F483776
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 859 | 481 | 700 | 498 |
Family's Representative Sequence
| Representative Sequence | 3300026041|Ga0207639_10015350|Ga0207639_100153504 |
| Length | 533 |
| Sequence | MKLETRSARFWRGRRRWHDARTDMTTTKSTPAEAKQVWFLTGSQELYGPQTLAQVAEQSRAIVAHLAAKGQLPAEVVWKPVVTSASAIRACLDDANREPACIGVIAWMHTFSPAKMWISGLDLLRKPLLHLHTQVNESLPWATIDMDFMNLNQAAHGDREFGYVQTRLGVPRKTVAGHVSDPAVLGRITRWVRAATGFTKLRTLRLARFGDNMRDVAVTEGDKVEAELRFGVSVNTYGVNDLVAAVDAVEEGRVDALVKEYAEVYRLAPELAAGGAKHASLRYAARIEVGLRNFLTAGGFGAFTTNFEDLGGLRQLPGLAVQRLMADGYGFGGEGDWKTSLLLATLKAAGXXXXRGTSFMEDYTYHFGPGEPKILGAHMLEVCPSISAAKPSCEIHPLSIGGREDPVRLVFDAKPGPAVVIGLCDLGDRFRLVANEIDVVPPDAPLPRLPVARAVWKPRPTLPTSAECWLEAGGPHHTVLSQAVDGEILHDLATMLRTELVLIDADTKTASFTDRLRWNQAYFRLAAGLPGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 3 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 4 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 5 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 6 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 7 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 8 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 9 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 10 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 11 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 12 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 13 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 14 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 15 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 16 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 17 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 18 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 19 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 20 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 21 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 22 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 23 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 24 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 25 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 26 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 27 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 28 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 29 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 30 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 31 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 32 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 33 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 34 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 35 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 36 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 37 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 38 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 39 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 40 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 41 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 42 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 43 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 44 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 45 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 46 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 47 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 48 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 49 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 50 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 51 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 52 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 53 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 54 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 55 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 56 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 57 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 58 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 59 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 60 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 61 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 62 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 63 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 64 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 65 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 66 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 67 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 68 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 69 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 70 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 71 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 72 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 73 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 74 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 75 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 76 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 77 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 78 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 79 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 80 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 81 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 82 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 83 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 84 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 85 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 86 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 87 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 88 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 89 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 90 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 91 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 92 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 93 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 94 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 95 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 96 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 97 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 98 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 99 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 100 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 101 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 102 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 103 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 104 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 105 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 106 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 107 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 108 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 109 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 110 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 111 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 112 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 113 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 114 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 115 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 116 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 117 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 118 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 119 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 120 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 121 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 122 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 123 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 124 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 125 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 126 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 127 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 128 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 129 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 130 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 131 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 132 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 133 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 134 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 135 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 136 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 137 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 138 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 142 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 145 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 147 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 156 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 158 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 164 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 165 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 166 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 167 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 169 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 170 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 172 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 173 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 174 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 175 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 176 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 177 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 178 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 179 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 180 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 181 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 182 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 183 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 184 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 185 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 186 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 187 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 188 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 210 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 213 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 214 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 216 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 217 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 265 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 272 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 273 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 274 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 275 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 276 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 277 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 278 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 279 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 280 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 281 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 282 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 283 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 284 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 285 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 286 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 287 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 288 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 289 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 290 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 291 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 292 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 293 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 294 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 295 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 296 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 301 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 302 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 303 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 304 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 305 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 306 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 307 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 308 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 309 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 310 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 311 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 312 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 314 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 315 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 316 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 317 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 318 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 319 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 320 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 321 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 322 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 323 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 324 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 325 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 326 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 327 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 328 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 329 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 330 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 331 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 332 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 333 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 334 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 335 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 336 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 337 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 338 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 339 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 340 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 341 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 342 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 343 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 344 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 345 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 442 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 452 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 454 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 455 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 457 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 458 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 459 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 462 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 463 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 464 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 465 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 466 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 467 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 468 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 469 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 470 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 471 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 472 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 473 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 474 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 475 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 476 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 477 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 478 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 479 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 480 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 481 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.37 |
| Metatranscriptomes | 0.12 |
| Isolates | 18.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.47 |
| Bulb | 0 |
| Endosphere | 7.68 |
| Nodule | 1.05 |
| Rhizoplane | 7.22 |
| Rhizosphere | 66.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1001250 | 3300000546 | Bacteria | 3820 |
| 2 | JGI25152J39213_1001324 | 3300002773 | Bacteria | 10970 |
| 3 | JGI25406J46586_10004170 | 3300003203 | Bacteria | 6746 |
| 4 | Ga0055540_1000489 | 3300003792 | Bacteria | 30349 |
| 5 | Ga0055540_1000565 | 3300003792 | Bacteria | 27246 |
| 6 | Ga0055540_1011832 | 3300003792 | Bacteria | 2782 |
| 7 | Ga0070658_10009217 | 3300005327 | Bacteria | 7936 |
| 8 | Ga0070658_10091794 | 3300005327 | Bacteria | 2503 |
| 9 | Ga0070676_10013628 | 3300005328 | Bacteria | 4457 |
| 10 | Ga0070683_100008071 | 3300005329 | Bacteria | 8939 |
| 11 | Ga0070683_100025665 | 3300005329 | Bacteria | 5295 |
| 12 | Ga0070683_100042809 | 3300005329 | Bacteria | 4171 |
| 13 | Ga0070683_100069343 | 3300005329 | Bacteria | 3287 |
| 14 | Ga0070683_100206941 | 3300005329 | Bacteria | 1864 |
| 15 | Ga0068869_100002032 | 3300005334 | Bacteria | 12153 |
| 16 | Ga0070680_100098710 | 3300005336 | Bacteria | 2423 |
| 17 | Ga0070682_100033936 | 3300005337 | Bacteria | 3103 |
| 18 | Ga0070682_100040418 | 3300005337 | Bacteria | 2869 |
| 19 | Ga0070682_100090221 | 3300005337 | Bacteria | 2003 |
| 20 | Ga0068868_100051831 | 3300005338 | Bacteria | 3229 |
| 21 | Ga0070660_100044752 | 3300005339 | Bacteria | 3387 |
| 22 | Ga0070660_100174198 | 3300005339 | Bacteria | 1739 |
| 23 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 24 | Ga0070692_10007140 | 3300005345 | Bacteria | 4904 |
| 25 | Ga0070668_100000179 | 3300005347 | Bacteria | 40901 |
| 26 | Ga0070668_100002291 | 3300005347 | Bacteria | 14119 |
| 27 | Ga0070668_100004262 | 3300005347 | Bacteria | 10609 |
| 28 | Ga0070668_100025049 | 3300005347 | Bacteria | 4522 |
| 29 | Ga0070668_100045835 | 3300005347 | Bacteria | 3355 |
| 30 | Ga0070668_100118124 | 3300005347 | Bacteria | 2117 |
| 31 | Ga0070669_100039467 | 3300005353 | Bacteria | 3431 |
| 32 | Ga0070669_100070915 | 3300005353 | Bacteria | 2576 |
| 33 | Ga0070675_100000489 | 3300005354 | Bacteria | 27047 |
| 34 | Ga0070671_100011360 | 3300005355 | Bacteria | 7159 |
| 35 | Ga0070674_100166612 | 3300005356 | Bacteria | 1676 |
| 36 | Ga0070673_100007266 | 3300005364 | Bacteria | 7292 |
| 37 | Ga0070667_100002522 | 3300005367 | Bacteria | 15967 |
| 38 | Ga0070709_10044445 | 3300005434 | Bacteria | 2751 |
| 39 | Ga0070714_100012167 | 3300005435 | Bacteria | 6858 |
| 40 | Ga0070713_100054093 | 3300005436 | Bacteria | 3329 |
| 41 | Ga0070710_10000215 | 3300005437 | Bacteria | 27009 |
| 42 | Ga0070701_10041216 | 3300005438 | Bacteria | 2352 |
| 43 | Ga0070700_100041430 | 3300005441 | Bacteria | 2823 |
| 44 | Ga0070663_100049269 | 3300005455 | Bacteria | 2990 |
| 45 | Ga0070662_100027514 | 3300005457 | Bacteria | 3948 |
| 46 | Ga0070679_100093619 | 3300005530 | Bacteria | 2992 |
| 47 | Ga0070679_100240347 | 3300005530 | Bacteria | 1768 |
| 48 | Ga0070684_100035482 | 3300005535 | Bacteria | 4268 |
| 49 | Ga0070684_100081857 | 3300005535 | Bacteria | 2857 |
| 50 | Ga0068853_100000325 | 3300005539 | Bacteria | 33307 |
| 51 | Ga0068853_100032893 | 3300005539 | Bacteria | 4396 |
| 52 | Ga0068853_100042799 | 3300005539 | Bacteria | 3874 |
| 53 | Ga0068855_100000172 | 3300005563 | Bacteria | 82970 |
| 54 | Ga0068855_100001513 | 3300005563 | Bacteria | 29118 |
| 55 | Ga0068855_100012140 | 3300005563 | Bacteria | 10408 |
| 56 | Ga0068855_100072839 | 3300005563 | Bacteria | 3992 |
| 57 | Ga0070664_100002862 | 3300005564 | Bacteria | 13971 |
| 58 | Ga0070664_100009397 | 3300005564 | Bacteria | 7927 |
| 59 | Ga0068857_100013053 | 3300005577 | Bacteria | 7237 |
| 60 | Ga0068857_100054135 | 3300005577 | Bacteria | 3560 |
| 61 | Ga0068854_100029349 | 3300005578 | Bacteria | 3807 |
| 62 | Ga0068854_100084363 | 3300005578 | Bacteria | 2351 |
| 63 | Ga0070702_100026025 | 3300005615 | Bacteria | 3140 |
| 64 | Ga0068852_100093088 | 3300005616 | Bacteria | 2700 |
| 65 | Ga0068859_100028586 | 3300005617 | Bacteria | 5590 |
| 66 | Ga0068859_100112811 | 3300005617 | Bacteria | 2782 |
| 67 | Ga0068864_100140322 | 3300005618 | Bacteria | 2179 |
| 68 | Ga0068861_100052850 | 3300005719 | Bacteria | 3089 |
| 69 | Ga0068863_100000375 | 3300005841 | Bacteria | 45482 |
| 70 | Ga0068863_100065619 | 3300005841 | Bacteria | 3434 |
| 71 | Ga0068858_100003308 | 3300005842 | Bacteria | 16050 |
| 72 | Ga0068858_100019157 | 3300005842 | Bacteria | 6402 |
| 73 | Ga0068860_100000155 | 3300005843 | Bacteria | 111737 |
| 74 | Ga0068860_100231201 | 3300005843 | Bacteria | 1797 |
| 75 | Ga0068862_100000096 | 3300005844 | Bacteria | 104906 |
| 76 | Ga0068862_100040707 | 3300005844 | Bacteria | 3950 |
| 77 | Ga0068862_100062847 | 3300005844 | Bacteria | 3194 |
| 78 | Ga0068862_100078038 | 3300005844 | Bacteria | 2869 |
| 79 | Ga0081539_10000359 | 3300005985 | Bacteria | 100242 |
| 80 | Ga0081539_10000458 | 3300005985 | Bacteria | 86555 |
| 81 | Ga0081539_10000560 | 3300005985 | Bacteria | 76655 |
| 82 | Ga0081539_10000985 | 3300005985 | Bacteria | 53050 |
| 83 | Ga0081539_10001893 | 3300005985 | Bacteria | 32457 |
| 84 | Ga0081539_10002007 | 3300005985 | Bacteria | 30812 |
| 85 | Ga0081539_10004205 | 3300005985 | Bacteria | 16250 |
| 86 | Ga0081539_10007921 | 3300005985 | Bacteria | 9464 |
| 87 | Ga0081539_10010097 | 3300005985 | Bacteria | 7749 |
| 88 | Ga0081539_10034216 | 3300005985 | Bacteria | 3078 |
| 89 | Ga0075365_10002645 | 3300006038 | Bacteria | 8888 |
| 90 | Ga0075365_10005755 | 3300006038 | Bacteria | 6727 |
| 91 | Ga0075365_10071511 | 3300006038 | Bacteria | 2336 |
| 92 | Ga0075365_10148940 | 3300006038 | Bacteria | 1628 |
| 93 | Ga0075368_10000868 | 3300006042 | Bacteria | 9359 |
| 94 | Ga0075368_10001361 | 3300006042 | Bacteria | 7778 |
| 95 | Ga0075368_10039467 | 3300006042 | Bacteria | 1851 |
| 96 | Ga0075363_100000403 | 3300006048 | Bacteria | 13279 |
| 97 | Ga0075363_100024021 | 3300006048 | Bacteria | 3095 |
| 98 | Ga0075364_10004861 | 3300006051 | Bacteria | 7784 |
| 99 | Ga0075364_10011674 | 3300006051 | Bacteria | 5342 |
| 100 | Ga0075364_10047974 | 3300006051 | Bacteria | 2782 |
| 101 | Ga0075364_10065601 | 3300006051 | Bacteria | 2383 |
| 102 | Ga0075364_10068995 | 3300006051 | Bacteria | 2326 |
| 103 | Ga0075362_10000193 | 3300006177 | Bacteria | 16989 |
| 104 | Ga0075362_10003372 | 3300006177 | Bacteria | 5570 |
| 105 | Ga0075362_10007078 | 3300006177 | Bacteria | 4221 |
| 106 | Ga0075362_10034696 | 3300006177 | Bacteria | 2200 |
| 107 | Ga0075367_10003098 | 3300006178 | Bacteria | 7813 |
| 108 | Ga0075367_10005852 | 3300006178 | Bacteria | 6160 |
| 109 | Ga0075367_10006954 | 3300006178 | Bacteria | 5761 |
| 110 | Ga0075367_10018525 | 3300006178 | Bacteria | 3844 |
| 111 | Ga0075367_10023653 | 3300006178 | Bacteria | 3459 |
| 112 | Ga0075366_10003511 | 3300006195 | Bacteria | 8284 |
| 113 | Ga0075370_10001246 | 3300006353 | Bacteria | 10830 |
| 114 | Ga0075370_10046674 | 3300006353 | Bacteria | 2452 |
| 115 | Ga0097620_100028585 | 3300006931 | Bacteria | 5590 |
| 116 | Ga0097620_100112810 | 3300006931 | Bacteria | 2782 |
| 117 | Ga0105244_10019545 | 3300009036 | Bacteria | 3778 |
| 118 | Ga0105240_10000794 | 3300009093 | Bacteria | 57248 |
| 119 | Ga0105240_10142030 | 3300009093 | Bacteria | 2869 |
| 120 | Ga0111539_10012327 | 3300009094 | Bacteria | 10711 |
| 121 | Ga0105245_10059011 | 3300009098 | Bacteria | 3454 |
| 122 | Ga0105247_10000040 | 3300009101 | Bacteria | 158975 |
| 123 | Ga0105247_10058390 | 3300009101 | Bacteria | 2387 |
| 124 | Ga0114129_10001649 | 3300009147 | Bacteria | 30343 |
| 125 | Ga0105243_10028615 | 3300009148 | Bacteria | 4279 |
| 126 | Ga0105241_10166788 | 3300009174 | Bacteria | 1815 |
| 127 | Ga0105248_10000095 | 3300009177 | Bacteria | 98093 |
| 128 | Ga0105248_10000523 | 3300009177 | Bacteria | 43662 |
| 129 | Ga0105248_10033382 | 3300009177 | Bacteria | 5749 |
| 130 | Ga0105237_10000069 | 3300009545 | Bacteria | 138459 |
| 131 | Ga0105237_10082291 | 3300009545 | Bacteria | 3210 |
| 132 | Ga0105237_10164917 | 3300009545 | Bacteria | 2214 |
| 133 | Ga0105238_10018496 | 3300009551 | Bacteria | 7090 |
| 134 | Ga0105238_10172151 | 3300009551 | Bacteria | 2141 |
| 135 | Ga0105238_10178253 | 3300009551 | Bacteria | 2102 |
| 136 | Ga0105249_10000069 | 3300009553 | Bacteria | 148118 |
| 137 | Ga0105239_10011205 | 3300010375 | Bacteria | 10006 |
| 138 | Ga0105239_10017704 | 3300010375 | Bacteria | 7883 |
| 139 | Ga0105239_10035524 | 3300010375 | Bacteria | 5473 |
| 140 | Ga0105239_10075668 | 3300010375 | Bacteria | 3702 |
| 141 | Ga0157369_10004237 | 3300013105 | Bacteria | 16990 |
| 142 | Ga0157378_10086842 | 3300013297 | Bacteria | 2836 |
| 143 | Ga0163162_10178658 | 3300013306 | Bacteria | 2249 |
| 144 | Ga0163162_10243649 | 3300013306 | Bacteria | 1929 |
| 145 | Ga0157372_10009312 | 3300013307 | Bacteria | 10445 |
| 146 | Ga0157375_10027678 | 3300013308 | Bacteria | 5303 |
| 147 | Ga0157375_10120599 | 3300013308 | Bacteria | 2731 |
| 148 | Ga0163163_10002221 | 3300014325 | Bacteria | 16342 |
| 149 | Ga0163163_10032767 | 3300014325 | Bacteria | 5021 |
| 150 | Ga0163163_10232425 | 3300014325 | Bacteria | 1893 |
| 151 | Ga0157380_10097983 | 3300014326 | Bacteria | 2435 |
| 152 | Ga0157380_10106037 | 3300014326 | Bacteria | 2351 |
| 153 | Ga0157380_10113687 | 3300014326 | Bacteria | 2280 |
| 154 | Ga0157380_10151243 | 3300014326 | Bacteria | 2007 |
| 155 | Ga0182008_10003222 | 3300014497 | Bacteria | 9971 |
| 156 | Ga0157377_10016890 | 3300014745 | Bacteria | 3764 |
| 157 | Ga0157379_10048180 | 3300014968 | Bacteria | 3803 |
| 158 | Ga0157379_10061645 | 3300014968 | Bacteria | 3354 |
| 159 | Ga0157379_10110976 | 3300014968 | Bacteria | 2463 |
| 160 | Ga0182006_1022536 | 3300015261 | Bacteria | 2617 |
| 161 | Ga0182007_10003290 | 3300015262 | Bacteria | 7668 |
| 162 | Ga0163161_10001854 | 3300017792 | Bacteria | 15446 |
| 163 | Ga0163161_10088878 | 3300017792 | Bacteria | 2284 |
| 164 | Ga0206353_11323100 | 3300020082 | Bacteria | 3273 |
| 165 | Ga0213876_10003619 | 3300021384 | Bacteria | 8788 |
| 166 | Ga0209129_1000060 | 3300025258 | Bacteria | 248262 |
| 167 | Ga0209673_1018588 | 3300025273 | Bacteria | 2521 |
| 168 | Ga0209025_1000308 | 3300025294 | Bacteria | 108660 |
| 169 | Ga0209051_1001145 | 3300025303 | Bacteria | 24140 |
| 170 | Ga0209051_1002772 | 3300025303 | Bacteria | 12097 |
| 171 | Ga0207697_10000819 | 3300025315 | Bacteria | 17603 |
| 172 | Ga0207692_10000374 | 3300025898 | Bacteria | 15408 |
| 173 | Ga0207710_10000050 | 3300025900 | Bacteria | 186453 |
| 174 | Ga0207688_10011034 | 3300025901 | Bacteria | 4915 |
| 175 | Ga0207688_10019867 | 3300025901 | Bacteria | 3663 |
| 176 | Ga0207699_10024303 | 3300025906 | Bacteria | 3312 |
| 177 | Ga0207645_10003630 | 3300025907 | Bacteria | 11667 |
| 178 | Ga0207645_10004422 | 3300025907 | Bacteria | 10404 |
| 179 | Ga0207705_10010020 | 3300025909 | Bacteria | 6900 |
| 180 | Ga0207705_10056278 | 3300025909 | Bacteria | 2835 |
| 181 | Ga0207695_10004093 | 3300025913 | Bacteria | 20042 |
| 182 | Ga0207695_10012775 | 3300025913 | Bacteria | 10056 |
| 183 | Ga0207695_10220548 | 3300025913 | Bacteria | 1804 |
| 184 | Ga0207671_10000154 | 3300025914 | Bacteria | 106945 |
| 185 | Ga0207671_10001756 | 3300025914 | Bacteria | 24379 |
| 186 | Ga0207671_10006465 | 3300025914 | Bacteria | 10431 |
| 187 | Ga0207657_10067366 | 3300025919 | Bacteria | 3044 |
| 188 | Ga0207652_10024905 | 3300025921 | Bacteria | 4968 |
| 189 | Ga0207652_10213874 | 3300025921 | Bacteria | 1736 |
| 190 | Ga0207652_10264190 | 3300025921 | Bacteria | 1552 |
| 191 | Ga0207681_10002699 | 3300025923 | Bacteria | 11244 |
| 192 | Ga0207694_10005408 | 3300025924 | Bacteria | 9831 |
| 193 | Ga0207694_10006871 | 3300025924 | Bacteria | 8643 |
| 194 | Ga0207650_10129326 | 3300025925 | Bacteria | 1974 |
| 195 | Ga0207659_10002025 | 3300025926 | Bacteria | 12013 |
| 196 | Ga0207659_10066240 | 3300025926 | Bacteria | 2621 |
| 197 | Ga0207664_10101658 | 3300025929 | Bacteria | 2376 |
| 198 | Ga0207664_10109071 | 3300025929 | Bacteria | 2299 |
| 199 | Ga0207706_10004973 | 3300025933 | Bacteria | 12421 |
| 200 | Ga0207709_10033255 | 3300025935 | Bacteria | 3026 |
| 201 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 202 | Ga0207669_10003595 | 3300025937 | Bacteria | 6723 |
| 203 | Ga0207665_10162161 | 3300025939 | Bacteria | 1609 |
| 204 | Ga0207691_10002119 | 3300025940 | Bacteria | 19397 |
| 205 | Ga0207691_10009346 | 3300025940 | Bacteria | 9411 |
| 206 | Ga0207711_10000082 | 3300025941 | Bacteria | 102386 |
| 207 | Ga0207711_10001532 | 3300025941 | Bacteria | 21418 |
| 208 | Ga0207689_10017680 | 3300025942 | Bacteria | 6025 |
| 209 | Ga0207689_10055970 | 3300025942 | Bacteria | 3245 |
| 210 | Ga0207661_10000627 | 3300025944 | Bacteria | 22709 |
| 211 | Ga0207661_10006461 | 3300025944 | Bacteria | 8287 |
| 212 | Ga0207661_10010242 | 3300025944 | Bacteria | 6742 |
| 213 | Ga0207661_10018147 | 3300025944 | Bacteria | 5227 |
| 214 | Ga0207661_10086160 | 3300025944 | Bacteria | 2606 |
| 215 | Ga0207679_10008166 | 3300025945 | Bacteria | 6662 |
| 216 | Ga0207679_10014220 | 3300025945 | Bacteria | 5227 |
| 217 | Ga0207679_10016040 | 3300025945 | Bacteria | 4966 |
| 218 | Ga0207667_10000288 | 3300025949 | Bacteria | 69604 |
| 219 | Ga0207667_10011093 | 3300025949 | Bacteria | 10492 |
| 220 | Ga0207667_10016376 | 3300025949 | Bacteria | 8379 |
| 221 | Ga0207667_10065374 | 3300025949 | Bacteria | 3793 |
| 222 | Ga0207667_10108198 | 3300025949 | Bacteria | 2868 |
| 223 | Ga0207651_10075480 | 3300025960 | Bacteria | 2406 |
| 224 | Ga0207712_10000358 | 3300025961 | Bacteria | 40472 |
| 225 | Ga0207668_10000813 | 3300025972 | Bacteria | 19132 |
| 226 | Ga0207668_10001454 | 3300025972 | Bacteria | 13906 |
| 227 | Ga0207668_10002664 | 3300025972 | Bacteria | 10444 |
| 228 | Ga0207668_10012883 | 3300025972 | Bacteria | 5132 |
| 229 | Ga0207668_10012972 | 3300025972 | Bacteria | 5121 |
| 230 | Ga0207668_10133450 | 3300025972 | Bacteria | 1899 |
| 231 | Ga0207658_10001810 | 3300025986 | Bacteria | 16011 |
| 232 | Ga0207703_10010353 | 3300026035 | Bacteria | 7298 |
| 233 | Ga0207703_10079361 | 3300026035 | Bacteria | 2730 |
| 234 | Ga0207639_10015350 | 3300026041 | Bacteria | 5403 |
| 235 | Ga0207639_10035234 | 3300026041 | Bacteria | 3703 |
| 236 | Ga0207639_10035662 | 3300026041 | Bacteria | 3682 |
| 237 | Ga0207708_10021040 | 3300026075 | Bacteria | 4922 |
| 238 | Ga0207708_10023839 | 3300026075 | Bacteria | 4627 |
| 239 | Ga0207641_10002016 | 3300026088 | Bacteria | 19356 |
| 240 | Ga0207641_10230516 | 3300026088 | Bacteria | 1721 |
| 241 | Ga0207648_10013559 | 3300026089 | Bacteria | 7577 |
| 242 | Ga0207676_10079769 | 3300026095 | Bacteria | 2655 |
| 243 | Ga0207676_10098840 | 3300026095 | Bacteria | 2414 |
| 244 | Ga0207674_10005994 | 3300026116 | Bacteria | 14383 |
| 245 | Ga0207674_10019776 | 3300026116 | Bacteria | 7286 |
| 246 | Ga0207674_10058927 | 3300026116 | Bacteria | 3888 |
| 247 | Ga0207674_10092796 | 3300026116 | Bacteria | 3008 |
| 248 | Ga0207675_100007436 | 3300026118 | Bacteria | 10350 |
| 249 | Ga0207683_10182073 | 3300026121 | Bacteria | 1905 |
| 250 | Ga0207683_10205772 | 3300026121 | Bacteria | 1790 |
| 251 | Ga0207698_10041223 | 3300026142 | Bacteria | 3438 |
| 252 | Ga0207698_10190191 | 3300026142 | Bacteria | 1827 |
| 253 | Ga0209371_1009997 | 3300027312 | Bacteria | 2962 |
| 254 | Ga0209813_10005131 | 3300027866 | Bacteria | 3166 |
| 255 | Ga0207428_10034604 | 3300027907 | Bacteria | 4136 |
| 256 | Ga0207428_10051212 | 3300027907 | Bacteria | 3301 |
| 257 | Ga0268266_10005012 | 3300028379 | Bacteria | 12509 |
| 258 | Ga0268266_10142167 | 3300028379 | Bacteria | 2154 |
| 259 | Ga0268265_10000106 | 3300028380 | Bacteria | 104924 |
| 260 | Ga0268265_10012140 | 3300028380 | Bacteria | 5833 |
| 261 | Ga0268265_10037886 | 3300028380 | Bacteria | 3542 |
| 262 | Ga0268265_10161810 | 3300028380 | Bacteria | 1902 |
| 263 | Ga0268264_10000219 | 3300028381 | Bacteria | 111751 |
| 264 | Ga0307517_10027818 | 3300028786 | Bacteria | 6771 |
| 265 | Ga0307517_10067886 | 3300028786 | Bacteria | 3257 |
| 266 | Ga0307515_10000947 | 3300028794 | Bacteria | 66394 |
| 267 | Ga0307515_10001813 | 3300028794 | Bacteria | 47671 |
| 268 | Ga0307515_10018371 | 3300028794 | Bacteria | 12663 |
| 269 | Ga0307515_10039644 | 3300028794 | Bacteria | 7480 |
| 270 | Ga0307515_10087567 | 3300028794 | Bacteria | 3950 |
| 271 | Ga0307515_10089386 | 3300028794 | Bacteria | 3879 |
| 272 | Ga0265338_10000718 | 3300028800 | Bacteria | 56666 |
| 273 | Ga0268256_1011287 | 3300030500 | Bacteria | 2840 |
| 274 | Ga0307511_10000551 | 3300030521 | Bacteria | 40242 |
| 275 | Ga0307512_10003501 | 3300030522 | Bacteria | 18159 |
| 276 | Ga0307512_10016324 | 3300030522 | Bacteria | 6854 |
| 277 | Ga0307512_10082058 | 3300030522 | Bacteria | 2309 |
| 278 | Ga0316177_1196084 | 3300030731 | Bacteria | 1866 |
| 279 | Ga0265340_10002148 | 3300031247 | Bacteria | 11312 |
| 280 | Ga0265340_10002640 | 3300031247 | Bacteria | 10187 |
| 281 | Ga0265339_10005353 | 3300031249 | Bacteria | 8546 |
| 282 | Ga0307513_10001099 | 3300031456 | Bacteria | 39148 |
| 283 | Ga0307513_10026149 | 3300031456 | Bacteria | 6738 |
| 284 | Ga0307513_10117422 | 3300031456 | Bacteria | 2638 |
| 285 | Ga0307509_10003859 | 3300031507 | Bacteria | 22216 |
| 286 | Ga0307509_10012346 | 3300031507 | Bacteria | 10228 |
| 287 | Ga0307509_10047240 | 3300031507 | Bacteria | 4631 |
| 288 | Ga0307509_10051795 | 3300031507 | Bacteria | 4386 |
| 289 | Ga0307509_10096687 | 3300031507 | Bacteria | 3004 |
| 290 | Ga0307408_100002739 | 3300031548 | Bacteria | 12229 |
| 291 | Ga0307408_100008034 | 3300031548 | Bacteria | 6975 |
| 292 | Ga0307408_100011377 | 3300031548 | Bacteria | 5878 |
| 293 | Ga0307408_100015213 | 3300031548 | Bacteria | 5121 |
| 294 | Ga0307408_100076779 | 3300031548 | Bacteria | 2486 |
| 295 | Ga0307508_10003602 | 3300031616 | Bacteria | 15569 |
| 296 | Ga0307508_10026043 | 3300031616 | Bacteria | 5302 |
| 297 | Ga0307508_10030179 | 3300031616 | Bacteria | 4899 |
| 298 | Ga0307508_10042136 | 3300031616 | Bacteria | 4097 |
| 299 | Ga0307508_10056678 | 3300031616 | Bacteria | 3469 |
| 300 | Ga0307516_10000250 | 3300031730 | Bacteria | 69490 |
| 301 | Ga0307516_10028506 | 3300031730 | Bacteria | 5649 |
| 302 | Ga0307413_10009293 | 3300031824 | Bacteria | 4698 |
| 303 | Ga0307413_10016133 | 3300031824 | Bacteria | 3849 |
| 304 | Ga0307413_10027581 | 3300031824 | Bacteria | 3149 |
| 305 | Ga0307413_10035274 | 3300031824 | Bacteria | 2867 |
| 306 | Ga0307413_10039642 | 3300031824 | Bacteria | 2741 |
| 307 | Ga0307518_10012013 | 3300031838 | Bacteria | 6197 |
| 308 | Ga0307410_10001657 | 3300031852 | Bacteria | 10246 |
| 309 | Ga0307410_10002221 | 3300031852 | Bacteria | 9260 |
| 310 | Ga0307410_10034921 | 3300031852 | Bacteria | 3261 |
| 311 | Ga0307410_10043783 | 3300031852 | Bacteria | 2969 |
| 312 | Ga0307410_10045737 | 3300031852 | Bacteria | 2917 |
| 313 | Ga0326468_10000057 | 3300031889 | Bacteria | 9014 |
| 314 | Ga0307406_10000550 | 3300031901 | Bacteria | 21605 |
| 315 | Ga0307406_10003121 | 3300031901 | Bacteria | 9007 |
| 316 | Ga0307406_10026991 | 3300031901 | Bacteria | 3455 |
| 317 | Ga0307406_10038987 | 3300031901 | Bacteria | 2944 |
| 318 | Ga0307407_10009961 | 3300031903 | Bacteria | 4455 |
| 319 | Ga0307407_10012418 | 3300031903 | Bacteria | 4093 |
| 320 | Ga0307407_10014986 | 3300031903 | Bacteria | 3814 |
| 321 | Ga0307407_10109959 | 3300031903 | Bacteria | 1728 |
| 322 | Ga0307412_10001250 | 3300031911 | Bacteria | 14379 |
| 323 | Ga0307412_10012746 | 3300031911 | Bacteria | 4906 |
| 324 | Ga0307412_10034660 | 3300031911 | Bacteria | 3219 |
| 325 | Ga0307412_10075738 | 3300031911 | Bacteria | 2309 |
| 326 | Ga0307412_10079546 | 3300031911 | Bacteria | 2262 |
| 327 | Ga0307409_100000001 | 3300031995 | Bacteria | 93927 |
| 328 | Ga0307409_100001839 | 3300031995 | Bacteria | 10784 |
| 329 | Ga0307409_100015269 | 3300031995 | Bacteria | 5033 |
| 330 | Ga0307409_100022829 | 3300031995 | Bacteria | 4320 |
| 331 | Ga0307409_100033573 | 3300031995 | Bacteria | 3736 |
| 332 | Ga0307409_100271302 | 3300031995 | Bacteria | 1562 |
| 333 | Ga0307416_100000340 | 3300032002 | Bacteria | 24185 |
| 334 | Ga0307416_100092582 | 3300032002 | Bacteria | 2600 |
| 335 | Ga0307416_100093606 | 3300032002 | Bacteria | 2589 |
| 336 | Ga0307416_100123188 | 3300032002 | Bacteria | 2316 |
| 337 | Ga0307416_100126699 | 3300032002 | Bacteria | 2288 |
| 338 | Ga0307416_100202809 | 3300032002 | Bacteria | 1884 |
| 339 | Ga0307414_10020036 | 3300032004 | Bacteria | 4159 |
| 340 | Ga0307414_10047442 | 3300032004 | Bacteria | 2956 |
| 341 | Ga0307411_10011641 | 3300032005 | Bacteria | 4760 |
| 342 | Ga0307415_100000176 | 3300032126 | Bacteria | 28510 |
| 343 | Ga0307415_100005698 | 3300032126 | Bacteria | 6639 |
| 344 | Ga0307415_100027228 | 3300032126 | Bacteria | 3619 |
| 345 | Ga0307415_100037791 | 3300032126 | Bacteria | 3176 |
| 346 | Ga0307415_100082941 | 3300032126 | Bacteria | 2295 |
| 347 | Ga0307507_10000769 | 3300033179 | Bacteria | 70490 |
| 348 | Ga0307507_10036950 | 3300033179 | Bacteria | 4978 |
| 349 | Ga0307507_10054641 | 3300033179 | Bacteria | 3798 |
| 350 | Ga0307507_10067875 | 3300033179 | Bacteria | 3258 |
| 351 | Ga0307507_10129131 | 3300033179 | Bacteria | 1986 |
| 352 | Ga0307510_10025243 | 3300033180 | Bacteria | 6857 |
| 353 | Ga0307510_10033123 | 3300033180 | Bacteria | 5808 |
| 354 | Ga0307510_10086838 | 3300033180 | Bacteria | 2998 |
| 355 | Ga0373951_0000101 | 3300035091 | Bacteria | 33226 |
| 356 | Ga0373954_0040190 | 3300035118 | Bacteria | 2179 |
| 357 | Ga0373956_0069724 | 3300035119 | Bacteria | 1603 |
| 358 | Ga0373942_0000020 | 3300035207 | Bacteria | 30859 |
| 359 | Ga0373942_0002271 | 3300035207 | Bacteria | 4704 |
| 360 | Ga0373962_0001716 | 3300035242 | Bacteria | 5205 |
| 361 | Ga0373935_0033966 | 3300035692 | Bacteria | 3177 |
| 362 | Ga0316582_0054479 | 3300036647 | Bacteria | 2546 |
| 363 | Ga0395899_0043425 | 3300037312 | Bacteria | 3353 |
| 364 | Ga0395900_0003634 | 3300037418 | Bacteria | 16576 |
| 365 | Ga0395900_0024250 | 3300037418 | Bacteria | 6211 |
| 366 | Ga0395900_0168595 | 3300037418 | Bacteria | 2230 |
| 367 | Ga0395898_0001504 | 3300037466 | Bacteria | 32204 |
| 368 | Ga0395898_0005765 | 3300037466 | Bacteria | 13330 |
| 369 | Ga0395898_0007741 | 3300037466 | Bacteria | 11405 |
| 370 | Ga0395898_0013473 | 3300037466 | Bacteria | 8420 |
| 371 | Ga0395898_0097470 | 3300037466 | Bacteria | 2824 |
| 372 | Ga0395898_0129601 | 3300037466 | Bacteria | 2416 |
| 373 | Ga0395898_0183460 | 3300037466 | Bacteria | 2000 |
| 374 | Ga0395901_0009136 | 3300038443 | Bacteria | 10038 |
| 375 | Ga0395901_0011602 | 3300038443 | Bacteria | 8927 |
| 376 | Ga0395901_0013592 | 3300038443 | Bacteria | 8278 |
| 377 | Ga0395901_0020552 | 3300038443 | Bacteria | 6757 |
| 378 | Ga0395901_0047570 | 3300038443 | Bacteria | 4454 |
| 379 | Ga0395901_0084088 | 3300038443 | Bacteria | 3326 |
| 380 | Ga0436365_0727080 | 3300039437 | Bacteria | 13899 |
| 381 | Ga0439436_0000821 | 3300041404 | Bacteria | 8438 |
| 382 | Ga0439438_004754 | 3300041405 | Bacteria | 5131 |
| 383 | Ga0439438_015083 | 3300041405 | Bacteria | 2283 |
| 384 | Ga0439461_0000431 | 3300041410 | Bacteria | 6028 |
| 385 | Ga0439461_0002285 | 3300041410 | Bacteria | 3043 |
| 386 | Ga0439466_0001864 | 3300041411 | Bacteria | 8252 |
| 387 | Ga0439466_0002713 | 3300041411 | Bacteria | 6934 |
| 388 | Ga0439466_0018729 | 3300041411 | Bacteria | 2482 |
| 389 | Ga0451791_0029453 | 3300041451 | Bacteria | 10881 |
| 390 | Ga0451793_0934301 | 3300041452 | Bacteria | 39444 |
| 391 | Ga0451802_1520593 | 3300041460 | Bacteria | 2091 |
| 392 | Ga0451843_0598042 | 3300041509 | Bacteria | 2285 |
| 393 | Ga0451843_0667147 | 3300041509 | Bacteria | 4487 |
| 394 | Ga0439433_0000112 | 3300041999 | Bacteria | 11573 |
| 395 | Ga0439433_0001029 | 3300041999 | Bacteria | 5649 |
| 396 | Ga0439433_0003610 | 3300041999 | Bacteria | 3326 |
| 397 | Ga0439433_0005299 | 3300041999 | Bacteria | 2771 |
| 398 | Ga0439442_000035 | 3300042002 | Bacteria | 30420 |
| 399 | Ga0439442_000131 | 3300042002 | Bacteria | 18737 |
| 400 | Ga0439442_001539 | 3300042002 | Bacteria | 4523 |
| 401 | Ga0439442_003246 | 3300042002 | Bacteria | 3213 |
| 402 | Ga0439442_007106 | 3300042002 | Bacteria | 2249 |
| 403 | Ga0439448_0008307 | 3300042005 | Bacteria | 3035 |
| 404 | Ga0439449_0003274 | 3300042007 | Bacteria | 6314 |
| 405 | Ga0439449_0010735 | 3300042007 | Bacteria | 3459 |
| 406 | Ga0439449_0019538 | 3300042007 | Bacteria | 2540 |
| 407 | Ga0439457_007506 | 3300042014 | Bacteria | 2612 |
| 408 | Ga0439462_0002963 | 3300042015 | Bacteria | 4023 |
| 409 | Ga0439463_010288 | 3300042016 | Bacteria | 2299 |
| 410 | Ga0450920_000305 | 3300042122 | Bacteria | 7439 |
| 411 | Ga0450903_000903 | 3300042138 | Bacteria | 5715 |
| 412 | Ga0450907_000055 | 3300042146 | Bacteria | 47367 |
| 413 | Ga0439458_0001178 | 3300042157 | Bacteria | 6648 |
| 414 | Ga0450909_000077 | 3300042185 | Bacteria | 8947 |
| 415 | Ga0439460_0017137 | 3300042461 | Bacteria | 1938 |
| 416 | Ga0450918_000503 | 3300042531 | Bacteria | 8393 |
| 417 | Ga0466969_0001086 | 3300044656 | Bacteria | 14712 |
| 418 | Ga0466969_0036751 | 3300044656 | Bacteria | 2472 |
| 419 | Ga0466972_0000524 | 3300044658 | Bacteria | 18970 |
| 420 | Ga0466972_0000545 | 3300044658 | Bacteria | 18461 |
| 421 | Ga0466965_0000763 | 3300044683 | Bacteria | 12114 |
| 422 | Ga0466965_0001730 | 3300044683 | Bacteria | 8991 |
| 423 | Ga0466966_0001853 | 3300044684 | Bacteria | 13712 |
| 424 | Ga0466966_0002672 | 3300044684 | Bacteria | 11679 |
| 425 | Ga0466966_0009749 | 3300044684 | Bacteria | 6364 |
| 426 | Ga0466966_0067081 | 3300044684 | Bacteria | 2254 |
| 427 | Ga0466961_0000711 | 3300044693 | Bacteria | 20959 |
| 428 | Ga0466961_0000793 | 3300044693 | Bacteria | 19802 |
| 429 | Ga0466961_0000960 | 3300044693 | Bacteria | 17846 |
| 430 | Ga0466961_0040981 | 3300044693 | Bacteria | 2968 |
| 431 | Ga0466961_0068220 | 3300044693 | Bacteria | 2258 |
| 432 | Ga0466963_0009927 | 3300044694 | Bacteria | 5749 |
| 433 | Ga0466963_0032627 | 3300044694 | Bacteria | 3374 |
| 434 | Ga0466964_0015909 | 3300044706 | Bacteria | 2866 |
| 435 | Ga0453684_0013537 | 3300044712 | Bacteria | 13234 |
| 436 | Ga0466971_0002569 | 3300044719 | Bacteria | 7669 |
| 437 | Ga0466971_0002762 | 3300044719 | Bacteria | 7418 |
| 438 | Ga0466971_0047280 | 3300044719 | Bacteria | 1934 |
| 439 | Ga0466970_0000451 | 3300044765 | Bacteria | 20171 |
| 440 | Ga0466970_0011680 | 3300044765 | Bacteria | 4480 |
| 441 | Ga0466970_0016655 | 3300044765 | Bacteria | 3793 |
| 442 | Ga0466970_0048002 | 3300044765 | Bacteria | 2276 |
| 443 | Ga0466970_0069419 | 3300044765 | Bacteria | 1894 |
| 444 | Ga0466957_0004216 | 3300044842 | Bacteria | 7973 |
| 445 | Ga0466960_0001075 | 3300044901 | Bacteria | 9799 |
| 446 | Ga0466960_0003579 | 3300044901 | Bacteria | 5993 |
| 447 | Ga0466959_0000368 | 3300045049 | Bacteria | 26632 |
| 448 | Ga0466959_0000869 | 3300045049 | Bacteria | 17831 |
| 449 | Ga0466959_0005517 | 3300045049 | Bacteria | 8676 |
| 450 | Ga0466959_0022600 | 3300045049 | Bacteria | 4650 |
| 451 | Ga0466959_0052377 | 3300045049 | Bacteria | 2989 |
| 452 | Ga0466958_0000491 | 3300045836 | Bacteria | 16536 |
| 453 | Ga0466967_0000947 | 3300045976 | Bacteria | 15667 |
| 454 | Ga0466967_0006971 | 3300045976 | Bacteria | 8087 |
| 455 | Ga0466967_0013884 | 3300045976 | Bacteria | 6246 |
| 456 | Ga0466967_0019408 | 3300045976 | Bacteria | 5466 |
| 457 | Ga0466967_0180582 | 3300045976 | Bacteria | 1990 |
| 458 | Ga0495592_0001614 | 3300046454 | Bacteria | 15793 |
| 459 | Ga0495629_0079356 | 3300046459 | Bacteria | 2292 |
| 460 | Ga0495629_0123779 | 3300046459 | Bacteria | 1801 |
| 461 | Ga0495651_0000678 | 3300046462 | Bacteria | 26457 |
| 462 | Ga0495651_0003220 | 3300046462 | Bacteria | 12540 |
| 463 | Ga0495639_0029015 | 3300046475 | Bacteria | 2454 |
| 464 | Ga0495662_0001303 | 3300046476 | Bacteria | 12338 |
| 465 | Ga0495664_0003177 | 3300046477 | Bacteria | 8923 |
| 466 | Ga0495585_0030131 | 3300046492 | Bacteria | 3087 |
| 467 | Ga0495594_0008427 | 3300046499 | Bacteria | 5313 |
| 468 | Ga0495608_0007013 | 3300046511 | Bacteria | 7976 |
| 469 | Ga0495618_0067902 | 3300046514 | Bacteria | 2267 |
| 470 | Ga0495628_0014756 | 3300046516 | Bacteria | 6538 |
| 471 | Ga0495628_0014954 | 3300046516 | Bacteria | 6490 |
| 472 | Ga0495628_0055316 | 3300046516 | Bacteria | 3126 |
| 473 | Ga0495628_0176619 | 3300046516 | Bacteria | 1617 |
| 474 | Ga0495630_0102134 | 3300046517 | Bacteria | 2169 |
| 475 | Ga0495630_0159285 | 3300046517 | Bacteria | 1719 |
| 476 | Ga0495644_0053396 | 3300046523 | Bacteria | 1518 |
| 477 | Ga0495648_0063908 | 3300046524 | Bacteria | 2170 |
| 478 | Ga0495666_0000855 | 3300046526 | Bacteria | 14155 |
| 479 | Ga0495652_0004774 | 3300046529 | Bacteria | 12900 |
| 480 | Ga0495665_0003887 | 3300046531 | Bacteria | 8080 |
| 481 | Ga0495665_0034671 | 3300046531 | Bacteria | 2699 |
| 482 | Ga0495640_0003851 | 3300046533 | Bacteria | 12036 |
| 483 | Ga0495586_0017308 | 3300046535 | Bacteria | 3831 |
| 484 | Ga0495586_0039006 | 3300046535 | Bacteria | 2553 |
| 485 | Ga0495587_0044989 | 3300046536 | Bacteria | 2624 |
| 486 | Ga0495645_0069144 | 3300046543 | Bacteria | 2548 |
| 487 | Ga0495622_0034335 | 3300046557 | Bacteria | 2366 |
| 488 | Ga0495667_0013456 | 3300046559 | Bacteria | 5539 |
| 489 | Ga0495656_0000628 | 3300046615 | Bacteria | 11287 |
| 490 | Ga0495656_0015355 | 3300046615 | Bacteria | 2890 |
| 491 | Ga0495656_0061603 | 3300046615 | Bacteria | 1639 |
| 492 | Ga0495668_0000265 | 3300046616 | Bacteria | 73791 |
| 493 | Ga0495668_0038338 | 3300046616 | Bacteria | 2678 |
| 494 | Ga0495625_0001104 | 3300046660 | Bacteria | 35020 |
| 495 | Ga0495659_0040138 | 3300046664 | Bacteria | 1667 |
| 496 | Ga0495657_0054675 | 3300046675 | Bacteria | 2665 |
| 497 | Ga0495623_0020420 | 3300046679 | Bacteria | 4281 |
| 498 | Ga0495623_0082377 | 3300046679 | Bacteria | 1988 |
| 499 | Ga0495623_0099625 | 3300046679 | Bacteria | 1772 |
| 500 | Ga0495646_0041224 | 3300046680 | Bacteria | 2837 |
| 501 | Ga0495613_0005934 | 3300046689 | Bacteria | 9137 |
| 502 | Ga0495624_0027297 | 3300046690 | Bacteria | 3738 |
| 503 | Ga0495600_0007956 | 3300046809 | Bacteria | 6496 |
| 504 | Ga0495581_0002585 | 3300047315 | Bacteria | 10294 |
| 505 | Ga0495581_0048889 | 3300047315 | Bacteria | 2442 |
| 506 | Ga0495604_0006943 | 3300047317 | Bacteria | 8969 |
| 507 | Ga0495604_0007169 | 3300047317 | Bacteria | 8832 |
| 508 | Ga0495604_0015411 | 3300047317 | Bacteria | 6101 |
| 509 | Ga0495604_0058905 | 3300047317 | Bacteria | 2947 |
| 510 | Ga0495604_0123938 | 3300047317 | Bacteria | 1866 |
| 511 | Ga0495676_0063829 | 3300047321 | Bacteria | 2868 |
| 512 | Ga0495687_007238 | 3300047443 | Bacteria | 6589 |
| 513 | Ga0495675_0025804 | 3300047444 | Bacteria | 3745 |
| 514 | Ga0495673_0010153 | 3300047469 | Bacteria | 5145 |
| 515 | Ga0495686_0009647 | 3300047472 | Bacteria | 6933 |
| 516 | Ga0495602_0162922 | 3300048088 | Bacteria | 1739 |
| 517 | Ga0495626_0000052 | 3300048091 | Bacteria | 156421 |
| 518 | Ga0496100_0003391 | 3300048903 | Bacteria | 8302 |
| 519 | Ga0496101_0000047 | 3300048904 | Bacteria | 152715 |
| 520 | Ga0496101_0003589 | 3300048904 | Bacteria | 9687 |
| 521 | Ga0496101_0060011 | 3300048904 | Bacteria | 2758 |
| 522 | Ga0496101_0168596 | 3300048904 | Bacteria | 1682 |
| 523 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 524 | Ga0496102_0000206 | 3300048905 | Bacteria | 79436 |
| 525 | Ga0496102_0010092 | 3300048905 | Bacteria | 8126 |
| 526 | Ga0496102_0116241 | 3300048905 | Bacteria | 2496 |
| 527 | Ga0496102_0123375 | 3300048905 | Bacteria | 2420 |
| 528 | Ga0496102_0233851 | 3300048905 | Bacteria | 1733 |
| 529 | Ga0496103_0000012 | 3300048906 | Bacteria | 301778 |
| 530 | Ga0496103_0000934 | 3300048906 | Bacteria | 20964 |
| 531 | Ga0496103_0001998 | 3300048906 | Bacteria | 13140 |
| 532 | Ga0496103_0026918 | 3300048906 | Bacteria | 3481 |
| 533 | Ga0496104_0027710 | 3300048907 | Bacteria | 5245 |
| 534 | Ga0496104_0030068 | 3300048907 | Bacteria | 5045 |
| 535 | Ga0496104_0080089 | 3300048907 | Bacteria | 3114 |
| 536 | Ga0496105_0012004 | 3300048908 | Bacteria | 6859 |
| 537 | Ga0496105_0096501 | 3300048908 | Bacteria | 2441 |
| 538 | Ga0496106_0002541 | 3300048909 | Bacteria | 13570 |
| 539 | Ga0496106_0008372 | 3300048909 | Bacteria | 7653 |
| 540 | Ga0496106_0010176 | 3300048909 | Bacteria | 6948 |
| 541 | Ga0496106_0030586 | 3300048909 | Bacteria | 4013 |
| 542 | Ga0496107_0006139 | 3300048910 | Bacteria | 8250 |
| 543 | Ga0496107_0015918 | 3300048910 | Bacteria | 5276 |
| 544 | Ga0496107_0034030 | 3300048910 | Bacteria | 3647 |
| 545 | Ga0496108_0000109 | 3300048911 | Bacteria | 85533 |
| 546 | Ga0496108_0019176 | 3300048911 | Bacteria | 5614 |
| 547 | Ga0496108_0033674 | 3300048911 | Bacteria | 4256 |
| 548 | Ga0496108_0077661 | 3300048911 | Bacteria | 2809 |
| 549 | Ga0496109_0005237 | 3300048912 | Bacteria | 10828 |
| 550 | Ga0496109_0067839 | 3300048912 | Bacteria | 3268 |
| 551 | Ga0496109_0072590 | 3300048912 | Bacteria | 3162 |
| 552 | Ga0496109_0145383 | 3300048912 | Bacteria | 2218 |
| 553 | Ga0496109_0154399 | 3300048912 | Bacteria | 2150 |
| 554 | Ga0496110_0003813 | 3300048913 | Bacteria | 11619 |
| 555 | Ga0496110_0027413 | 3300048913 | Bacteria | 4884 |
| 556 | Ga0496110_0091339 | 3300048913 | Bacteria | 2723 |
| 557 | Ga0496110_0140106 | 3300048913 | Bacteria | 2186 |
| 558 | Ga0496110_0265767 | 3300048913 | Bacteria | 1562 |
| 559 | Ga0496111_0016986 | 3300048914 | Bacteria | 5023 |
| 560 | Ga0496111_0065447 | 3300048914 | Bacteria | 2638 |
| 561 | Ga0496111_0135364 | 3300048914 | Bacteria | 1825 |
| 562 | Ga0496112_0001792 | 3300048915 | Bacteria | 16899 |
| 563 | Ga0496112_0052209 | 3300048915 | Bacteria | 4012 |
| 564 | Ga0496112_0087122 | 3300048915 | Bacteria | 3090 |
| 565 | Ga0496112_0283956 | 3300048915 | Bacteria | 1602 |
| 566 | Ga0496113_0080787 | 3300048916 | Bacteria | 2491 |
| 567 | Ga0496113_0104405 | 3300048916 | Bacteria | 2199 |
| 568 | Ga0496114_0001646 | 3300048917 | Bacteria | 16951 |
| 569 | Ga0496114_0002583 | 3300048917 | Bacteria | 13831 |
| 570 | Ga0496114_0009732 | 3300048917 | Bacteria | 7637 |
| 571 | Ga0496114_0012128 | 3300048917 | Bacteria | 6897 |
| 572 | Ga0496114_0019861 | 3300048917 | Bacteria | 5449 |
| 573 | Ga0496114_0079193 | 3300048917 | Bacteria | 2773 |
| 574 | Ga0496114_0164720 | 3300048917 | Bacteria | 1929 |
| 575 | Ga0496115_0012168 | 3300048918 | Bacteria | 6469 |
| 576 | Ga0496115_0026559 | 3300048918 | Bacteria | 4521 |
| 577 | Ga0496116_0000040 | 3300048919 | Bacteria | 346900 |
| 578 | Ga0496116_0021828 | 3300048919 | Bacteria | 4815 |
| 579 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 580 | Ga0496117_0002524 | 3300048920 | Bacteria | 22923 |
| 581 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 582 | Ga0496118_0004713 | 3300048921 | Bacteria | 15970 |
| 583 | Ga0496118_0004924 | 3300048921 | Bacteria | 15502 |
| 584 | Ga0496119_0000142 | 3300048922 | Bacteria | 100419 |
| 585 | Ga0496119_0003343 | 3300048922 | Bacteria | 16708 |
| 586 | Ga0496120_0000149 | 3300048923 | Bacteria | 116137 |
| 587 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 588 | Ga0496121_0005049 | 3300048924 | Bacteria | 17239 |
| 589 | Ga0496124_0039079 | 3300048927 | Bacteria | 4115 |
| 590 | Ga0496125_0052807 | 3300048928 | Bacteria | 3339 |
| 591 | Ga0496126_0000785 | 3300048929 | Bacteria | 57203 |
| 592 | Ga0496126_0018498 | 3300048929 | Bacteria | 6899 |
| 593 | Ga0501032_0000782 | 3300049569 | Bacteria | 25766 |
| 594 | Ga0501032_0083001 | 3300049569 | Bacteria | 2131 |
| 595 | Ga0501033_0032600 | 3300049570 | Bacteria | 3912 |
| 596 | Ga0501034_0070903 | 3300049571 | Bacteria | 3495 |
| 597 | Ga0501034_0129862 | 3300049571 | Bacteria | 2503 |
| 598 | Ga0501036_0026630 | 3300049572 | Bacteria | 4884 |
| 599 | Ga0501036_0033597 | 3300049572 | Bacteria | 4337 |
| 600 | Ga0501036_0053444 | 3300049572 | Bacteria | 3421 |
| 601 | Ga0501037_0001460 | 3300049573 | Bacteria | 17336 |
| 602 | Ga0501037_0102755 | 3300049573 | Bacteria | 2061 |
| 603 | Ga0501038_0000915 | 3300049574 | Bacteria | 26176 |
| 604 | Ga0501038_0017485 | 3300049574 | Bacteria | 6482 |
| 605 | Ga0501038_0063144 | 3300049574 | Bacteria | 3162 |
| 606 | Ga0501038_0096192 | 3300049574 | Bacteria | 2472 |
| 607 | Ga0501038_0153725 | 3300049574 | Bacteria | 1875 |
| 608 | Ga0501039_0002473 | 3300049575 | Bacteria | 13757 |
| 609 | Ga0501039_0015387 | 3300049575 | Bacteria | 5856 |
| 610 | Ga0501039_0052335 | 3300049575 | Bacteria | 3159 |
| 611 | Ga0501039_0085490 | 3300049575 | Bacteria | 2457 |
| 612 | Ga0501040_0076999 | 3300049576 | Bacteria | 2307 |
| 613 | Ga0501041_0070866 | 3300049577 | Bacteria | 2140 |
| 614 | Ga0501041_0115304 | 3300049577 | Bacteria | 1668 |
| 615 | Ga0501043_0084525 | 3300049579 | Bacteria | 2494 |
| 616 | Ga0501047_0110503 | 3300049581 | Bacteria | 2631 |
| 617 | Ga0501048_0032066 | 3300049582 | Bacteria | 3799 |
| 618 | Ga0501067_0003636 | 3300049583 | Bacteria | 8495 |
| 619 | Ga0501067_0005558 | 3300049583 | Bacteria | 6989 |
| 620 | Ga0501069_0009182 | 3300049585 | Bacteria | 5219 |
| 621 | Ga0501070_0013936 | 3300049586 | Bacteria | 6768 |
| 622 | Ga0501071_0007926 | 3300049587 | Bacteria | 7005 |
| 623 | Ga0501071_0037259 | 3300049587 | Bacteria | 3472 |
| 624 | Ga0501071_0169532 | 3300049587 | Bacteria | 1634 |
| 625 | Ga0501072_0006093 | 3300049588 | Bacteria | 9202 |
| 626 | Ga0501072_0016437 | 3300049588 | Bacteria | 5682 |
| 627 | Ga0501072_0039745 | 3300049588 | Bacteria | 3693 |
| 628 | Ga0501074_0041140 | 3300049590 | Bacteria | 3346 |
| 629 | Ga0501074_0078463 | 3300049590 | Bacteria | 2370 |
| 630 | Ga0501075_0018683 | 3300049591 | Bacteria | 5020 |
| 631 | Ga0501075_0038398 | 3300049591 | Bacteria | 3580 |
| 632 | Ga0501075_0060248 | 3300049591 | Bacteria | 2860 |
| 633 | Ga0501075_0081334 | 3300049591 | Bacteria | 2452 |
| 634 | Ga0501076_0026592 | 3300049592 | Bacteria | 4483 |
| 635 | Ga0501076_0044661 | 3300049592 | Bacteria | 3494 |
| 636 | Ga0501202_003666 | 3300049652 | Bacteria | 2647 |
| 637 | Ga0501079_0013318 | 3300049741 | Bacteria | 6270 |
| 638 | Ga0501079_0020783 | 3300049741 | Bacteria | 5020 |
| 639 | Ga0501080_0039341 | 3300049742 | Bacteria | 4414 |
| 640 | Ga0501080_0130712 | 3300049742 | Bacteria | 2325 |
| 641 | Ga0501081_0008556 | 3300049743 | Bacteria | 6650 |
| 642 | Ga0501081_0105278 | 3300049743 | Bacteria | 1998 |
| 643 | Ga0501083_0000001 | 3300049744 | Bacteria | 555041 |
| 644 | Ga0501083_0063182 | 3300049744 | Bacteria | 2469 |
| 645 | Ga0501035_0004093 | 3300049822 | Bacteria | 13862 |
| 646 | Ga0501035_0043459 | 3300049822 | Bacteria | 4049 |
| 647 | Ga0501044_0075665 | 3300049823 | Bacteria | 3418 |
| 648 | Ga0501044_0097760 | 3300049823 | Bacteria | 2956 |
| 649 | Ga0501044_0211629 | 3300049823 | Bacteria | 1893 |
| 650 | Ga0501044_0226215 | 3300049823 | Bacteria | 1820 |
| 651 | Ga0501045_0058733 | 3300049824 | Bacteria | 2817 |
| 652 | Ga0501045_0130989 | 3300049824 | Bacteria | 1864 |
| 653 | Ga0501045_0157098 | 3300049824 | Bacteria | 1692 |
| 654 | nmdc:mga03n38_11372_c1 | 3300050490 | Bacteria | 3314 |
| 655 | nmdc:mga03n38_11902_c1 | 3300050490 | Bacteria | 3256 |
| 656 | nmdc:mga03n38_730_c1 | 3300050490 | Bacteria | 8674 |
| 657 | nmdc:mga00v17_2296_c2 | 3300050491 | Bacteria | 6101 |
| 658 | nmdc:mga00v17_30699_c1 | 3300050491 | Bacteria | 3163 |
| 659 | nmdc:mga00v17_3857_c1 | 3300050491 | Bacteria | 7735 |
| 660 | nmdc:mga00v17_59100_c1 | 3300050491 | Bacteria | 2351 |
| 661 | nmdc:mga0yw44_42447_c1 | 3300050492 | Bacteria | 2712 |
| 662 | nmdc:mga06z11_1986_c1 | 3300050494 | Bacteria | 7737 |
| 663 | nmdc:mga06z11_44605_c1 | 3300050494 | Bacteria | 2237 |
| 664 | nmdc:mga06z11_5485_c1 | 3300050494 | Bacteria | 5094 |
| 665 | nmdc:mga06z11_66263_c1 | 3300050494 | Bacteria | 1898 |
| 666 | nmdc:mga06z11_7355_c1 | 3300050494 | Bacteria | 4525 |
| 667 | nmdc:mga04h51_5822_c1 | 3300050495 | Bacteria | 3160 |
| 668 | nmdc:mga07m45_94667_c1 | 3300050496 | Bacteria | 1713 |
| 669 | nmdc:mga05p37_6858_c1 | 3300050507 | Bacteria | 13427 |
| 670 | nmdc:mga08y16_25902_c1 | 3300050511 | Bacteria | 6188 |
| 671 | Ga0495601_0003491 | 3300053077 | Bacteria | 9024 |
| 672 | Ga0500610_0029662 | 3300053079 | Bacteria | 2766 |
| 673 | Ga0495619_0074474 | 3300053085 | Bacteria | 2277 |
| 674 | Ga0495619_0103880 | 3300053085 | Bacteria | 1936 |
| 675 | Ga0500643_016853 | 3300053087 | Bacteria | 2463 |
| 676 | Ga0500641_0008959 | 3300053096 | Bacteria | 3586 |
| 677 | Ga0500641_0013870 | 3300053096 | Bacteria | 2965 |
| 678 | Ga0500562_003818 | 3300053108 | Bacteria | 3793 |
| 679 | Ga0500593_000060 | 3300053117 | Bacteria | 40345 |
| 680 | Ga0500559_0000078 | 3300053136 | Bacteria | 76033 |
| 681 | Ga0500559_0002799 | 3300053136 | Bacteria | 8815 |
| 682 | Ga0500573_0000011 | 3300053140 | Bacteria | 209484 |
| 683 | Ga0500573_0002508 | 3300053140 | Bacteria | 9196 |
| 684 | Ga0500573_0081038 | 3300053140 | Bacteria | 1844 |
| 685 | Ga0500577_0012975 | 3300053142 | Bacteria | 2533 |
| 686 | Ga0500616_0000146 | 3300053153 | Bacteria | 119628 |
| 687 | Ga0500616_0001346 | 3300053153 | Bacteria | 24012 |
| 688 | Ga0500616_0033635 | 3300053153 | Bacteria | 2796 |
| 689 | Ga0501084_0052258 | 3300054114 | Bacteria | 3420 |
| 690 | Ga0501084_0056410 | 3300054114 | Bacteria | 3286 |
| 691 | Ga0501084_0098640 | 3300054114 | Bacteria | 2453 |
| 692 | Ga0501082_0060531 | 3300060353 | Bacteria | 3260 |
| 693 | Ga0501082_0339285 | 3300060353 | Bacteria | 1309 |
| 694 | Ga0466962_0000502 | 3300061719 | Bacteria | 17005 |
| 695 | Ga0466962_0002010 | 3300061719 | Bacteria | 9603 |
| 696 | Ga0466962_0003591 | 3300061719 | Bacteria | 7393 |
| 697 | Ga0466962_0019705 | 3300061719 | Bacteria | 3241 |
| 698 | Ga0530510_0013669 | 3300061734 | Bacteria | 5713 |
| 699 | Ga0530510_0026826 | 3300061734 | Bacteria | 4126 |
| 700 | Ga0530510_0049543 | 3300061734 | Bacteria | 3034 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0068220 | Ga0466961_0068220_14_1168 | 384 |
| 2 | 3300048914 | Ga0496111_0135364 | Ga0496111_0135364_512_1780 | 389 |
| 3 | 3300049824 | Ga0501045_0157098 | Ga0501045_0157098_33_1319 | 407 |
| 4 | 3300049574 | Ga0501038_0153725 | Ga0501038_0153725_579_1847 | 411 |
| 5 | 3300049577 | Ga0501041_0070866 | Ga0501041_0070866_23_1291 | 411 |
| 6 | 3300060353 | Ga0501082_0339285 | Ga0501082_0339285_13_1281 | 411 |
| 7 | 3300042016 | Ga0439463_010288 | Ga0439463_010288_1002_2270 | 422 |
| 8 | 3300046523 | Ga0495644_0053396 | Ga0495644_0053396_209_1483 | 422 |
| 9 | 3300035119 | Ga0373956_0069724 | Ga0373956_0069724_285_1589 | 424 |
| 10 | 3300046516 | Ga0495628_0176619 | Ga0495628_0176619_298_1584 | 428 |
| 11 | 3300046615 | Ga0495656_0061603 | Ga0495656_0061603_310_1629 | 437 |
| 12 | 3300048917 | Ga0496114_0012128 | Ga0496114_0012128_5500_6882 | 441 |
| 13 | 3300048912 | Ga0496109_0154399 | Ga0496109_0154399_770_2131 | 453 |
| 14 | 3300041999 | Ga0439433_0001029 | Ga0439433_0001029_12_1388 | 458 |
| 15 | 3300049742 | Ga0501080_0130712 | Ga0501080_0130712_750_2210 | 461 |
| 16 | 3300013308 | Ga0157375_10120599 | Ga0157375_101205992 | 462 |
| 17 | 3300046517 | Ga0495630_0102134 | Ga0495630_0102134_599_2095 | 463 |
| 18 | 3300049590 | Ga0501074_0078463 | Ga0501074_0078463_906_2333 | 464 |
| 19 | 3300031507 | Ga0307509_10096687 | Ga0307509_100966872 | 467 |
| 20 | 3300049743 | Ga0501081_0105278 | Ga0501081_0105278_363_1865 | 467 |
| 21 | 3300045976 | Ga0466967_0180582 | Ga0466967_0180582_16_1422 | 468 |
| 22 | 3300035091 | Ga0373951_0000101 | Ga0373951_0000101_4126_5616 | 469 |
| 23 | 3300030521 | Ga0307511_10000551 | Ga0307511_1000055120 | 472 |
| 24 | 3300005985 | Ga0081539_10000359 | Ga0081539_1000035940 | 473 |
| 25 | 3300050496 | nmdc:mga07m45_94667_c1 | nmdc:mga07m45_94667_c1_121_1575 | 475 |
| 26 | 3300044656 | Ga0466969_0001086 | Ga0466969_0001086_3988_5490 | 477 |
| 27 | 3300044684 | Ga0466966_0002672 | Ga0466966_0002672_7087_8589 | 477 |
| 28 | 3300044693 | Ga0466961_0000793 | Ga0466961_0000793_8505_10007 | 477 |
| 29 | 3300044765 | Ga0466970_0048002 | Ga0466970_0048002_55_1557 | 477 |
| 30 | 3300049591 | Ga0501075_0081334 | Ga0501075_0081334_90_1595 | 477 |
| 31 | 3300060353 | Ga0501082_0060531 | Ga0501082_0060531_361_1866 | 477 |
| 32 | 3300013306 | Ga0163162_10243649 | Ga0163162_102436492 | 478 |
| 33 | 3300037466 | Ga0395898_0001504 | Ga0395898_0001504_10943_12448 | 478 |
| 34 | 3300038443 | Ga0395901_0011602 | Ga0395901_0011602_6427_7932 | 478 |
| 35 | 3300049587 | Ga0501071_0037259 | Ga0501071_0037259_376_1881 | 479 |
| 36 | 3300049588 | Ga0501072_0006093 | Ga0501072_0006093_4114_5619 | 479 |
| 37 | 3300049588 | Ga0501072_0016437 | Ga0501072_0016437_451_1956 | 479 |
| 38 | 3300049590 | Ga0501074_0041140 | Ga0501074_0041140_1569_3074 | 479 |
| 39 | 3300049744 | Ga0501083_0063182 | Ga0501083_0063182_929_2434 | 479 |
| 40 | 3300054114 | Ga0501084_0056410 | Ga0501084_0056410_1746_3251 | 479 |
| 41 | 3300005327 | Ga0070658_10091794 | Ga0070658_100917943 | 480 |
| 42 | 3300005339 | Ga0070660_100174198 | Ga0070660_1001741981 | 480 |
| 43 | 3300005530 | Ga0070679_100093619 | Ga0070679_1000936193 | 480 |
| 44 | 3300005539 | Ga0068853_100032893 | Ga0068853_1000328934 | 480 |
| 45 | 3300005616 | Ga0068852_100093088 | Ga0068852_1000930882 | 480 |
| 46 | 3300025921 | Ga0207652_10213874 | Ga0207652_102138741 | 480 |
| 47 | 3300026041 | Ga0207639_10035234 | Ga0207639_100352343 | 480 |
| 48 | 3300026142 | Ga0207698_10041223 | Ga0207698_100412232 | 480 |
| 49 | 3300031838 | Ga0307518_10012013 | Ga0307518_100120132 | 480 |
| 50 | iso_pu_bacteria | 2675903060 | 2676496460 | 480 |
| 51 | iso_pu_bacteria | 2884693830 | 2884701748 | 480 |
| 52 | iso_pu_bacteria | 2895427314 | 2895437425 | 480 |
| 53 | iso_pu_bacteria | 2895442618 | 2895446569 | 480 |
| 54 | 3300005530 | Ga0070679_100240347 | Ga0070679_1002403471 | 481 |
| 55 | 3300009147 | Ga0114129_10001649 | Ga0114129_1000164917 | 481 |
| 56 | 3300050507 | nmdc:mga05p37_6858_c1 | nmdc:mga05p37_6858_c1_10648_12132 | 481 |
| 57 | 3300025921 | Ga0207652_10264190 | Ga0207652_102641901 | 484 |
| 58 | 3300028794 | Ga0307515_10039644 | Ga0307515_100396444 | 484 |
| 59 | 3300031616 | Ga0307508_10056678 | Ga0307508_100566781 | 484 |
| 60 | 3300046524 | Ga0495648_0063908 | Ga0495648_0063908_704_2158 | 484 |
| 61 | 3300005329 | Ga0070683_100042809 | Ga0070683_1000428092 | 485 |
| 62 | 3300005334 | Ga0068869_100002032 | Ga0068869_1000020329 | 485 |
| 63 | 3300005345 | Ga0070692_10007140 | Ga0070692_100071405 | 485 |
| 64 | 3300005347 | Ga0070668_100002291 | Ga0070668_10000229112 | 485 |
| 65 | 3300005354 | Ga0070675_100000489 | Ga0070675_10000048918 | 485 |
| 66 | 3300005441 | Ga0070700_100041430 | Ga0070700_1000414302 | 485 |
| 67 | 3300005457 | Ga0070662_100027514 | Ga0070662_1000275142 | 485 |
| 68 | 3300005535 | Ga0070684_100035482 | Ga0070684_1000354822 | 485 |
| 69 | 3300005563 | Ga0068855_100012140 | Ga0068855_1000121402 | 485 |
| 70 | 3300005564 | Ga0070664_100002862 | Ga0070664_1000028626 | 485 |
| 71 | 3300005577 | Ga0068857_100013053 | Ga0068857_1000130532 | 485 |
| 72 | 3300005578 | Ga0068854_100084363 | Ga0068854_1000843632 | 485 |
| 73 | 3300005843 | Ga0068860_100231201 | Ga0068860_1002312011 | 485 |
| 74 | 3300005844 | Ga0068862_100078038 | Ga0068862_1000780384 | 485 |
| 75 | 3300009094 | Ga0111539_10012327 | Ga0111539_100123274 | 485 |
| 76 | 3300009148 | Ga0105243_10028615 | Ga0105243_100286152 | 485 |
| 77 | 3300009174 | Ga0105241_10166788 | Ga0105241_101667881 | 485 |
| 78 | 3300009177 | Ga0105248_10033382 | Ga0105248_100333825 | 485 |
| 79 | 3300010375 | Ga0105239_10011205 | Ga0105239_100112051 | 485 |
| 80 | 3300013306 | Ga0163162_10178658 | Ga0163162_101786582 | 485 |
| 81 | 3300014325 | Ga0163163_10232425 | Ga0163163_102324251 | 485 |
| 82 | 3300014745 | Ga0157377_10016890 | Ga0157377_100168902 | 485 |
| 83 | 3300025909 | Ga0207705_10056278 | Ga0207705_100562782 | 485 |
| 84 | 3300025913 | Ga0207695_10012775 | Ga0207695_100127757 | 485 |
| 85 | 3300025914 | Ga0207671_10001756 | Ga0207671_1000175610 | 485 |
| 86 | 3300025924 | Ga0207694_10005408 | Ga0207694_100054081 | 485 |
| 87 | 3300025926 | Ga0207659_10002025 | Ga0207659_1000202510 | 485 |
| 88 | 3300025942 | Ga0207689_10017680 | Ga0207689_100176803 | 485 |
| 89 | 3300025944 | Ga0207661_10018147 | Ga0207661_100181474 | 485 |
| 90 | 3300025945 | Ga0207679_10016040 | Ga0207679_100160402 | 485 |
| 91 | 3300025949 | Ga0207667_10108198 | Ga0207667_101081981 | 485 |
| 92 | 3300025972 | Ga0207668_10001454 | Ga0207668_100014547 | 485 |
| 93 | 3300026075 | Ga0207708_10021040 | Ga0207708_100210403 | 485 |
| 94 | 3300026116 | Ga0207674_10019776 | Ga0207674_100197763 | 485 |
| 95 | 3300027907 | Ga0207428_10034604 | Ga0207428_100346043 | 485 |
| 96 | 3300028380 | Ga0268265_10012140 | Ga0268265_100121404 | 485 |
| 97 | 3300031995 | Ga0307409_100033573 | Ga0307409_1000335733 | 485 |
| 98 | 3300048913 | Ga0496110_0265767 | Ga0496110_0265767_26_1537 | 485 |
| 99 | 3300049581 | Ga0501047_0110503 | Ga0501047_0110503_41_1558 | 485 |
| 100 | 3300050511 | nmdc:mga08y16_25902_c1 | nmdc:mga08y16_25902_c1_2346_3842 | 485 |
| 101 | 3300037418 | Ga0395900_0024250 | Ga0395900_0024250_4246_5736 | 486 |
| 102 | 3300037466 | Ga0395898_0097470 | Ga0395898_0097470_136_1626 | 486 |
| 103 | 3300038443 | Ga0395901_0013592 | Ga0395901_0013592_787_2277 | 486 |
| 104 | 3300005985 | Ga0081539_10007921 | Ga0081539_100079217 | 487 |
| 105 | 3300044712 | Ga0453684_0013537 | Ga0453684_0013537_10171_11679 | 487 |
| 106 | 3300053096 | Ga0500641_0008959 | Ga0500641_0008959_1196_2698 | 487 |
| 107 | 3300005347 | Ga0070668_100045835 | Ga0070668_1000458352 | 488 |
| 108 | 3300013297 | Ga0157378_10086842 | Ga0157378_100868422 | 488 |
| 109 | 3300025972 | Ga0207668_10012972 | Ga0207668_100129723 | 488 |
| 110 | 3300026035 | Ga0207703_10079361 | Ga0207703_100793612 | 488 |
| 111 | 3300046459 | Ga0495629_0079356 | Ga0495629_0079356_37_1542 | 488 |
| 112 | 3300005563 | Ga0068855_100000172 | Ga0068855_10000017254 | 489 |
| 113 | 3300009551 | Ga0105238_10172151 | Ga0105238_101721512 | 489 |
| 114 | 3300025949 | Ga0207667_10000288 | Ga0207667_1000028810 | 489 |
| 115 | 3300031852 | Ga0307410_10034921 | Ga0307410_100349213 | 489 |
| 116 | 3300032004 | Ga0307414_10047442 | Ga0307414_100474423 | 489 |
| 117 | 3300032005 | Ga0307411_10011641 | Ga0307411_100116414 | 489 |
| 118 | 3300045049 | Ga0466959_0005517 | Ga0466959_0005517_5191_6699 | 489 |
| 119 | 3300049572 | Ga0501036_0053444 | Ga0501036_0053444_1647_3152 | 489 |
| 120 | 3300049576 | Ga0501040_0076999 | Ga0501040_0076999_331_1836 | 489 |
| 121 | 3300049577 | Ga0501041_0115304 | Ga0501041_0115304_25_1530 | 489 |
| 122 | 3300049587 | Ga0501071_0007926 | Ga0501071_0007926_834_2339 | 489 |
| 123 | 3300049588 | Ga0501072_0039745 | Ga0501072_0039745_1123_2628 | 489 |
| 124 | 3300049591 | Ga0501075_0018683 | Ga0501075_0018683_2888_4393 | 489 |
| 125 | 3300049591 | Ga0501075_0060248 | Ga0501075_0060248_1278_2783 | 489 |
| 126 | 3300049592 | Ga0501076_0026592 | Ga0501076_0026592_2617_4122 | 489 |
| 127 | 3300049741 | Ga0501079_0013318 | Ga0501079_0013318_2025_3530 | 489 |
| 128 | 3300049743 | Ga0501081_0008556 | Ga0501081_0008556_2744_4249 | 489 |
| 129 | 3300054114 | Ga0501084_0052258 | Ga0501084_0052258_1100_2629 | 489 |
| 130 | 3300054114 | Ga0501084_0098640 | Ga0501084_0098640_889_2394 | 489 |
| 131 | 3300061734 | Ga0530510_0013669 | Ga0530510_0013669_2555_4060 | 489 |
| 132 | 3300061734 | Ga0530510_0026826 | Ga0530510_0026826_1896_3401 | 489 |
| 133 | iso_pu_bacteria | 2856741275 | 2856744876 | 489 |
| 134 | iso_pu_bacteria | 2857453340 | 2857454146 | 489 |
| 135 | iso_pu_bacteria | 2891562705 | 2891563894 | 489 |
| 136 | iso_pu_bacteria | 2904765812 | 2904766334 | 489 |
| 137 | iso_pu_bacteria | 2904770941 | 2904772385 | 489 |
| 138 | iso_pu_bacteria | 2908811453 | 2908816519 | 489 |
| 139 | iso_pu_bacteria | 2919420072 | 2919421239 | 489 |
| 140 | iso_pu_bacteria | 2919425241 | 2919426673 | 489 |
| 141 | iso_pu_bacteria | 2919432681 | 2919433003 | 489 |
| 142 | iso_pu_bacteria | 8055172936 | 8055174616 | 489 |
| 143 | iso_pu_bacteria | 8056533031 | 8056534705 | 489 |
| 144 | 3300005329 | Ga0070683_100069343 | Ga0070683_1000693433 | 490 |
| 145 | 3300005564 | Ga0070664_100009397 | Ga0070664_1000093972 | 490 |
| 146 | 3300005577 | Ga0068857_100054135 | Ga0068857_1000541353 | 490 |
| 147 | 3300014325 | Ga0163163_10002221 | Ga0163163_100022219 | 490 |
| 148 | 3300025925 | Ga0207650_10129326 | Ga0207650_101293262 | 490 |
| 149 | 3300025944 | Ga0207661_10010242 | Ga0207661_100102424 | 490 |
| 150 | 3300025945 | Ga0207679_10014220 | Ga0207679_100142204 | 490 |
| 151 | 3300026116 | Ga0207674_10005994 | Ga0207674_1000599411 | 490 |
| 152 | 3300028794 | Ga0307515_10087567 | Ga0307515_100875673 | 490 |
| 153 | 3300032002 | Ga0307416_100202809 | Ga0307416_1002028092 | 490 |
| 154 | 3300048915 | Ga0496112_0052209 | Ga0496112_0052209_348_1862 | 490 |
| 155 | 3300048916 | Ga0496113_0080787 | Ga0496113_0080787_48_1568 | 490 |
| 156 | 3300005340 | Ga0070689_100000001 | Ga0070689_100000001585 | 491 |
| 157 | 3300009545 | Ga0105237_10164917 | Ga0105237_101649172 | 491 |
| 158 | 3300013105 | Ga0157369_10004237 | Ga0157369_100042371 | 491 |
| 159 | 3300025936 | Ga0207670_10000002 | Ga0207670_10000002480 | 491 |
| 160 | 3300048911 | Ga0496108_0033674 | Ga0496108_0033674_2169_3674 | 491 |
| 161 | 3300048918 | Ga0496115_0012168 | Ga0496115_0012168_1842_3368 | 491 |
| 162 | iso_pu_bacteria | 8057977335 | 8057980269 | 491 |
| 163 | 3300005985 | Ga0081539_10002007 | Ga0081539_1000200722 | 492 |
| 164 | 3300005985 | Ga0081539_10034216 | Ga0081539_100342164 | 492 |
| 165 | 3300031903 | Ga0307407_10109959 | Ga0307407_101099591 | 492 |
| 166 | 3300032126 | Ga0307415_100037791 | Ga0307415_1000377913 | 492 |
| 167 | 3300048905 | Ga0496102_0116241 | Ga0496102_0116241_612_2132 | 492 |
| 168 | 3300048911 | Ga0496108_0077661 | Ga0496108_0077661_1172_2650 | 492 |
| 169 | 3300048915 | Ga0496112_0001792 | Ga0496112_0001792_13544_15064 | 492 |
| 170 | iso_pu_bacteria | 2751185782 | 2753266707 | 492 |
| 171 | 3300006038 | Ga0075365_10002645 | Ga0075365_100026458 | 493 |
| 172 | 3300006048 | Ga0075363_100024021 | Ga0075363_1000240212 | 493 |
| 173 | 3300006051 | Ga0075364_10065601 | Ga0075364_100656012 | 493 |
| 174 | 3300006177 | Ga0075362_10000193 | Ga0075362_100001937 | 493 |
| 175 | 3300006353 | Ga0075370_10001246 | Ga0075370_100012464 | 493 |
| 176 | 3300032126 | Ga0307415_100082941 | Ga0307415_1000829412 | 493 |
| 177 | 3300035207 | Ga0373942_0002271 | Ga0373942_0002271_1954_3462 | 493 |
| 178 | 3300035242 | Ga0373962_0001716 | Ga0373962_0001716_3082_4590 | 493 |
| 179 | 3300041999 | Ga0439433_0003610 | Ga0439433_0003610_1446_2966 | 493 |
| 180 | 3300044719 | Ga0466971_0047280 | Ga0466971_0047280_295_1797 | 493 |
| 181 | 3300049585 | Ga0501069_0009182 | Ga0501069_0009182_2226_3707 | 493 |
| 182 | 3300049586 | Ga0501070_0013936 | Ga0501070_0013936_4798_6279 | 493 |
| 183 | 3300050490 | nmdc:mga03n38_11902_c1 | nmdc:mga03n38_11902_c1_138_1646 | 493 |
| 184 | 3300005347 | Ga0070668_100000179 | Ga0070668_10000017935 | 494 |
| 185 | 3300005617 | Ga0068859_100112811 | Ga0068859_1001128113 | 494 |
| 186 | 3300005844 | Ga0068862_100062847 | Ga0068862_1000628473 | 494 |
| 187 | 3300006931 | Ga0097620_100112810 | Ga0097620_1001128103 | 494 |
| 188 | 3300009177 | Ga0105248_10000523 | Ga0105248_100005235 | 494 |
| 189 | 3300025972 | Ga0207668_10000813 | Ga0207668_1000081319 | 494 |
| 190 | 3300028380 | Ga0268265_10037886 | Ga0268265_100378862 | 494 |
| 191 | 3300031616 | Ga0307508_10030179 | Ga0307508_100301793 | 494 |
| 192 | 3300031824 | Ga0307413_10027581 | Ga0307413_100275812 | 494 |
| 193 | 3300031889 | Ga0326468_10000057 | Ga0326468_100000573 | 494 |
| 194 | 3300031901 | Ga0307406_10003121 | Ga0307406_100031216 | 494 |
| 195 | 3300031903 | Ga0307407_10009961 | Ga0307407_100099613 | 494 |
| 196 | 3300031911 | Ga0307412_10079546 | Ga0307412_100795462 | 494 |
| 197 | 3300031995 | Ga0307409_100001839 | Ga0307409_1000018394 | 494 |
| 198 | 3300032004 | Ga0307414_10020036 | Ga0307414_100200363 | 494 |
| 199 | 3300048921 | Ga0496118_0004924 | Ga0496118_0004924_1090_2589 | 494 |
| 200 | iso_pu_bacteria | 2675903059 | 2676482592 | 494 |
| 201 | iso_pu_bacteria | 8047710418 | 8047715625 | 494 |
| 202 | 3300005329 | Ga0070683_100008071 | Ga0070683_1000080716 | 495 |
| 203 | 3300005434 | Ga0070709_10044445 | Ga0070709_100444452 | 495 |
| 204 | 3300025906 | Ga0207699_10024303 | Ga0207699_100243033 | 495 |
| 205 | 3300025929 | Ga0207664_10101658 | Ga0207664_101016582 | 495 |
| 206 | 3300025944 | Ga0207661_10000627 | Ga0207661_100006277 | 495 |
| 207 | 3300026116 | Ga0207674_10092796 | Ga0207674_100927962 | 495 |
| 208 | 3300048917 | Ga0496114_0002583 | Ga0496114_0002583_2766_4295 | 495 |
| 209 | iso_pu_bacteria | 8055066027 | 8055070171 | 495 |
| 210 | 3300006042 | Ga0075368_10039467 | Ga0075368_100394671 | 496 |
| 211 | 3300006051 | Ga0075364_10004861 | Ga0075364_100048612 | 496 |
| 212 | 3300006177 | Ga0075362_10003372 | Ga0075362_100033722 | 496 |
| 213 | 3300006178 | Ga0075367_10005852 | Ga0075367_100058521 | 496 |
| 214 | 3300006195 | Ga0075366_10003511 | Ga0075366_100035116 | 496 |
| 215 | 3300028786 | Ga0307517_10027818 | Ga0307517_100278183 | 496 |
| 216 | 3300028794 | Ga0307515_10000947 | Ga0307515_1000094733 | 496 |
| 217 | 3300028794 | Ga0307515_10018371 | Ga0307515_100183716 | 496 |
| 218 | 3300028794 | Ga0307515_10089386 | Ga0307515_100893862 | 496 |
| 219 | 3300030522 | Ga0307512_10003501 | Ga0307512_100035016 | 496 |
| 220 | 3300031456 | Ga0307513_10026149 | Ga0307513_100261495 | 496 |
| 221 | 3300031507 | Ga0307509_10012346 | Ga0307509_100123467 | 496 |
| 222 | 3300031616 | Ga0307508_10042136 | Ga0307508_100421363 | 496 |
| 223 | 3300031730 | Ga0307516_10000250 | Ga0307516_100002506 | 496 |
| 224 | 3300033179 | Ga0307507_10054641 | Ga0307507_100546412 | 496 |
| 225 | 3300035207 | Ga0373942_0000020 | Ga0373942_0000020_711_2201 | 496 |
| 226 | 3300035692 | Ga0373935_0033966 | Ga0373935_0033966_895_2385 | 496 |
| 227 | 3300048911 | Ga0496108_0000109 | Ga0496108_0000109_49667_51157 | 496 |
| 228 | 3300053077 | Ga0495601_0003491 | Ga0495601_0003491_2559_4064 | 496 |
| 229 | 3300053096 | Ga0500641_0013870 | Ga0500641_0013870_80_1570 | 496 |
| 230 | iso_pu_bacteria | 2501939600 | 2501940091 | 496 |
| 231 | iso_pu_bacteria | 2643221567 | 2643852243 | 496 |
| 232 | iso_pu_bacteria | 2643221601 | 2644016793 | 496 |
| 233 | iso_pu_bacteria | 2643221624 | 2644136326 | 496 |
| 234 | iso_pu_bacteria | 2643221631 | 2644178190 | 496 |
| 235 | iso_pu_bacteria | 2643221961 | 2645722231 | 496 |
| 236 | iso_pu_bacteria | 2643221962 | 2645725101 | 496 |
| 237 | iso_pu_bacteria | 2772190715 | 2772647074 | 496 |
| 238 | iso_pu_bacteria | 2831935698 | 2831936817 | 496 |
| 239 | iso_pu_bacteria | 2832004796 | 2832009880 | 496 |
| 240 | iso_pu_bacteria | 2855670206 | 2855672044 | 496 |
| 241 | iso_pu_bacteria | 2855676851 | 2855678165 | 496 |
| 242 | iso_pu_bacteria | 2856858025 | 2856863373 | 496 |
| 243 | iso_pu_bacteria | 2857288857 | 2857291676 | 496 |
| 244 | iso_pu_bacteria | 2858848962 | 2858849655 | 496 |
| 245 | iso_pu_bacteria | 2858882152 | 2858886103 | 496 |
| 246 | iso_pu_bacteria | 2858888857 | 2858889411 | 496 |
| 247 | iso_pu_bacteria | 2858895516 | 2858900622 | 496 |
| 248 | iso_pu_bacteria | 2866065130 | 2866066019 | 496 |
| 249 | iso_pu_bacteria | 2866612099 | 2866613399 | 496 |
| 250 | iso_pu_bacteria | 2867507094 | 2867507453 | 496 |
| 251 | iso_pu_bacteria | 2869048445 | 2869052821 | 496 |
| 252 | iso_pu_bacteria | 2869061728 | 2869065411 | 496 |
| 253 | iso_pu_bacteria | 2869068681 | 2869069847 | 496 |
| 254 | iso_pu_bacteria | 2880489317 | 2880492488 | 496 |
| 255 | iso_pu_bacteria | 2880495981 | 2880499805 | 496 |
| 256 | iso_pu_bacteria | 2887478801 | 2887485169 | 496 |
| 257 | iso_pu_bacteria | 2902582711 | 2902582889 | 496 |
| 258 | iso_pu_bacteria | 2929219909 | 2929221707 | 496 |
| 259 | iso_pu_bacteria | 2929226422 | 2929228377 | 496 |
| 260 | iso_pu_bacteria | 649633069 | 649814862 | 496 |
| 261 | iso_pu_bacteria | 8001781756 | 8001782837 | 496 |
| 262 | iso_pu_bacteria | 8003830390 | 8003835881 | 496 |
| 263 | iso_pu_bacteria | 8003870546 | 8003871008 | 496 |
| 264 | iso_pu_bacteria | 8054704163 | 8054710423 | 496 |
| 265 | iso_pu_bacteria | 8054727385 | 8054728670 | 496 |
| 266 | iso_pu_bacteria | 8054734606 | 8054738560 | 496 |
| 267 | 3300005985 | Ga0081539_10001893 | Ga0081539_100018931 | 497 |
| 268 | 3300006051 | Ga0075364_10068995 | Ga0075364_100689952 | 497 |
| 269 | 3300013307 | Ga0157372_10009312 | Ga0157372_100093126 | 497 |
| 270 | 3300031548 | Ga0307408_100002739 | Ga0307408_1000027392 | 497 |
| 271 | 3300031824 | Ga0307413_10009293 | Ga0307413_100092933 | 497 |
| 272 | 3300031852 | Ga0307410_10001657 | Ga0307410_100016572 | 497 |
| 273 | 3300031901 | Ga0307406_10000550 | Ga0307406_1000055010 | 497 |
| 274 | 3300031911 | Ga0307412_10034660 | Ga0307412_100346602 | 497 |
| 275 | 3300031995 | Ga0307409_100000001 | Ga0307409_1000000013 | 497 |
| 276 | 3300032002 | Ga0307416_100000340 | Ga0307416_10000034020 | 497 |
| 277 | 3300032126 | Ga0307415_100000176 | Ga0307415_10000017614 | 497 |
| 278 | 3300035118 | Ga0373954_0040190 | Ga0373954_0040190_498_2027 | 497 |
| 279 | 3300037418 | Ga0395900_0168595 | Ga0395900_0168595_694_2211 | 497 |
| 280 | 3300037466 | Ga0395898_0005765 | Ga0395898_0005765_8993_10510 | 497 |
| 281 | 3300038443 | Ga0395901_0084088 | Ga0395901_0084088_1787_3304 | 497 |
| 282 | 3300046809 | Ga0495600_0007956 | Ga0495600_0007956_29_1522 | 497 |
| 283 | 3300048912 | Ga0496109_0072590 | Ga0496109_0072590_483_1976 | 497 |
| 284 | 3300048913 | Ga0496110_0027413 | Ga0496110_0027413_1893_3386 | 497 |
| 285 | 3300048917 | Ga0496114_0164720 | Ga0496114_0164720_215_1708 | 497 |
| 286 | 3300053085 | Ga0495619_0103880 | Ga0495619_0103880_75_1568 | 497 |
| 287 | iso_pu_bacteria | 2585427649 | 2586060793 | 497 |
| 288 | iso_pu_bacteria | 2731639228 | 2731907600 | 497 |
| 289 | iso_pu_bacteria | 2751185734 | 2753071142 | 497 |
| 290 | iso_pu_bacteria | 2751185782 | 2753270446 | 497 |
| 291 | iso_pu_bacteria | 2791354901 | 2791911319 | 497 |
| 292 | iso_pu_bacteria | 2799112218 | 2799183591 | 497 |
| 293 | iso_pu_bacteria | 2808606522 | 2809589316 | 497 |
| 294 | iso_pu_bacteria | 2867312974 | 2867315040 | 497 |
| 295 | iso_pu_bacteria | 2867319477 | 2867319962 | 497 |
| 296 | iso_pu_bacteria | 2870721527 | 2870722063 | 497 |
| 297 | iso_pu_bacteria | 2912723979 | 2912727415 | 497 |
| 298 | iso_pu_bacteria | 2915768154 | 2915769965 | 497 |
| 299 | iso_pu_bacteria | 2917736166 | 2917736929 | 497 |
| 300 | iso_pu_bacteria | 8003314358 | 8003321327 | 497 |
| 301 | iso_pu_bacteria | 8003856774 | 8003861180 | 497 |
| 302 | 3300005438 | Ga0070701_10041216 | Ga0070701_100412162 | 498 |
| 303 | 3300005455 | Ga0070663_100049269 | Ga0070663_1000492693 | 498 |
| 304 | 3300005578 | Ga0068854_100029349 | Ga0068854_1000293493 | 498 |
| 305 | 3300005615 | Ga0070702_100026025 | Ga0070702_1000260252 | 498 |
| 306 | 3300005719 | Ga0068861_100052850 | Ga0068861_1000528502 | 498 |
| 307 | 3300005841 | Ga0068863_100065619 | Ga0068863_1000656192 | 498 |
| 308 | 3300005844 | Ga0068862_100040707 | Ga0068862_1000407072 | 498 |
| 309 | 3300009101 | Ga0105247_10058390 | Ga0105247_100583902 | 498 |
| 310 | 3300009551 | Ga0105238_10178253 | Ga0105238_101782532 | 498 |
| 311 | 3300014326 | Ga0157380_10097983 | Ga0157380_100979832 | 498 |
| 312 | 3300014326 | Ga0157380_10106037 | Ga0157380_101060372 | 498 |
| 313 | 3300014326 | Ga0157380_10151243 | Ga0157380_101512432 | 498 |
| 314 | 3300025901 | Ga0207688_10019867 | Ga0207688_100198673 | 498 |
| 315 | 3300025907 | Ga0207645_10004422 | Ga0207645_100044224 | 498 |
| 316 | 3300025933 | Ga0207706_10004973 | Ga0207706_100049736 | 498 |
| 317 | 3300025939 | Ga0207665_10162161 | Ga0207665_101621611 | 498 |
| 318 | 3300025940 | Ga0207691_10009346 | Ga0207691_100093465 | 498 |
| 319 | 3300025941 | Ga0207711_10001532 | Ga0207711_100015326 | 498 |
| 320 | 3300025942 | Ga0207689_10055970 | Ga0207689_100559702 | 498 |
| 321 | 3300025960 | Ga0207651_10075480 | Ga0207651_100754802 | 498 |
| 322 | 3300026075 | Ga0207708_10023839 | Ga0207708_100238393 | 498 |
| 323 | 3300026089 | Ga0207648_10013559 | Ga0207648_100135593 | 498 |
| 324 | 3300026118 | Ga0207675_100007436 | Ga0207675_1000074368 | 498 |
| 325 | 3300026121 | Ga0207683_10205772 | Ga0207683_102057721 | 498 |
| 326 | 3300028380 | Ga0268265_10161810 | Ga0268265_101618102 | 498 |
| 327 | 3300028786 | Ga0307517_10067886 | Ga0307517_100678862 | 498 |
| 328 | 3300031616 | Ga0307508_10003602 | Ga0307508_1000360215 | 498 |
| 329 | 3300032126 | Ga0307415_100027228 | Ga0307415_1000272282 | 498 |
| 330 | 3300044656 | Ga0466969_0036751 | Ga0466969_0036751_806_2308 | 498 |
| 331 | 3300044684 | Ga0466966_0067081 | Ga0466966_0067081_275_1777 | 498 |
| 332 | 3300044693 | Ga0466961_0000960 | Ga0466961_0000960_12070_13572 | 498 |
| 333 | 3300044719 | Ga0466971_0002762 | Ga0466971_0002762_2675_4177 | 498 |
| 334 | 3300045049 | Ga0466959_0000368 | Ga0466959_0000368_17228_18730 | 498 |
| 335 | 3300046462 | Ga0495651_0000678 | Ga0495651_0000678_16427_17929 | 498 |
| 336 | 3300046516 | Ga0495628_0014954 | Ga0495628_0014954_3346_4848 | 498 |
| 337 | 3300046529 | Ga0495652_0004774 | Ga0495652_0004774_5595_7097 | 498 |
| 338 | 3300046679 | Ga0495623_0082377 | Ga0495623_0082377_21_1523 | 498 |
| 339 | 3300048088 | Ga0495602_0162922 | Ga0495602_0162922_37_1539 | 498 |
| 340 | 3300048907 | Ga0496104_0030068 | Ga0496104_0030068_1189_2685 | 498 |
| 341 | 3300048912 | Ga0496109_0005237 | Ga0496109_0005237_5243_6739 | 498 |
| 342 | 3300048913 | Ga0496110_0003813 | Ga0496110_0003813_4923_6419 | 498 |
| 343 | 3300048914 | Ga0496111_0016986 | Ga0496111_0016986_1665_3161 | 498 |
| 344 | 3300048915 | Ga0496112_0283956 | Ga0496112_0283956_57_1553 | 498 |
| 345 | 3300048917 | Ga0496114_0001646 | Ga0496114_0001646_3922_5418 | 498 |
| 346 | 3300048918 | Ga0496115_0026559 | Ga0496115_0026559_1004_2551 | 498 |
| 347 | 3300049823 | Ga0501044_0211629 | Ga0501044_0211629_10_1518 | 498 |
| 348 | 3300061719 | Ga0466962_0000502 | Ga0466962_0000502_11571_13073 | 498 |
| 349 | iso_pu_bacteria | 2643221578 | 2643904993 | 498 |
| 350 | iso_pu_bacteria | 2643221587 | 2643947191 | 498 |
| 351 | iso_pu_bacteria | 2643221673 | 2644403052 | 498 |
| 352 | iso_pu_bacteria | 2643221677 | 2644433338 | 498 |
| 353 | iso_pu_bacteria | 2818991472 | 2819744624 | 498 |
| 354 | iso_pu_bacteria | 2837183177 | 2837183674 | 498 |
| 355 | iso_pu_bacteria | 2837268691 | 2837272049 | 498 |
| 356 | iso_pu_bacteria | 2848551377 | 2848553860 | 498 |
| 357 | iso_pu_bacteria | 2868088558 | 2868095208 | 498 |
| 358 | iso_pu_bacteria | 2946045630 | 2946052401 | 498 |
| 359 | iso_pu_bacteria | 2995463766 | 2995469743 | 498 |
| 360 | 3300005327 | Ga0070658_10009217 | Ga0070658_100092172 | 499 |
| 361 | 3300005435 | Ga0070714_100012167 | Ga0070714_1000121675 | 499 |
| 362 | 3300005437 | Ga0070710_10000215 | Ga0070710_100002155 | 499 |
| 363 | 3300005539 | Ga0068853_100000325 | Ga0068853_1000003259 | 499 |
| 364 | 3300009093 | Ga0105240_10000794 | Ga0105240_100007948 | 499 |
| 365 | 3300009098 | Ga0105245_10059011 | Ga0105245_100590113 | 499 |
| 366 | 3300009545 | Ga0105237_10000069 | Ga0105237_1000006917 | 499 |
| 367 | 3300009545 | Ga0105237_10082291 | Ga0105237_100822912 | 499 |
| 368 | 3300009551 | Ga0105238_10018496 | Ga0105238_100184962 | 499 |
| 369 | 3300010375 | Ga0105239_10035524 | Ga0105239_100355242 | 499 |
| 370 | 3300025898 | Ga0207692_10000374 | Ga0207692_1000037411 | 499 |
| 371 | 3300025909 | Ga0207705_10010020 | Ga0207705_100100204 | 499 |
| 372 | 3300025913 | Ga0207695_10004093 | Ga0207695_100040935 | 499 |
| 373 | 3300025914 | Ga0207671_10000154 | Ga0207671_100001544 | 499 |
| 374 | 3300025921 | Ga0207652_10024905 | Ga0207652_100249053 | 499 |
| 375 | 3300025924 | Ga0207694_10006871 | Ga0207694_100068713 | 499 |
| 376 | 3300025929 | Ga0207664_10109071 | Ga0207664_101090711 | 499 |
| 377 | 3300025949 | Ga0207667_10065374 | Ga0207667_100653742 | 499 |
| 378 | 3300026041 | Ga0207639_10015350 | Ga0207639_100153504 | 499 |
| 379 | 3300026116 | Ga0207674_10058927 | Ga0207674_100589272 | 499 |
| 380 | 3300033179 | Ga0307507_10129131 | Ga0307507_101291311 | 499 |
| 381 | 3300036647 | Ga0316582_0054479 | Ga0316582_0054479_193_1695 | 499 |
| 382 | 3300037466 | Ga0395898_0183460 | Ga0395898_0183460_439_1938 | 499 |
| 383 | 3300042461 | Ga0439460_0017137 | Ga0439460_0017137_33_1532 | 499 |
| 384 | 3300044658 | Ga0466972_0000545 | Ga0466972_0000545_2515_4017 | 499 |
| 385 | 3300044683 | Ga0466965_0000763 | Ga0466965_0000763_4769_6271 | 499 |
| 386 | 3300044901 | Ga0466960_0001075 | Ga0466960_0001075_2581_4083 | 499 |
| 387 | 3300048907 | Ga0496104_0080089 | Ga0496104_0080089_628_2127 | 499 |
| 388 | 3300048912 | Ga0496109_0145383 | Ga0496109_0145383_405_1904 | 499 |
| 389 | 3300048917 | Ga0496114_0079193 | Ga0496114_0079193_273_1772 | 499 |
| 390 | 3300049583 | Ga0501067_0003636 | Ga0501067_0003636_668_2194 | 499 |
| 391 | 3300050491 | nmdc:mga00v17_3857_c1 | nmdc:mga00v17_3857_c1_4179_5732 | 499 |
| 392 | 3300050494 | nmdc:mga06z11_1986_c1 | nmdc:mga06z11_1986_c1_5837_7390 | 499 |
| 393 | iso_pu_bacteria | 2643221615 | 2644091331 | 499 |
| 394 | iso_pu_bacteria | 2643221641 | 2644229499 | 499 |
| 395 | iso_pu_bacteria | 2643221657 | 2644321134 | 499 |
| 396 | iso_pu_bacteria | 2643221687 | 2644487621 | 499 |
| 397 | iso_pu_bacteria | 2643221715 | 2644635416 | 499 |
| 398 | iso_pu_bacteria | 2675903059 | 2676479680 | 499 |
| 399 | iso_pu_bacteria | 2738541305 | 2738869589 | 499 |
| 400 | iso_pu_bacteria | 2784746768 | 2785368107 | 499 |
| 401 | iso_pu_bacteria | 2802429296 | 2804846005 | 499 |
| 402 | iso_pu_bacteria | 2808606375 | 2808919543 | 499 |
| 403 | iso_pu_bacteria | 2857481737 | 2857483201 | 499 |
| 404 | iso_pu_bacteria | 2867302475 | 2867303210 | 499 |
| 405 | iso_pu_bacteria | 2902792274 | 2902792831 | 499 |
| 406 | iso_pu_bacteria | 2902810491 | 2902811678 | 499 |
| 407 | iso_pu_bacteria | 2902837492 | 2902839093 | 499 |
| 408 | iso_pu_bacteria | 2929212328 | 2929214441 | 499 |
| 409 | iso_pu_bacteria | 2935390628 | 2935393221 | 499 |
| 410 | iso_pu_bacteria | 3006486233 | 3006492169 | 499 |
| 411 | iso_pu_bacteria | 8025413630 | 8025418305 | 499 |
| 412 | iso_pu_bacteria | 8054609563 | 8054611570 | 499 |
| 413 | 3300005338 | Ga0068868_100051831 | Ga0068868_1000518312 | 500 |
| 414 | 3300005539 | Ga0068853_100042799 | Ga0068853_1000427992 | 500 |
| 415 | 3300005985 | Ga0081539_10000560 | Ga0081539_1000056047 | 500 |
| 416 | 3300006051 | Ga0075364_10047974 | Ga0075364_100479743 | 500 |
| 417 | 3300020082 | Ga0206353_11323100 | Ga0206353_113231002 | 500 |
| 418 | 3300025913 | Ga0207695_10220548 | Ga0207695_102205482 | 500 |
| 419 | 3300026041 | Ga0207639_10035662 | Ga0207639_100356622 | 500 |
| 420 | 3300045976 | Ga0466967_0000947 | Ga0466967_0000947_12172_13677 | 500 |
| 421 | 3300045976 | Ga0466967_0006971 | Ga0466967_0006971_979_2487 | 500 |
| 422 | 3300046616 | Ga0495668_0000265 | Ga0495668_0000265_14331_15833 | 500 |
| 423 | 3300046660 | Ga0495625_0001104 | Ga0495625_0001104_25834_27336 | 500 |
| 424 | 3300047317 | Ga0495604_0058905 | Ga0495604_0058905_271_1779 | 500 |
| 425 | 3300048091 | Ga0495626_0000052 | Ga0495626_0000052_56644_58146 | 500 |
| 426 | 3300048904 | Ga0496101_0168596 | Ga0496101_0168596_166_1668 | 500 |
| 427 | 3300048905 | Ga0496102_0233851 | Ga0496102_0233851_22_1530 | 500 |
| 428 | 3300049587 | Ga0501071_0169532 | Ga0501071_0169532_63_1568 | 500 |
| 429 | 3300050491 | nmdc:mga00v17_30699_c1 | nmdc:mga00v17_30699_c1_524_2029 | 500 |
| 430 | 3300053117 | Ga0500593_000060 | Ga0500593_000060_20621_22126 | 500 |
| 431 | iso_pu_bacteria | 2582581313 | 2585305536 | 500 |
| 432 | iso_pu_bacteria | 2582581314 | 2585312529 | 500 |
| 433 | iso_pu_bacteria | 2582581314 | 2585321316 | 500 |
| 434 | iso_pu_bacteria | 2643221647 | 2644267697 | 500 |
| 435 | iso_pu_bacteria | 2643221714 | 2644627246 | 500 |
| 436 | iso_pu_bacteria | 2775506735 | 2775658943 | 500 |
| 437 | iso_pu_bacteria | 2784746768 | 2785371603 | 500 |
| 438 | iso_pu_bacteria | 2786546132 | 2786669160 | 500 |
| 439 | iso_pu_bacteria | 2808606357 | 2808830016 | 500 |
| 440 | iso_pu_bacteria | 2808606360 | 2808851191 | 500 |
| 441 | iso_pu_bacteria | 2808606366 | 2808876282 | 500 |
| 442 | iso_pu_bacteria | 2808606370 | 2808893844 | 500 |
| 443 | iso_pu_bacteria | 2808606371 | 2808897783 | 500 |
| 444 | iso_pu_bacteria | 2808606375 | 2808921520 | 500 |
| 445 | iso_pu_bacteria | 2811994871 | 2812318209 | 500 |
| 446 | iso_pu_bacteria | 2811994879 | 2812357306 | 500 |
| 447 | iso_pu_bacteria | 2818991458 | 2819665294 | 500 |
| 448 | iso_pu_bacteria | 2844849076 | 2844849965 | 500 |
| 449 | iso_pu_bacteria | 2870622029 | 2870624890 | 500 |
| 450 | iso_pu_bacteria | 2870782633 | 2870790377 | 500 |
| 451 | iso_pu_bacteria | 2877676314 | 2877679010 | 500 |
| 452 | iso_pu_bacteria | 2919391150 | 2919394574 | 500 |
| 453 | iso_pu_bacteria | 2939598168 | 2939601410 | 500 |
| 454 | iso_pu_bacteria | 2939657138 | 2939659671 | 500 |
| 455 | iso_pu_bacteria | 2945916053 | 2945920310 | 500 |
| 456 | iso_pu_bacteria | 2945920336 | 2945923392 | 500 |
| 457 | iso_pu_bacteria | 2945941187 | 2945944946 | 500 |
| 458 | iso_pu_bacteria | 2945956166 | 2945956571 | 500 |
| 459 | iso_pu_bacteria | 2946037020 | 2946039306 | 500 |
| 460 | iso_pu_bacteria | 2946037020 | 2946040890 | 500 |
| 461 | iso_pu_bacteria | 2946059875 | 2946064025 | 500 |
| 462 | iso_pu_bacteria | 2946072368 | 2946079774 | 500 |
| 463 | iso_pu_bacteria | 2947224130 | 2947225291 | 500 |
| 464 | iso_pu_bacteria | 2953998280 | 2954002129 | 500 |
| 465 | iso_pu_bacteria | 2954002825 | 2954002918 | 500 |
| 466 | iso_pu_bacteria | 2954380949 | 2954385539 | 500 |
| 467 | iso_pu_bacteria | 2954380949 | 2954387630 | 500 |
| 468 | iso_pu_bacteria | 2954673503 | 2954675458 | 500 |
| 469 | iso_pu_bacteria | 2954682443 | 2954688674 | 500 |
| 470 | iso_pu_bacteria | 2954691527 | 2954698417 | 500 |
| 471 | iso_pu_bacteria | 2954701450 | 2954703804 | 500 |
| 472 | iso_pu_bacteria | 2974302888 | 2974303862 | 500 |
| 473 | iso_pu_bacteria | 2984523437 | 2984526299 | 500 |
| 474 | iso_pu_bacteria | 8054107350 | 8054111444 | 500 |
| 475 | 3300003203 | JGI25406J46586_10004170 | JGI25406J46586_100041704 | 501 |
| 476 | 3300005329 | Ga0070683_100025665 | Ga0070683_1000256654 | 501 |
| 477 | 3300005329 | Ga0070683_100206941 | Ga0070683_1002069412 | 501 |
| 478 | 3300005337 | Ga0070682_100033936 | Ga0070682_1000339363 | 501 |
| 479 | 3300005337 | Ga0070682_100040418 | Ga0070682_1000404182 | 501 |
| 480 | 3300005347 | Ga0070668_100004262 | Ga0070668_1000042626 | 501 |
| 481 | 3300005436 | Ga0070713_100054093 | Ga0070713_1000540933 | 501 |
| 482 | 3300005842 | Ga0068858_100019157 | Ga0068858_1000191574 | 501 |
| 483 | 3300005985 | Ga0081539_10000458 | Ga0081539_1000045823 | 501 |
| 484 | 3300005985 | Ga0081539_10004205 | Ga0081539_100042057 | 501 |
| 485 | 3300005985 | Ga0081539_10010097 | Ga0081539_100100974 | 501 |
| 486 | 3300006038 | Ga0075365_10005755 | Ga0075365_100057552 | 501 |
| 487 | 3300006042 | Ga0075368_10001361 | Ga0075368_100013612 | 501 |
| 488 | 3300006048 | Ga0075363_100000403 | Ga0075363_1000004035 | 501 |
| 489 | 3300006177 | Ga0075362_10007078 | Ga0075362_100070783 | 501 |
| 490 | 3300006178 | Ga0075367_10018525 | Ga0075367_100185252 | 501 |
| 491 | 3300006178 | Ga0075367_10023653 | Ga0075367_100236533 | 501 |
| 492 | 3300006353 | Ga0075370_10046674 | Ga0075370_100466742 | 501 |
| 493 | 3300014968 | Ga0157379_10048180 | Ga0157379_100481803 | 501 |
| 494 | 3300017792 | Ga0163161_10001854 | Ga0163161_1000185410 | 501 |
| 495 | 3300025926 | Ga0207659_10066240 | Ga0207659_100662402 | 501 |
| 496 | 3300025937 | Ga0207669_10003595 | Ga0207669_100035952 | 501 |
| 497 | 3300025944 | Ga0207661_10006461 | Ga0207661_100064617 | 501 |
| 498 | 3300025944 | Ga0207661_10086160 | Ga0207661_100861602 | 501 |
| 499 | 3300025972 | Ga0207668_10002664 | Ga0207668_100026643 | 501 |
| 500 | 3300025972 | Ga0207668_10012883 | Ga0207668_100128833 | 501 |
| 501 | 3300026088 | Ga0207641_10230516 | Ga0207641_102305161 | 501 |
| 502 | 3300026095 | Ga0207676_10098840 | Ga0207676_100988402 | 501 |
| 503 | 3300026121 | Ga0207683_10182073 | Ga0207683_101820732 | 501 |
| 504 | 3300027866 | Ga0209813_10005131 | Ga0209813_100051312 | 501 |
| 505 | 3300028379 | Ga0268266_10142167 | Ga0268266_101421672 | 501 |
| 506 | 3300028800 | Ga0265338_10000718 | Ga0265338_1000071848 | 501 |
| 507 | 3300030522 | Ga0307512_10016324 | Ga0307512_100163243 | 501 |
| 508 | 3300030731 | Ga0316177_1196084 | Ga0316177_11960842 | 501 |
| 509 | 3300031247 | Ga0265340_10002148 | Ga0265340_100021488 | 501 |
| 510 | 3300031456 | Ga0307513_10001099 | Ga0307513_1000109929 | 501 |
| 511 | 3300031456 | Ga0307513_10117422 | Ga0307513_101174222 | 501 |
| 512 | 3300031507 | Ga0307509_10003859 | Ga0307509_1000385918 | 501 |
| 513 | 3300031852 | Ga0307410_10043783 | Ga0307410_100437832 | 501 |
| 514 | 3300031901 | Ga0307406_10026991 | Ga0307406_100269913 | 501 |
| 515 | 3300032126 | Ga0307415_100005698 | Ga0307415_1000056985 | 501 |
| 516 | 3300033179 | Ga0307507_10000769 | Ga0307507_1000076944 | 501 |
| 517 | 3300033179 | Ga0307507_10036950 | Ga0307507_100369503 | 501 |
| 518 | 3300033179 | Ga0307507_10067875 | Ga0307507_100678751 | 501 |
| 519 | 3300038443 | Ga0395901_0020552 | Ga0395901_0020552_2616_4121 | 501 |
| 520 | 3300041460 | Ga0451802_1520593 | Ga0451802_1520593_271_1779 | 501 |
| 521 | 3300041509 | Ga0451843_0598042 | Ga0451843_0598042_252_1760 | 501 |
| 522 | 3300044683 | Ga0466965_0001730 | Ga0466965_0001730_2909_4417 | 501 |
| 523 | 3300045049 | Ga0466959_0052377 | Ga0466959_0052377_532_2088 | 501 |
| 524 | 3300046454 | Ga0495592_0001614 | Ga0495592_0001614_2480_3988 | 501 |
| 525 | 3300046462 | Ga0495651_0003220 | Ga0495651_0003220_6400_7908 | 501 |
| 526 | 3300046476 | Ga0495662_0001303 | Ga0495662_0001303_1166_2674 | 501 |
| 527 | 3300046477 | Ga0495664_0003177 | Ga0495664_0003177_5261_6769 | 501 |
| 528 | 3300046492 | Ga0495585_0030131 | Ga0495585_0030131_400_1905 | 501 |
| 529 | 3300046511 | Ga0495608_0007013 | Ga0495608_0007013_305_1813 | 501 |
| 530 | 3300046516 | Ga0495628_0014756 | Ga0495628_0014756_793_2301 | 501 |
| 531 | 3300046526 | Ga0495666_0000855 | Ga0495666_0000855_2776_4284 | 501 |
| 532 | 3300046531 | Ga0495665_0003887 | Ga0495665_0003887_5935_7443 | 501 |
| 533 | 3300046533 | Ga0495640_0003851 | Ga0495640_0003851_9853_11361 | 501 |
| 534 | 3300046535 | Ga0495586_0017308 | Ga0495586_0017308_2043_3551 | 501 |
| 535 | 3300046536 | Ga0495587_0044989 | Ga0495587_0044989_902_2410 | 501 |
| 536 | 3300046543 | Ga0495645_0069144 | Ga0495645_0069144_57_1565 | 501 |
| 537 | 3300046559 | Ga0495667_0013456 | Ga0495667_0013456_3589_5097 | 501 |
| 538 | 3300046680 | Ga0495646_0041224 | Ga0495646_0041224_57_1565 | 501 |
| 539 | 3300046689 | Ga0495613_0005934 | Ga0495613_0005934_2188_3696 | 501 |
| 540 | 3300047317 | Ga0495604_0006943 | Ga0495604_0006943_4648_6153 | 501 |
| 541 | 3300047317 | Ga0495604_0007169 | Ga0495604_0007169_902_2410 | 501 |
| 542 | 3300047317 | Ga0495604_0015411 | Ga0495604_0015411_2086_3591 | 501 |
| 543 | 3300048905 | Ga0496102_0010092 | Ga0496102_0010092_1833_3338 | 501 |
| 544 | 3300048909 | Ga0496106_0008372 | Ga0496106_0008372_4867_6372 | 501 |
| 545 | 3300048910 | Ga0496107_0015918 | Ga0496107_0015918_1798_3303 | 501 |
| 546 | 3300048911 | Ga0496108_0019176 | Ga0496108_0019176_1969_3474 | 501 |
| 547 | 3300048912 | Ga0496109_0067839 | Ga0496109_0067839_773_2278 | 501 |
| 548 | 3300048915 | Ga0496112_0087122 | Ga0496112_0087122_369_1874 | 501 |
| 549 | 3300048917 | Ga0496114_0019861 | Ga0496114_0019861_2214_3719 | 501 |
| 550 | 3300049569 | Ga0501032_0083001 | Ga0501032_0083001_379_1884 | 501 |
| 551 | 3300049570 | Ga0501033_0032600 | Ga0501033_0032600_1467_2972 | 501 |
| 552 | 3300049571 | Ga0501034_0070903 | Ga0501034_0070903_1168_2673 | 501 |
| 553 | 3300049571 | Ga0501034_0129862 | Ga0501034_0129862_983_2488 | 501 |
| 554 | 3300049572 | Ga0501036_0026630 | Ga0501036_0026630_1814_3319 | 501 |
| 555 | 3300049572 | Ga0501036_0033597 | Ga0501036_0033597_357_1862 | 501 |
| 556 | 3300049573 | Ga0501037_0102755 | Ga0501037_0102755_192_1697 | 501 |
| 557 | 3300049574 | Ga0501038_0000915 | Ga0501038_0000915_2317_3831 | 501 |
| 558 | 3300049574 | Ga0501038_0017485 | Ga0501038_0017485_3968_5473 | 501 |
| 559 | 3300049575 | Ga0501039_0015387 | Ga0501039_0015387_736_2241 | 501 |
| 560 | 3300049575 | Ga0501039_0085490 | Ga0501039_0085490_612_2117 | 501 |
| 561 | 3300049579 | Ga0501043_0084525 | Ga0501043_0084525_357_1862 | 501 |
| 562 | 3300049582 | Ga0501048_0032066 | Ga0501048_0032066_998_2503 | 501 |
| 563 | 3300049583 | Ga0501067_0005558 | Ga0501067_0005558_3906_5411 | 501 |
| 564 | 3300049591 | Ga0501075_0038398 | Ga0501075_0038398_2052_3557 | 501 |
| 565 | 3300049592 | Ga0501076_0044661 | Ga0501076_0044661_1415_2920 | 501 |
| 566 | 3300049652 | Ga0501202_003666 | Ga0501202_003666_519_2030 | 501 |
| 567 | 3300049741 | Ga0501079_0020783 | Ga0501079_0020783_2801_4306 | 501 |
| 568 | 3300049742 | Ga0501080_0039341 | Ga0501080_0039341_1643_3148 | 501 |
| 569 | 3300049744 | Ga0501083_0000001 | Ga0501083_0000001_517394_518908 | 501 |
| 570 | 3300049822 | Ga0501035_0004093 | Ga0501035_0004093_663_2168 | 501 |
| 571 | 3300049822 | Ga0501035_0043459 | Ga0501035_0043459_855_2360 | 501 |
| 572 | 3300049823 | Ga0501044_0075665 | Ga0501044_0075665_1835_3340 | 501 |
| 573 | 3300049823 | Ga0501044_0097760 | Ga0501044_0097760_360_1865 | 501 |
| 574 | 3300049823 | Ga0501044_0226215 | Ga0501044_0226215_277_1782 | 501 |
| 575 | 3300049824 | Ga0501045_0058733 | Ga0501045_0058733_474_1979 | 501 |
| 576 | 3300049824 | Ga0501045_0130989 | Ga0501045_0130989_317_1822 | 501 |
| 577 | 3300050491 | nmdc:mga00v17_2296_c2 | nmdc:mga00v17_2296_c2_4115_5653 | 501 |
| 578 | 3300050494 | nmdc:mga06z11_44605_c1 | nmdc:mga06z11_44605_c1_367_1905 | 501 |
| 579 | 3300050494 | nmdc:mga06z11_5485_c1 | nmdc:mga06z11_5485_c1_2196_3704 | 501 |
| 580 | 3300050495 | nmdc:mga04h51_5822_c1 | nmdc:mga04h51_5822_c1_1077_2585 | 501 |
| 581 | 3300053085 | Ga0495619_0074474 | Ga0495619_0074474_118_1626 | 501 |
| 582 | 3300053140 | Ga0500573_0081038 | Ga0500573_0081038_214_1722 | 501 |
| 583 | 3300053142 | Ga0500577_0012975 | Ga0500577_0012975_364_1872 | 501 |
| 584 | 3300053153 | Ga0500616_0000146 | Ga0500616_0000146_110158_111666 | 501 |
| 585 | 3300053153 | Ga0500616_0001346 | Ga0500616_0001346_20151_21659 | 501 |
| 586 | 3300061719 | Ga0466962_0019705 | Ga0466962_0019705_1485_3041 | 501 |
| 587 | 3300061734 | Ga0530510_0049543 | Ga0530510_0049543_1065_2570 | 501 |
| 588 | iso_pu_bacteria | 2984576629 | 2984577325 | 501 |
| 589 | iso_pu_bacteria | 2990256926 | 2990259486 | 501 |
| 590 | iso_pu_bacteria | 3006321560 | 3006327596 | 501 |
| 591 | iso_pu_bacteria | 8002775197 | 8002780908 | 501 |
| 592 | 3300005336 | Ga0070680_100098710 | Ga0070680_1000987101 | 502 |
| 593 | 3300005337 | Ga0070682_100090221 | Ga0070682_1000902211 | 502 |
| 594 | 3300005339 | Ga0070660_100044752 | Ga0070660_1000447523 | 502 |
| 595 | 3300005347 | Ga0070668_100025049 | Ga0070668_1000250492 | 502 |
| 596 | 3300005535 | Ga0070684_100081857 | Ga0070684_1000818572 | 502 |
| 597 | 3300005985 | Ga0081539_10000985 | Ga0081539_1000098533 | 502 |
| 598 | 3300006038 | Ga0075365_10071511 | Ga0075365_100715112 | 502 |
| 599 | 3300025901 | Ga0207688_10011034 | Ga0207688_100110343 | 502 |
| 600 | 3300025919 | Ga0207657_10067366 | Ga0207657_100673663 | 502 |
| 601 | 3300025945 | Ga0207679_10008166 | Ga0207679_100081665 | 502 |
| 602 | 3300025972 | Ga0207668_10133450 | Ga0207668_101334501 | 502 |
| 603 | 3300037466 | Ga0395898_0013473 | Ga0395898_0013473_2020_3528 | 502 |
| 604 | 3300038443 | Ga0395901_0009136 | Ga0395901_0009136_1289_2797 | 502 |
| 605 | 3300041451 | Ga0451791_0029453 | Ga0451791_0029453_1685_3196 | 502 |
| 606 | 3300041452 | Ga0451793_0934301 | Ga0451793_0934301_34964_36475 | 502 |
| 607 | 3300041509 | Ga0451843_0667147 | Ga0451843_0667147_1498_3009 | 502 |
| 608 | 3300044901 | Ga0466960_0003579 | Ga0466960_0003579_2000_3514 | 502 |
| 609 | 3300046459 | Ga0495629_0123779 | Ga0495629_0123779_64_1581 | 502 |
| 610 | 3300046679 | Ga0495623_0020420 | Ga0495623_0020420_56_1564 | 502 |
| 611 | 3300046679 | Ga0495623_0099625 | Ga0495623_0099625_206_1714 | 502 |
| 612 | 3300047444 | Ga0495675_0025804 | Ga0495675_0025804_769_2277 | 502 |
| 613 | 3300050491 | nmdc:mga00v17_59100_c1 | nmdc:mga00v17_59100_c1_598_2142 | 502 |
| 614 | 3300050492 | nmdc:mga0yw44_42447_c1 | nmdc:mga0yw44_42447_c1_932_2440 | 502 |
| 615 | iso_pu_bacteria | 2643221681 | 2644455850 | 502 |
| 616 | iso_pu_bacteria | 2687453737 | 2689957910 | 502 |
| 617 | iso_pu_bacteria | 8002784119 | 8002789119 | 502 |
| 618 | 3300000546 | LJNas_1001250 | LJNas_10012503 | 503 |
| 619 | 3300002773 | JGI25152J39213_1001324 | JGI25152J39213_10013242 | 503 |
| 620 | 3300003792 | Ga0055540_1000489 | Ga0055540_10004896 | 503 |
| 621 | 3300003792 | Ga0055540_1000565 | Ga0055540_100056510 | 503 |
| 622 | 3300003792 | Ga0055540_1011832 | Ga0055540_10118323 | 503 |
| 623 | 3300005328 | Ga0070676_10013628 | Ga0070676_100136282 | 503 |
| 624 | 3300005347 | Ga0070668_100118124 | Ga0070668_1001181242 | 503 |
| 625 | 3300005353 | Ga0070669_100039467 | Ga0070669_1000394673 | 503 |
| 626 | 3300005353 | Ga0070669_100070915 | Ga0070669_1000709151 | 503 |
| 627 | 3300005355 | Ga0070671_100011360 | Ga0070671_1000113605 | 503 |
| 628 | 3300005356 | Ga0070674_100166612 | Ga0070674_1001666121 | 503 |
| 629 | 3300005364 | Ga0070673_100007266 | Ga0070673_1000072662 | 503 |
| 630 | 3300005367 | Ga0070667_100002522 | Ga0070667_1000025222 | 503 |
| 631 | 3300005563 | Ga0068855_100001513 | Ga0068855_10000151321 | 503 |
| 632 | 3300005563 | Ga0068855_100072839 | Ga0068855_1000728393 | 503 |
| 633 | 3300005617 | Ga0068859_100028586 | Ga0068859_1000285864 | 503 |
| 634 | 3300005618 | Ga0068864_100140322 | Ga0068864_1001403222 | 503 |
| 635 | 3300005841 | Ga0068863_100000375 | Ga0068863_10000037532 | 503 |
| 636 | 3300005842 | Ga0068858_100003308 | Ga0068858_10000330813 | 503 |
| 637 | 3300005843 | Ga0068860_100000155 | Ga0068860_10000015598 | 503 |
| 638 | 3300005844 | Ga0068862_100000096 | Ga0068862_10000009687 | 503 |
| 639 | 3300006038 | Ga0075365_10148940 | Ga0075365_101489402 | 503 |
| 640 | 3300006042 | Ga0075368_10000868 | Ga0075368_100008687 | 503 |
| 641 | 3300006051 | Ga0075364_10011674 | Ga0075364_100116742 | 503 |
| 642 | 3300006177 | Ga0075362_10034696 | Ga0075362_100346962 | 503 |
| 643 | 3300006178 | Ga0075367_10003098 | Ga0075367_100030985 | 503 |
| 644 | 3300006178 | Ga0075367_10006954 | Ga0075367_100069545 | 503 |
| 645 | 3300006931 | Ga0097620_100028585 | Ga0097620_1000285854 | 503 |
| 646 | 3300009036 | Ga0105244_10019545 | Ga0105244_100195452 | 503 |
| 647 | 3300009093 | Ga0105240_10142030 | Ga0105240_101420302 | 503 |
| 648 | 3300009101 | Ga0105247_10000040 | Ga0105247_10000040145 | 503 |
| 649 | 3300009177 | Ga0105248_10000095 | Ga0105248_1000009579 | 503 |
| 650 | 3300009553 | Ga0105249_10000069 | Ga0105249_10000069134 | 503 |
| 651 | 3300010375 | Ga0105239_10017704 | Ga0105239_100177042 | 503 |
| 652 | 3300010375 | Ga0105239_10075668 | Ga0105239_100756683 | 503 |
| 653 | 3300013308 | Ga0157375_10027678 | Ga0157375_100276786 | 503 |
| 654 | 3300014325 | Ga0163163_10032767 | Ga0163163_100327673 | 503 |
| 655 | 3300014326 | Ga0157380_10113687 | Ga0157380_101136872 | 503 |
| 656 | 3300014497 | Ga0182008_10003222 | Ga0182008_100032226 | 503 |
| 657 | 3300014968 | Ga0157379_10061645 | Ga0157379_100616453 | 503 |
| 658 | 3300014968 | Ga0157379_10110976 | Ga0157379_101109762 | 503 |
| 659 | 3300015261 | Ga0182006_1022536 | Ga0182006_10225362 | 503 |
| 660 | 3300015262 | Ga0182007_10003290 | Ga0182007_100032905 | 503 |
| 661 | 3300017792 | Ga0163161_10088878 | Ga0163161_100888782 | 503 |
| 662 | 3300021384 | Ga0213876_10003619 | Ga0213876_100036193 | 503 |
| 663 | 3300025258 | Ga0209129_1000060 | Ga0209129_100006096 | 503 |
| 664 | 3300025273 | Ga0209673_1018588 | Ga0209673_10185882 | 503 |
| 665 | 3300025294 | Ga0209025_1000308 | Ga0209025_100030826 | 503 |
| 666 | 3300025303 | Ga0209051_1001145 | Ga0209051_100114520 | 503 |
| 667 | 3300025303 | Ga0209051_1002772 | Ga0209051_10027727 | 503 |
| 668 | 3300025315 | Ga0207697_10000819 | Ga0207697_1000081910 | 503 |
| 669 | 3300025900 | Ga0207710_10000050 | Ga0207710_10000050175 | 503 |
| 670 | 3300025907 | Ga0207645_10003630 | Ga0207645_100036304 | 503 |
| 671 | 3300025914 | Ga0207671_10006465 | Ga0207671_1000646510 | 503 |
| 672 | 3300025923 | Ga0207681_10002699 | Ga0207681_100026999 | 503 |
| 673 | 3300025935 | Ga0207709_10033255 | Ga0207709_100332553 | 503 |
| 674 | 3300025940 | Ga0207691_10002119 | Ga0207691_100021198 | 503 |
| 675 | 3300025941 | Ga0207711_10000082 | Ga0207711_100000825 | 503 |
| 676 | 3300025949 | Ga0207667_10011093 | Ga0207667_100110933 | 503 |
| 677 | 3300025949 | Ga0207667_10016376 | Ga0207667_100163765 | 503 |
| 678 | 3300025961 | Ga0207712_10000358 | Ga0207712_1000035816 | 503 |
| 679 | 3300025986 | Ga0207658_10001810 | Ga0207658_100018102 | 503 |
| 680 | 3300026035 | Ga0207703_10010353 | Ga0207703_100103533 | 503 |
| 681 | 3300026088 | Ga0207641_10002016 | Ga0207641_100020163 | 503 |
| 682 | 3300026095 | Ga0207676_10079769 | Ga0207676_100797693 | 503 |
| 683 | 3300026142 | Ga0207698_10190191 | Ga0207698_101901911 | 503 |
| 684 | 3300027312 | Ga0209371_1009997 | Ga0209371_10099972 | 503 |
| 685 | 3300027907 | Ga0207428_10051212 | Ga0207428_100512123 | 503 |
| 686 | 3300028379 | Ga0268266_10005012 | Ga0268266_1000501212 | 503 |
| 687 | 3300028380 | Ga0268265_10000106 | Ga0268265_1000010615 | 503 |
| 688 | 3300028381 | Ga0268264_10000219 | Ga0268264_1000021993 | 503 |
| 689 | 3300028794 | Ga0307515_10001813 | Ga0307515_100018132 | 503 |
| 690 | 3300030500 | Ga0268256_1011287 | Ga0268256_10112873 | 503 |
| 691 | 3300030522 | Ga0307512_10082058 | Ga0307512_100820582 | 503 |
| 692 | 3300031247 | Ga0265340_10002640 | Ga0265340_100026404 | 503 |
| 693 | 3300031249 | Ga0265339_10005353 | Ga0265339_100053537 | 503 |
| 694 | 3300031507 | Ga0307509_10047240 | Ga0307509_100472402 | 503 |
| 695 | 3300031507 | Ga0307509_10051795 | Ga0307509_100517952 | 503 |
| 696 | 3300031548 | Ga0307408_100008034 | Ga0307408_1000080343 | 503 |
| 697 | 3300031548 | Ga0307408_100011377 | Ga0307408_1000113772 | 503 |
| 698 | 3300031548 | Ga0307408_100015213 | Ga0307408_1000152134 | 503 |
| 699 | 3300031548 | Ga0307408_100076779 | Ga0307408_1000767792 | 503 |
| 700 | 3300031616 | Ga0307508_10026043 | Ga0307508_100260434 | 503 |
| 701 | 3300031730 | Ga0307516_10028506 | Ga0307516_100285063 | 503 |
| 702 | 3300031824 | Ga0307413_10016133 | Ga0307413_100161333 | 503 |
| 703 | 3300031824 | Ga0307413_10035274 | Ga0307413_100352742 | 503 |
| 704 | 3300031824 | Ga0307413_10039642 | Ga0307413_100396423 | 503 |
| 705 | 3300031852 | Ga0307410_10002221 | Ga0307410_100022213 | 503 |
| 706 | 3300031852 | Ga0307410_10045737 | Ga0307410_100457372 | 503 |
| 707 | 3300031901 | Ga0307406_10038987 | Ga0307406_100389872 | 503 |
| 708 | 3300031903 | Ga0307407_10012418 | Ga0307407_100124183 | 503 |
| 709 | 3300031903 | Ga0307407_10014986 | Ga0307407_100149864 | 503 |
| 710 | 3300031911 | Ga0307412_10001250 | Ga0307412_100012508 | 503 |
| 711 | 3300031911 | Ga0307412_10012746 | Ga0307412_100127462 | 503 |
| 712 | 3300031911 | Ga0307412_10075738 | Ga0307412_100757382 | 503 |
| 713 | 3300031995 | Ga0307409_100015269 | Ga0307409_1000152693 | 503 |
| 714 | 3300031995 | Ga0307409_100022829 | Ga0307409_1000228292 | 503 |
| 715 | 3300031995 | Ga0307409_100271302 | Ga0307409_1002713021 | 503 |
| 716 | 3300032002 | Ga0307416_100092582 | Ga0307416_1000925821 | 503 |
| 717 | 3300032002 | Ga0307416_100093606 | Ga0307416_1000936062 | 503 |
| 718 | 3300032002 | Ga0307416_100123188 | Ga0307416_1001231882 | 503 |
| 719 | 3300032002 | Ga0307416_100126699 | Ga0307416_1001266992 | 503 |
| 720 | 3300033180 | Ga0307510_10025243 | Ga0307510_100252435 | 503 |
| 721 | 3300033180 | Ga0307510_10033123 | Ga0307510_100331233 | 503 |
| 722 | 3300033180 | Ga0307510_10086838 | Ga0307510_100868382 | 503 |
| 723 | 3300037312 | Ga0395899_0043425 | Ga0395899_0043425_1698_3218 | 503 |
| 724 | 3300037418 | Ga0395900_0003634 | Ga0395900_0003634_14759_16279 | 503 |
| 725 | 3300037466 | Ga0395898_0007741 | Ga0395898_0007741_5490_7010 | 503 |
| 726 | 3300037466 | Ga0395898_0129601 | Ga0395898_0129601_29_1549 | 503 |
| 727 | 3300038443 | Ga0395901_0047570 | Ga0395901_0047570_1949_3469 | 503 |
| 728 | 3300039437 | Ga0436365_0727080 | Ga0436365_0727080_6328_7851 | 503 |
| 729 | 3300041404 | Ga0439436_0000821 | Ga0439436_0000821_2718_4238 | 503 |
| 730 | 3300041405 | Ga0439438_004754 | Ga0439438_004754_2049_3569 | 503 |
| 731 | 3300041405 | Ga0439438_015083 | Ga0439438_015083_114_1634 | 503 |
| 732 | 3300041410 | Ga0439461_0000431 | Ga0439461_0000431_699_2210 | 503 |
| 733 | 3300041410 | Ga0439461_0002285 | Ga0439461_0002285_596_2116 | 503 |
| 734 | 3300041411 | Ga0439466_0001864 | Ga0439466_0001864_5102_6613 | 503 |
| 735 | 3300041411 | Ga0439466_0002713 | Ga0439466_0002713_4642_6162 | 503 |
| 736 | 3300041411 | Ga0439466_0018729 | Ga0439466_0018729_784_2304 | 503 |
| 737 | 3300041999 | Ga0439433_0000112 | Ga0439433_0000112_7883_9403 | 503 |
| 738 | 3300041999 | Ga0439433_0005299 | Ga0439433_0005299_415_1935 | 503 |
| 739 | 3300042002 | Ga0439442_000035 | Ga0439442_000035_3179_4699 | 503 |
| 740 | 3300042002 | Ga0439442_000131 | Ga0439442_000131_5518_7038 | 503 |
| 741 | 3300042002 | Ga0439442_001539 | Ga0439442_001539_1346_2866 | 503 |
| 742 | 3300042002 | Ga0439442_003246 | Ga0439442_003246_1350_2870 | 503 |
| 743 | 3300042002 | Ga0439442_007106 | Ga0439442_007106_64_1584 | 503 |
| 744 | 3300042005 | Ga0439448_0008307 | Ga0439448_0008307_664_2181 | 503 |
| 745 | 3300042007 | Ga0439449_0003274 | Ga0439449_0003274_854_2371 | 503 |
| 746 | 3300042007 | Ga0439449_0010735 | Ga0439449_0010735_1899_3419 | 503 |
| 747 | 3300042007 | Ga0439449_0019538 | Ga0439449_0019538_153_1673 | 503 |
| 748 | 3300042014 | Ga0439457_007506 | Ga0439457_007506_357_1877 | 503 |
| 749 | 3300042015 | Ga0439462_0002963 | Ga0439462_0002963_220_1740 | 503 |
| 750 | 3300042122 | Ga0450920_000305 | Ga0450920_000305_567_2087 | 503 |
| 751 | 3300042138 | Ga0450903_000903 | Ga0450903_000903_103_1620 | 503 |
| 752 | 3300042146 | Ga0450907_000055 | Ga0450907_000055_11108_12628 | 503 |
| 753 | 3300042157 | Ga0439458_0001178 | Ga0439458_0001178_4210_5727 | 503 |
| 754 | 3300042185 | Ga0450909_000077 | Ga0450909_000077_2616_4136 | 503 |
| 755 | 3300042531 | Ga0450918_000503 | Ga0450918_000503_5910_7430 | 503 |
| 756 | 3300044658 | Ga0466972_0000524 | Ga0466972_0000524_1672_3189 | 503 |
| 757 | 3300044684 | Ga0466966_0001853 | Ga0466966_0001853_7500_9017 | 503 |
| 758 | 3300044684 | Ga0466966_0009749 | Ga0466966_0009749_725_2245 | 503 |
| 759 | 3300044693 | Ga0466961_0000711 | Ga0466961_0000711_7538_9055 | 503 |
| 760 | 3300044693 | Ga0466961_0040981 | Ga0466961_0040981_1120_2637 | 503 |
| 761 | 3300044694 | Ga0466963_0009927 | Ga0466963_0009927_243_1760 | 503 |
| 762 | 3300044694 | Ga0466963_0032627 | Ga0466963_0032627_1783_3300 | 503 |
| 763 | 3300044706 | Ga0466964_0015909 | Ga0466964_0015909_1101_2618 | 503 |
| 764 | 3300044719 | Ga0466971_0002569 | Ga0466971_0002569_275_1792 | 503 |
| 765 | 3300044765 | Ga0466970_0000451 | Ga0466970_0000451_2129_3646 | 503 |
| 766 | 3300044765 | Ga0466970_0011680 | Ga0466970_0011680_143_1657 | 503 |
| 767 | 3300044765 | Ga0466970_0016655 | Ga0466970_0016655_1318_2874 | 503 |
| 768 | 3300044765 | Ga0466970_0069419 | Ga0466970_0069419_15_1535 | 503 |
| 769 | 3300044842 | Ga0466957_0004216 | Ga0466957_0004216_2719_4236 | 503 |
| 770 | 3300045049 | Ga0466959_0000869 | Ga0466959_0000869_16064_17581 | 503 |
| 771 | 3300045049 | Ga0466959_0022600 | Ga0466959_0022600_935_2491 | 503 |
| 772 | 3300045836 | Ga0466958_0000491 | Ga0466958_0000491_3737_5254 | 503 |
| 773 | 3300045976 | Ga0466967_0013884 | Ga0466967_0013884_3627_5144 | 503 |
| 774 | 3300045976 | Ga0466967_0019408 | Ga0466967_0019408_2335_3852 | 503 |
| 775 | 3300046475 | Ga0495639_0029015 | Ga0495639_0029015_36_1556 | 503 |
| 776 | 3300046499 | Ga0495594_0008427 | Ga0495594_0008427_1503_3020 | 503 |
| 777 | 3300046514 | Ga0495618_0067902 | Ga0495618_0067902_408_1925 | 503 |
| 778 | 3300046516 | Ga0495628_0055316 | Ga0495628_0055316_13_1539 | 503 |
| 779 | 3300046517 | Ga0495630_0159285 | Ga0495630_0159285_178_1698 | 503 |
| 780 | 3300046531 | Ga0495665_0034671 | Ga0495665_0034671_663_2183 | 503 |
| 781 | 3300046535 | Ga0495586_0039006 | Ga0495586_0039006_875_2395 | 503 |
| 782 | 3300046557 | Ga0495622_0034335 | Ga0495622_0034335_34_1554 | 503 |
| 783 | 3300046615 | Ga0495656_0000628 | Ga0495656_0000628_8057_9577 | 503 |
| 784 | 3300046615 | Ga0495656_0015355 | Ga0495656_0015355_577_2112 | 503 |
| 785 | 3300046616 | Ga0495668_0038338 | Ga0495668_0038338_94_1605 | 503 |
| 786 | 3300046664 | Ga0495659_0040138 | Ga0495659_0040138_34_1554 | 503 |
| 787 | 3300046675 | Ga0495657_0054675 | Ga0495657_0054675_1121_2638 | 503 |
| 788 | 3300046690 | Ga0495624_0027297 | Ga0495624_0027297_205_1722 | 503 |
| 789 | 3300047315 | Ga0495581_0002585 | Ga0495581_0002585_3795_5315 | 503 |
| 790 | 3300047315 | Ga0495581_0048889 | Ga0495581_0048889_894_2414 | 503 |
| 791 | 3300047317 | Ga0495604_0123938 | Ga0495604_0123938_239_1756 | 503 |
| 792 | 3300047321 | Ga0495676_0063829 | Ga0495676_0063829_311_1828 | 503 |
| 793 | 3300047443 | Ga0495687_007238 | Ga0495687_007238_3237_4754 | 503 |
| 794 | 3300047469 | Ga0495673_0010153 | Ga0495673_0010153_2209_3720 | 503 |
| 795 | 3300047472 | Ga0495686_0009647 | Ga0495686_0009647_3314_4825 | 503 |
| 796 | 3300048903 | Ga0496100_0003391 | Ga0496100_0003391_4525_6036 | 503 |
| 797 | 3300048904 | Ga0496101_0000047 | Ga0496101_0000047_81063_82574 | 503 |
| 798 | 3300048904 | Ga0496101_0003589 | Ga0496101_0003589_3804_5315 | 503 |
| 799 | 3300048904 | Ga0496101_0060011 | Ga0496101_0060011_903_2423 | 503 |
| 800 | 3300048905 | Ga0496102_0000003 | Ga0496102_0000003_418117_419628 | 503 |
| 801 | 3300048905 | Ga0496102_0000206 | Ga0496102_0000206_14429_15940 | 503 |
| 802 | 3300048905 | Ga0496102_0123375 | Ga0496102_0123375_864_2384 | 503 |
| 803 | 3300048906 | Ga0496103_0000012 | Ga0496103_0000012_127629_129140 | 503 |
| 804 | 3300048906 | Ga0496103_0000934 | Ga0496103_0000934_15802_17313 | 503 |
| 805 | 3300048906 | Ga0496103_0001998 | Ga0496103_0001998_3265_4785 | 503 |
| 806 | 3300048906 | Ga0496103_0026918 | Ga0496103_0026918_1643_3163 | 503 |
| 807 | 3300048907 | Ga0496104_0027710 | Ga0496104_0027710_48_1559 | 503 |
| 808 | 3300048908 | Ga0496105_0012004 | Ga0496105_0012004_1615_3135 | 503 |
| 809 | 3300048908 | Ga0496105_0096501 | Ga0496105_0096501_830_2341 | 503 |
| 810 | 3300048909 | Ga0496106_0002541 | Ga0496106_0002541_1471_2982 | 503 |
| 811 | 3300048909 | Ga0496106_0010176 | Ga0496106_0010176_2513_4024 | 503 |
| 812 | 3300048909 | Ga0496106_0030586 | Ga0496106_0030586_634_2154 | 503 |
| 813 | 3300048910 | Ga0496107_0006139 | Ga0496107_0006139_3659_5170 | 503 |
| 814 | 3300048910 | Ga0496107_0034030 | Ga0496107_0034030_1485_2996 | 503 |
| 815 | 3300048913 | Ga0496110_0091339 | Ga0496110_0091339_751_2271 | 503 |
| 816 | 3300048913 | Ga0496110_0140106 | Ga0496110_0140106_227_1747 | 503 |
| 817 | 3300048914 | Ga0496111_0065447 | Ga0496111_0065447_1020_2540 | 503 |
| 818 | 3300048916 | Ga0496113_0104405 | Ga0496113_0104405_660_2174 | 503 |
| 819 | 3300048917 | Ga0496114_0009732 | Ga0496114_0009732_4515_6026 | 503 |
| 820 | 3300048919 | Ga0496116_0000040 | Ga0496116_0000040_172757_174268 | 503 |
| 821 | 3300048919 | Ga0496116_0021828 | Ga0496116_0021828_539_2050 | 503 |
| 822 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_172636_174147 | 503 |
| 823 | 3300048920 | Ga0496117_0002524 | Ga0496117_0002524_7364_8875 | 503 |
| 824 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_172639_174150 | 503 |
| 825 | 3300048921 | Ga0496118_0004713 | Ga0496118_0004713_411_1922 | 503 |
| 826 | 3300048922 | Ga0496119_0000142 | Ga0496119_0000142_29694_31205 | 503 |
| 827 | 3300048922 | Ga0496119_0003343 | Ga0496119_0003343_4616_6127 | 503 |
| 828 | 3300048923 | Ga0496120_0000149 | Ga0496120_0000149_37755_39266 | 503 |
| 829 | 3300048924 | Ga0496121_0000019 | Ga0496121_0000019_427595_429106 | 503 |
| 830 | 3300048924 | Ga0496121_0005049 | Ga0496121_0005049_2347_3858 | 503 |
| 831 | 3300048927 | Ga0496124_0039079 | Ga0496124_0039079_611_2122 | 503 |
| 832 | 3300048928 | Ga0496125_0052807 | Ga0496125_0052807_341_1852 | 503 |
| 833 | 3300048929 | Ga0496126_0000785 | Ga0496126_0000785_14168_15679 | 503 |
| 834 | 3300048929 | Ga0496126_0018498 | Ga0496126_0018498_566_2077 | 503 |
| 835 | 3300049569 | Ga0501032_0000782 | Ga0501032_0000782_15904_17424 | 503 |
| 836 | 3300049573 | Ga0501037_0001460 | Ga0501037_0001460_3804_5324 | 503 |
| 837 | 3300049574 | Ga0501038_0063144 | Ga0501038_0063144_731_2251 | 503 |
| 838 | 3300049574 | Ga0501038_0096192 | Ga0501038_0096192_650_2170 | 503 |
| 839 | 3300049575 | Ga0501039_0002473 | Ga0501039_0002473_9289_10809 | 503 |
| 840 | 3300049575 | Ga0501039_0052335 | Ga0501039_0052335_953_2473 | 503 |
| 841 | 3300050490 | nmdc:mga03n38_11372_c1 | nmdc:mga03n38_11372_c1_1414_2928 | 503 |
| 842 | 3300050490 | nmdc:mga03n38_730_c1 | nmdc:mga03n38_730_c1_565_2076 | 503 |
| 843 | 3300050494 | nmdc:mga06z11_66263_c1 | nmdc:mga06z11_66263_c1_157_1668 | 503 |
| 844 | 3300050494 | nmdc:mga06z11_7355_c1 | nmdc:mga06z11_7355_c1_314_1825 | 503 |
| 845 | 3300053079 | Ga0500610_0029662 | Ga0500610_0029662_916_2427 | 503 |
| 846 | 3300053087 | Ga0500643_016853 | Ga0500643_016853_313_1824 | 503 |
| 847 | 3300053108 | Ga0500562_003818 | Ga0500562_003818_997_2508 | 503 |
| 848 | 3300053136 | Ga0500559_0000078 | Ga0500559_0000078_47765_49285 | 503 |
| 849 | 3300053136 | Ga0500559_0002799 | Ga0500559_0002799_3238_4758 | 503 |
| 850 | 3300053140 | Ga0500573_0000011 | Ga0500573_0000011_90409_91929 | 503 |
| 851 | 3300053140 | Ga0500573_0002508 | Ga0500573_0002508_188_1708 | 503 |
| 852 | 3300053153 | Ga0500616_0033635 | Ga0500616_0033635_470_1981 | 503 |
| 853 | 3300061719 | Ga0466962_0002010 | Ga0466962_0002010_3609_5126 | 503 |
| 854 | 3300061719 | Ga0466962_0003591 | Ga0466962_0003591_734_2290 | 503 |
| 855 | iso_pu_bacteria | 2643221576 | 2643890682 | 503 |
| 856 | iso_pu_bacteria | 2643221590 | 2643959738 | 503 |
| 857 | iso_pu_bacteria | 2643221617 | 2644100698 | 503 |
| 858 | iso_pu_bacteria | 2643221620 | 2644117106 | 503 |
| 859 | iso_pu_bacteria | 2984592036 | 2984592725 | 503 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cyy-assembly1.cif.gz_F-2 | crystal structure of arabinose isomerase from hybrid ai8 with adonitol | 0.9637 | 8 | 496 |
| 7cyy-assembly1.cif.gz_A | crystal structure of arabinose isomerase from hybrid ai8 with adonitol | 0.9626 | 1 | 497 |
| 7ch3-assembly1.cif.gz_F | crystal structure of arabinose isomerase from hyper thermophilic bacterium thermotoga maritima (tmai) triple mutant (k264a, e265a, k266a) | 0.9626 | 1 | 498 |
| 7cx7-assembly1.cif.gz_F-2 | crystal structure of arabinose isomerase from hybrid ai8 | 0.9621 | 2 | 497 |
| 7chl-assembly1.cif.gz_D | crystal structure of hybrid arabinose isomerase ai-10 | 0.9619 | 5 | 497 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f2dC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9623 | 6 | 174 | 3.40.50.10940 |
| 4lqlD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.958 | 5 | 174 | 3.40.50.10940 |
| 4f2dC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.929 | 6 | 174 | 3.40.50.10940 |
| 4lqlD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9264 | 5 | 174 | 3.40.50.10940 |
| 1dciC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.6784 | 59 | 108 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1ZRN4-F1-model_v4 | L-arabinose isomerase | 0.9977 | 376 | 500 |
GO:0005829
GO:0008733 GO:0019569 |
| AF-A0A376K383-F1-model_v4 | L-arabinose isomerase (EC 5.3.1.4) | 0.9965 | 218 | 322 |
GO:0005829
GO:0008733 GO:0019569 |
| AF-A0A259SFD8-F1-model_v4 | L-arabinose isomerase | 0.9943 | 380 | 503 |
GO:0005829
GO:0008733 GO:0019569 |
| AF-A0A4Q3VLW5-F1-model_v4 | L-arabinose isomerase | 0.9915 | 213 | 304 |
GO:0005829
GO:0008733 GO:0019569 |
| AF-A0A533RYG3-F1-model_v4 | L-arabinose isomerase | 0.9904 | 214 | 498 |
GO:0005829
GO:0008733 GO:0019569 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar