025945 | Bacteria | 717 |
| 306 | Ga0207679_11777126 | 3300025945 | Bacteria | 564 |
| 307 | Ga0207667_11583965 | 3300025949 | Bacteria | 624 |
| 308 | Ga0207712_10000043 | 3300025961 | Bacteria | 173580 |
| 309 | Ga0207712_10058830 | 3300025961 | Bacteria | 2717 |
| 310 | Ga0207668_10015963 | 3300025972 | Bacteria | 4677 |
| 311 | Ga0207668_10227696 | 3300025972 | Bacteria | 1501 |
| 312 | Ga0207668_10970912 | 3300025972 | Bacteria | 758 |
| 313 | Ga0207640_11848502 | 3300025981 | Bacteria | 546 |
| 314 | Ga0207658_10002150 | 3300025986 | Bacteria | 14650 |
| 315 | Ga0207658_10086104 | 3300025986 | Bacteria | 2422 |
| 316 | Ga0207658_10494224 | 3300025986 | Bacteria | 1089 |
| 317 | Ga0207658_11537262 | 3300025986 | Bacteria | 609 |
| 318 | Ga0207677_10524221 | 3300026023 | Bacteria | 1028 |
| 319 | Ga0207677_10524946 | 3300026023 | Bacteria | 1028 |
| 320 | Ga0207703_10187530 | 3300026035 | Bacteria | 1829 |
| 321 | Ga0207703_10258374 | 3300026035 | Bacteria | 1573 |
| 322 | Ga0207703_10496429 | 3300026035 | Bacteria | 1145 |
| 323 | Ga0207703_10933190 | 3300026035 | Bacteria | 832 |
| 324 | Ga0207639_11121263 | 3300026041 | Bacteria | 738 |
| 325 | Ga0207639_11188568 | 3300026041 | Bacteria | 716 |
| 326 | Ga0207678_10094057 | 3300026067 | Bacteria | 2560 |
| 327 | Ga0207678_10586918 | 3300026067 | Bacteria | 976 |
| 328 | Ga0207708_10019119 | 3300026075 | Bacteria | 5159 |
| 329 | Ga0207708_10044344 | 3300026075 | Bacteria | 3389 |
| 330 | Ga0207708_10054943 | 3300026075 | Bacteria | 3036 |
| 331 | Ga0207708_10888195 | 3300026075 | Bacteria | 771 |
| 332 | Ga0207708_11323869 | 3300026075 | Bacteria | 631 |
| 333 | Ga0207702_10307793 | 3300026078 | Bacteria | 1505 |
| 334 | Ga0207702_11132617 | 3300026078 | Bacteria | 776 |
| 335 | Ga0207641_10064158 | 3300026088 | Bacteria | 3139 |
| 336 | Ga0207641_10082249 | 3300026088 | Bacteria | 2797 |
| 337 | Ga0207641_10183619 | 3300026088 | Bacteria | 1917 |
| 338 | Ga0207648_10077261 | 3300026089 | Bacteria | 2902 |
| 339 | Ga0207676_10562121 | 3300026095 | Bacteria | 1091 |
| 340 | Ga0207676_10684026 | 3300026095 | Bacteria | 993 |
| 341 | Ga0207676_11012966 | 3300026095 | Bacteria | 819 |
| 342 | Ga0207676_11089325 | 3300026095 | Bacteria | 789 |
| 343 | Ga0207674_10016969 | 3300026116 | Bacteria | 7950 |
| 344 | Ga0207674_10202943 | 3300026116 | Bacteria | 1932 |
| 345 | Ga0207674_10276026 | 3300026116 | Bacteria | 1628 |
| 346 | Ga0207674_11176582 | 3300026116 | Bacteria | 736 |
| 347 | Ga0207675_100092181 | 3300026118 | Bacteria | 2849 |
| 348 | Ga0207675_100136680 | 3300026118 | Bacteria | 2326 |
| 349 | Ga0207675_100366322 | 3300026118 | Bacteria | 1415 |
| 350 | Ga0207675_100941777 | 3300026118 | Bacteria | 881 |
| 351 | Ga0207683_10029382 | 3300026121 | Bacteria | 4759 |
| 352 | Ga0207683_10048530 | 3300026121 | Bacteria | 3717 |
| 353 | Ga0207683_10259622 | 3300026121 | Bacteria | 1586 |
| 354 | Ga0207698_10605420 | 3300026142 | Bacteria | 1081 |
| 355 | Ga0209813_10177766 | 3300027866 | Bacteria | 777 |
| 356 | Ga0209974_10003307 | 3300027876 | Bacteria | 5821 |
| 357 | Ga0268266_10014521 | 3300028379 | Bacteria | 6770 |
| 358 | Ga0268266_10084735 | 3300028379 | Bacteria | 2768 |
| 359 | Ga0268266_10196577 | 3300028379 | Bacteria | 1844 |
| 360 | Ga0268265_10000027 | 3300028380 | Bacteria | 240507 |
| 361 | Ga0268265_11019790 | 3300028380 | Bacteria | 818 |
| 362 | Ga0268264_10000127 | 3300028381 | Bacteria | 185112 |
| 363 | Ga0268264_10055903 | 3300028381 | Bacteria | 3299 |
| 364 | Ga0268264_11537199 | 3300028381 | Bacteria | 676 |
| 365 | Ga0316180_1179688 | 3300030736 | Bacteria | 625 |
| 366 | Ga0307513_10650260 | 3300031456 | Bacteria | 761 |
| 367 | Ga0307408_100004108 | 3300031548 | Bacteria | 9934 |
| 368 | Ga0307408_100707667 | 3300031548 | Bacteria | 906 |
| 369 | Ga0307408_100911274 | 3300031548 | Bacteria | 805 |
| 370 | Ga0265314_10010611 | 3300031711 | Bacteria | 7665 |
| 371 | Ga0307516_10361035 | 3300031730 | Bacteria | 1117 |
| 372 | Ga0307405_10007098 | 3300031731 | Bacteria | 5570 |
| 373 | Ga0307405_10134083 | 3300031731 | Bacteria | 1716 |
| 374 | Ga0307405_10653106 | 3300031731 | Bacteria | 865 |
| 375 | Ga0307413_10040543 | 3300031824 | Bacteria | 2718 |
| 376 | Ga0307413_10114308 | 3300031824 | Bacteria | 1814 |
| 377 | Ga0307413_10616921 | 3300031824 | Bacteria | 890 |
| 378 | Ga0307413_10627508 | 3300031824 | Bacteria | 883 |
| 379 | Ga0307413_10753871 | 3300031824 | Bacteria | 814 |
| 380 | Ga0307413_10866558 | 3300031824 | Bacteria | 764 |
| 381 | Ga0307413_10998179 | 3300031824 | Bacteria | 717 |
| 382 | Ga0307410_10096546 | 3300031852 | Bacteria | 2110 |
| 383 | Ga0307410_10149722 | 3300031852 | Bacteria | 1736 |
| 384 | Ga0307410_10235418 | 3300031852 | Bacteria | 1416 |
| 385 | Ga0307410_10382038 | 3300031852 | Bacteria | 1133 |
| 386 | Ga0326468_10026058 | 3300031889 | Bacteria | 739 |
| 387 | Ga0307406_10000351 | 3300031901 | Bacteria | 26871 |
| 388 | Ga0307406_10134669 | 3300031901 | Bacteria | 1739 |
| 389 | Ga0307407_10011368 | 3300031903 | Bacteria | 4235 |
| 390 | Ga0307407_10060954 | 3300031903 | Bacteria | 2203 |
| 391 | Ga0307407_10266633 | 3300031903 | Bacteria | 1180 |
| 392 | Ga0307407_10313732 | 3300031903 | Bacteria | 1098 |
| 393 | Ga0307407_10343687 | 3300031903 | Bacteria | 1054 |
| 394 | Ga0307407_10440523 | 3300031903 | Bacteria | 943 |
| 395 | Ga0307407_10727769 | 3300031903 | Bacteria | 749 |
| 396 | Ga0307412_10007532 | 3300031911 | Bacteria | 6181 |
| 397 | Ga0307412_10074713 | 3300031911 | Bacteria | 2323 |
| 398 | Ga0307412_10113443 | 3300031911 | Bacteria | 1939 |
| 399 | Ga0307412_10221032 | 3300031911 | Bacteria | 1452 |
| 400 | Ga0307412_10262109 | 3300031911 | Bacteria | 1348 |
| 401 | Ga0307409_100000384 | 3300031995 | Bacteria | 18744 |
| 402 | Ga0307409_100006886 | 3300031995 | Bacteria | 6736 |
| 403 | Ga0307409_100197467 | 3300031995 | Bacteria | 1797 |
| 404 | Ga0307409_100224734 | 3300031995 | Bacteria | 1697 |
| 405 | Ga0307409_100360284 | 3300031995 | Bacteria | 1375 |
| 406 | Ga0307409_100360996 | 3300031995 | Bacteria | 1374 |
| 407 | Ga0307409_100399290 | 3300031995 | Bacteria | 1313 |
| 408 | Ga0307409_100524765 | 3300031995 | Bacteria | 1157 |
| 409 | Ga0307409_101257554 | 3300031995 | Bacteria | 764 |
| 410 | Ga0307409_101299681 | 3300031995 | Bacteria | 752 |
| 411 | Ga0307409_101614947 | 3300031995 | Bacteria | 677 |
| 412 | Ga0307416_100000202 | 3300032002 | Bacteria | 31241 |
| 413 | Ga0307416_100076047 | 3300032002 | Bacteria | 2812 |
| 414 | Ga0307416_100296926 | 3300032002 | Bacteria | 1603 |
| 415 | Ga0307416_100406094 | 3300032002 | Bacteria | 1401 |
| 416 | Ga0307416_100472994 | 3300032002 | Bacteria | 1311 |
| 417 | Ga0307416_100712150 | 3300032002 | Bacteria | 1094 |
| 418 | Ga0307416_103346912 | 3300032002 | Bacteria | 536 |
| 419 | Ga0307414_10066607 | 3300032004 | Bacteria | 2575 |
| 420 | Ga0307414_10433920 | 3300032004 | Bacteria | 1148 |
| 421 | Ga0307414_10646795 | 3300032004 | Bacteria | 953 |
| 422 | Ga0307414_11290917 | 3300032004 | Bacteria | 677 |
| 423 | Ga0307414_11422459 | 3300032004 | Bacteria | 645 |
| 424 | Ga0307411_10109275 | 3300032005 | Bacteria | 1975 |
| 425 | Ga0307411_10130483 | 3300032005 | Bacteria | 1836 |
| 426 | Ga0307411_10200572 | 3300032005 | Bacteria | 1532 |
| 427 | Ga0307411_10387683 | 3300032005 | Bacteria | 1151 |
| 428 | Ga0307415_100008086 | 3300032126 | Bacteria | 5808 |
| 429 | Ga0307415_100047581 | 3300032126 | Bacteria | 2887 |
| 430 | Ga0307415_100330591 | 3300032126 | Bacteria | 1275 |
| 431 | Ga0307415_100798146 | 3300032126 | Bacteria | 861 |
| 432 | Ga0307415_101537599 | 3300032126 | Bacteria | 637 |
| 433 | Ga0307415_101697499 | 3300032126 | Bacteria | 609 |
| 434 | Ga0307415_102293703 | 3300032126 | Bacteria | 529 |
| 435 | Ga0316593_10297345 | 3300032168 | Bacteria | 610 |
| 436 | Ga0307507_10082385 | 3300033179 | Bacteria | 2821 |
| 437 | Ga0316212_1006312 | 3300033547 | Bacteria | 1719 |
| 438 | Ga0373940_0024685 | 3300035088 | Bacteria | 1560 |
| 439 | Ga0373951_0000111 | 3300035091 | Bacteria | 31636 |
| 440 | Ga0373939_0164298 | 3300035114 | Bacteria | 817 |
| 441 | Ga0373956_0004902 | 3300035119 | Bacteria | 5358 |
| 442 | Ga0373942_0000618 | 3300035207 | Bacteria | 9957 |
| 443 | Ga0395898_0900844 | 3300037466 | Bacteria | 823 |
| 444 | Ga0395898_1909934 | 3300037466 | Bacteria | 514 |
| 445 | Ga0436364_0370199 | 3300037853 | Bacteria | 6562 |
| 446 | Ga0436364_0800302 | 3300037853 | Bacteria | 17536 |
| 447 | Ga0400486_10057 | 3300038742 | Bacteria | 45646 |
| 448 | Ga0436365_0229193 | 3300039437 | Bacteria | 608 |
| 449 | Ga0436365_1721535 | 3300039437 | Bacteria | 2537 |
| 450 | Ga0439461_0006261 | 3300041410 | Bacteria | 2067 |
| 451 | Ga0439461_0116314 | 3300041410 | Bacteria | 665 |
| 452 | Ga0439465_0007956 | 3300041413 | Bacteria | 3355 |
| 453 | Ga0451787_707672 | 3300041441 | Bacteria | 849 |
| 454 | Ga0451789_0786992 | 3300041443 | Bacteria | 914 |
| 455 | Ga0451794_38020 | 3300041446 | Bacteria | 675 |
| 456 | Ga0451793_1877998 | 3300041452 | Bacteria | 2337 |
| 457 | Ga0451797_0867144 | 3300041453 | Bacteria | 1057 |
| 458 | Ga0451795_0104097 | 3300041456 | Bacteria | 570 |
| 459 | Ga0451833_1383050 | 3300041491 | Bacteria | 514 |
| 460 | Ga0451835_1256974 | 3300041492 | Bacteria | 953 |
| 461 | Ga0451841_1378285 | 3300041498 | Bacteria | 1289 |
| 462 | Ga0451849_1036751 | 3300041505 | Bacteria | 607 |
| 463 | Ga0451849_1244970 | 3300041505 | Bacteria | 1345 |
| 464 | Ga0439431_0075201 | 3300041997 | Bacteria | 905 |
| 465 | Ga0439433_0110734 | 3300041999 | Bacteria | 687 |
| 466 | Ga0439448_0109178 | 3300042005 | Unclassified | 944 |
| 467 | Ga0439459_0115643 | 3300042438 | Unclassified | 671 |
| 468 | Ga0466969_0122213 | 3300044656 | Bacteria | 1211 |
| 469 | Ga0466965_0007987 | 3300044683 | Bacteria | 4881 |
| 470 | Ga0466965_0038050 | 3300044683 | Bacteria | 2363 |
| 471 | Ga0466966_0018089 | 3300044684 | Bacteria | 4652 |
| 472 | Ga0466966_0141483 | 3300044684 | Bacteria | 1470 |
| 473 | Ga0466961_0008483 | 3300044693 | Bacteria | 6546 |
| 474 | Ga0466961_0023991 | 3300044693 | Bacteria | 3924 |
| 475 | Ga0466963_0023550 | 3300044694 | Bacteria | 3912 |
| 476 | Ga0466963_0341526 | 3300044694 | Bacteria | 1054 |
| 477 | Ga0466963_1283544 | 3300044694 | Bacteria | 514 |
| 478 | Ga0466964_0009950 | 3300044706 | Bacteria | 3581 |
| 479 | Ga0466964_0268515 | 3300044706 | Bacteria | 848 |
| 480 | Ga0466971_0088526 | 3300044719 | Bacteria | 1416 |
| 481 | Ga0466970_0001442 | 3300044765 | Bacteria | 11509 |
| 482 | Ga0466957_0015711 | 3300044842 | Bacteria | 4423 |
| 483 | Ga0466957_0043411 | 3300044842 | Bacteria | 2722 |
| 484 | Ga0466960_0001275 | 3300044901 | Bacteria | 9124 |
| 485 | Ga0466960_0108019 | 3300044901 | Bacteria | 1442 |
| 486 | Ga0466960_0112553 | 3300044901 | Bacteria | 1416 |
| 487 | Ga0466960_0596248 | 3300044901 | Bacteria | 655 |
| 488 | Ga0466959_0081309 | 3300045049 | Bacteria | 2335 |
| 489 | Ga0451576_0041977 | 3300045051 | Bacteria | 4831 |
| 490 | Ga0466958_0002161 | 3300045836 | Bacteria | 9788 |
| 491 | Ga0466958_0077654 | 3300045836 | Bacteria | 2039 |
| 492 | Ga0466967_0002113 | 3300045976 | Bacteria | 12194 |
| 493 | Ga0466967_0042860 | 3300045976 | Bacteria | 3914 |
| 494 | Ga0466967_0069744 | 3300045976 | Bacteria | 3142 |
| 495 | Ga0466967_0138337 | 3300045976 | Bacteria | 2266 |
| 496 | Ga0466967_0167722 | 3300045976 | Bacteria | 2064 |
| 497 | Ga0466967_0307707 | 3300045976 | Bacteria | 1526 |
| 498 | Ga0466967_0402211 | 3300045976 | Bacteria | 1332 |
| 499 | Ga0495603_0237117 | 3300046455 | Bacteria | 1051 |
| 500 | Ga0495629_0212728 | 3300046459 | Bacteria | 1335 |
| 501 | Ga0495651_0134004 | 3300046462 | Bacteria | 1805 |
| 502 | Ga0495662_0153997 | 3300046476 | Bacteria | 1132 |
| 503 | Ga0495596_0161149 | 3300046500 | Bacteria | 872 |
| 504 | Ga0495596_0179583 | 3300046500 | Bacteria | 823 |
| 505 | Ga0495583_0133698 | 3300046506 | Bacteria | 1036 |
| 506 | Ga0495606_0007788 | 3300046507 | Bacteria | 9479 |
| 507 | Ga0495608_0449067 | 3300046511 | Bacteria | 785 |
| 508 | Ga0495620_0174958 | 3300046515 | Bacteria | 831 |
| 509 | Ga0495632_0015091 | 3300046519 | Bacteria | 4343 |
| 510 | Ga0495637_0098686 | 3300046520 | Bacteria | 1144 |
| 511 | Ga0495648_0013828 | 3300046524 | Bacteria | 5945 |
| 512 | Ga0495663_0045274 | 3300046525 | Bacteria | 1349 |
| 513 | Ga0495652_0391189 | 3300046529 | Bacteria | 987 |
| 514 | Ga0495640_0237143 | 3300046533 | Bacteria | 1146 |
| 515 | Ga0495667_0250256 | 3300046559 | Bacteria | 1128 |
| 516 | Ga0495656_0018756 | 3300046615 | Bacteria | 2663 |
| 517 | Ga0495656_0415778 | 3300046615 | Bacteria | 705 |
| 518 | Ga0495668_0029298 | 3300046616 | Bacteria | 3111 |
| 519 | Ga0495668_0229007 | 3300046616 | Bacteria | 1018 |
| 520 | Ga0495611_0111418 | 3300046648 | Bacteria | 1274 |
| 521 | Ga0495635_0029079 | 3300046663 | Bacteria | 3842 |
| 522 | Ga0495661_0252072 | 3300046665 | Bacteria | 901 |
| 523 | Ga0495588_0598872 | 3300046674 | Bacteria | 577 |
| 524 | Ga0495670_0081207 | 3300046691 | Bacteria | 1652 |
| 525 | Ga0495670_0692177 | 3300046691 | Bacteria | 556 |
| 526 | Ga0495671_0101447 | 3300046692 | Bacteria | 1407 |
| 527 | Ga0495600_0157895 | 3300046809 | Bacteria | 1467 |
| 528 | Ga0495600_0463744 | 3300046809 | Bacteria | 782 |
| 529 | Ga0495674_0734035 | 3300047319 | Bacteria | 773 |
| 530 | Ga0495672_0002575 | 3300047320 | Bacteria | 16485 |
| 531 | Ga0495672_0034233 | 3300047320 | Bacteria | 3141 |
| 532 | Ga0495680_0121473 | 3300047322 | Bacteria | 1928 |
| 533 | Ga0495680_0219498 | 3300047322 | Bacteria | 1358 |
| 534 | Ga0495673_0000444 | 3300047469 | Bacteria | 45563 |
| 535 | Ga0495686_0267361 | 3300047472 | Bacteria | 955 |
| 536 | Ga0496100_0328605 | 3300048903 | Bacteria | 1150 |
| 537 | Ga0496100_0434550 | 3300048903 | Bacteria | 1004 |
| 538 | Ga0496100_0548776 | 3300048903 | Bacteria | 894 |
| 539 | Ga0496100_0775642 | 3300048903 | Bacteria | 750 |
| 540 | Ga0496101_0000026 | 3300048904 | Bacteria | 199963 |
| 541 | Ga0496101_0057138 | 3300048904 | Bacteria | 2822 |
| 542 | Ga0496102_0000031 | 3300048905 | Bacteria | 217389 |
| 543 | Ga0496102_0001061 | 3300048905 | Bacteria | 25475 |
| 544 | Ga0496102_0008531 | 3300048905 | Bacteria | 8787 |
| 545 | Ga0496102_0010274 | 3300048905 | Bacteria | 8048 |
| 546 | Ga0496102_0413858 | 3300048905 | Bacteria | 1266 |
| 547 | Ga0496102_1188322 | 3300048905 | Bacteria | 682 |
| 548 | Ga0496102_1677600 | 3300048905 | Bacteria | 553 |
| 549 | Ga0496103_0000025 | 3300048906 | Bacteria | 221144 |
| 550 | Ga0496103_0000521 | 3300048906 | Bacteria | 31557 |
| 551 | Ga0496103_0639552 | 3300048906 | Bacteria | 676 |
| 552 | Ga0496104_0001896 | 3300048907 | Bacteria | 18117 |
| 553 | Ga0496104_0081732 | 3300048907 | Bacteria | 3081 |
| 554 | Ga0496104_0217587 | 3300048907 | Bacteria | 1822 |
| 555 | Ga0496104_0470074 | 3300048907 | Bacteria | 1169 |
| 556 | Ga0496104_0718243 | 3300048907 | Bacteria | 907 |
| 557 | Ga0496105_0002045 | 3300048908 | Bacteria | 14588 |
| 558 | Ga0496105_0077224 | 3300048908 | Bacteria | 2750 |
| 559 | Ga0496105_0493623 | 3300048908 | Bacteria | 962 |
| 560 | Ga0496106_0020434 | 3300048909 | Bacteria | 4914 |
| 561 | Ga0496106_0410220 | 3300048909 | Bacteria | 1089 |
| 562 | Ga0496106_0784192 | 3300048909 | Bacteria | 756 |
| 563 | Ga0496106_1074722 | 3300048909 | Bacteria | 631 |
| 564 | Ga0496107_0020405 | 3300048910 | Bacteria | 4680 |
| 565 | Ga0496107_0095336 | 3300048910 | Bacteria | 2177 |
| 566 | Ga0496107_0105175 | 3300048910 | Bacteria | 2072 |
| 567 | Ga0496107_0584415 | 3300048910 | Bacteria | 826 |
| 568 | Ga0496107_0590546 | 3300048910 | Bacteria | 821 |
| 569 | Ga0496107_0777917 | 3300048910 | Bacteria | 701 |
| 570 | Ga0496108_0018135 | 3300048911 | Bacteria | 5759 |
| 571 | Ga0496108_0077705 | 3300048911 | Bacteria | 2808 |
| 572 | Ga0496108_0244927 | 3300048911 | Bacteria | 1559 |
| 573 | Ga0496108_0505388 | 3300048911 | Bacteria | 1055 |
| 574 | Ga0496108_0531196 | 3300048911 | Bacteria | 1027 |
| 575 | Ga0496109_0035352 | 3300048912 | Bacteria | 4506 |
| 576 | Ga0496109_0057643 | 3300048912 | Bacteria | 3546 |
| 577 | Ga0496109_0179239 | 3300048912 | Bacteria | 1989 |
| 578 | Ga0496109_0191225 | 3300048912 | Bacteria | 1923 |
| 579 | Ga0496109_0336942 | 3300048912 | Bacteria | 1424 |
| 580 | Ga0496109_0437796 | 3300048912 | Bacteria | 1235 |
| 581 | Ga0496109_0635552 | 3300048912 | Bacteria | 1004 |
| 582 | Ga0496109_0929944 | 3300048912 | Bacteria | 807 |
| 583 | Ga0496109_1111628 | 3300048912 | Bacteria | 727 |
| 584 | Ga0496109_1375430 | 3300048912 | Bacteria | 641 |
| 585 | Ga0496109_1494225 | 3300048912 | Bacteria | 610 |
| 586 | Ga0496110_0041681 | 3300048913 | Bacteria | 4006 |
| 587 | Ga0496110_0088233 | 3300048913 | Bacteria | 2770 |
| 588 | Ga0496110_0299734 | 3300048913 | Bacteria | 1464 |
| 589 | Ga0496110_0408581 | 3300048913 | Bacteria | 1238 |
| 590 | Ga0496110_0567035 | 3300048913 | Bacteria | 1031 |
| 591 | Ga0496110_0740835 | 3300048913 | Bacteria | 885 |
| 592 | Ga0496111_0002344 | 3300048914 | Bacteria | 11413 |
| 593 | Ga0496111_0152242 | 3300048914 | Bacteria | 1716 |
| 594 | Ga0496111_0476066 | 3300048914 | Bacteria | 920 |
| 595 | Ga0496111_1129723 | 3300048914 | Bacteria | 557 |
| 596 | Ga0496111_1130455 | 3300048914 | Bacteria | 557 |
| 597 | Ga0496112_0076570 | 3300048915 | Bacteria | 3308 |
| 598 | Ga0496112_0102024 | 3300048915 | Bacteria | 2839 |
| 599 | Ga0496112_1922357 | 3300048915 | Bacteria | 503 |
| 600 | Ga0496113_0027694 | 3300048916 | Bacteria | 4066 |
| 601 | Ga0496113_0373317 | 3300048916 | Bacteria | 1145 |
| 602 | Ga0496113_0784230 | 3300048916 | Bacteria | 758 |
| 603 | Ga0496113_0965282 | 3300048916 | Bacteria | 672 |
| 604 | Ga0496113_1548954 | 3300048916 | Bacteria | 511 |
| 605 | Ga0496114_0019400 | 3300048917 | Bacteria | 5509 |
| 606 | Ga0496114_0049962 | 3300048917 | Bacteria | 3480 |
| 607 | Ga0496114_0549306 | 3300048917 | Bacteria | 1020 |
| 608 | Ga0496114_1124850 | 3300048917 | Bacteria | 670 |
| 609 | Ga0496115_0102404 | 3300048918 | Bacteria | 2348 |
| 610 | Ga0496116_0000084 | 3300048919 | Bacteria | 219579 |
| 611 | Ga0496116_0012299 | 3300048919 | Bacteria | 6997 |
| 612 | Ga0496117_0000018 | 3300048920 | Bacteria | 479613 |
| 613 | Ga0496117_0003175 | 3300048920 | Bacteria | 19539 |
| 614 | Ga0496118_0000013 | 3300048921 | Bacteria | 574008 |
| 615 | Ga0496118_0001120 | 3300048921 | Bacteria | 41519 |
| 616 | Ga0496119_0001033 | 3300048922 | Bacteria | 35640 |
| 617 | Ga0496119_0009526 | 3300048922 | Bacteria | 8318 |
| 618 | Ga0496119_0096382 | 3300048922 | Bacteria | 1669 |
| 619 | Ga0496120_0000418 | 3300048923 | Bacteria | 67915 |
| 620 | Ga0496120_0006102 | 3300048923 | Bacteria | 9347 |
| 621 | Ga0496121_0000056 | 3300048924 | Bacteria | 296250 |
| 622 | Ga0496121_0008270 | 3300048924 | Bacteria | 12309 |
| 623 | Ga0496124_0067027 | 3300048927 | Bacteria | 2987 |
| 624 | Ga0496125_0009200 | 3300048928 | Bacteria | 10206 |
| 625 | Ga0496126_0002664 | 3300048929 | Bacteria | 23643 |
| 626 | Ga0501306_008094 | 3300049127 | Bacteria | 1275 |
| 627 | Ga0501306_013711 | 3300049127 | Bacteria | 1061 |
| 628 | Ga0501306_026237 | 3300049127 | Bacteria | 843 |
| 629 | Ga0501306_035627 | 3300049127 | Bacteria | 756 |
| 630 | Ga0501306_100055 | 3300049127 | Bacteria | 518 |
| 631 | Ga0501308_023215 | 3300049128 | Bacteria | 790 |
| 632 | Ga0501308_078777 | 3300049128 | Bacteria | 522 |
| 633 | Ga0501309_009803 | 3300049129 | Bacteria | 1227 |
| 634 | Ga0501309_036569 | 3300049129 | Bacteria | 740 |
| 635 | Ga0501309_059324 | 3300049129 | Bacteria | 613 |
| 636 | Ga0501309_098013 | 3300049129 | Bacteria | 506 |
| 637 | Ga0501310_000128 | 3300049130 | Bacteria | 7517 |
| 638 | Ga0501310_012829 | 3300049130 | Bacteria | 965 |
| 639 | Ga0501310_017530 | 3300049130 | Bacteria | 867 |
| 640 | Ga0501310_022786 | 3300049130 | Bacteria | 792 |
| 641 | Ga0501310_025747 | 3300049130 | Bacteria | 759 |
| 642 | Ga0501310_035918 | 3300049130 | Bacteria | 674 |
| 643 | Ga0501310_042492 | 3300049130 | Bacteria | 637 |
| 644 | Ga0501310_044254 | 3300049130 | Bacteria | 628 |
| 645 | Ga0501310_053390 | 3300049130 | Bacteria | 589 |
| 646 | Ga0501341_07290 | 3300049131 | Bacteria | 691 |
| 647 | Ga0501304_008579 | 3300049160 | Bacteria | 863 |
| 648 | Ga0501304_015143 | 3300049160 | Bacteria | 720 |
| 649 | Ga0501305_003880 | 3300049161 | Bacteria | 1724 |
| 650 | Ga0501305_039832 | 3300049161 | Bacteria | 761 |
| 651 | Ga0501305_055843 | 3300049161 | Bacteria | 671 |
| 652 | Ga0501305_064617 | 3300049161 | Bacteria | 635 |
| 653 | Ga0501305_108569 | 3300049161 | Bacteria | 523 |
| 654 | Ga0501307_004015 | 3300049162 | Bacteria | 1478 |
| 655 | Ga0501307_030126 | 3300049162 | Bacteria | 749 |
| 656 | Ga0501307_055754 | 3300049162 | Bacteria | 603 |
| 657 | Ga0501291_024418 | 3300049514 | Bacteria | 983 |
| 658 | Ga0501311_005386 | 3300049527 | Bacteria | 1401 |
| 659 | Ga0501311_091285 | 3300049527 | Bacteria | 529 |
| 660 | Ga0501312_037887 | 3300049528 | Bacteria | 779 |
| 661 | Ga0501312_084136 | 3300049528 | Bacteria | 579 |
| 662 | Ga0501312_088491 | 3300049528 | Bacteria | 569 |
| 663 | Ga0501312_098031 | 3300049528 | Bacteria | 547 |
| 664 | Ga0501312_120633 | 3300049528 | Bacteria | 507 |
| 665 | Ga0501313_068268 | 3300049529 | Bacteria | 512 |
| 666 | Ga0501314_021685 | 3300049530 | Bacteria | 671 |
| 667 | Ga0501315_013456 | 3300049531 | Bacteria | 1024 |
| 668 | Ga0501315_016671 | 3300049531 | Bacteria | 953 |
| 669 | Ga0501315_044349 | 3300049531 | Bacteria | 682 |
| 670 | Ga0501316_024524 | 3300049532 | Bacteria | 780 |
| 671 | Ga0501316_047792 | 3300049532 | Bacteria | 610 |
| 672 | Ga0501316_066454 | 3300049532 | Bacteria | 540 |
| 673 | Ga0501317_005721 | 3300049533 | Bacteria | 1343 |
| 674 | Ga0501317_015307 | 3300049533 | Bacteria | 982 |
| 675 | Ga0501317_017476 | 3300049533 | Bacteria | 941 |
| 676 | Ga0501317_034541 | 3300049533 | Bacteria | 749 |
| 677 | Ga0501317_039754 | 3300049533 | Bacteria | 714 |
| 678 | Ga0501317_047493 | 3300049533 | Bacteria | 673 |
| 679 | Ga0501317_068984 | 3300049533 | Bacteria | 593 |
| 680 | Ga0501317_078681 | 3300049533 | Bacteria | 567 |
| 681 | Ga0501318_006622 | 3300049534 | Bacteria | 1188 |
| 682 | Ga0501318_007610 | 3300049534 | Bacteria | 1137 |
| 683 | Ga0501318_015169 | 3300049534 | Bacteria | 917 |
| 684 | Ga0501318_063571 | 3300049534 | Bacteria | 571 |
| 685 | Ga0501320_013294 | 3300049536 | Bacteria | 877 |
| 686 | Ga0501321_002857 | 3300049537 | Bacteria | 1537 |
| 687 | Ga0501321_006525 | 3300049537 | Bacteria | 1189 |
| 688 | Ga0501321_011649 | 3300049537 | Bacteria | 984 |
| 689 | Ga0501321_026875 | 3300049537 | Bacteria | 749 |
| 690 | Ga0501321_032037 | 3300049537 | Bacteria | 707 |
| 691 | Ga0501321_074251 | 3300049537 | Bacteria | 534 |
| 692 | Ga0501321_079861 | 3300049537 | Bacteria | 520 |
| 693 | Ga0501322_002466 | 3300049538 | Bacteria | 1137 |
| 694 | Ga0501323_005780 | 3300049539 | Bacteria | 1366 |
| 695 | Ga0501323_012824 | 3300049539 | Bacteria | 1028 |
| 696 | Ga0501323_071541 | 3300049539 | Bacteria | 555 |
| 697 | Ga0501325_001770 | 3300049541 | Bacteria | 1386 |
| 698 | Ga0501325_038963 | 3300049541 | Bacteria | 572 |
| 699 | Ga0501330_006144 | 3300049546 | Bacteria | 780 |
| 700 | Ga0501331_00744 | 3300049547 | Bacteria | 1430 |
| 701 | Ga0501332_12510 | 3300049548 | Bacteria | 584 |
| 702 | Ga0501336_005035 | 3300049552 | Bacteria | 945 |
| 703 | Ga0501340_005401 | 3300049556 | Bacteria | 832 |
| 704 | Ga0501031_0012399 | 3300049568 | Bacteria | 5558 |
| 705 | Ga0501031_0319283 | 3300049568 | Bacteria | 1006 |
| 706 | Ga0501032_0022265 | 3300049569 | Bacteria | 4394 |
| 707 | Ga0501032_0148063 | 3300049569 | Bacteria | 1545 |
| 708 | Ga0501033_0109174 | 3300049570 | Bacteria | 2015 |
| 709 | Ga0501033_0649696 | 3300049570 | Bacteria | 721 |
| 710 | Ga0501034_0060431 | 3300049571 | Bacteria | 3806 |
| 711 | Ga0501034_0157108 | 3300049571 | Bacteria | 2247 |
| 712 | Ga0501034_0600641 | 3300049571 | Bacteria | 1006 |
| 713 | Ga0501036_0003887 | 3300049572 | Bacteria | 11989 |
| 714 | Ga0501036_0075150 | 3300049572 | Bacteria | 2858 |
| 715 | Ga0501036_0126363 | 3300049572 | Bacteria | 2159 |
| 716 | Ga0501036_0578496 | 3300049572 | Bacteria | 932 |
| 717 | Ga0501037_0001404 | 3300049573 | Bacteria | 17665 |
| 718 | Ga0501037_0011156 | 3300049573 | Bacteria | 6613 |
| 719 | Ga0501037_0281657 | 3300049573 | Bacteria | 1158 |
| 720 | Ga0501038_0000759 | 3300049574 | Bacteria | 28718 |
| 721 | Ga0501038_0034435 | 3300049574 | Bacteria | 4453 |
| 722 | Ga0501038_0471536 | 3300049574 | Bacteria | 963 |
| 723 | Ga0501039_0023422 | 3300049575 | Bacteria | 4739 |
| 724 | Ga0501039_0080671 | 3300049575 | Bacteria | 2532 |
| 725 | Ga0501039_0780899 | 3300049575 | Bacteria | 745 |
| 726 | Ga0501040_0007280 | 3300049576 | Bacteria | 7171 |
| 727 | Ga0501040_0511777 | 3300049576 | Bacteria | 865 |
| 728 | Ga0501040_0537189 | 3300049576 | Bacteria | 843 |
| 729 | Ga0501040_0582582 | 3300049576 | Bacteria | 808 |
| 730 | Ga0501041_0002242 | 3300049577 | Bacteria | 10927 |
| 731 | Ga0501041_0130299 | 3300049577 | Bacteria | 1567 |
| 732 | Ga0501042_0010005 | 3300049578 | Bacteria | 6342 |
| 733 | Ga0501042_0050735 | 3300049578 | Bacteria | 2959 |
| 734 | Ga0501042_0295372 | 3300049578 | Bacteria | 1170 |
| 735 | Ga0501042_0680117 | 3300049578 | Bacteria | 748 |
| 736 | Ga0501043_0000624 | 3300049579 | Bacteria | 31242 |
| 737 | Ga0501043_0043377 | 3300049579 | Bacteria | 3535 |
| 738 | Ga0501043_0596299 | 3300049579 | Bacteria | 817 |
| 739 | Ga0501046_0043263 | 3300049580 | Bacteria | 3586 |
| 740 | Ga0501046_0488780 | 3300049580 | Bacteria | 882 |
| 741 | Ga0501047_0008218 | 3300049581 | Bacteria | 9850 |
| 742 | Ga0501048_0002565 | 3300049582 | Bacteria | 13916 |
| 743 | Ga0501048_0016909 | 3300049582 | Bacteria | 5376 |
| 744 | Ga0501048_0085034 | 3300049582 | Bacteria | 2231 |
| 745 | Ga0501048_0407001 | 3300049582 | Bacteria | 973 |
| 746 | Ga0501048_0507037 | 3300049582 | Bacteria | 865 |
| 747 | Ga0501067_0254514 | 3300049583 | Bacteria | 977 |
| 748 | Ga0501068_0159499 | 3300049584 | Bacteria | 1421 |
| 749 | Ga0501068_0455787 | 3300049584 | Bacteria | 827 |
| 750 | Ga0501068_0638804 | 3300049584 | Bacteria | 694 |
| 751 | Ga0501069_0021713 | 3300049585 | Bacteria | 3487 |
| 752 | Ga0501069_0064505 | 3300049585 | Bacteria | 2047 |
| 753 | Ga0501069_0110210 | 3300049585 | Bacteria | 1567 |
| 754 | Ga0501069_0559815 | 3300049585 | Bacteria | 684 |
| 755 | Ga0501070_0000743 | 3300049586 | Bacteria | 29764 |
| 756 | Ga0501070_0141145 | 3300049586 | Bacteria | 1989 |
| 757 | Ga0501070_0505636 | 3300049586 | Bacteria | 970 |
| 758 | Ga0501070_0635443 | 3300049586 | Bacteria | 848 |
| 759 | Ga0501071_0003883 | 3300049587 | Bacteria | 9414 |
| 760 | Ga0501071_0764603 | 3300049587 | Bacteria | 744 |
| 761 | Ga0501071_1005336 | 3300049587 | Bacteria | 644 |
| 762 | Ga0501071_1143468 | 3300049587 | Bacteria | 601 |
| 763 | Ga0501072_0001887 | 3300049588 | Bacteria | 15611 |
| 764 | Ga0501072_0091792 | 3300049588 | Bacteria | 2411 |
| 765 | Ga0501072_0349927 | 3300049588 | Bacteria | 1173 |
| 766 | Ga0501073_0019467 | 3300049589 | Bacteria | 4900 |
| 767 | Ga0501073_0055586 | 3300049589 | Bacteria | 2769 |
| 768 | Ga0501073_0138290 | 3300049589 | Bacteria | 1688 |
| 769 | Ga0501073_0138625 | 3300049589 | Bacteria | 1685 |
| 770 | Ga0501073_0549000 | 3300049589 | Bacteria | 798 |
| 771 | Ga0501074_0001922 | 3300049590 | Bacteria | 14276 |
| 772 | Ga0501074_0005993 | 3300049590 | Bacteria | 8770 |
| 773 | Ga0501074_0030459 | 3300049590 | Bacteria | 3910 |
| 774 | Ga0501074_0551991 | 3300049590 | Bacteria | 815 |
| 775 | Ga0501075_0217304 | 3300049591 | Bacteria | 1458 |
| 776 | Ga0501076_0004239 | 3300049592 | Bacteria | 10147 |
| 777 | Ga0501076_0268866 | 3300049592 | Bacteria | 1396 |
| 778 | Ga0501076_0303671 | 3300049592 | Bacteria | 1309 |
| 779 | Ga0501077_0082549 | 3300049593 | Bacteria | 2036 |
| 780 | Ga0501077_0197062 | 3300049593 | Bacteria | 1279 |
| 781 | Ga0501214_020069 | 3300049659 | Bacteria | 841 |
| 782 | Ga0501243_137586 | 3300049675 | Bacteria | 514 |
| 783 | Ga0501253_058829 | 3300049683 | Bacteria | 823 |
| 784 | Ga0501079_0003642 | 3300049741 | Bacteria | 11347 |
| 785 | Ga0501079_0271966 | 3300049741 | Bacteria | 1324 |
| 786 | Ga0501079_0317096 | 3300049741 | Bacteria | 1220 |
| 787 | Ga0501079_0432705 | 3300049741 | Bacteria | 1033 |
| 788 | Ga0501079_0450305 | 3300049741 | Bacteria | 1011 |
| 789 | Ga0501080_0039146 | 3300049742 | Bacteria | 4425 |
| 790 | Ga0501080_0326470 | 3300049742 | Bacteria | 1388 |
| 791 | Ga0501080_0739870 | 3300049742 | Bacteria | 865 |
| 792 | Ga0501080_0791760 | 3300049742 | Bacteria | 832 |
| 793 | Ga0501081_0069864 | 3300049743 | Bacteria | 2447 |
| 794 | Ga0501083_0035666 | 3300049744 | Bacteria | 3396 |
| 795 | Ga0501035_0015863 | 3300049822 | Bacteria | 6951 |
| 796 | Ga0501044_0101358 | 3300049823 | Bacteria | 2896 |
| 797 | Ga0501044_0331718 | 3300049823 | Bacteria | 1444 |
| 798 | Ga0501044_0437965 | 3300049823 | Bacteria | 1215 |
| 799 | Ga0501044_0848771 | 3300049823 | Bacteria | 790 |
| 800 | Ga0501044_0862690 | 3300049823 | Bacteria | 782 |
| 801 | Ga0501044_0870958 | 3300049823 | Bacteria | 777 |
| 802 | Ga0501045_0006408 | 3300049824 | Bacteria | 8150 |
| 803 | Ga0501045_0340365 | 3300049824 | Bacteria | 1116 |
| 804 | nmdc:mga03683_151531_c1 | 3300050489 | Bacteria | 1046 |
| 805 | nmdc:mga03n38_37536_c1 | 3300050490 | Bacteria | 2090 |
| 806 | nmdc:mga03n38_697536_c1 | 3300050490 | Bacteria | 585 |
| 807 | nmdc:mga00v17_114942_c1 | 3300050491 | Bacteria | 1710 |
| 808 | nmdc:mga0yw44_122880_c1 | 3300050492 | Bacteria | 1674 |
| 809 | nmdc:mga0yw44_19236_c1 | 3300050492 | Bacteria | 3761 |
| 810 | nmdc:mga0yw44_29668_c1 | 3300050492 | Bacteria | 3160 |
| 811 | nmdc:mga0yw44_319468_c1 | 3300050492 | Bacteria | 1042 |
| 812 | nmdc:mga0yw44_5193_c1 | 3300050492 | Bacteria | 6105 |
| 813 | nmdc:mga0yw44_6588_c1 | 3300050492 | Bacteria | 5624 |
| 814 | nmdc:mga06z11_404907_c1 | 3300050494 | Bacteria | 821 |
| 815 | nmdc:mga04h51_126501_c1 | 3300050495 | Bacteria | 957 |
| 816 | nmdc:mga07m45_103753_c1 | 3300050496 | Bacteria | 1634 |
| 817 | nmdc:mga09592_107261_c1 | 3300050508 | Bacteria | 2396 |
| 818 | nmdc:mga0qj67_56091_c1 | 3300050509 | Bacteria | 3123 |
| 819 | Ga0500635_0007481 | 3300053080 | Bacteria | 2961 |
| 820 | Ga0495655_0231897 | 3300053083 | Bacteria | 615 |
| 821 | Ga0495619_0051747 | 3300053085 | Bacteria | 2715 |
| 822 | Ga0500643_012033 | 3300053087 | Bacteria | 3118 |
| 823 | Ga0500591_160439 | 3300053115 | Bacteria | 851 |
| 824 | Ga0500652_001762 | 3300053131 | Bacteria | 6564 |
| 825 | Ga0500573_0015258 | 3300053140 | Bacteria | 4352 |
| 826 | Ga0500616_0009295 | 3300053153 | Bacteria | 5988 |
| 827 | Ga0500620_027847 | 3300053155 | Bacteria | 1762 |
| 828 | Ga0500624_022288 | 3300053157 | Bacteria | 1029 |
| 829 | Ga0500637_0012957 | 3300053178 | Bacteria | 4356 |
| 830 | Ga0501084_0014898 | 3300054114 | Bacteria | 6447 |
| 831 | Ga0501084_0054959 | 3300054114 | Bacteria | 3331 |
| 832 | Ga0501084_0221023 | 3300054114 | Bacteria | 1598 |
| 833 | Ga0587083_0075499 | 3300059505 | Bacteria | 792 |
| 834 | Ga0587083_0165833 | 3300059505 | Bacteria | 608 |
| 835 | Ga0587090_083790 | 3300059510 | Bacteria | 643 |
| 836 | Ga0587098_024866 | 3300059604 | Bacteria | 787 |
| 837 | Ga0587128_032896 | 3300059630 | Bacteria | 869 |
| 838 | Ga0587068_029138 | 3300059641 | Bacteria | 948 |
| 839 | Ga0587068_069272 | 3300059641 | Bacteria | 693 |
| 840 | Ga0587107_085251 | 3300059652 | Bacteria | 601 |
| 841 | Ga0501082_0024137 | 3300060353 | Bacteria | 5245 |
| 842 | Ga0501082_0116180 | 3300060353 | Bacteria | 2317 |
| 843 | Ga0501082_0165797 | 3300060353 | Bacteria | 1920 |
| 844 | Ga0466962_0027951 | 3300061719 | Bacteria | 2703 |
| 845 | Ga0530510_0002923 | 3300061734 | Bacteria | 11719 |
| 846 | Ga0530510_0089022 | 3300061734 | Bacteria | 2251 |
| 847 | 2643827093 | 2643221561 | Bacteria | 4984412 |
| 848 | 2644035102 | 2643221604 | Bacteria | 5014917 |
| 849 | 2644231726 | 2643221641 | Bacteria | 4490190 |
| 850 | 2644534446 | 2643221696 | Bacteria | 5431823 |
| 851 | 2738868853 | 2738541305 | Bacteria | 4910150 |
| 852 | 2739365734 | 2738543034 | Bacteria | 6084756 |
| 853 | 2740165457 | 2739367898 | Bacteria | 4367674 |
| 854 | 2812372654 | 2811994882 | Bacteria | 4688362 |
| 855 | 2819689853 | 2818991462 | Bacteria | 4320267 |
| 856 | 2819726591 | 2818991469 | Bacteria | 4644110 |
| 857 | 2832008891 | 2832004796 | Bacteria | 6538017 |
| 858 | 2842892623 | 2842888712 | Bacteria | 4279094 |
| 859 | 2855388535 | 2855386786 | Bacteria | 4752232 |
| 860 | 2857486171 | 2857481737 | Bacteria | 4761446 |
| 861 | 2866071152 | 2866065130 | Bacteria | 6518152 |
| 862 | 2902792439 | 2902792274 | Bacteria | 7270173 |
| 863 | 2974319879 | 2974315732 | Bacteria | 4602776 |
| 864 | 2984523751 | 2984523437 | Bacteria | 4508481 |
| 865 | 8054611848 | 8054609563 | Bacteria | 5170090 |
| 866 | Ga0501325_008401 | |||
| 867 | LJQas_1000912 | |||
| 868 | JGI24743J22301_10035349 | |||
| 869 | JGI24745J21846_1007099 | |||
| 870 | JGI24744J21845_10006602 | |||
| 871 | Ga0070658_10006341 | |||
| 872 | Ga0070658_10349433 | |||
| 873 | Ga0070683_100259945 | |||
| 874 | Ga0070683_101418262 | |||
| 875 | Ga0070670_100604449 | |||
| 876 | Ga0070677_10228512 | |||
| 877 | Ga0068869_100730256 | |||
| 878 | Ga0070680_100796129 | |||
| 879 | Ga0070682_100010325 | |||
| 880 | Ga0070682_100275321 | |||
| 881 | Ga0070682_100527915 | |||
| 882 | Ga0070682_101136941 | |||
| 883 | Ga0068868_100262936 | |||
| 884 | Ga0068868_100932878 | |||
| 885 | Ga0068868_101140954 | |||
| 886 | Ga0068868_102011563 | |||
| 887 | Ga0070660_100229451 | |||
| 888 | Ga0070660_100746656 | |||
| 889 | Ga0070687_100144599 | |||
| 890 | Ga0070687_100299576 | |||
| 891 | Ga0070661_100651925 | |||
| 892 | Ga0070692_10114198 | |||
| 893 | Ga0070668_100010096 | |||
| 894 | Ga0070668_100396819 | |||
| 895 | Ga0070668_100443761 | |||
| 896 | Ga0070669_100003361 | |||
| 897 | Ga0070675_100067313 | |||
| 898 | Ga0070675_100212056 | |||
| 899 | Ga0070671_100546502 | |||
| 900 | Ga0070671_100657433 | |||
| 901 | Ga0070671_101585745 | |||
| 902 | Ga0070688_100241294 | |||
| 903 | Ga0070688_100346447 | |||
| 904 | Ga0070659_100056198 | |||
| 905 | Ga0070659_101281547 | |||
| 906 | Ga0070667_100000432 | |||
| 907 | Ga0070667_100159320 | |||
| 908 | Ga0070701_10169722 | |||
| 909 | Ga0070700_100022907 | |||
| 910 | Ga0070700_100625453 | |||
| 911 | Ga0070700_101513458 | |||
| 912 | Ga0070694_100313099 | |||
| 913 | Ga0070663_100286379 | |||
| 914 | Ga0070663_100810117 | |||
| 915 | Ga0070681_10363518 | |||
| 916 | Ga0070681_10939920 | |||
| 917 | Ga0068867_100168502 | |||
| 918 | Ga0070685_10021075 | |||
| 919 | Ga0070685_10824124 | |||
| 920 | Ga0070679_100059219 | |||
| 921 | Ga0070679_100694056 | |||
| 922 | Ga0070684_100003524 | |||
| 923 | Ga0070684_100217339 | |||
| 924 | Ga0070684_100609313 | |||
| 925 | Ga0070684_101153488 | |||
| 926 | Ga0070684_101235475 | |||
| 927 | Ga0068853_100567994 | |||
| 928 | Ga0068853_100681803 | |||
| 929 | Ga0068853_101010953 | |||
| 930 | Ga0070672_100286558 | |||
| 931 | Ga0070672_101263041 | |||
| 932 | Ga0070686_100278892 | |||
| 933 | Ga0070686_100471728 | |||
| 934 | Ga0070693_100248248 | |||
| 935 | Ga0070693_100424049 | |||
| 936 | Ga0070693_101158774 | |||
| 937 | Ga0070665_100042384 | |||
| 938 | Ga0070665_100120151 | |||
| 939 | Ga0070665_100290442 | |||
| 940 | Ga0070665_100291386 | |||
| 941 | Ga0068855_100267083 | |||
| 942 | Ga0070664_100218826 | |||
| 943 | Ga0070664_100410291 | |||
| 944 | Ga0070664_100485871 | |||
| 945 | Ga0070664_100667758 | |||
| 946 | Ga0070664_101005729 | |||
| 947 | Ga0068857_100039278 | |||
| 948 | Ga0068857_100560933 | |||
| 949 | Ga0068854_100184745 | |||
| 950 | Ga0068856_100051542 | |||
| 951 | Ga0070702_100076638 | |||
| 952 | Ga0070702_100166339 | |||
| 953 | Ga0070702_100183340 | |||
| 954 | Ga0068852_100249938 | |||
| 955 | Ga0068852_100627398 | |||
| 956 | Ga0068859_100032205 | |||
| 957 | Ga0068859_100257908 | |||
| 958 | Ga0068859_100422240 | |||
| 959 | Ga0068859_101754097 | |||
| 960 | Ga0068864_100086949 | |||
| 961 | Ga0068864_100644803 | |||
| 962 | Ga0068864_100854460 | |||
| 963 | Ga0068866_10369475 | |||
| 964 | Ga0068866_10682626 | |||
| 965 | Ga0068861_100172731 | |||
| 966 | Ga0068861_100212407 | |||
| 967 | Ga0068861_100376667 | |||
| 968 | Ga0068861_100588169 | |||
| 969 | Ga0068851_10290397 | |||
| 970 | Ga0068851_10425587 | |||
| 971 | Ga0068870_10243976 | |||
| 972 | Ga0068863_100001815 | |||
| 973 | Ga0068863_100056451 | |||
| 974 | Ga0068863_101576294 | |||
| 975 | Ga0068858_100006606 | |||
| 976 | Ga0068858_100019647 | |||
| 977 | Ga0068858_100091789 | |||
| 978 | Ga0068858_100911476 | |||
| 979 | Ga0068860_100000140 | |||
| 980 | Ga0068860_100081601 | |||
| 981 | Ga0068862_100000034 | |||
| 982 | Ga0068862_100141255 | |||
| 983 | Ga0081455_10005208 | |||
| 984 | Ga0081455_10008436 | |||
| 985 | Ga0081455_10023824 | |||
| 986 | Ga0081455_10105170 | |||
| 987 | Ga0081540_1017822 | |||
| 988 | Ga0081539_10003389 | |||
| 989 | Ga0081539_10162290 | |||
| 990 | Ga0075365_10000512 | |||
| 991 | Ga0075365_10004406 | |||
| 992 | Ga0075365_10311391 | |||
| 993 | Ga0075365_10398331 | |||
| 994 | Ga0075368_10133693 | |||
| 995 | Ga0075363_100031624 | |||
| 996 | Ga0075363_100169960 | |||
| 997 | Ga0075363_100261095 | |||
| 998 | Ga0075363_100523830 | |||
| 999 | Ga0075364_10685415 | |||
| 1000 | Ga0070715_10287920 | |||
| 1001 | Ga0075362_10172277 | |||
| 1002 | Ga0075367_10373970 | |||
| 1003 | Ga0075367_10591898 | |||
| 1004 | Ga0075370_10100217 | |||
| 1005 | Ga0068871_100643194 | |||
| 1006 | Ga0075428_100573065 | |||
| 1007 | Ga0075430_100004635 | |||
| 1008 | Ga0075431_100025721 | |||
| 1009 | Ga0075431_100897479 | |||
| 1010 | Ga0075429_100002834 | |||
| 1011 | Ga0068865_100009402 | |||
| 1012 | Ga0068865_101343163 | |||
| 1013 | Ga0097620_100032205 | |||
| 1014 | Ga0097620_100257909 | |||
| 1015 | Ga0097620_100422226 | |||
| 1016 | Ga0097620_101754221 | |||
| 1017 | Ga0105251_10271334 | |||
| 1018 | Ga0105244_10200279 | |||
| 1019 | Ga0111539_12197983 | |||
| 1020 | Ga0105245_10049423 | |||
| 1021 | Ga0105245_10121541 | |||
| 1022 | Ga0105245_10286270 | |||
| 1023 | Ga0105245_10693758 | |||
| 1024 | Ga0105245_11968521 | |||
| 1025 | Ga0105247_10000065 | |||
| 1026 | Ga0105247_10082542 | |||
| 1027 | Ga0105247_10157390 | |||
| 1028 | Ga0105247_10977683 | |||
| 1029 | Ga0114129_10063703 | |||
| 1030 | Ga0114129_11049491 | |||
| 1031 | Ga0114129_11318244 | |||
| 1032 | Ga0105243_10062246 | |||
| 1033 | Ga0105243_10079772 | |||
| 1034 | Ga0105243_10100460 | |||
| 1035 | Ga0105243_10635656 | |||
| 1036 | Ga0105243_10778341 | |||
| 1037 | Ga0105243_11237979 | |||
| 1038 | Ga0105243_11632457 | |||
| 1039 | Ga0105241_10684221 | |||
| 1040 | Ga0105241_10817677 | |||
| 1041 | Ga0105242_12098112 | |||
| 1042 | Ga0105248_10000067 | |||
| 1043 | Ga0105248_10128116 | |||
| 1044 | Ga0105248_10147229 | |||
| 1045 | Ga0105248_10777106 | |||
| 1046 | Ga0105237_10014123 | |||
| 1047 | Ga0105237_11399045 | |||
| 1048 | Ga0105238_10539382 | |||
| 1049 | Ga0105238_10756027 | |||
| 1050 | Ga0105238_10990769 | |||
| 1051 | Ga0105249_10000051 | |||
| 1052 | Ga0105249_10174574 | |||
| 1053 | Ga0105249_10229480 | |||
| 1054 | Ga0105239_10017001 | |||
| 1055 | Ga0105239_10107810 | |||
| 1056 | Ga0105239_10135079 | |||
| 1057 | Ga0105239_11812853 | |||
| 1058 | Ga0105246_10005334 | |||
| 1059 | Ga0105246_10754512 | |||
| 1060 | Ga0105246_11279175 | |||
| 1061 | Ga0157328_1012475 | |||
| 1062 | Ga0157322_1024428 | |||
| 1063 | Ga0157371_10943450 | |||
| 1064 | Ga0157369_10437358 | |||
| 1065 | Ga0157369_10759209 | |||
| 1066 | Ga0157374_10002631 | |||
| 1067 | Ga0157374_10739751 | |||
| 1068 | Ga0157374_11252365 | |||
| 1069 | Ga0157378_10605632 | |||
| 1070 | Ga0163162_10060396 | |||
| 1071 | Ga0163162_10230348 | |||
| 1072 | Ga0163162_10251329 | |||
| 1073 | Ga0163162_10415130 | |||
| 1074 | Ga0163162_10651708 | |||
| 1075 | Ga0163162_10672381 | |||
| 1076 | Ga0163162_12365802 | |||
| 1077 | Ga0157372_10016137 | |||
| 1078 | Ga0157372_10377116 | |||
| 1079 | Ga0157372_10835470 | |||
| 1080 | Ga0157375_10043714 | |||
| 1081 | Ga0157375_10176786 | |||
| 1082 | Ga0157375_10645500 | |||
| 1083 | Ga0157375_11349356 | |||
| 1084 | Ga0157375_11411888 | |||
| 1085 | Ga0157375_13277522 | |||
| 1086 | Ga0163163_10169117 | |||
| 1087 | Ga0163163_10193215 | |||
| 1088 | Ga0163163_10468376 | |||
| 1089 | Ga0163163_10633812 | |||
| 1090 | Ga0163163_10657011 | |||
| 1091 | Ga0157380_10038706 | |||
| 1092 | Ga0157380_11178472 | |||
| 1093 | Ga0157380_11276242 | |||
| 1094 | Ga0157380_12745482 | |||
| 1095 | Ga0157380_12946312 | |||
| 1096 | Ga0157377_10256865 | |||
| 1097 | Ga0157377_11119613 | |||
| 1098 | Ga0157379_10047850 | |||
| 1099 | Ga0157379_10415711 | |||
| 1100 | Ga0157379_10616215 | |||
| 1101 | Ga0157379_10893363 | |||
| 1102 | Ga0157376_10300034 | |||
| 1103 | Ga0157376_10701739 | |||
| 1104 | Ga0157376_12654233 | |||
| 1105 | Ga0163161_10025668 | |||
| 1106 | Ga0163161_10523728 | |||
| 1107 | Ga0163161_10800911 | |||
| 1108 | Ga0197907_11437332 | |||
| 1109 | Ga0206355_1537635 | |||
| 1110 | Ga0206355_1666784 | |||
| 1111 | Ga0206352_10467026 | |||
| 1112 | Ga0206354_10237669 | |||
| 1113 | Ga0206354_10488921 | |||
| 1114 | Ga0206353_10446262 | |||
| 1115 | Ga0206353_10590081 | |||
| 1116 | Ga0154015_1046720 | |||
| 1117 | Ga0213875_10024669 | |||
| 1118 | Ga0224712_10173611 | |||
| 1119 | Ga0207642_10187534 | |||
| 1120 | Ga0207642_10235959 | |||
| 1121 | Ga0207642_10292463 | |||
| 1122 | Ga0207642_10372595 | |||
| 1123 | Ga0207710_10000089 | |||
| 1124 | Ga0207688_10013848 | |||
| 1125 | Ga0207688_10017436 | |||
| 1126 | Ga0207688_10343754 | |||
| 1127 | Ga0207647_10039445 | |||
| 1128 | Ga0207645_10039602 | |||
| 1129 | Ga0207643_10005026 | |||
| 1130 | Ga0207643_10055690 | |||
| 1131 | Ga0207705_10088468 | |||
| 1132 | Ga0207705_10105475 | |||
| 1133 | Ga0207705_10380331 | |||
| 1134 | Ga0207707_10133987 | |||
| 1135 | Ga0207707_10865211 | |||
| 1136 | Ga0207671_10029794 | |||
| 1137 | Ga0207671_10684716 | |||
| 1138 | Ga0207662_10281644 | |||
| 1139 | Ga0207662_10392598 | |||
| 1140 | Ga0207657_10191883 | |||
| 1141 | Ga0207657_10623205 | |||
| 1142 | Ga0207657_10878542 | |||
| 1143 | Ga0207657_11488479 | |||
| 1144 | Ga0207652_10006742 | |||
| 1145 | Ga0207681_10000955 | |||
| 1146 | Ga0207694_10292001 | |||
| 1147 | Ga0207694_11303163 | |||
| 1148 | Ga0207650_10986911 | |||
| 1149 | Ga0207659_10090071 | |||
| 1150 | Ga0207659_10517242 | |||
| 1151 | Ga0207687_10025363 | |||
| 1152 | Ga0207687_10122377 | |||
| 1153 | Ga0207687_11025168 | |||
| 1154 | Ga0207644_10267918 | |||
| 1155 | Ga0207690_10065216 | |||
| 1156 | Ga0207690_10161503 | |||
| 1157 | Ga0207706_10196692 | |||
| 1158 | Ga0207706_10453659 | |||
| 1159 | Ga0207709_10416760 | |||
| 1160 | Ga0207704_10374667 | |||
| 1161 | Ga0207704_10684678 | |||
| 1162 | Ga0207711_10000091 | |||
| 1163 | Ga0207711_10231583 | |||
| 1164 | Ga0207711_10410525 | |||
| 1165 | Ga0207689_10012353 | |||
| 1166 | Ga0207661_10477025 | |||
| 1167 | Ga0207661_10631246 | |||
| 1168 | Ga0207661_10651542 | |||
| 1169 | Ga0207661_11884116 | |||
| 1170 | Ga0207679_11135132 | |||
| 1171 | Ga0207679_11777126 | |||
| 1172 | Ga0207667_11583965 | |||
| 1173 | Ga0207712_10000043 | |||
| 1174 | Ga0207712_10058830 | |||
| 1175 | Ga0207668_10015963 | |||
| 1176 | Ga0207668_10227696 | |||
| 1177 | Ga0207668_10970912 | |||
| 1178 | Ga0207640_11848502 | |||
| 1179 | Ga0207658_10002150 | |||
| 1180 | Ga0207658_10086104 | |||
| 1181 | Ga0207658_10494224 | |||
| 1182 | Ga0207658_11537262 | |||
| 1183 | Ga0207677_10524221 | |||
| 1184 | Ga0207677_10524946 | |||
| 1185 | Ga0207703_10187530 | |||
| 1186 | Ga0207703_10258374 | |||
| 1187 | Ga0207703_10496429 | |||
| 1188 | Ga0207703_10933190 | |||
| 1189 | Ga0207639_11121263 | |||
| 1190 | Ga0207639_11188568 | |||
| 1191 | Ga0207678_10094057 | |||
| 1192 | Ga0207678_10586918 | |||
| 1193 | Ga0207708_10019119 | |||
| 1194 | Ga0207708_10044344 | |||
| 1195 | Ga0207708_10054943 | |||
| 1196 | Ga0207708_10888195 | |||
| 1197 | Ga0207708_11323869 | |||
| 1198 | Ga0207702_10307793 | |||
| 1199 | Ga0207702_11132617 | |||
| 1200 | Ga0207641_10064158 | |||
| 1201 | Ga0207641_10082249 | |||
| 1202 | Ga0207641_10183619 | |||
| 1203 | Ga0207648_10077261 | |||
| 1204 | Ga0207676_10562121 | |||
| 1205 | Ga0207676_10684026 | |||
| 1206 | Ga0207676_11012966 | |||
| 1207 | Ga0207676_11089325 | |||
| 1208 | Ga0207674_10016969 | |||
| 1209 | Ga0207674_10202943 | |||
| 1210 | Ga0207674_10276026 | |||
| 1211 | Ga0207674_11176582 | |||
| 1212 | Ga0207675_100092181 | |||
| 1213 | Ga0207675_100136680 | |||
| 1214 | Ga0207675_100366322 | |||
| 1215 | Ga0207675_100941777 | |||
| 1216 | Ga0207683_10029382 | |||
| 1217 | Ga0207683_10048530 | |||
| 1218 | Ga0207683_10259622 | |||
| 1219 | Ga0207698_10605420 | |||
| 1220 | Ga0209813_10177766 | |||
| 1221 | Ga0209974_10003307 | |||
| 1222 | Ga0268266_10014521 | |||
| 1223 | Ga0268266_10084735 | |||
| 1224 | Ga0268266_10196577 | |||
| 1225 | Ga0268265_10000027 | |||
| 1226 | Ga0268265_11019790 | |||
| 1227 | Ga0268264_10000127 | |||
| 1228 | Ga0268264_10055903 | |||
| 1229 | Ga0268264_11537199 | |||
| 1230 | Ga0316180_1179688 | |||
| 1231 | Ga0307513_10650260 | |||
| 1232 | Ga0307408_100004108 | |||
| 1233 | Ga0307408_100707667 | |||
| 1234 | Ga0307408_100911274 | |||
| 1235 | Ga0265314_10010611 | |||
| 1236 | Ga0307516_10361035 | |||
| 1237 | Ga0307405_10007098 | |||
| 1238 | Ga0307405_10134083 | |||
| 1239 | Ga0307405_10653106 | |||
| 1240 | Ga0307413_10040543 | |||
| 1241 | Ga0307413_10114308 | |||
| 1242 | Ga0307413_10616921 | |||
| 1243 | Ga0307413_10627508 | |||
| 1244 | Ga0307413_10753871 | |||
| 1245 | Ga0307413_10866558 | |||
| 1246 | Ga0307413_10998179 | |||
| 1247 | Ga0307410_10096546 | |||
| 1248 | Ga0307410_10149722 | |||
| 1249 | Ga0307410_10235418 | |||
| 1250 | Ga0307410_10382038 | |||
| 1251 | Ga0326468_10026058 | |||
| 1252 | Ga0307406_10000351 | |||
| 1253 | Ga0307406_10134669 | |||
| 1254 | Ga0307407_10011368 | |||
| 1255 | Ga0307407_10060954 | |||
| 1256 | Ga0307407_10266633 | |||
| 1257 | Ga0307407_10313732 | |||
| 1258 | Ga0307407_10343687 | |||
| 1259 | Ga0307407_10440523 | |||
| 1260 | Ga0307407_10727769 | |||
| 1261 | Ga0307412_10007532 | |||
| 1262 | Ga0307412_10074713 | |||
| 1263 | Ga0307412_10113443 | |||
| 1264 | Ga0307412_10221032 | |||
| 1265 | Ga0307412_10262109 | |||
| 1266 | Ga0307409_100000384 | |||
| 1267 | Ga0307409_100006886 | |||
| 1268 | Ga0307409_100197467 | |||
| 1269 | Ga0307409_100224734 | |||
| 1270 | Ga0307409_100360284 | |||
| 1271 | Ga0307409_100360996 | |||
| 1272 | Ga0307409_100399290 | |||
| 1273 | Ga0307409_100524765 | |||
| 1274 | Ga0307409_101257554 | |||
| 1275 | Ga0307409_101299681 | |||
| 1276 | Ga0307409_101614947 | |||
| 1277 | Ga0307416_100000202 | |||
| 1278 | Ga0307416_100076047 | |||
| 1279 | Ga0307416_100296926 | |||
| 1280 | Ga0307416_100406094 | |||
| 1281 | Ga0307416_100472994 | |||
| 1282 | Ga0307416_100712150 | |||
| 1283 | Ga0307416_103346912 | |||
| 1284 | Ga0307414_10066607 | |||
| 1285 | Ga0307414_10433920 | |||
| 1286 | Ga0307414_10646795 | |||
| 1287 | Ga0307414_11290917 | |||
| 1288 | Ga0307414_11422459 | |||
| 1289 | Ga0307411_10109275 | |||
| 1290 | Ga0307411_10130483 | |||
| 1291 | Ga0307411_10200572 | |||
| 1292 | Ga0307411_10387683 | |||
| 1293 | Ga0307415_100008086 | |||
| 1294 | Ga0307415_100047581 | |||
| 1295 | Ga0307415_100330591 | |||
| 1296 | Ga0307415_100798146 | |||
| 1297 | Ga0307415_101537599 | |||
| 1298 | Ga0307415_101697499 | |||
| 1299 | Ga0307415_102293703 | |||
| 1300 | Ga0316593_10297345 | |||
| 1301 | Ga0307507_10082385 | |||
| 1302 | Ga0316212_1006312 | |||
| 1303 | Ga0373940_0024685 | |||
| 1304 | Ga0373951_0000111 | |||
| 1305 | Ga0373939_0164298 | |||
| 1306 | Ga0373956_0004902 | |||
| 1307 | Ga0373942_0000618 | |||
| 1308 | Ga0395898_0900844 | |||
| 1309 | Ga0395898_1909934 | |||
| 1310 | Ga0436364_0370199 | |||
| 1311 | Ga0436364_0800302 | |||
| 1312 | Ga0400486_10057 | |||
| 1313 | Ga0436365_0229193 | |||
| 1314 | Ga0436365_1721535 | |||
| 1315 | Ga0439461_0006261 | |||
| 1316 | Ga0439461_0116314 | |||
| 1317 | Ga0439465_0007956 | |||
| 1318 | Ga0451787_707672 | |||
| 1319 | Ga0451789_0786992 | |||
| 1320 | Ga0451794_38020 | |||
| 1321 | Ga0451793_1877998 | |||
| 1322 | Ga0451797_0867144 | |||
| 1323 | Ga0451795_0104097 | |||
| 1324 | Ga0451833_1383050 | |||
| 1325 | Ga0451835_1256974 | |||
| 1326 | Ga0451841_1378285 | |||
| 1327 | Ga0451849_1036751 | |||
| 1328 | Ga0451849_1244970 | |||
| 1329 | Ga0439431_0075201 | |||
| 1330 | Ga0439433_0110734 | |||
| 1331 | Ga0439448_0109178 | |||
| 1332 | Ga0439459_0115643 | |||
| 1333 | Ga0466969_0122213 | |||
| 1334 | Ga0466965_0007987 | |||
| 1335 | Ga0466965_0038050 | |||
| 1336 | Ga0466966_0018089 | |||
| 1337 | Ga0466966_0141483 | |||
| 1338 | Ga0466961_0008483 | |||
| 1339 | Ga0466961_0023991 | |||
| 1340 | Ga0466963_0023550 | |||
| 1341 | Ga0466963_0341526 | |||
| 1342 | Ga0466963_1283544 | |||
| 1343 | Ga0466964_0009950 | |||
| 1344 | Ga0466964_0268515 | |||
| 1345 | Ga0466971_0088526 | |||
| 1346 | Ga0466970_0001442 | |||
| 1347 | Ga0466957_0015711 | |||
| 1348 | Ga0466957_0043411 | |||
| 1349 | Ga0466960_0001275 | |||
| 1350 | Ga0466960_0108019 | |||
| 1351 | Ga0466960_0112553 | |||
| 1352 | Ga0466960_0596248 | |||
| 1353 | Ga0466959_0081309 | |||
| 1354 | Ga0451576_0041977 | |||
| 1355 | Ga0466958_0002161 | |||
| 1356 | Ga0466958_0077654 | |||
| 1357 | Ga0466967_0002113 | |||
| 1358 | Ga0466967_0042860 | |||
| 1359 | Ga0466967_0069744 | |||
| 1360 | Ga0466967_0138337 | |||
| 1361 | Ga0466967_0167722 | |||
| 1362 | Ga0466967_0307707 | |||
| 1363 | Ga0466967_0402211 | |||
| 1364 | Ga0495603_0237117 | |||
| 1365 | Ga0495629_0212728 | |||
| 1366 | Ga0495651_0134004 | |||
| 1367 | Ga0495662_0153997 | |||
| 1368 | Ga0495596_0161149 | |||
| 1369 | Ga0495596_0179583 | |||
| 1370 | Ga0495583_0133698 | |||
| 1371 | Ga0495606_0007788 | |||
| 1372 | Ga0495608_0449067 | |||
| 1373 | Ga0495620_0174958 | |||
| 1374 | Ga0495632_0015091 | |||
| 1375 | Ga0495637_0098686 | |||
| 1376 | Ga0495648_0013828 | |||
| 1377 | Ga0495663_0045274 | |||
| 1378 | Ga0495652_0391189 | |||
| 1379 | Ga0495640_0237143 | |||
| 1380 | Ga0495667_0250256 | |||
| 1381 | Ga0495656_0018756 | |||
| 1382 | Ga0495656_0415778 | |||
| 1383 | Ga0495668_0029298 | |||
| 1384 | Ga0495668_0229007 | |||
| 1385 | Ga0495611_0111418 | |||
| 1386 | Ga0495635_0029079 | |||
| 1387 | Ga0495661_0252072 | |||
| 1388 | Ga0495588_0598872 | |||
| 1389 | Ga0495670_0081207 | |||
| 1390 | Ga0495670_0692177 | |||
| 1391 | Ga0495671_0101447 | |||
| 1392 | Ga0495600_0157895 | |||
| 1393 | Ga0495600_0463744 | |||
| 1394 | Ga0495674_0734035 | |||
| 1395 | Ga0495672_0002575 | |||
| 1396 | Ga0495672_0034233 | |||
| 1397 | Ga0495680_0121473 | |||
| 1398 | Ga0495680_0219498 | |||
| 1399 | Ga0495673_0000444 | |||
| 1400 | Ga0495686_0267361 | |||
| 1401 | Ga0496100_0328605 | |||
| 1402 | Ga0496100_0434550 | |||
| 1403 | Ga0496100_0548776 | |||
| 1404 | Ga0496100_0775642 | |||
| 1405 | Ga0496101_0000026 | |||
| 1406 | Ga0496101_0057138 | |||
| 1407 | Ga0496102_0000031 | |||
| 1408 | Ga0496102_0001061 | |||
| 1409 | Ga0496102_0008531 | |||
| 1410 | Ga0496102_0010274 | |||
| 1411 | Ga0496102_0413858 | |||
| 1412 | Ga0496102_1188322 | |||
| 1413 | Ga0496102_1677600 | |||
| 1414 | Ga0496103_0000025 | |||
| 1415 | Ga0496103_0000521 | |||
| 1416 | Ga0496103_0639552 | |||
| 1417 | Ga0496104_0001896 | |||
| 1418 | Ga0496104_0081732 | |||
| 1419 | Ga0496104_0217587 | |||
| 1420 | Ga0496104_0470074 | |||
| 1421 | Ga0496104_0718243 | |||
| 1422 | Ga0496105_0002045 | |||
| 1423 | Ga0496105_0077224 | |||
| 1424 | Ga0496105_0493623 | |||
| 1425 | Ga0496106_0020434 | |||
| 1426 | Ga0496106_0410220 | |||
| 1427 | Ga0496106_0784192 | |||
| 1428 | Ga0496106_1074722 | |||
| 1429 | Ga0496107_0020405 | |||
| 1430 | Ga0496107_0095336 | |||
| 1431 | Ga0496107_0105175 | |||
| 1432 | Ga0496107_0584415 | |||
| 1433 | Ga0496107_0590546 | |||
| 1434 | Ga0496107_0777917 | |||
| 1435 | Ga0496108_0018135 | |||
| 1436 | Ga0496108_0077705 | |||
| 1437 | Ga0496108_0244927 | |||
| 1438 | Ga0496108_0505388 | |||
| 1439 | Ga0496108_0531196 | |||
| 1440 | Ga0496109_0035352 | |||
| 1441 | Ga0496109_0057643 | |||
| 1442 | Ga0496109_0179239 | |||
| 1443 | Ga0496109_0191225 | |||
| 1444 | Ga0496109_0336942 | |||
| 1445 | Ga0496109_0437796 | |||
| 1446 | Ga0496109_0635552 | |||
| 1447 | Ga0496109_0929944 | |||
| 1448 | Ga0496109_1111628 | |||
| 1449 | Ga0496109_1375430 | |||
| 1450 | Ga0496109_1494225 | |||
| 1451 | Ga0496110_0041681 | |||
| 1452 | Ga0496110_0088233 | |||
| 1453 | Ga0496110_0299734 | |||
| 1454 | Ga0496110_0408581 | |||
| 1455 | Ga0496110_0567035 | |||
| 1456 | Ga0496110_0740835 | |||
| 1457 | Ga0496111_0002344 | |||
| 1458 | Ga0496111_0152242 | |||
| 1459 | Ga0496111_0476066 | |||
| 1460 | Ga0496111_1129723 | |||
| 1461 | Ga0496111_1130455 | |||
| 1462 | Ga0496112_0076570 | |||
| 1463 | Ga0496112_0102024 | |||
| 1464 | Ga0496112_1922357 | |||
| 1465 | Ga0496113_0027694 | |||
| 1466 | Ga0496113_0373317 | |||
| 1467 | Ga0496113_0784230 | |||
| 1468 | Ga0496113_0965282 | |||
| 1469 | Ga0496113_1548954 | |||
| 1470 | Ga0496114_0019400 | |||
| 1471 | Ga0496114_0049962 | |||
| 1472 | Ga0496114_0549306 | |||
| 1473 | Ga0496114_1124850 | |||
| 1474 | Ga0496115_0102404 | |||
| 1475 | Ga0496116_0000084 | |||
| 1476 | Ga0496116_0012299 | |||
| 1477 | Ga0496117_0000018 | |||
| 1478 | Ga0496117_0003175 | |||
| 1479 | Ga0496118_0000013 | |||
| 1480 | Ga0496118_0001120 | |||
| 1481 | Ga0496119_0001033 | |||
| 1482 | Ga0496119_0009526 | |||
| 1483 | Ga0496119_0096382 | |||
| 1484 | Ga0496120_0000418 | |||
| 1485 | Ga0496120_0006102 | |||
| 1486 | Ga0496121_0000056 | |||
| 1487 | Ga0496121_0008270 | |||
| 1488 | Ga0496124_0067027 | |||
| 1489 | Ga0496125_0009200 | |||
| 1490 | Ga0496126_0002664 | |||
| 1491 | Ga0501306_008094 | |||
| 1492 | Ga0501306_013711 | |||
| 1493 | Ga0501306_026237 | |||
| 1494 | Ga0501306_035627 | |||
| 1495 | Ga0501306_100055 | |||
| 1496 | Ga0501308_023215 | |||
| 1497 | Ga0501308_078777 | |||
| 1498 | Ga0501309_009803 | |||
| 1499 | Ga0501309_036569 | |||
| 1500 | Ga0501309_059324 | |||
| 1501 | Ga0501309_098013 | |||
| 1502 | Ga0501310_000128 | |||
| 1503 | Ga0501310_012829 | |||
| 1504 | Ga0501310_017530 | |||
| 1505 | Ga0501310_022786 | |||
| 1506 | Ga0501310_025747 | |||
| 1507 | Ga0501310_035918 | |||
| 1508 | Ga0501310_042492 | |||
| 1509 | Ga0501310_044254 | |||
| 1510 | Ga0501310_053390 | |||
| 1511 | Ga0501341_07290 | |||
| 1512 | Ga0501304_008579 | |||
| 1513 | Ga0501304_015143 | |||
| 1514 | Ga0501305_003880 | |||
| 1515 | Ga0501305_039832 | |||
| 1516 | Ga0501305_055843 | |||
| 1517 | Ga0501305_064617 | |||
| 1518 | Ga0501305_108569 | |||
| 1519 | Ga0501307_004015 | |||
| 1520 | Ga0501307_030126 | |||
| 1521 | Ga0501307_055754 | |||
| 1522 | Ga0501291_024418 | |||
| 1523 | Ga0501311_005386 | |||
| 1524 | Ga0501311_091285 | |||
| 1525 | Ga0501312_037887 | |||
| 1526 | Ga0501312_084136 | |||
| 1527 | Ga0501312_088491 | |||
| 1528 | Ga0501312_098031 | |||
| 1529 | Ga0501312_120633 | |||
| 1530 | Ga0501313_068268 | |||
| 1531 | Ga0501314_021685 | |||
| 1532 | Ga0501315_013456 | |||
| 1533 | Ga0501315_016671 | |||
| 1534 | Ga0501315_044349 | |||
| 1535 | Ga0501316_024524 | |||
| 1536 | Ga0501316_047792 | |||
| 1537 | Ga0501316_066454 | |||
| 1538 | Ga0501317_005721 | |||
| 1539 | Ga0501317_015307 | |||
| 1540 | Ga0501317_017476 | |||
| 1541 | Ga0501317_034541 | |||
| 1542 | Ga0501317_039754 | |||
| 1543 | Ga0501317_047493 | |||
| 1544 | Ga0501317_068984 | |||
| 1545 | Ga0501317_078681 | |||
| 1546 | Ga0501318_006622 | |||
| 1547 | Ga0501318_007610 | |||
| 1548 | Ga0501318_015169 | |||
| 1549 | Ga0501318_063571 | |||
| 1550 | Ga0501320_013294 | |||
| 1551 | Ga0501321_002857 | |||
| 1552 | Ga0501321_006525 | |||
| 1553 | Ga0501321_011649 | |||
| 1554 | Ga0501321_026875 | |||
| 1555 | Ga0501321_032037 | |||
| 1556 | Ga0501321_074251 | |||
| 1557 | Ga0501321_079861 | |||
| 1558 | Ga0501322_002466 | |||
| 1559 | Ga0501323_005780 | |||
| 1560 | Ga0501323_012824 | |||
| 1561 | Ga0501323_071541 | |||
| 1562 | Ga0501325_001770 | |||
| 1563 | Ga0501325_038963 | |||
| 1564 | Ga0501330_006144 | |||
| 1565 | Ga0501331_00744 | |||
| 1566 | Ga0501332_12510 | |||
| 1567 | Ga0501336_005035 | |||
| 1568 | Ga0501340_005401 | |||
| 1569 | Ga0501031_0012399 | |||
| 1570 | Ga0501031_0319283 | |||
| 1571 | Ga0501032_0022265 | |||
| 1572 | Ga0501032_0148063 | |||
| 1573 | Ga0501033_0109174 | |||
| 1574 | Ga0501033_0649696 | |||
| 1575 | Ga0501034_0060431 | |||
| 1576 | Ga0501034_0157108 | |||
| 1577 | Ga0501034_0600641 | |||
| 1578 | Ga0501036_0003887 | |||
| 1579 | Ga0501036_0075150 | |||
| 1580 | Ga0501036_0126363 | |||
| 1581 | Ga0501036_0578496 | |||
| 1582 | Ga0501037_0001404 | |||
| 1583 | Ga0501037_0011156 | |||
| 1584 | Ga0501037_0281657 | |||
| 1585 | Ga0501038_0000759 | |||
| 1586 | Ga0501038_0034435 | |||
| 1587 | Ga0501038_0471536 | |||
| 1588 | Ga0501039_0023422 | |||
| 1589 | Ga0501039_0080671 | |||
| 1590 | Ga0501039_0780899 | |||
| 1591 | Ga0501040_0007280 | |||
| 1592 | Ga0501040_0511777 | |||
| 1593 | Ga0501040_0537189 | |||
| 1594 | Ga0501040_0582582 | |||
| 1595 | Ga0501041_0002242 | |||
| 1596 | Ga0501041_0130299 | |||
| 1597 | Ga0501042_0010005 | |||
| 1598 | Ga0501042_0050735 | |||
| 1599 | Ga0501042_0295372 | |||
| 1600 | Ga0501042_0680117 | |||
| 1601 | Ga0501043_0000624 | |||
| 1602 | Ga0501043_0043377 | |||
| 1603 | Ga0501043_0596299 | |||
| 1604 | Ga0501046_0043263 | |||
| 1605 | Ga0501046_0488780 | |||
| 1606 | Ga0501047_0008218 | |||
| 1607 | Ga0501048_0002565 | |||
| 1608 | Ga0501048_0016909 | |||
| 1609 | Ga0501048_0085034 | |||
| 1610 | Ga0501048_0407001 | |||
| 1611 | Ga0501048_0507037 | |||
| 1612 | Ga0501067_0254514 | |||
| 1613 | Ga0501068_0159499 | |||
| 1614 | Ga0501068_0455787 | |||
| 1615 | Ga0501068_0638804 | |||
| 1616 | Ga0501069_0021713 | |||
| 1617 | Ga0501069_0064505 | |||
| 1618 | Ga0501069_0110210 | |||
| 1619 | Ga0501069_0559815 | |||
| 1620 | Ga0501070_0000743 | |||
| 1621 | Ga0501070_0141145 | |||
| 1622 | Ga0501070_0505636 | |||
| 1623 | Ga0501070_0635443 | |||
| 1624 | Ga0501071_0003883 | |||
| 1625 | Ga0501071_0764603 | |||
| 1626 | Ga0501071_1005336 | |||
| 1627 | Ga0501071_1143468 | |||
| 1628 | Ga0501072_0001887 | |||
| 1629 | Ga0501072_0091792 | |||
| 1630 | Ga0501072_0349927 | |||
| 1631 | Ga0501073_0019467 | |||
| 1632 | Ga0501073_0055586 | |||
| 1633 | Ga0501073_0138290 | |||
| 1634 | Ga0501073_0138625 | |||
| 1635 | Ga0501073_0549000 | |||
| 1636 | Ga0501074_0001922 | |||
| 1637 | Ga0501074_0005993 | |||
| 1638 | Ga0501074_0030459 | |||
| 1639 | Ga0501074_0551991 | |||
| 1640 | Ga0501075_0217304 | |||
| 1641 | Ga0501076_0004239 | |||
| 1642 | Ga0501076_0268866 | |||
| 1643 | Ga0501076_0303671 | |||
| 1644 | Ga0501077_0082549 | |||
| 1645 | Ga0501077_0197062 | |||
| 1646 | Ga0501214_020069 | |||
| 1647 | Ga0501243_137586 | |||
| 1648 | Ga0501253_058829 | |||
| 1649 | Ga0501079_0003642 | |||
| 1650 | Ga0501079_0271966 | |||
| 1651 | Ga0501079_0317096 | |||
| 1652 | Ga0501079_0432705 | |||
| 1653 | Ga0501079_0450305 | |||
| 1654 | Ga0501080_0039146 | |||
| 1655 | Ga0501080_0326470 | |||
| 1656 | Ga0501080_0739870 | |||
| 1657 | Ga0501080_0791760 | |||
| 1658 | Ga0501081_0069864 | |||
| 1659 | Ga0501083_0035666 | |||
| 1660 | Ga0501035_0015863 | |||
| 1661 | Ga0501044_0101358 | |||
| 1662 | Ga0501044_0331718 | |||
| 1663 | Ga0501044_0437965 | |||
| 1664 | Ga0501044_0848771 | |||
| 1665 | Ga0501044_0862690 | |||
| 1666 | Ga0501044_0870958 | |||
| 1667 | Ga0501045_0006408 | |||
| 1668 | Ga0501045_0340365 | |||
| 1669 | nmdc:mga03683_151531_c1 | |||
| 1670 | nmdc:mga03n38_37536_c1 | |||
| 1671 | nmdc:mga03n38_697536_c1 | |||
| 1672 | nmdc:mga00v17_114942_c1 | |||
| 1673 | nmdc:mga0yw44_122880_c1 | |||
| 1674 | nmdc:mga0yw44_19236_c1 | |||
| 1675 | nmdc:mga0yw44_29668_c1 | |||
| 1676 | nmdc:mga0yw44_319468_c1 | |||
| 1677 | nmdc:mga0yw44_5193_c1 | |||
| 1678 | nmdc:mga0yw44_6588_c1 | |||
| 1679 | nmdc:mga06z11_404907_c1 | |||
| 1680 | nmdc:mga04h51_126501_c1 | |||
| 1681 | nmdc:mga07m45_103753_c1 | |||
| 1682 | nmdc:mga09592_107261_c1 | |||
| 1683 | nmdc:mga0qj67_56091_c1 | |||
| 1684 | Ga0500635_0007481 | |||
| 1685 | Ga0495655_0231897 | |||
| 1686 | Ga0495619_0051747 | |||
| 1687 | Ga0500643_012033 | |||
| 1688 | Ga0500591_160439 | |||
| 1689 | Ga0500652_001762 | |||
| 1690 | Ga0500573_0015258 | |||
| 1691 | Ga0500616_0009295 | |||
| 1692 | Ga0500620_027847 | |||
| 1693 | Ga0500624_022288 | |||
| 1694 | Ga0500637_0012957 | |||
| 1695 | Ga0501084_0014898 | |||
| 1696 | Ga0501084_0054959 | |||
| 1697 | Ga0501084_0221023 | |||
| 1698 | Ga0587083_0075499 | |||
| 1699 | Ga0587083_0165833 | |||
| 1700 | Ga0587090_083790 | |||
| 1701 | Ga0587098_024866 | |||
| 1702 | Ga0587128_032896 | |||
| 1703 | Ga0587068_029138 | |||
| 1704 | Ga0587068_069272 | |||
| 1705 | Ga0587107_085251 | |||
| 1706 | Ga0501082_0024137 | |||
| 1707 | Ga0501082_0116180 | |||
| 1708 | Ga0501082_0165797 | |||
| 1709 | Ga0466962_0027951 | |||
| 1710 | Ga0530510_0002923 | |||
| 1711 | Ga0530510_0089022 | |||
| 1712 | 2643827093 | |||
| 1713 | 2644035102 | |||
| 1714 | 2644231726 | |||
| 1715 | 2644534446 | |||
| 1716 | 2738868853 | |||
| 1717 | 2739365734 | |||
| 1718 | 2740165457 | |||
| 1719 | 2812372654 | |||
| 1720 | 2819689853 | |||
| 1721 | 2819726591 | |||
| 1722 | 2832008891 | |||
| 1723 | 2842892623 | |||
| 1724 | 2855388535 | |||
| 1725 | 2857486171 | |||
| 1726 | 2866071152 | |||
| 1727 | 2902792439 | |||
| 1728 | 2974319879 | |||
| 1729 | 2984523751 | |||
| 1730 | 8054611848 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fto-assembly1.cif.gz_h | e. coli 70s ribosome with an improved ms2 tag inserted in h98 | 0.9886 | 1 | 41 |
| 8cgd-assembly1.cif.gz_h | clindamycin bound to the 50s subunit | 0.9885 | 1 | 41 |
| 8aye-assembly1.cif.gz_h | e. coli 70s ribosome bound to thermorubin and fmet-trna | 0.9875 | 1 | 41 |
| 8cgk-assembly1.cif.gz_h | lincomycin and avilamycin bound to the 50s subunit | 0.981 | 1 | 41 |
| 8ceu-assembly1.cif.gz_h | retapamulin and capreomycin bound to the 50s subunit | 0.9807 | 1 | 41 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HNM4_48_91_3.40.5.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.957 | 3 | 43 | 3.40.5.10 |
| af_P0A7R1_1_50_3.40.5.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9415 | 1 | 49 | 3.40.5.10 |
| 4kj5H00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9222 | 1 | 49 | 3.40.5.10 |
| 3j7zH00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9172 | 1 | 49 | 3.40.5.10 |
| af_Q54QM2_41_88_3.40.5.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain | 0.9142 | 3 | 48 | 3.40.5.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G0T2A4-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.8888 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0G0T2A4-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.8834 | 1 | 148 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6B0Z4J3-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.8733 | 1 | 147 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6B0Z4J3-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.8627 | 1 | 147 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E0VTH1-F1-model_v4 | Large ribosomal subunit protein bL9 | 0.8593 | 1 | 147 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |