F483844

General Info

Members Datasets Scaffolds Average Seq Length
861 460 1722 161

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10193543|Ga0157370_101935432
Length 195
Sequence MLSRALQSSSRFTGLHNASGSDLRGLAPDGRPFPVNELAKSAFLNRPDLHIGTEGEFAGWRTWSRDAFETNNGPFWHRMEDDGSIRCAFRVEKKHLNGARNVHGGCFMSFADYCLFATAAPILEGPGVTLSFACEFLAAVREGQLIEGRAEITRAGNSIVFLRGMLTSAEKPVFSFSGSIKRVARKIPPAAGINT

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
196 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
308 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
358 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
381 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
382 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
383 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
384 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
385 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
386 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
392 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
393 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
394 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
395 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
396 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
397 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
398 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
399 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
400 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
401 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
402 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
403 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
404 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
405 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
408 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
409 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
412 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
413 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
414 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
415 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
416 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
417 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
418 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
423 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
424 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
425 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
426 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
427 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
430 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
431 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
432 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
433 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
434 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
435 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
436 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
437 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
438 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
439 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
440 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
441 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
442 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
443 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
444 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
445 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
446 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
447 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
448 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
449 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
450 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
451 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
452 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
453 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
454 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
455 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
456 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
457 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
458 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
459 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
460 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0.12
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.12
Nodule 1.51
Rhizoplane 3.72
Rhizosphere 67.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10193543 3300013104 Bacteria 1887
2 JGI25406J46586_10000141 3300003203 Bacteria 31326
3 JGI25406J46586_10012298 3300003203 Bacteria 3721
4 JGI25404J52841_10046494 3300003659 Bacteria 915
5 Ga0065165_1001284 3300005262 Bacteria 28344
6 Ga0070676_10408636 3300005328 Bacteria 946
7 Ga0070683_100842246 3300005329 Bacteria 879
8 Ga0070683_101318389 3300005329 Bacteria 694
9 Ga0070670_100300604 3300005331 Bacteria 1404
10 Ga0068869_100122121 3300005334 Bacteria 1993
11 Ga0070666_10443607 3300005335 Bacteria 937
12 Ga0070680_100177155 3300005336 Bacteria 1795
13 Ga0070680_100332274 3300005336 Bacteria 1291
14 Ga0070682_100084553 3300005337 Bacteria 2062
15 Ga0070682_101898851 3300005337 Bacteria 522
16 Ga0068868_100573873 3300005338 Bacteria 997
17 Ga0068868_101209335 3300005338 Bacteria 699
18 Ga0070660_101294527 3300005339 Bacteria 618
19 Ga0070687_100867076 3300005343 Bacteria 645
20 Ga0070668_100522920 3300005347 Bacteria 1030
21 Ga0070669_100436093 3300005353 Bacteria 1077
22 Ga0070675_100758337 3300005354 Bacteria 886
23 Ga0070674_100092348 3300005356 Bacteria 2188
24 Ga0070688_100377051 3300005365 Bacteria 1045
25 Ga0070659_100473676 3300005366 Bacteria 1065
26 Ga0070659_100818502 3300005366 Bacteria 811
27 Ga0070667_100115768 3300005367 Bacteria 2328
28 Ga0070709_10005591 3300005434 Bacteria 6807
29 Ga0070709_10529663 3300005434 Bacteria 899
30 Ga0070714_100306457 3300005435 Bacteria 1482
31 Ga0070714_100784970 3300005435 Bacteria 922
32 Ga0070713_100019812 3300005436 Bacteria 5147
33 Ga0070713_100076436 3300005436 Bacteria 2844
34 Ga0070713_100121604 3300005436 Bacteria 2291
35 Ga0070713_101373012 3300005436 Bacteria 685
36 Ga0070710_10034526 3300005437 Bacteria 2752
37 Ga0070710_10051557 3300005437 Bacteria 2311
38 Ga0070710_10108687 3300005437 Bacteria 1663
39 Ga0070701_10398193 3300005438 Bacteria 872
40 Ga0070711_100043435 3300005439 Bacteria 3044
41 Ga0070711_100053230 3300005439 Bacteria 2789
42 Ga0070711_100142517 3300005439 Bacteria 1798
43 Ga0070711_100579700 3300005439 Bacteria 934
44 Ga0070663_100687249 3300005455 Bacteria 869
45 Ga0070678_100174288 3300005456 Bacteria 1755
46 Ga0070678_101043836 3300005456 Bacteria 753
47 Ga0070662_100041198 3300005457 Bacteria 3293
48 Ga0070662_100483960 3300005457 Bacteria 1031
49 Ga0070681_10065261 3300005458 Bacteria 3609
50 Ga0070681_10079471 3300005458 Bacteria 3237
51 Ga0070681_10315187 3300005458 Bacteria 1473
52 Ga0070706_100265273 3300005467 Bacteria 1603
53 Ga0070706_101008237 3300005467 Bacteria 768
54 Ga0070707_100586735 3300005468 Bacteria 1077
55 Ga0070698_100042737 3300005471 Bacteria 4649
56 Ga0070699_100337670 3300005518 Bacteria 1356
57 Ga0070679_100061846 3300005530 Bacteria 3732
58 Ga0070679_100069794 3300005530 Bacteria 3505
59 Ga0070684_100014121 3300005535 Bacteria 6458
60 Ga0070684_101336541 3300005535 Bacteria 675
61 Ga0070697_100103252 3300005536 Bacteria 2369
62 Ga0068853_100504216 3300005539 Bacteria 1143
63 Ga0068853_101262305 3300005539 Bacteria 714
64 Ga0070686_100152767 3300005544 Bacteria 1618
65 Ga0070693_100192946 3300005547 Bacteria 1318
66 Ga0070665_100025131 3300005548 Bacteria 6001
67 Ga0070665_100313178 3300005548 Bacteria 1573
68 Ga0070665_100335829 3300005548 Bacteria 1516
69 Ga0070665_100364292 3300005548 Bacteria 1452
70 Ga0070665_100739271 3300005548 Bacteria 997
71 Ga0068855_100021003 3300005563 Bacteria 7830
72 Ga0068855_100222149 3300005563 Bacteria 2118
73 Ga0068855_100310245 3300005563 Bacteria 1746
74 Ga0068855_100438622 3300005563 Bacteria 1427
75 Ga0068855_101440137 3300005563 Bacteria 709
76 Ga0070664_100151503 3300005564 Bacteria 2047
77 Ga0070664_100380400 3300005564 Bacteria 1288
78 Ga0070664_100510935 3300005564 Bacteria 1108
79 Ga0070664_100700459 3300005564 Bacteria 944
80 Ga0068857_100015806 3300005577 Bacteria 6605
81 Ga0068857_100362067 3300005577 Bacteria 1344
82 Ga0068857_100537867 3300005577 Bacteria 1100
83 Ga0068857_100714973 3300005577 Bacteria 952
84 Ga0068856_100055760 3300005614 Bacteria 3900
85 Ga0068856_100099005 3300005614 Bacteria 2906
86 Ga0068856_100362605 3300005614 Bacteria 1468
87 Ga0068856_100368213 3300005614 Bacteria 1456
88 Ga0068856_100412384 3300005614 Bacteria 1371
89 Ga0068856_101748072 3300005614 Bacteria 634
90 Ga0070702_100348053 3300005615 Bacteria 1043
91 Ga0068852_100246206 3300005616 Bacteria 1711
92 Ga0068852_101280654 3300005616 Bacteria 755
93 Ga0068859_100178886 3300005617 Bacteria 2203
94 Ga0068859_100517006 3300005617 Bacteria 1289
95 Ga0068866_10237730 3300005718 Bacteria 1108
96 Ga0068866_10323776 3300005718 Bacteria 971
97 Ga0068866_10598256 3300005718 Bacteria 744
98 Ga0068861_100369580 3300005719 Bacteria 1264
99 Ga0068851_10252002 3300005834 Bacteria 1002
100 Ga0068870_10302112 3300005840 Bacteria 1011
101 Ga0068863_100086464 3300005841 Bacteria 2971
102 Ga0068863_100817778 3300005841 Bacteria 930
103 Ga0068858_100616009 3300005842 Bacteria 1054
104 Ga0068860_100070235 3300005843 Bacteria 3329
105 Ga0068862_100040714 3300005844 Bacteria 3950
106 Ga0068862_100160822 3300005844 Bacteria 2004
107 Ga0068862_101014127 3300005844 Bacteria 821
108 Ga0081455_10020349 3300005937 Bacteria 6252
109 Ga0081455_10036445 3300005937 Bacteria 4379
110 Ga0081455_10051633 3300005937 Bacteria 3526
111 Ga0081455_10084498 3300005937 Bacteria 2590
112 Ga0081455_10131089 3300005937 Bacteria 1960
113 Ga0081455_10280738 3300005937 Bacteria 1203
114 Ga0081540_1006872 3300005983 Bacteria 8211
115 Ga0081540_1010024 3300005983 Bacteria 6450
116 Ga0081540_1023680 3300005983 Bacteria 3584
117 Ga0081540_1038041 3300005983 Bacteria 2542
118 Ga0081540_1052513 3300005983 Bacteria 2006
119 Ga0081540_1062938 3300005983 Bacteria 1759
120 Ga0081539_10000008 3300005985 Bacteria 525071
121 Ga0081539_10000747 3300005985 Bacteria 64612
122 Ga0070717_10031351 3300006028 Bacteria 4276
123 Ga0070717_10109250 3300006028 Bacteria 2357
124 Ga0070717_10230461 3300006028 Bacteria 1631
125 Ga0070717_10340700 3300006028 Bacteria 1339
126 Ga0075365_10067737 3300006038 Bacteria 2397
127 Ga0075365_10108669 3300006038 Bacteria 1904
128 Ga0075365_10358236 3300006038 Bacteria 1028
129 Ga0075365_10626235 3300006038 Bacteria 761
130 Ga0075365_10877649 3300006038 Bacteria 632
131 Ga0075363_100051605 3300006048 Bacteria 2194
132 Ga0075363_100150380 3300006048 Bacteria 1314
133 Ga0075364_10036818 3300006051 Bacteria 3165
134 Ga0070715_10225651 3300006163 Bacteria 966
135 Ga0070716_100008821 3300006173 Bacteria 5010
136 Ga0070712_100004710 3300006175 Bacteria 8436
137 Ga0070712_100022951 3300006175 Bacteria 4114
138 Ga0070712_100141822 3300006175 Bacteria 1835
139 Ga0070712_100669833 3300006175 Bacteria 883
140 Ga0075362_10086396 3300006177 Bacteria 1451
141 Ga0075362_10692864 3300006177 Bacteria 531
142 Ga0075367_10203328 3300006178 Bacteria 1237
143 Ga0075367_10231719 3300006178 Bacteria 1156
144 Ga0075367_10264589 3300006178 Bacteria 1080
145 Ga0075369_10112007 3300006186 Bacteria 1230
146 Ga0075369_10115230 3300006186 Bacteria 1213
147 Ga0075369_10469407 3300006186 Bacteria 597
148 Ga0075366_10054523 3300006195 Bacteria 2374
149 Ga0075366_10149611 3300006195 Bacteria 1413
150 Ga0097621_102238304 3300006237 Bacteria 523
151 Ga0075370_10120164 3300006353 Bacteria 1529
152 Ga0075370_10261930 3300006353 Bacteria 1025
153 Ga0068871_100771836 3300006358 Bacteria 885
154 Ga0068871_100783758 3300006358 Bacteria 878
155 Ga0075428_100619172 3300006844 Bacteria 1155
156 Ga0075430_100478241 3300006846 Bacteria 1028
157 Ga0075434_100021164 3300006871 Bacteria 6320
158 Ga0075436_100583717 3300006914 Bacteria 822
159 Ga0097620_100178896 3300006931 Bacteria 2203
160 Ga0097620_100516967 3300006931 Bacteria 1289
161 Ga0099795_10199871 3300007788 Bacteria 843
162 Ga0105251_10113150 3300009011 Bacteria 1235
163 Ga0105251_10494525 3300009011 Bacteria 571
164 Ga0105250_10063702 3300009092 Bacteria 1484
165 Ga0105240_10078922 3300009093 Bacteria 4053
166 Ga0105240_10333792 3300009093 Bacteria 1724
167 Ga0105240_10546293 3300009093 Bacteria 1282
168 Ga0105240_10678125 3300009093 Bacteria 1127
169 Ga0105240_10686907 3300009093 Bacteria 1118
170 Ga0105245_10731625 3300009098 Bacteria 1024
171 Ga0105245_11426370 3300009098 Bacteria 743
172 Ga0114129_10672162 3300009147 Bacteria 1334
173 Ga0105243_10135186 3300009148 Bacteria 2097
174 Ga0105243_10287429 3300009148 Bacteria 1484
175 Ga0105243_10313687 3300009148 Bacteria 1426
176 Ga0105243_10358824 3300009148 Bacteria 1341
177 Ga0105243_10522631 3300009148 Bacteria 1129
178 Ga0105241_10036287 3300009174 Bacteria 3709
179 Ga0105241_10727742 3300009174 Bacteria 908
180 Ga0105242_10576476 3300009176 Bacteria 1083
181 Ga0105248_10365450 3300009177 Bacteria 1624
182 Ga0105248_10859705 3300009177 Bacteria 1024
183 Ga0105237_10239081 3300009545 Bacteria 1817
184 Ga0105237_10368322 3300009545 Bacteria 1442
185 Ga0105237_10470445 3300009545 Bacteria 1263
186 Ga0105237_10623639 3300009545 Bacteria 1085
187 Ga0105237_10850654 3300009545 Bacteria 919
188 Ga0105238_10059220 3300009551 Bacteria 3837
189 Ga0105238_10225265 3300009551 Bacteria 1851
190 Ga0105238_10327174 3300009551 Bacteria 1519
191 Ga0105238_10369733 3300009551 Bacteria 1424
192 Ga0105238_10624151 3300009551 Bacteria 1087
193 Ga0105238_10628215 3300009551 Bacteria 1083
194 Ga0105238_11007539 3300009551 Bacteria 854
195 Ga0105249_10394352 3300009553 Bacteria 1413
196 Ga0105249_11620254 3300009553 Bacteria 720
197 Ga0105249_11836037 3300009553 Bacteria 679
198 Ga0099796_10027483 3300010159 Bacteria 1818
199 Ga0099796_10056844 3300010159 Bacteria 1374
200 Ga0099796_10080517 3300010159 Bacteria 1193
201 Ga0105239_10375663 3300010375 Bacteria 1607
202 Ga0105239_11157885 3300010375 Bacteria 891
203 Ga0105246_10126925 3300011119 Bacteria 1899
204 Ga0157371_10709067 3300013102 Bacteria 754
205 Ga0157370_10157208 3300013104 Bacteria 2115
206 Ga0157370_10513429 3300013104 Bacteria 1100
207 Ga0157370_11630979 3300013104 Bacteria 579
208 Ga0157369_10033089 3300013105 Bacteria 5683
209 Ga0157369_10070831 3300013105 Bacteria 3745
210 Ga0157369_11615681 3300013105 Bacteria 659
211 Ga0157369_11683412 3300013105 Bacteria 645
212 Ga0157374_10201398 3300013296 Bacteria 1949
213 Ga0157374_10440259 3300013296 Bacteria 1304
214 Ga0157374_11808765 3300013296 Bacteria 636
215 Ga0157378_10046497 3300013297 Bacteria 3858
216 Ga0157378_10308681 3300013297 Bacteria 1533
217 Ga0157378_10606618 3300013297 Bacteria 1106
218 Ga0163162_10097392 3300013306 Bacteria 3030
219 Ga0163162_10152258 3300013306 Bacteria 2431
220 Ga0163162_10346457 3300013306 Bacteria 1618
221 Ga0163162_10700785 3300013306 Bacteria 1134
222 Ga0163162_10801755 3300013306 Bacteria 1059
223 Ga0157372_10168615 3300013307 Bacteria 2532
224 Ga0157372_10287497 3300013307 Bacteria 1912
225 Ga0157372_10408029 3300013307 Bacteria 1583
226 Ga0157372_11070921 3300013307 Bacteria 933
227 Ga0157375_11968827 3300013308 Bacteria 694
228 Ga0163163_10326006 3300014325 Bacteria 1590
229 Ga0163163_10812860 3300014325 Bacteria 998
230 Ga0157380_10239594 3300014326 Bacteria 1634
231 Ga0157380_10826454 3300014326 Bacteria 946
232 Ga0157376_10367295 3300014969 Bacteria 1382
233 Ga0163161_10267594 3300017792 Bacteria 1336
234 Ga0213874_10007470 3300021377 Bacteria 2625
235 Ga0213876_10001447 3300021384 Bacteria 14763
236 Ga0213876_10055907 3300021384 Bacteria 2084
237 Ga0213876_10070520 3300021384 Bacteria 1846
238 Ga0213876_10345557 3300021384 Bacteria 791
239 Ga0213871_10034792 3300021441 Bacteria 1329
240 Ga0209026_1037426 3300025250 Bacteria 709
241 Ga0209677_102153 3300025253 Bacteria 7699
242 Ga0209233_1002461 3300025261 Bacteria 6797
243 Ga0209564_1000164 3300025295 Bacteria 160675
244 Ga0209758_1003132 3300025297 Bacteria 15611
245 Ga0209758_1055781 3300025297 Bacteria 1339
246 Ga0209758_1063632 3300025297 Bacteria 1200
247 Ga0207697_10061445 3300025315 Bacteria 1563
248 Ga0207697_10077643 3300025315 Bacteria 1396
249 Ga0207692_10003939 3300025898 Bacteria 5829
250 Ga0207692_10036582 3300025898 Bacteria 2395
251 Ga0207692_10288660 3300025898 Bacteria 995
252 Ga0207642_10087686 3300025899 Bacteria 1529
253 Ga0207710_10178408 3300025900 Bacteria 1041
254 Ga0207688_10057198 3300025901 Bacteria 2192
255 Ga0207688_10304487 3300025901 Bacteria 975
256 Ga0207688_10692954 3300025901 Bacteria 644
257 Ga0207647_10012667 3300025904 Bacteria 5861
258 Ga0207647_10080554 3300025904 Bacteria 1953
259 Ga0207685_10160399 3300025905 Bacteria 1026
260 Ga0207699_10003955 3300025906 Bacteria 7087
261 Ga0207699_10088560 3300025906 Bacteria 1938
262 Ga0207645_10149783 3300025907 Bacteria 1523
263 Ga0207705_10114776 3300025909 Bacteria 1993
264 Ga0207684_10264293 3300025910 Bacteria 1485
265 Ga0207654_10231397 3300025911 Bacteria 1231
266 Ga0207654_10379393 3300025911 Bacteria 979
267 Ga0207707_10002025 3300025912 Bacteria 18400
268 Ga0207707_10028678 3300025912 Bacteria 4864
269 Ga0207707_10054175 3300025912 Bacteria 3492
270 Ga0207707_10136068 3300025912 Bacteria 2148
271 Ga0207695_10043567 3300025913 Bacteria 4782
272 Ga0207695_10200019 3300025913 Bacteria 1912
273 Ga0207695_10583449 3300025913 Bacteria 999
274 Ga0207695_10984981 3300025913 Bacteria 723
275 Ga0207671_10031180 3300025914 Bacteria 3973
276 Ga0207671_10200661 3300025914 Bacteria 1558
277 Ga0207671_11256874 3300025914 Bacteria 578
278 Ga0207693_10034235 3300025915 Bacteria 4008
279 Ga0207693_10058818 3300025915 Bacteria 3011
280 Ga0207693_10209779 3300025915 Bacteria 1531
281 Ga0207693_10328992 3300025915 Bacteria 1196
282 Ga0207663_10005246 3300025916 Bacteria 6523
283 Ga0207663_10027348 3300025916 Bacteria 3323
284 Ga0207663_10422583 3300025916 Bacteria 1023
285 Ga0207660_10034786 3300025917 Bacteria 3494
286 Ga0207660_10278751 3300025917 Bacteria 1326
287 Ga0207649_10545346 3300025920 Bacteria 887
288 Ga0207652_10070098 3300025921 Bacteria 3044
289 Ga0207652_10144343 3300025921 Bacteria 2129
290 Ga0207681_10554191 3300025923 Bacteria 946
291 Ga0207694_10066329 3300025924 Bacteria 2816
292 Ga0207694_10078250 3300025924 Bacteria 2592
293 Ga0207694_10199039 3300025924 Bacteria 1629
294 Ga0207694_10578988 3300025924 Bacteria 943
295 Ga0207650_10233159 3300025925 Bacteria 1485
296 Ga0207659_11212658 3300025926 Bacteria 648
297 Ga0207687_10309003 3300025927 Bacteria 1276
298 Ga0207687_10362589 3300025927 Bacteria 1183
299 Ga0207700_10033194 3300025928 Bacteria 3692
300 Ga0207700_10117547 3300025928 Bacteria 2150
301 Ga0207700_10390705 3300025928 Bacteria 1218
302 Ga0207700_10428766 3300025928 Bacteria 1162
303 Ga0207700_11794715 3300025928 Bacteria 539
304 Ga0207664_10013204 3300025929 Bacteria 5918
305 Ga0207644_10047955 3300025931 Bacteria 3051
306 Ga0207690_10451379 3300025932 Bacteria 1033
307 Ga0207690_10733139 3300025932 Bacteria 814
308 Ga0207706_10016634 3300025933 Bacteria 6639
309 Ga0207706_10430051 3300025933 Bacteria 1143
310 Ga0207686_10327104 3300025934 Bacteria 1147
311 Ga0207709_10279325 3300025935 Bacteria 1233
312 Ga0207669_10051869 3300025937 Bacteria 2460
313 Ga0207704_11140832 3300025938 Bacteria 663
314 Ga0207665_10004269 3300025939 Bacteria 9499
315 Ga0207665_10285298 3300025939 Bacteria 1230
316 Ga0207691_10019091 3300025940 Bacteria 6493
317 Ga0207711_10574769 3300025941 Bacteria 1051
318 Ga0207689_10408604 3300025942 Bacteria 1132
319 Ga0207689_10463631 3300025942 Bacteria 1060
320 Ga0207661_10792151 3300025944 Bacteria 873
321 Ga0207679_10362659 3300025945 Bacteria 1266
322 Ga0207667_10091656 3300025949 Bacteria 3139
323 Ga0207667_10250469 3300025949 Bacteria 1812
324 Ga0207667_10388435 3300025949 Bacteria 1421
325 Ga0207667_10907093 3300025949 Bacteria 873
326 Ga0207667_10948043 3300025949 Bacteria 850
327 Ga0207712_11286655 3300025961 Bacteria 653
328 Ga0207668_10713573 3300025972 Bacteria 882
329 Ga0207640_10233347 3300025981 Bacteria 1417
330 Ga0207640_10680876 3300025981 Bacteria 879
331 Ga0207658_10218391 3300025986 Bacteria 1602
332 Ga0207658_10293538 3300025986 Bacteria 1398
333 Ga0207703_10177736 3300026035 Bacteria 1876
334 Ga0207703_12099734 3300026035 Bacteria 541
335 Ga0207639_10463992 3300026041 Bacteria 1152
336 Ga0207639_11202467 3300026041 Bacteria 711
337 Ga0207678_10057654 3300026067 Bacteria 3342
338 Ga0207708_10013800 3300026075 Bacteria 6040
339 Ga0207702_10001399 3300026078 Bacteria 24061
340 Ga0207702_10227441 3300026078 Bacteria 1741
341 Ga0207702_10554022 3300026078 Bacteria 1125
342 Ga0207702_10770134 3300026078 Bacteria 951
343 Ga0207641_10094339 3300026088 Bacteria 2624
344 Ga0207641_10705316 3300026088 Bacteria 994
345 Ga0207674_10321001 3300026116 Bacteria 1498
346 Ga0207674_10326834 3300026116 Bacteria 1483
347 Ga0207683_10207156 3300026121 Bacteria 1784
348 Ga0209179_1000883 3300027512 Bacteria 3348
349 Ga0209813_10019826 3300027866 Bacteria 1875
350 Ga0207428_10278134 3300027907 Bacteria 1243
351 Ga0207428_10528336 3300027907 Bacteria 855
352 Ga0268266_10027759 3300028379 Bacteria 4812
353 Ga0268266_10339285 3300028379 Bacteria 1410
354 Ga0268265_10246898 3300028380 Bacteria 1578
355 Ga0268265_10814695 3300028380 Bacteria 911
356 Ga0268264_10937916 3300028381 Bacteria 870
357 Ga0265319_1002829 3300028563 Bacteria 9272
358 Ga0265323_10000768 3300028653 Bacteria 17199
359 Ga0265336_10000106 3300028666 Bacteria 63839
360 Ga0307517_10281775 3300028786 Bacteria 947
361 Ga0265338_10000065 3300028800 Bacteria 188966
362 Ga0265324_10008335 3300029957 Bacteria 4125
363 Ga0307511_10022363 3300030521 Bacteria 5926
364 Ga0307511_10139153 3300030521 Bacteria 1433
365 Ga0307509_10189769 3300031507 Bacteria 1907
366 Ga0307509_10359704 3300031507 Bacteria 1175
367 Ga0307509_10386025 3300031507 Bacteria 1112
368 Ga0307509_10836023 3300031507 Bacteria 585
369 Ga0307408_101051145 3300031548 Bacteria 753
370 Ga0307408_101055154 3300031548 Bacteria 752
371 Ga0307508_10163867 3300031616 Bacteria 1826
372 Ga0307508_10173987 3300031616 Bacteria 1756
373 Ga0265314_10074751 3300031711 Bacteria 2256
374 Ga0307516_10159632 3300031730 Bacteria 2006
375 Ga0307405_10229418 3300031731 Bacteria 1368
376 Ga0307405_10602568 3300031731 Bacteria 897
377 Ga0307410_10299728 3300031852 Bacteria 1268
378 Ga0307407_10752552 3300031903 Bacteria 738
379 Ga0307412_10326557 3300031911 Bacteria 1223
380 Ga0307409_100871557 3300031995 Bacteria 912
381 Ga0307416_101061445 3300032002 Bacteria 914
382 Ga0307414_10471189 3300032004 Bacteria 1106
383 Ga0307414_11719905 3300032004 Bacteria 585
384 Ga0307507_10112574 3300033179 Bacteria 2216
385 Ga0307510_10151802 3300033180 Bacteria 1933
386 Ga0307510_10192917 3300033180 Bacteria 1583
387 Ga0315911_1000011 3300033442 Bacteria 264678
388 Ga0373926_0040219 3300035083 Bacteria 1668
389 Ga0373934_0134716 3300035086 Bacteria 1008
390 Ga0373923_0012474 3300035111 Bacteria 3142
391 Ga0373923_0327049 3300035111 Bacteria 729
392 Ga0373932_0053654 3300035112 Bacteria 1204
393 Ga0373932_0088928 3300035112 Bacteria 988
394 Ga0373936_0153523 3300035113 Bacteria 999
395 Ga0373936_0270729 3300035113 Bacteria 762
396 Ga0373939_0446501 3300035114 Bacteria 544
397 Ga0373945_0053209 3300035116 Bacteria 1494
398 Ga0373953_0025937 3300035117 Bacteria 2243
399 Ga0373954_0065123 3300035118 Bacteria 1724
400 Ga0373956_0028838 3300035119 Bacteria 2417
401 Ga0373943_0030825 3300035170 Bacteria 2541
402 Ga0373943_0103250 3300035170 Bacteria 1494
403 Ga0373943_0256105 3300035170 Bacteria 984
404 Ga0373946_0093509 3300035171 Bacteria 1336
405 Ga0373946_0179554 3300035171 Bacteria 1004
406 Ga0373955_0006489 3300035172 Bacteria 5331
407 Ga0373955_0268390 3300035172 Bacteria 1025
408 Ga0373924_0253748 3300035410 Bacteria 779
409 Ga0373935_0088665 3300035692 Bacteria 2021
410 Ga0373935_0132108 3300035692 Bacteria 1678
411 Ga0373935_0387195 3300035692 Bacteria 1002
412 Ga0373935_0453451 3300035692 Bacteria 927
413 Ga0373927_0202558 3300035695 Bacteria 1303
414 Ga0373933_0182347 3300035724 Bacteria 1339
415 Ga0373947_0192408 3300035725 Bacteria 1332
416 Ga0373947_0565460 3300035725 Bacteria 774
417 Ga0373947_0652561 3300035725 Bacteria 717
418 Ga0372808_003619 3300036459 Bacteria 1915
419 Ga0373925_0027205 3300037068 Bacteria 4188
420 Ga0373925_0088654 3300037068 Bacteria 2363
421 Ga0373925_0170297 3300037068 Bacteria 1719
422 Ga0395900_0077892 3300037418 Bacteria 3406
423 Ga0395898_0002649 3300037466 Bacteria 20818
424 Ga0395898_0064886 3300037466 Bacteria 3541
425 Ga0395898_0382111 3300037466 Bacteria 1343
426 Ga0395905_0055720 3300037471 Bacteria 3700
427 Ga0395905_0401724 3300037471 Bacteria 1265
428 Ga0395905_0796721 3300037471 Bacteria 848
429 Ga0436364_0417285 3300037853 Bacteria 931
430 Ga0395901_0017296 3300038443 Bacteria 7360
431 Ga0395901_0211490 3300038443 Bacteria 2030
432 Ga0395901_0492416 3300038443 Bacteria 1249
433 Ga0395901_0760918 3300038443 Bacteria 961
434 Ga0436365_0624406 3300039437 Bacteria 2328
435 Ga0436365_0643519 3300039437 Bacteria 2439
436 Ga0436365_0670968 3300039437 Bacteria 2236
437 Ga0436365_0687739 3300039437 Bacteria 11594
438 Ga0436365_0957545 3300039437 Bacteria 571
439 Ga0436365_1758154 3300039437 Bacteria 648
440 Ga0436360_0274387 3300039438 Bacteria 1497
441 Ga0436360_0345763 3300039438 Bacteria 4390
442 Ga0436360_0459788 3300039438 Bacteria 919
443 Ga0436360_0732565 3300039438 Bacteria 960
444 Ga0436361_0553250 3300039447 Bacteria 1012
445 Ga0436361_1028827 3300039447 Bacteria 661
446 Ga0436361_1117873 3300039447 Bacteria 879
447 Ga0436363_0055353 3300039450 Bacteria 1071
448 Ga0436363_0068743 3300039450 Bacteria 1177
449 Ga0436363_0294046 3300039450 Bacteria 3552
450 Ga0436363_1349492 3300039450 Bacteria 1234
451 Ga0436363_1601771 3300039450 Bacteria 4655
452 Ga0436362_0171030 3300039453 Bacteria 2740
453 Ga0439465_0056394 3300041413 Bacteria 1295
454 Ga0451802_1155021 3300041460 Bacteria 871
455 Ga0439445_0031128 3300042004 Bacteria 1386
456 Ga0466972_0015869 3300044658 Bacteria 3765
457 Ga0466966_0082549 3300044684 Bacteria 2000
458 Ga0466966_0199537 3300044684 Bacteria 1211
459 Ga0466963_0048258 3300044694 Bacteria 2812
460 Ga0466964_0055648 3300044706 Bacteria 1634
461 Ga0466968_0022712 3300044735 Bacteria 2551
462 Ga0466957_0130815 3300044842 Bacteria 1607
463 Ga0466960_0233728 3300044901 Bacteria 1015
464 Ga0466959_0718070 3300045049 Bacteria 669
465 Ga0451576_2183496 3300045051 Bacteria 569
466 Ga0466967_0040493 3300045976 Bacteria 4012
467 Ga0466967_0169604 3300045976 Bacteria 2053
468 Ga0466967_0189618 3300045976 Bacteria 1942
469 Ga0495603_0011089 3300046455 Bacteria 5464
470 Ga0495603_0101204 3300046455 Bacteria 1682
471 Ga0495603_0142220 3300046455 Bacteria 1395
472 Ga0495629_0275493 3300046459 Bacteria 1155
473 Ga0495638_0029777 3300046460 Bacteria 3520
474 Ga0495638_0105685 3300046460 Bacteria 1677
475 Ga0495638_0199645 3300046460 Bacteria 1130
476 Ga0495641_0338236 3300046461 Bacteria 680
477 Ga0495651_0035159 3300046462 Bacteria 3903
478 Ga0495580_0133335 3300046472 Bacteria 1722
479 Ga0495582_0110718 3300046473 Bacteria 1542
480 Ga0495639_0086042 3300046475 Bacteria 1470
481 Ga0495639_0100425 3300046475 Bacteria 1365
482 Ga0495662_0090596 3300046476 Bacteria 1491
483 Ga0495664_0204405 3300046477 Bacteria 1196
484 Ga0495664_0224755 3300046477 Bacteria 1136
485 Ga0495585_0248481 3300046492 Bacteria 888
486 Ga0495594_0026163 3300046499 Bacteria 3138
487 Ga0495596_0214941 3300046500 Bacteria 747
488 Ga0495607_0047072 3300046501 Bacteria 2528
489 Ga0495607_0275499 3300046501 Bacteria 800
490 Ga0495583_0033084 3300046506 Bacteria 2489
491 Ga0495583_0188808 3300046506 Bacteria 841
492 Ga0495606_0001396 3300046507 Bacteria 32606
493 Ga0495606_0191660 3300046507 Bacteria 1171
494 Ga0495606_0239185 3300046507 Bacteria 1013
495 Ga0495606_0451648 3300046507 Bacteria 658
496 Ga0495616_0034097 3300046513 Bacteria 2646
497 Ga0495616_0095512 3300046513 Bacteria 1401
498 Ga0495620_0076144 3300046515 Bacteria 1364
499 Ga0495628_0616219 3300046516 Bacteria 774
500 Ga0495630_0997395 3300046517 Bacteria 636
501 Ga0495631_0069642 3300046518 Bacteria 1521
502 Ga0495631_0237752 3300046518 Bacteria 777
503 Ga0495632_0074859 3300046519 Bacteria 1621
504 Ga0495632_0121091 3300046519 Bacteria 1223
505 Ga0495632_0145575 3300046519 Bacteria 1097
506 Ga0495632_0183911 3300046519 Bacteria 956
507 Ga0495637_0013415 3300046520 Bacteria 3888
508 Ga0495637_0137773 3300046520 Bacteria 928
509 Ga0495643_0062871 3300046522 Bacteria 1964
510 Ga0495643_0080940 3300046522 Bacteria 1689
511 Ga0495643_0161096 3300046522 Bacteria 1104
512 Ga0495648_0045787 3300046524 Bacteria 2718
513 Ga0495648_0050648 3300046524 Bacteria 2535
514 Ga0495654_0040150 3300046530 Bacteria 2333
515 Ga0495665_0008399 3300046531 Bacteria 5603
516 Ga0495640_0125851 3300046533 Bacteria 1662
517 Ga0495598_0089695 3300046537 Bacteria 1000
518 Ga0495597_0097189 3300046542 Bacteria 1244
519 Ga0495645_0219508 3300046543 Bacteria 1279
520 Ga0495645_0529174 3300046543 Bacteria 733
521 Ga0495622_0025918 3300046557 Bacteria 2740
522 Ga0495622_0101666 3300046557 Bacteria 1317
523 Ga0495633_0073748 3300046558 Bacteria 1591
524 Ga0495667_0176461 3300046559 Bacteria 1372
525 Ga0495667_0782243 3300046559 Bacteria 589
526 Ga0495668_0050340 3300046616 Bacteria 2309
527 Ga0495668_0235240 3300046616 Bacteria 1003
528 Ga0495668_0528754 3300046616 Bacteria 650
529 Ga0495634_0274442 3300046642 Bacteria 1025
530 Ga0495611_0140694 3300046648 Bacteria 1127
531 Ga0495611_0199599 3300046648 Bacteria 933
532 Ga0495611_0222657 3300046648 Bacteria 878
533 Ga0495625_0050299 3300046660 Bacteria 2991
534 Ga0495625_0105265 3300046660 Bacteria 1933
535 Ga0495625_0203257 3300046660 Bacteria 1306
536 Ga0495635_0241588 3300046663 Bacteria 1218
537 Ga0495659_0167230 3300046664 Bacteria 890
538 Ga0495661_0011489 3300046665 Bacteria 6007
539 Ga0495588_0006293 3300046674 Bacteria 5340
540 Ga0495588_0017962 3300046674 Bacteria 3444
541 Ga0495588_0662468 3300046674 Bacteria 546
542 Ga0495657_0226960 3300046675 Bacteria 1131
543 Ga0495623_0185204 3300046679 Bacteria 1207
544 Ga0495623_0650676 3300046679 Bacteria 543
545 Ga0495646_0323368 3300046680 Bacteria 812
546 Ga0495647_0029513 3300046681 Bacteria 2028
547 Ga0495647_0282381 3300046681 Bacteria 745
548 Ga0495658_0243763 3300046683 Bacteria 1129
549 Ga0495669_0019197 3300046684 Bacteria 2949
550 Ga0495669_0244193 3300046684 Bacteria 862
551 Ga0495613_0536849 3300046689 Bacteria 784
552 Ga0495624_0272391 3300046690 Bacteria 1023
553 Ga0495624_0302580 3300046690 Bacteria 964
554 Ga0495624_0448912 3300046690 Bacteria 773
555 Ga0495670_0058629 3300046691 Bacteria 1932
556 Ga0495670_0157829 3300046691 Bacteria 1191
557 Ga0495649_0227717 3300046694 Bacteria 963
558 Ga0495589_0041368 3300046794 Bacteria 2300
559 Ga0495589_0123394 3300046794 Bacteria 1246
560 Ga0495600_0036563 3300046809 Bacteria 3192
561 Ga0495660_0095941 3300046810 Bacteria 1533
562 Ga0495581_0072668 3300047315 Bacteria 1990
563 Ga0495581_0171373 3300047315 Bacteria 1269
564 Ga0495581_0275356 3300047315 Bacteria 984
565 Ga0495581_0394503 3300047315 Bacteria 807
566 Ga0495604_0465885 3300047317 Bacteria 824
567 Ga0495674_0669957 3300047319 Bacteria 816
568 Ga0495672_0075665 3300047320 Bacteria 1893
569 Ga0495676_0195320 3300047321 Bacteria 1409
570 Ga0495676_0267250 3300047321 Bacteria 1162
571 Ga0495680_0630176 3300047322 Bacteria 715
572 Ga0495683_0314455 3300047323 Bacteria 669
573 Ga0495687_023258 3300047443 Bacteria 2962
574 Ga0495687_134247 3300047443 Bacteria 871
575 Ga0495677_0164379 3300047445 Bacteria 857
576 Ga0495679_083097 3300047446 Bacteria 907
577 Ga0495684_0066247 3300047471 Bacteria 2746
578 Ga0495686_0060484 3300047472 Bacteria 2354
579 Ga0495593_0026963 3300047673 Bacteria 3166
580 Ga0495593_0467404 3300047673 Bacteria 632
581 Ga0495614_0356156 3300048089 Bacteria 683
582 Ga0495626_0078618 3300048091 Bacteria 1469
583 Ga0496100_0087925 3300048903 Bacteria 2114
584 Ga0496101_0200488 3300048904 Bacteria 1543
585 Ga0496101_0390341 3300048904 Bacteria 1096
586 Ga0496101_0430352 3300048904 Bacteria 1040
587 Ga0496101_0553598 3300048904 Bacteria 909
588 Ga0496101_1430136 3300048904 Bacteria 539
589 Ga0496102_0072478 3300048905 Bacteria 3165
590 Ga0496102_0086492 3300048905 Bacteria 2895
591 Ga0496102_0457716 3300048905 Bacteria 1197
592 Ga0496102_1358994 3300048905 Bacteria 629
593 Ga0496103_0234951 3300048906 Bacteria 1179
594 Ga0496103_0261860 3300048906 Bacteria 1113
595 Ga0496104_0197899 3300048907 Bacteria 1921
596 Ga0496104_0955771 3300048907 Bacteria 761
597 Ga0496104_1206853 3300048907 Bacteria 660
598 Ga0496105_0342825 3300048908 Bacteria 1194
599 Ga0496106_0002853 3300048909 Bacteria 12840
600 Ga0496106_0057293 3300048909 Bacteria 2947
601 Ga0496106_0070300 3300048909 Bacteria 2673
602 Ga0496106_0691922 3300048909 Bacteria 813
603 Ga0496108_0504512 3300048911 Bacteria 1056
604 Ga0496109_0106608 3300048912 Bacteria 2603
605 Ga0496110_0019056 3300048913 Bacteria 5768
606 Ga0496111_0304139 3300048914 Bacteria 1182
607 Ga0496112_0423261 3300048915 Bacteria 1270
608 Ga0496113_0192547 3300048916 Bacteria 1619
609 Ga0496114_0254959 3300048917 Bacteria 1544
610 Ga0496115_0192144 3300048918 Bacteria 1687
611 Ga0496115_1024722 3300048918 Bacteria 630
612 Ga0496116_0006808 3300048919 Bacteria 10280
613 Ga0496117_0049461 3300048920 Bacteria 2991
614 Ga0496117_0282973 3300048920 Bacteria 887
615 Ga0496117_0432587 3300048920 Bacteria 655
616 Ga0496118_0055423 3300048921 Bacteria 2992
617 Ga0496118_0113484 3300048921 Bacteria 1790
618 Ga0496118_0241875 3300048921 Bacteria 1032
619 Ga0496118_0291445 3300048921 Bacteria 902
620 Ga0496118_0313482 3300048921 Bacteria 855
621 Ga0496119_0030467 3300048922 Bacteria 3636
622 Ga0496119_0100239 3300048922 Bacteria 1627
623 Ga0496119_0123238 3300048922 Bacteria 1422
624 Ga0496119_0131350 3300048922 Bacteria 1364
625 Ga0496120_0153535 3300048923 Bacteria 1155
626 Ga0496120_0209092 3300048923 Bacteria 939
627 Ga0496121_0003460 3300048924 Bacteria 22502
628 Ga0496121_0020908 3300048924 Bacteria 6443
629 Ga0496121_0027422 3300048924 Bacteria 5331
630 Ga0496121_0060210 3300048924 Bacteria 3124
631 Ga0496121_0124108 3300048924 Bacteria 1944
632 Ga0496121_0199480 3300048924 Bacteria 1427
633 Ga0496121_0331685 3300048924 Bacteria 1020
634 Ga0496121_0429093 3300048924 Bacteria 858
635 Ga0496121_0436021 3300048924 Bacteria 848
636 Ga0496121_0502957 3300048924 Bacteria 769
637 Ga0496121_0709646 3300048924 Bacteria 604
638 Ga0496122_0068040 3300048925 Bacteria 2560
639 Ga0496122_0392562 3300048925 Bacteria 708
640 Ga0496123_0179917 3300048926 Bacteria 1105
641 Ga0496123_0181873 3300048926 Bacteria 1097
642 Ga0496124_0244673 3300048927 Bacteria 1331
643 Ga0496124_0246581 3300048927 Bacteria 1324
644 Ga0496124_0256813 3300048927 Bacteria 1289
645 Ga0496125_0000063 3300048928 Bacteria 250260
646 Ga0496125_0004082 3300048928 Bacteria 17081
647 Ga0496125_0054967 3300048928 Bacteria 3249
648 Ga0496125_0455643 3300048928 Bacteria 731
649 Ga0496126_0035131 3300048929 Bacteria 4701
650 Ga0496126_0042724 3300048929 Bacteria 4185
651 Ga0496126_0056284 3300048929 Bacteria 3556
652 Ga0496126_0075937 3300048929 Bacteria 2981
653 Ga0496126_0195313 3300048929 Bacteria 1712
654 Ga0496126_0275790 3300048929 Bacteria 1394
655 Ga0496126_0458896 3300048929 Bacteria 1024
656 Ga0496126_0618915 3300048929 Bacteria 851
657 Ga0495682_0107369 3300049460 Bacteria 1000
658 Ga0501032_0000046 3300049569 Bacteria 109405
659 Ga0501033_0000514 3300049570 Bacteria 36256
660 Ga0501034_0002794 3300049571 Bacteria 20423
661 Ga0501036_0000183 3300049572 Bacteria 41503
662 Ga0501037_0000210 3300049573 Bacteria 51992
663 Ga0501037_0258805 3300049573 Bacteria 1216
664 Ga0501038_0000415 3300049574 Bacteria 36967
665 Ga0501038_1036067 3300049574 Bacteria 601
666 Ga0501039_0000121 3300049575 Bacteria 54152
667 Ga0501043_0000135 3300049579 Bacteria 68762
668 Ga0501043_0072082 3300049579 Bacteria 2713
669 Ga0501046_0009728 3300049580 Bacteria 8292
670 Ga0501046_0068712 3300049580 Bacteria 2757
671 Ga0501047_0000101 3300049581 Bacteria 104950
672 Ga0501048_0009036 3300049582 Bacteria 7501
673 Ga0501048_0123824 3300049582 Bacteria 1828
674 Ga0501067_0097819 3300049583 Bacteria 1630
675 Ga0501067_0337960 3300049583 Bacteria 839
676 Ga0501068_0073656 3300049584 Bacteria 2086
677 Ga0501069_0034059 3300049585 Bacteria 2806
678 Ga0501070_0000702 3300049586 Bacteria 30762
679 Ga0501070_0096743 3300049586 Bacteria 2442
680 Ga0501071_0026543 3300049587 Bacteria 4067
681 Ga0501071_0401533 3300049587 Bacteria 1046
682 Ga0501071_0550876 3300049587 Bacteria 886
683 Ga0501072_0539658 3300049588 Bacteria 921
684 Ga0501073_0111689 3300049589 Bacteria 1895
685 Ga0501074_0003162 3300049590 Bacteria 11614
686 Ga0501074_0083777 3300049590 Bacteria 2286
687 Ga0501075_0731734 3300049591 Bacteria 753
688 Ga0501076_0373672 3300049592 Bacteria 1171
689 Ga0501079_0088183 3300049741 Bacteria 2402
690 Ga0501079_0301006 3300049741 Bacteria 1255
691 Ga0501080_0000121 3300049742 Bacteria 54804
692 Ga0501080_0263602 3300049742 Bacteria 1569
693 Ga0501081_0541419 3300049743 Bacteria 869
694 Ga0501083_0196797 3300049744 Bacteria 1315
695 Ga0501035_0000560 3300049822 Bacteria 41183
696 Ga0501035_0107197 3300049822 Bacteria 2449
697 Ga0501035_1240073 3300049822 Bacteria 577
698 Ga0501044_0003060 3300049823 Bacteria 18922
699 Ga0501044_0126444 3300049823 Bacteria 2553
700 Ga0501044_0339903 3300049823 Bacteria 1422
701 Ga0501045_0021557 3300049824 Bacteria 4610
702 Ga0501045_0392010 3300049824 Bacteria 1034
703 nmdc:mga03683_138181_c2 3300050489 Bacteria 556
704 nmdc:mga03n38_438642_c1 3300050490 Bacteria 725
705 nmdc:mga00v17_15162_c1 3300050491 Bacteria 4320
706 nmdc:mga00v17_192521_c1 3300050491 Bacteria 1317
707 nmdc:mga00v17_48928_c1 3300050491 Bacteria 2563
708 nmdc:mga0yw44_125417_c1 3300050492 Bacteria 1658
709 nmdc:mga0yw44_614383_c1 3300050492 Bacteria 739
710 nmdc:mga0yw44_64870_c1 3300050492 Bacteria 2249
711 nmdc:mga0k408_47851_c1 3300050493 Bacteria 2472
712 nmdc:mga06z11_737839_c1 3300050494 Bacteria 600
713 nmdc:mga07m45_313695_c1 3300050496 Bacteria 912
714 nmdc:mga07m45_534364_c1 3300050496 Bacteria 678
715 nmdc:mga07m45_54181_c1 3300050496 Bacteria 2267
716 nmdc:mga05p37_1099295_c1 3300050507 Bacteria 833
717 nmdc:mga08y16_1112174_c1 3300050511 Bacteria 765
718 nmdc:mga0n895_260877_c1 3300050512 Bacteria 1758
719 nmdc:mga08x19_217890_c1 3300050514 Bacteria 1311
720 nmdc:mga0a205_340828_c1 3300050515 Bacteria 1367
721 nmdc:mga0sz30_134609_c1 3300050516 Bacteria 1090
722 nmdc:mga0sz30_543670_c1 3300050516 Bacteria 524
723 Ga0495601_0045437 3300053077 Bacteria 2762
724 Ga0495612_0068390 3300053078 Bacteria 1478
725 Ga0500635_0058943 3300053080 Bacteria 1334
726 Ga0495655_0023426 3300053083 Bacteria 1423
727 Ga0500643_000019 3300053087 Bacteria 294301
728 Ga0500643_033033 3300053087 Bacteria 1567
729 Ga0500643_041002 3300053087 Bacteria 1362
730 Ga0500644_0222947 3300053088 Bacteria 787
731 Ga0500581_086634 3300053089 Bacteria 1556
732 Ga0500646_0058934 3300053090 Bacteria 1125
733 Ga0500646_0089176 3300053090 Bacteria 952
734 Ga0500647_0012879 3300053091 Bacteria 3772
735 Ga0500647_0025221 3300053091 Bacteria 2801
736 Ga0500583_0072299 3300053092 Bacteria 1651
737 Ga0500583_0086700 3300053092 Bacteria 1519
738 Ga0500651_0181130 3300053093 Bacteria 1251
739 Ga0500651_0191850 3300053093 Bacteria 1209
740 Ga0500566_0000064 3300053094 Bacteria 50908
741 Ga0500566_0000487 3300053094 Bacteria 22108
742 Ga0500566_0025880 3300053094 Bacteria 3436
743 Ga0500640_112304 3300053095 Bacteria 1106
744 Ga0500641_0012349 3300053096 Bacteria 3117
745 Ga0500641_0062311 3300053096 Bacteria 1555
746 Ga0500641_0193915 3300053096 Bacteria 869
747 Ga0500650_0000487 3300053098 Bacteria 10009
748 Ga0500650_0179496 3300053098 Bacteria 970
749 Ga0500555_009867 3300053103 Bacteria 2731
750 Ga0500555_077452 3300053103 Bacteria 869
751 Ga0500556_0000024 3300053104 Bacteria 167556
752 Ga0500562_016470 3300053108 Bacteria 1901
753 Ga0500562_043268 3300053108 Bacteria 1198
754 Ga0500569_014352 3300053109 Bacteria 1959
755 Ga0500569_032978 3300053109 Bacteria 1468
756 Ga0500572_000026 3300053111 Bacteria 45518
757 Ga0500572_000364 3300053111 Bacteria 16144
758 Ga0500572_004826 3300053111 Bacteria 3054
759 Ga0500592_004982 3300053116 Bacteria 2110
760 Ga0500593_086409 3300053117 Bacteria 1335
761 Ga0500594_0038664 3300053118 Bacteria 1294
762 Ga0500595_052557 3300053119 Bacteria 1257
763 Ga0500607_133685 3300053121 Bacteria 1178
764 Ga0500608_006353 3300053122 Bacteria 4802
765 Ga0500608_035870 3300053122 Bacteria 2365
766 Ga0500608_115824 3300053122 Bacteria 1222
767 Ga0500614_001622 3300053123 Bacteria 5303
768 Ga0500642_0000032 3300053130 Bacteria 111097
769 Ga0500642_0032767 3300053130 Bacteria 2183
770 Ga0500642_0047495 3300053130 Bacteria 1881
771 Ga0500652_000481 3300053131 Bacteria 14157
772 Ga0500658_0026053 3300053134 Bacteria 2250
773 Ga0500658_0127955 3300053134 Bacteria 1130
774 Ga0500658_0250178 3300053134 Bacteria 814
775 Ga0500559_0000253 3300053136 Bacteria 42462
776 Ga0500559_0004081 3300053136 Bacteria 7004
777 Ga0500559_0004285 3300053136 Bacteria 6825
778 Ga0500559_0186659 3300053136 Bacteria 977
779 Ga0500561_0040681 3300053137 Bacteria 1225
780 Ga0500564_234411 3300053138 Bacteria 736
781 Ga0500568_0002680 3300053139 Bacteria 10325
782 Ga0500568_0123854 3300053139 Bacteria 962
783 Ga0500573_0018416 3300053140 Bacteria 3979
784 Ga0500577_0005444 3300053142 Bacteria 3432
785 Ga0500577_0297215 3300053142 Bacteria 705
786 Ga0500579_182739 3300053143 Bacteria 821
787 Ga0500586_005621 3300053145 Bacteria 3187
788 Ga0500589_065286 3300053147 Bacteria 1659
789 Ga0500589_079400 3300053147 Bacteria 1468
790 Ga0500590_021236 3300053148 Bacteria 3371
791 Ga0500590_078722 3300053148 Bacteria 1623
792 Ga0500590_093519 3300053148 Bacteria 1456
793 Ga0500603_000077 3300053150 Bacteria 22571
794 Ga0500603_001774 3300053150 Bacteria 4853
795 Ga0500603_179810 3300053150 Bacteria 665
796 Ga0500604_0000989 3300053151 Bacteria 7901
797 Ga0500604_0004698 3300053151 Bacteria 3617
798 Ga0500616_0000332 3300053153 Bacteria 67840
799 Ga0500620_098065 3300053155 Bacteria 1024
800 Ga0500622_0000955 3300053156 Bacteria 24561
801 Ga0500622_0014137 3300053156 Bacteria 4289
802 Ga0500622_0203312 3300053156 Bacteria 899
803 Ga0500622_0320392 3300053156 Bacteria 653
804 Ga0500627_0029972 3300053158 Bacteria 2274
805 Ga0500627_0055008 3300053158 Bacteria 1741
806 Ga0500627_0068261 3300053158 Bacteria 1572
807 Ga0500627_0098394 3300053158 Bacteria 1312
808 Ga0500630_001362 3300053159 Bacteria 11522
809 Ga0500633_0056495 3300053160 Bacteria 1370
810 Ga0500633_0116425 3300053160 Bacteria 992
811 Ga0500633_0150569 3300053160 Bacteria 872
812 Ga0500634_0136143 3300053161 Bacteria 1171
813 Ga0500634_0152863 3300053161 Bacteria 1076
814 Ga0500638_024344 3300053162 Bacteria 2885
815 Ga0500638_042696 3300053162 Bacteria 2202
816 Ga0500638_170453 3300053162 Bacteria 948
817 Ga0500639_000221 3300053163 Bacteria 28281
818 Ga0500639_017544 3300053163 Bacteria 3778
819 Ga0500639_065028 3300053163 Bacteria 1872
820 Ga0500639_228021 3300053163 Bacteria 769
821 Ga0500636_0001338 3300053177 Bacteria 13373
822 Ga0500636_0004907 3300053177 Bacteria 7596
823 Ga0500636_0038378 3300053177 Bacteria 2833
824 Ga0500636_0300440 3300053177 Bacteria 791
825 Ga0500637_0003257 3300053178 Bacteria 7456
826 Ga0500637_0282501 3300053178 Bacteria 913
827 Ga0500567_066881 3300053723 Bacteria 1590
828 Ga0500570_107793 3300053724 Bacteria 1143
829 Ga0500611_035251 3300053727 Bacteria 1065
830 Ga0500645_062049 3300053730 Bacteria 1079
831 Ga0500609_006078 3300053731 Bacteria 1646
832 Ga0500609_011773 3300053731 Bacteria 1182
833 Ga0500596_000824 3300053735 Bacteria 6137
834 Ga0500596_002645 3300053735 Bacteria 3515
835 Ga0500596_009335 3300053735 Bacteria 1533
836 Ga0500599_030269 3300053736 Bacteria 803
837 Ga0500601_000615 3300053737 Bacteria 5045
838 Ga0500601_035567 3300053737 Bacteria 599
839 Ga0501084_0823990 3300054114 Bacteria 781
840 Ga0501082_1122867 3300060353 Bacteria 687
841 Ga0466962_0531068 3300061719 Bacteria 597
842 2513697001 2513237101 Bacteria 7952346
843 2524467053 2524023210 Bacteria 9029266
844 2603861011 2602042107 Bacteria 6226103
845 2671122892 2667528175 Bacteria 7532676
846 2723846445 2721755755 Bacteria 8322773
847 2793072460 2791355197 Bacteria 8420563
848 2857528863 2857524615 Bacteria 6615449
849 2874610589 2874604998 Bacteria 7834745
850 2876810050 2876808645 Bacteria 8824342
851 2879118649 2879110137 Bacteria 8907982
852 2885382452 2885374607 Bacteria 8927485
853 2893069061 2893066018 Bacteria 6158120
854 2903750436 2903748898 Bacteria 9972761
855 2919079285 2919073203 Bacteria 6531949
856 2922387990 2922386360 Bacteria 7017218
857 3005478666 3005474847 Bacteria 9259049
858 8006964829 8006964411 Bacteria 8966052
859 8006991775 8006984368 Bacteria 9651211
860 8006995566 8006994254 Bacteria 8309700
861 8056676388 8056673599 Bacteria 7871253
862 Ga0157370_10193543
863 JGI25406J46586_10000141
864 JGI25406J46586_10012298
865 JGI25404J52841_10046494
866 Ga0065165_1001284
867 Ga0070676_10408636
868 Ga0070683_100842246
869 Ga0070683_101318389
870 Ga0070670_100300604
871 Ga0068869_100122121
872 Ga0070666_10443607
873 Ga0070680_100177155
874 Ga0070680_100332274
875 Ga0070682_100084553
876 Ga0070682_101898851
877 Ga0068868_100573873
878 Ga0068868_101209335
879 Ga0070660_101294527
880 Ga0070687_100867076
881 Ga0070668_100522920
882 Ga0070669_100436093
883 Ga0070675_100758337
884 Ga0070674_100092348
885 Ga0070688_100377051
886 Ga0070659_100473676
887 Ga0070659_100818502
888 Ga0070667_100115768
889 Ga0070709_10005591
890 Ga0070709_10529663
891 Ga0070714_100306457
892 Ga0070714_100784970
893 Ga0070713_100019812
894 Ga0070713_100076436
895 Ga0070713_100121604
896 Ga0070713_101373012
897 Ga0070710_10034526
898 Ga0070710_10051557
899 Ga0070710_10108687
900 Ga0070701_10398193
901 Ga0070711_100043435
902 Ga0070711_100053230
903 Ga0070711_100142517
904 Ga0070711_100579700
905 Ga0070663_100687249
906 Ga0070678_100174288
907 Ga0070678_101043836
908 Ga0070662_100041198
909 Ga0070662_100483960
910 Ga0070681_10065261
911 Ga0070681_10079471
912 Ga0070681_10315187
913 Ga0070706_100265273
914 Ga0070706_101008237
915 Ga0070707_100586735
916 Ga0070698_100042737
917 Ga0070699_100337670
918 Ga0070679_100061846
919 Ga0070679_100069794
920 Ga0070684_100014121
921 Ga0070684_101336541
922 Ga0070697_100103252
923 Ga0068853_100504216
924 Ga0068853_101262305
925 Ga0070686_100152767
926 Ga0070693_100192946
927 Ga0070665_100025131
928 Ga0070665_100313178
929 Ga0070665_100335829
930 Ga0070665_100364292
931 Ga0070665_100739271
932 Ga0068855_100021003
933 Ga0068855_100222149
934 Ga0068855_100310245
935 Ga0068855_100438622
936 Ga0068855_101440137
937 Ga0070664_100151503
938 Ga0070664_100380400
939 Ga0070664_100510935
940 Ga0070664_100700459
941 Ga0068857_100015806
942 Ga0068857_100362067
943 Ga0068857_100537867
944 Ga0068857_100714973
945 Ga0068856_100055760
946 Ga0068856_100099005
947 Ga0068856_100362605
948 Ga0068856_100368213
949 Ga0068856_100412384
950 Ga0068856_101748072
951 Ga0070702_100348053
952 Ga0068852_100246206
953 Ga0068852_101280654
954 Ga0068859_100178886
955 Ga0068859_100517006
956 Ga0068866_10237730
957 Ga0068866_10323776
958 Ga0068866_10598256
959 Ga0068861_100369580
960 Ga0068851_10252002
961 Ga0068870_10302112
962 Ga0068863_100086464
963 Ga0068863_100817778
964 Ga0068858_100616009
965 Ga0068860_100070235
966 Ga0068862_100040714
967 Ga0068862_100160822
968 Ga0068862_101014127
969 Ga0081455_10020349
970 Ga0081455_10036445
971 Ga0081455_10051633
972 Ga0081455_10084498
973 Ga0081455_10131089
974 Ga0081455_10280738
975 Ga0081540_1006872
976 Ga0081540_1010024
977 Ga0081540_1023680
978 Ga0081540_1038041
979 Ga0081540_1052513
980 Ga0081540_1062938
981 Ga0081539_10000008
982 Ga0081539_10000747
983 Ga0070717_10031351
984 Ga0070717_10109250
985 Ga0070717_10230461
986 Ga0070717_10340700
987 Ga0075365_10067737
988 Ga0075365_10108669
989 Ga0075365_10358236
990 Ga0075365_10626235
991 Ga0075365_10877649
992 Ga0075363_100051605
993 Ga0075363_100150380
994 Ga0075364_10036818
995 Ga0070715_10225651
996 Ga0070716_100008821
997 Ga0070712_100004710
998 Ga0070712_100022951
999 Ga0070712_100141822
1000 Ga0070712_100669833
1001 Ga0075362_10086396
1002 Ga0075362_10692864
1003 Ga0075367_10203328
1004 Ga0075367_10231719
1005 Ga0075367_10264589
1006 Ga0075369_10112007
1007 Ga0075369_10115230
1008 Ga0075369_10469407
1009 Ga0075366_10054523
1010 Ga0075366_10149611
1011 Ga0097621_102238304
1012 Ga0075370_10120164
1013 Ga0075370_10261930
1014 Ga0068871_100771836
1015 Ga0068871_100783758
1016 Ga0075428_100619172
1017 Ga0075430_100478241
1018 Ga0075434_100021164
1019 Ga0075436_100583717
1020 Ga0097620_100178896
1021 Ga0097620_100516967
1022 Ga0099795_10199871
1023 Ga0105251_10113150
1024 Ga0105251_10494525
1025 Ga0105250_10063702
1026 Ga0105240_10078922
1027 Ga0105240_10333792
1028 Ga0105240_10546293
1029 Ga0105240_10678125
1030 Ga0105240_10686907
1031 Ga0105245_10731625
1032 Ga0105245_11426370
1033 Ga0114129_10672162
1034 Ga0105243_10135186
1035 Ga0105243_10287429
1036 Ga0105243_10313687
1037 Ga0105243_10358824
1038 Ga0105243_10522631
1039 Ga0105241_10036287
1040 Ga0105241_10727742
1041 Ga0105242_10576476
1042 Ga0105248_10365450
1043 Ga0105248_10859705
1044 Ga0105237_10239081
1045 Ga0105237_10368322
1046 Ga0105237_10470445
1047 Ga0105237_10623639
1048 Ga0105237_10850654
1049 Ga0105238_10059220
1050 Ga0105238_10225265
1051 Ga0105238_10327174
1052 Ga0105238_10369733
1053 Ga0105238_10624151
1054 Ga0105238_10628215
1055 Ga0105238_11007539
1056 Ga0105249_10394352
1057 Ga0105249_11620254
1058 Ga0105249_11836037
1059 Ga0099796_10027483
1060 Ga0099796_10056844
1061 Ga0099796_10080517
1062 Ga0105239_10375663
1063 Ga0105239_11157885
1064 Ga0105246_10126925
1065 Ga0157371_10709067
1066 Ga0157370_10157208
1067 Ga0157370_10513429
1068 Ga0157370_11630979
1069 Ga0157369_10033089
1070 Ga0157369_10070831
1071 Ga0157369_11615681
1072 Ga0157369_11683412
1073 Ga0157374_10201398
1074 Ga0157374_10440259
1075 Ga0157374_11808765
1076 Ga0157378_10046497
1077 Ga0157378_10308681
1078 Ga0157378_10606618
1079 Ga0163162_10097392
1080 Ga0163162_10152258
1081 Ga0163162_10346457
1082 Ga0163162_10700785
1083 Ga0163162_10801755
1084 Ga0157372_10168615
1085 Ga0157372_10287497
1086 Ga0157372_10408029
1087 Ga0157372_11070921
1088 Ga0157375_11968827
1089 Ga0163163_10326006
1090 Ga0163163_10812860
1091 Ga0157380_10239594
1092 Ga0157380_10826454
1093 Ga0157376_10367295
1094 Ga0163161_10267594
1095 Ga0213874_10007470
1096 Ga0213876_10001447
1097 Ga0213876_10055907
1098 Ga0213876_10070520
1099 Ga0213876_10345557
1100 Ga0213871_10034792
1101 Ga0209026_1037426
1102 Ga0209677_102153
1103 Ga0209233_1002461
1104 Ga0209564_1000164
1105 Ga0209758_1003132
1106 Ga0209758_1055781
1107 Ga0209758_1063632
1108 Ga0207697_10061445
1109 Ga0207697_10077643
1110 Ga0207692_10003939
1111 Ga0207692_10036582
1112 Ga0207692_10288660
1113 Ga0207642_10087686
1114 Ga0207710_10178408
1115 Ga0207688_10057198
1116 Ga0207688_10304487
1117 Ga0207688_10692954
1118 Ga0207647_10012667
1119 Ga0207647_10080554
1120 Ga0207685_10160399
1121 Ga0207699_10003955
1122 Ga0207699_10088560
1123 Ga0207645_10149783
1124 Ga0207705_10114776
1125 Ga0207684_10264293
1126 Ga0207654_10231397
1127 Ga0207654_10379393
1128 Ga0207707_10002025
1129 Ga0207707_10028678
1130 Ga0207707_10054175
1131 Ga0207707_10136068
1132 Ga0207695_10043567
1133 Ga0207695_10200019
1134 Ga0207695_10583449
1135 Ga0207695_10984981
1136 Ga0207671_10031180
1137 Ga0207671_10200661
1138 Ga0207671_11256874
1139 Ga0207693_10034235
1140 Ga0207693_10058818
1141 Ga0207693_10209779
1142 Ga0207693_10328992
1143 Ga0207663_10005246
1144 Ga0207663_10027348
1145 Ga0207663_10422583
1146 Ga0207660_10034786
1147 Ga0207660_10278751
1148 Ga0207649_10545346
1149 Ga0207652_10070098
1150 Ga0207652_10144343
1151 Ga0207681_10554191
1152 Ga0207694_10066329
1153 Ga0207694_10078250
1154 Ga0207694_10199039
1155 Ga0207694_10578988
1156 Ga0207650_10233159
1157 Ga0207659_11212658
1158 Ga0207687_10309003
1159 Ga0207687_10362589
1160 Ga0207700_10033194
1161 Ga0207700_10117547
1162 Ga0207700_10390705
1163 Ga0207700_10428766
1164 Ga0207700_11794715
1165 Ga0207664_10013204
1166 Ga0207644_10047955
1167 Ga0207690_10451379
1168 Ga0207690_10733139
1169 Ga0207706_10016634
1170 Ga0207706_10430051
1171 Ga0207686_10327104
1172 Ga0207709_10279325
1173 Ga0207669_10051869
1174 Ga0207704_11140832
1175 Ga0207665_10004269
1176 Ga0207665_10285298
1177 Ga0207691_10019091
1178 Ga0207711_10574769
1179 Ga0207689_10408604
1180 Ga0207689_10463631
1181 Ga0207661_10792151
1182 Ga0207679_10362659
1183 Ga0207667_10091656
1184 Ga0207667_10250469
1185 Ga0207667_10388435
1186 Ga0207667_10907093
1187 Ga0207667_10948043
1188 Ga0207712_11286655
1189 Ga0207668_10713573
1190 Ga0207640_10233347
1191 Ga0207640_10680876
1192 Ga0207658_10218391
1193 Ga0207658_10293538
1194 Ga0207703_10177736
1195 Ga0207703_12099734
1196 Ga0207639_10463992
1197 Ga0207639_11202467
1198 Ga0207678_10057654
1199 Ga0207708_10013800
1200 Ga0207702_10001399
1201 Ga0207702_10227441
1202 Ga0207702_10554022
1203 Ga0207702_10770134
1204 Ga0207641_10094339
1205 Ga0207641_10705316
1206 Ga0207674_10321001
1207 Ga0207674_10326834
1208 Ga0207683_10207156
1209 Ga0209179_1000883
1210 Ga0209813_10019826
1211 Ga0207428_10278134
1212 Ga0207428_10528336
1213 Ga0268266_10027759
1214 Ga0268266_10339285
1215 Ga0268265_10246898
1216 Ga0268265_10814695
1217 Ga0268264_10937916
1218 Ga0265319_1002829
1219 Ga0265323_10000768
1220 Ga0265336_10000106
1221 Ga0307517_10281775
1222 Ga0265338_10000065
1223 Ga0265324_10008335
1224 Ga0307511_10022363
1225 Ga0307511_10139153
1226 Ga0307509_10189769
1227 Ga0307509_10359704
1228 Ga0307509_10386025
1229 Ga0307509_10836023
1230 Ga0307408_101051145
1231 Ga0307408_101055154
1232 Ga0307508_10163867
1233 Ga0307508_10173987
1234 Ga0265314_10074751
1235 Ga0307516_10159632
1236 Ga0307405_10229418
1237 Ga0307405_10602568
1238 Ga0307410_10299728
1239 Ga0307407_10752552
1240 Ga0307412_10326557
1241 Ga0307409_100871557
1242 Ga0307416_101061445
1243 Ga0307414_10471189
1244 Ga0307414_11719905
1245 Ga0307507_10112574
1246 Ga0307510_10151802
1247 Ga0307510_10192917
1248 Ga0315911_1000011
1249 Ga0373926_0040219
1250 Ga0373934_0134716
1251 Ga0373923_0012474
1252 Ga0373923_0327049
1253 Ga0373932_0053654
1254 Ga0373932_0088928
1255 Ga0373936_0153523
1256 Ga0373936_0270729
1257 Ga0373939_0446501
1258 Ga0373945_0053209
1259 Ga0373953_0025937
1260 Ga0373954_0065123
1261 Ga0373956_0028838
1262 Ga0373943_0030825
1263 Ga0373943_0103250
1264 Ga0373943_0256105
1265 Ga0373946_0093509
1266 Ga0373946_0179554
1267 Ga0373955_0006489
1268 Ga0373955_0268390
1269 Ga0373924_0253748
1270 Ga0373935_0088665
1271 Ga0373935_0132108
1272 Ga0373935_0387195
1273 Ga0373935_0453451
1274 Ga0373927_0202558
1275 Ga0373933_0182347
1276 Ga0373947_0192408
1277 Ga0373947_0565460
1278 Ga0373947_0652561
1279 Ga0372808_003619
1280 Ga0373925_0027205
1281 Ga0373925_0088654
1282 Ga0373925_0170297
1283 Ga0395900_0077892
1284 Ga0395898_0002649
1285 Ga0395898_0064886
1286 Ga0395898_0382111
1287 Ga0395905_0055720
1288 Ga0395905_0401724
1289 Ga0395905_0796721
1290 Ga0436364_0417285
1291 Ga0395901_0017296
1292 Ga0395901_0211490
1293 Ga0395901_0492416
1294 Ga0395901_0760918
1295 Ga0436365_0624406
1296 Ga0436365_0643519
1297 Ga0436365_0670968
1298 Ga0436365_0687739
1299 Ga0436365_0957545
1300 Ga0436365_1758154
1301 Ga0436360_0274387
1302 Ga0436360_0345763
1303 Ga0436360_0459788
1304 Ga0436360_0732565
1305 Ga0436361_0553250
1306 Ga0436361_1028827
1307 Ga0436361_1117873
1308 Ga0436363_0055353
1309 Ga0436363_0068743
1310 Ga0436363_0294046
1311 Ga0436363_1349492
1312 Ga0436363_1601771
1313 Ga0436362_0171030
1314 Ga0439465_0056394
1315 Ga0451802_1155021
1316 Ga0439445_0031128
1317 Ga0466972_0015869
1318 Ga0466966_0082549
1319 Ga0466966_0199537
1320 Ga0466963_0048258
1321 Ga0466964_0055648
1322 Ga0466968_0022712
1323 Ga0466957_0130815
1324 Ga0466960_0233728
1325 Ga0466959_0718070
1326 Ga0451576_2183496
1327 Ga0466967_0040493
1328 Ga0466967_0169604
1329 Ga0466967_0189618
1330 Ga0495603_0011089
1331 Ga0495603_0101204
1332 Ga0495603_0142220
1333 Ga0495629_0275493
1334 Ga0495638_0029777
1335 Ga0495638_0105685
1336 Ga0495638_0199645
1337 Ga0495641_0338236
1338 Ga0495651_0035159
1339 Ga0495580_0133335
1340 Ga0495582_0110718
1341 Ga0495639_0086042
1342 Ga0495639_0100425
1343 Ga0495662_0090596
1344 Ga0495664_0204405
1345 Ga0495664_0224755
1346 Ga0495585_0248481
1347 Ga0495594_0026163
1348 Ga0495596_0214941
1349 Ga0495607_0047072
1350 Ga0495607_0275499
1351 Ga0495583_0033084
1352 Ga0495583_0188808
1353 Ga0495606_0001396
1354 Ga0495606_0191660
1355 Ga0495606_0239185
1356 Ga0495606_0451648
1357 Ga0495616_0034097
1358 Ga0495616_0095512
1359 Ga0495620_0076144
1360 Ga0495628_0616219
1361 Ga0495630_0997395
1362 Ga0495631_0069642
1363 Ga0495631_0237752
1364 Ga0495632_0074859
1365 Ga0495632_0121091
1366 Ga0495632_0145575
1367 Ga0495632_0183911
1368 Ga0495637_0013415
1369 Ga0495637_0137773
1370 Ga0495643_0062871
1371 Ga0495643_0080940
1372 Ga0495643_0161096
1373 Ga0495648_0045787
1374 Ga0495648_0050648
1375 Ga0495654_0040150
1376 Ga0495665_0008399
1377 Ga0495640_0125851
1378 Ga0495598_0089695
1379 Ga0495597_0097189
1380 Ga0495645_0219508
1381 Ga0495645_0529174
1382 Ga0495622_0025918
1383 Ga0495622_0101666
1384 Ga0495633_0073748
1385 Ga0495667_0176461
1386 Ga0495667_0782243
1387 Ga0495668_0050340
1388 Ga0495668_0235240
1389 Ga0495668_0528754
1390 Ga0495634_0274442
1391 Ga0495611_0140694
1392 Ga0495611_0199599
1393 Ga0495611_0222657
1394 Ga0495625_0050299
1395 Ga0495625_0105265
1396 Ga0495625_0203257
1397 Ga0495635_0241588
1398 Ga0495659_0167230
1399 Ga0495661_0011489
1400 Ga0495588_0006293
1401 Ga0495588_0017962
1402 Ga0495588_0662468
1403 Ga0495657_0226960
1404 Ga0495623_0185204
1405 Ga0495623_0650676
1406 Ga0495646_0323368
1407 Ga0495647_0029513
1408 Ga0495647_0282381
1409 Ga0495658_0243763
1410 Ga0495669_0019197
1411 Ga0495669_0244193
1412 Ga0495613_0536849
1413 Ga0495624_0272391
1414 Ga0495624_0302580
1415 Ga0495624_0448912
1416 Ga0495670_0058629
1417 Ga0495670_0157829
1418 Ga0495649_0227717
1419 Ga0495589_0041368
1420 Ga0495589_0123394
1421 Ga0495600_0036563
1422 Ga0495660_0095941
1423 Ga0495581_0072668
1424 Ga0495581_0171373
1425 Ga0495581_0275356
1426 Ga0495581_0394503
1427 Ga0495604_0465885
1428 Ga0495674_0669957
1429 Ga0495672_0075665
1430 Ga0495676_0195320
1431 Ga0495676_0267250
1432 Ga0495680_0630176
1433 Ga0495683_0314455
1434 Ga0495687_023258
1435 Ga0495687_134247
1436 Ga0495677_0164379
1437 Ga0495679_083097
1438 Ga0495684_0066247
1439 Ga0495686_0060484
1440 Ga0495593_0026963
1441 Ga0495593_0467404
1442 Ga0495614_0356156
1443 Ga0495626_0078618
1444 Ga0496100_0087925
1445 Ga0496101_0200488
1446 Ga0496101_0390341
1447 Ga0496101_0430352
1448 Ga0496101_0553598
1449 Ga0496101_1430136
1450 Ga0496102_0072478
1451 Ga0496102_0086492
1452 Ga0496102_0457716
1453 Ga0496102_1358994
1454 Ga0496103_0234951
1455 Ga0496103_0261860
1456 Ga0496104_0197899
1457 Ga0496104_0955771
1458 Ga0496104_1206853
1459 Ga0496105_0342825
1460 Ga0496106_0002853
1461 Ga0496106_0057293
1462 Ga0496106_0070300
1463 Ga0496106_0691922
1464 Ga0496108_0504512
1465 Ga0496109_0106608
1466 Ga0496110_0019056
1467 Ga0496111_0304139
1468 Ga0496112_0423261
1469 Ga0496113_0192547
1470 Ga0496114_0254959
1471 Ga0496115_0192144
1472 Ga0496115_1024722
1473 Ga0496116_0006808
1474 Ga0496117_0049461
1475 Ga0496117_0282973
1476 Ga0496117_0432587
1477 Ga0496118_0055423
1478 Ga0496118_0113484
1479 Ga0496118_0241875
1480 Ga0496118_0291445
1481 Ga0496118_0313482
1482 Ga0496119_0030467
1483 Ga0496119_0100239
1484 Ga0496119_0123238
1485 Ga0496119_0131350
1486 Ga0496120_0153535
1487 Ga0496120_0209092
1488 Ga0496121_0003460
1489 Ga0496121_0020908
1490 Ga0496121_0027422
1491 Ga0496121_0060210
1492 Ga0496121_0124108
1493 Ga0496121_0199480
1494 Ga0496121_0331685
1495 Ga0496121_0429093
1496 Ga0496121_0436021
1497 Ga0496121_0502957
1498 Ga0496121_0709646
1499 Ga0496122_0068040
1500 Ga0496122_0392562
1501 Ga0496123_0179917
1502 Ga0496123_0181873
1503 Ga0496124_0244673
1504 Ga0496124_0246581
1505 Ga0496124_0256813
1506 Ga0496125_0000063
1507 Ga0496125_0004082
1508 Ga0496125_0054967
1509 Ga0496125_0455643
1510 Ga0496126_0035131
1511 Ga0496126_0042724
1512 Ga0496126_0056284
1513 Ga0496126_0075937
1514 Ga0496126_0195313
1515 Ga0496126_0275790
1516 Ga0496126_0458896
1517 Ga0496126_0618915
1518 Ga0495682_0107369
1519 Ga0501032_0000046
1520 Ga0501033_0000514
1521 Ga0501034_0002794
1522 Ga0501036_0000183
1523 Ga0501037_0000210
1524 Ga0501037_0258805
1525 Ga0501038_0000415
1526 Ga0501038_1036067
1527 Ga0501039_0000121
1528 Ga0501043_0000135
1529 Ga0501043_0072082
1530 Ga0501046_0009728
1531 Ga0501046_0068712
1532 Ga0501047_0000101
1533 Ga0501048_0009036
1534 Ga0501048_0123824
1535 Ga0501067_0097819
1536 Ga0501067_0337960
1537 Ga0501068_0073656
1538 Ga0501069_0034059
1539 Ga0501070_0000702
1540 Ga0501070_0096743
1541 Ga0501071_0026543
1542 Ga0501071_0401533
1543 Ga0501071_0550876
1544 Ga0501072_0539658
1545 Ga0501073_0111689
1546 Ga0501074_0003162
1547 Ga0501074_0083777
1548 Ga0501075_0731734
1549 Ga0501076_0373672
1550 Ga0501079_0088183
1551 Ga0501079_0301006
1552 Ga0501080_0000121
1553 Ga0501080_0263602
1554 Ga0501081_0541419
1555 Ga0501083_0196797
1556 Ga0501035_0000560
1557 Ga0501035_0107197
1558 Ga0501035_1240073
1559 Ga0501044_0003060
1560 Ga0501044_0126444
1561 Ga0501044_0339903
1562 Ga0501045_0021557
1563 Ga0501045_0392010
1564 nmdc:mga03683_138181_c2
1565 nmdc:mga03n38_438642_c1
1566 nmdc:mga00v17_15162_c1
1567 nmdc:mga00v17_192521_c1
1568 nmdc:mga00v17_48928_c1
1569 nmdc:mga0yw44_125417_c1
1570 nmdc:mga0yw44_614383_c1
1571 nmdc:mga0yw44_64870_c1
1572 nmdc:mga0k408_47851_c1
1573 nmdc:mga06z11_737839_c1
1574 nmdc:mga07m45_313695_c1
1575 nmdc:mga07m45_534364_c1
1576 nmdc:mga07m45_54181_c1
1577 nmdc:mga05p37_1099295_c1
1578 nmdc:mga08y16_1112174_c1
1579 nmdc:mga0n895_260877_c1
1580 nmdc:mga08x19_217890_c1
1581 nmdc:mga0a205_340828_c1
1582 nmdc:mga0sz30_134609_c1
1583 nmdc:mga0sz30_543670_c1
1584 Ga0495601_0045437
1585 Ga0495612_0068390
1586 Ga0500635_0058943
1587 Ga0495655_0023426
1588 Ga0500643_000019
1589 Ga0500643_033033
1590 Ga0500643_041002
1591 Ga0500644_0222947
1592 Ga0500581_086634
1593 Ga0500646_0058934
1594 Ga0500646_0089176
1595 Ga0500647_0012879
1596 Ga0500647_0025221
1597 Ga0500583_0072299
1598 Ga0500583_0086700
1599 Ga0500651_0181130
1600 Ga0500651_0191850
1601 Ga0500566_0000064
1602 Ga0500566_0000487
1603 Ga0500566_0025880
1604 Ga0500640_112304
1605 Ga0500641_0012349
1606 Ga0500641_0062311
1607 Ga0500641_0193915
1608 Ga0500650_0000487
1609 Ga0500650_0179496
1610 Ga0500555_009867
1611 Ga0500555_077452
1612 Ga0500556_0000024
1613 Ga0500562_016470
1614 Ga0500562_043268
1615 Ga0500569_014352
1616 Ga0500569_032978
1617 Ga0500572_000026
1618 Ga0500572_000364
1619 Ga0500572_004826
1620 Ga0500592_004982
1621 Ga0500593_086409
1622 Ga0500594_0038664
1623 Ga0500595_052557
1624 Ga0500607_133685
1625 Ga0500608_006353
1626 Ga0500608_035870
1627 Ga0500608_115824
1628 Ga0500614_001622
1629 Ga0500642_0000032
1630 Ga0500642_0032767
1631 Ga0500642_0047495
1632 Ga0500652_000481
1633 Ga0500658_0026053
1634 Ga0500658_0127955
1635 Ga0500658_0250178
1636 Ga0500559_0000253
1637 Ga0500559_0004081
1638 Ga0500559_0004285
1639 Ga0500559_0186659
1640 Ga0500561_0040681
1641 Ga0500564_234411
1642 Ga0500568_0002680
1643 Ga0500568_0123854
1644 Ga0500573_0018416
1645 Ga0500577_0005444
1646 Ga0500577_0297215
1647 Ga0500579_182739
1648 Ga0500586_005621
1649 Ga0500589_065286
1650 Ga0500589_079400
1651 Ga0500590_021236
1652 Ga0500590_078722
1653 Ga0500590_093519
1654 Ga0500603_000077
1655 Ga0500603_001774
1656 Ga0500603_179810
1657 Ga0500604_0000989
1658 Ga0500604_0004698
1659 Ga0500616_0000332
1660 Ga0500620_098065
1661 Ga0500622_0000955
1662 Ga0500622_0014137
1663 Ga0500622_0203312
1664 Ga0500622_0320392
1665 Ga0500627_0029972
1666 Ga0500627_0055008
1667 Ga0500627_0068261
1668 Ga0500627_0098394
1669 Ga0500630_001362
1670 Ga0500633_0056495
1671 Ga0500633_0116425
1672 Ga0500633_0150569
1673 Ga0500634_0136143
1674 Ga0500634_0152863
1675 Ga0500638_024344
1676 Ga0500638_042696
1677 Ga0500638_170453
1678 Ga0500639_000221
1679 Ga0500639_017544
1680 Ga0500639_065028
1681 Ga0500639_228021
1682 Ga0500636_0001338
1683 Ga0500636_0004907
1684 Ga0500636_0038378
1685 Ga0500636_0300440
1686 Ga0500637_0003257
1687 Ga0500637_0282501
1688 Ga0500567_066881
1689 Ga0500570_107793
1690 Ga0500611_035251
1691 Ga0500645_062049
1692 Ga0500609_006078
1693 Ga0500609_011773
1694 Ga0500596_000824
1695 Ga0500596_002645
1696 Ga0500596_009335
1697 Ga0500599_030269
1698 Ga0500601_000615
1699 Ga0500601_035567
1700 Ga0501084_0823990
1701 Ga0501082_1122867
1702 Ga0466962_0531068
1703 2513697001
1704 2524467053
1705 2603861011
1706 2671122892
1707 2723846445
1708 2793072460
1709 2857528863
1710 2874610589
1711 2876810050
1712 2879118649
1713 2885382452
1714 2893069061
1715 2903750436
1716 2919079285
1717 2922387990
1718 3005478666
1719 8006964829
1720 8006991775
1721 8006995566
1722 8056676388

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

99

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dm5-assembly1.cif.gz_F crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.936 54 150
5dm5-assembly1.cif.gz_D crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9217 54 150
2qq2-assembly2.cif.gz_J crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.9159 52 150
5dm5-assembly1.cif.gz_B crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9126 54 150
2qq2-assembly1.cif.gz_C crystal structure of c-terminal domain of human acyl-coa thioesterase 7 0.908 52 150
ID Description Score Start End Superfamily
af_Q91V12_220_381_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.913 52 150 3.10.129.10
af_A0A1D6KJS7_406_533_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9033 41 150 3.10.129.10
af_Q9VMA4_280_435_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9026 52 150 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.897 51 147 3.10.129.10
af_O06307_73_209_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8969 51 149 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A844SJT9-F1-model_v4 Thioesterase domain-containing protein 0.9911 52 148 GO:0047617
AF-A0A259K1R4-F1-model_v4 Phosphoglycerate kinase (EC 2.7.2.3) 0.9802 15 151 GO:0004618
GO:0005524
GO:0005829
GO:0006094
GO:0006096
GO:0016790
GO:0043531
AF-A0A0S6UYL4-F1-model_v4 Hypothetical UPF0152 protein PA0474 0.9772 25 158 GO:0047617
AF-A0A560JDY4-F1-model_v4 Uncharacterized protein (TIGR00369 family) 0.9724 14 150 GO:0047617
AF-A0A844SJT9-F1-model_v4 Thioesterase domain-containing protein 0.9713 52 148 GO:0047617

Map