F483754

General Info

Members Datasets Scaffolds Average Seq Length
858 488 839 103

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0392039|Ga0501037_0392039_337_756
Length 122
Sequence MATRHPSIASAAEGKNTVETPLSKSYTDPRDVLIKPVVSEKSYALLDENKYTFIVDPRANKTQIKEAVQAVFEVKVTGVNTINRQGKRKRTRTGFGQRAATKRAIVTLAEGDRIDIFGGPTA

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
3 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
4 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
5 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
6 2867475112 Streptomyces sp. TM32 Isolate Unclassified
7 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
8 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
9 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
10 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
96 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
97 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
181 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
224 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
225 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
226 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
232 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
235 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
238 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
241 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
242 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
243 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
244 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
301 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
326 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
327 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
328 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
345 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
384 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
385 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
388 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
389 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
390 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
402 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
403 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
404 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
409 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
410 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
411 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
412 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
415 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
418 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
419 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
420 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
421 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
422 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
423 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
424 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
425 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
426 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
427 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
428 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
429 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
430 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
431 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
434 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
435 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
436 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
437 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
438 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
439 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
440 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
441 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
444 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
445 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
446 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
449 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
479 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
480 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
481 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
482 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
483 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
484 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
485 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
486 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
487 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
488 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.73
Metatranscriptomes 13.05
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 6.99
Rhizosphere 77.16
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1032287 3300003354 Bacteria 1333
2 Ga0058859_10027059 3300004798 Bacteria 810
3 Ga0058861_12031117 3300004800 Bacteria 721
4 Ga0058860_10020864 3300004801 Bacteria 651
5 Ga0058860_12055840 3300004801 Bacteria 550
6 Ga0058862_10019043 3300004803 Bacteria 924
7 Ga0058862_12685021 3300004803 Bacteria 637
8 Ga0070658_11036574 3300005327 Bacteria 713
9 Ga0070683_100243292 3300005329 Bacteria 1711
10 Ga0070683_100730630 3300005329 Bacteria 948
11 Ga0070683_101138786 3300005329 Bacteria 749
12 Ga0070670_100425233 3300005331 Bacteria 1175
13 Ga0070670_100760505 3300005331 Bacteria 873
14 Ga0068869_100293072 3300005334 Bacteria 1311
15 Ga0070682_100283454 3300005337 Bacteria 1209
16 Ga0070682_100420354 3300005337 Bacteria 1016
17 Ga0068868_100719583 3300005338 Bacteria 894
18 Ga0068868_101528756 3300005338 Bacteria 625
19 Ga0070660_100392575 3300005339 Bacteria 1146
20 Ga0070689_100898597 3300005340 Bacteria 784
21 Ga0070687_100565731 3300005343 Bacteria 776
22 Ga0070661_100303924 3300005344 Bacteria 1242
23 Ga0070692_10467664 3300005345 Bacteria 810
24 Ga0070692_11211312 3300005345 Bacteria 538
25 Ga0070668_100198226 3300005347 Bacteria 1647
26 Ga0070668_101450308 3300005347 Bacteria 627
27 Ga0070669_101860188 3300005353 Bacteria 525
28 Ga0070675_100820281 3300005354 Bacteria 851
29 Ga0070671_100314327 3300005355 Bacteria 1334
30 Ga0070671_100546495 3300005355 Bacteria 999
31 Ga0070674_101090453 3300005356 Bacteria 705
32 Ga0070674_101177552 3300005356 Bacteria 680
33 Ga0070673_100855117 3300005364 Bacteria 842
34 Ga0070673_101041985 3300005364 Bacteria 763
35 Ga0070659_100346616 3300005366 Bacteria 1245
36 Ga0070659_101468914 3300005366 Bacteria 607
37 Ga0070667_100005984 3300005367 Bacteria 10104
38 Ga0070667_100313417 3300005367 Bacteria 1414
39 Ga0070667_100552437 3300005367 Bacteria 1058
40 Ga0070703_10117275 3300005406 Bacteria 961
41 Ga0070714_100233697 3300005435 Bacteria 1695
42 Ga0070714_100319510 3300005435 Bacteria 1451
43 Ga0070713_100004669 3300005436 Bacteria 9248
44 Ga0070701_10842954 3300005438 Bacteria 629
45 Ga0070711_100253031 3300005439 Bacteria 1383
46 Ga0070700_100780034 3300005441 Bacteria 768
47 Ga0070700_101998074 3300005441 Bacteria 503
48 Ga0070663_100166935 3300005455 Bacteria 1699
49 Ga0070678_100132027 3300005456 Bacteria 1985
50 Ga0070678_100420815 3300005456 Bacteria 1164
51 Ga0070678_101247103 3300005456 Bacteria 691
52 Ga0070678_101280762 3300005456 Bacteria 682
53 Ga0070662_100552981 3300005457 Bacteria 964
54 Ga0070662_101939477 3300005457 Bacteria 509
55 Ga0068867_100312233 3300005459 Bacteria 1299
56 Ga0070685_10284947 3300005466 Bacteria 1107
57 Ga0070685_11409986 3300005466 Bacteria 535
58 Ga0070685_11481707 3300005466 Bacteria 522
59 Ga0070706_101774999 3300005467 Bacteria 561
60 Ga0070679_101137379 3300005530 Bacteria 726
61 Ga0070679_101142826 3300005530 Bacteria 724
62 Ga0070679_101800756 3300005530 Bacteria 561
63 Ga0070684_100285523 3300005535 Bacteria 1512
64 Ga0070672_100582283 3300005543 Bacteria 974
65 Ga0070672_101372942 3300005543 Bacteria 632
66 Ga0070686_100186467 3300005544 Bacteria 1478
67 Ga0070686_101484268 3300005544 Bacteria 571
68 Ga0070693_100400377 3300005547 Bacteria 952
69 Ga0070693_101028264 3300005547 Bacteria 625
70 Ga0070665_100125445 3300005548 Bacteria 2570
71 Ga0070665_102611067 3300005548 Bacteria 506
72 Ga0070664_100611988 3300005564 Bacteria 1011
73 Ga0070664_100964697 3300005564 Bacteria 801
74 Ga0068857_100367935 3300005577 Bacteria 1333
75 Ga0068854_101954602 3300005578 Bacteria 540
76 Ga0068856_100781514 3300005614 Bacteria 975
77 Ga0068856_101071620 3300005614 Bacteria 824
78 Ga0070702_100134868 3300005615 Bacteria 1565
79 Ga0068852_100025908 3300005616 Bacteria 4759
80 Ga0068852_100649273 3300005616 Bacteria 1062
81 Ga0068852_101215577 3300005616 Bacteria 775
82 Ga0068859_100743950 3300005617 Bacteria 1070
83 Ga0068864_100521326 3300005618 Bacteria 1146
84 Ga0068864_100627925 3300005618 Bacteria 1045
85 Ga0068866_10632194 3300005718 Bacteria 726
86 Ga0068861_100130584 3300005719 Bacteria 2038
87 Ga0068851_10299893 3300005834 Bacteria 924
88 Ga0068870_10582921 3300005840 Bacteria 758
89 Ga0068870_11409036 3300005840 Bacteria 511
90 Ga0068863_100342072 3300005841 Bacteria 1455
91 Ga0068863_101686661 3300005841 Bacteria 643
92 Ga0068858_100000013 3300005842 Bacteria 216466
93 Ga0068858_100212121 3300005842 Bacteria 1833
94 Ga0068860_100780105 3300005843 Bacteria 968
95 Ga0081455_10106856 3300005937 Bacteria 2232
96 Ga0081455_10386216 3300005937 Bacteria 976
97 Ga0081455_10547032 3300005937 Bacteria 766
98 Ga0081540_1005568 3300005983 Bacteria 9381
99 Ga0070717_11314727 3300006028 Bacteria 657
100 Ga0075365_10006681 3300006038 Bacteria 6372
101 Ga0075365_10075797 3300006038 Bacteria 2270
102 Ga0075365_10855404 3300006038 Bacteria 641
103 Ga0075365_10948699 3300006038 Bacteria 606
104 Ga0075363_100038892 3300006048 Bacteria 2502
105 Ga0075364_10048616 3300006051 Bacteria 2764
106 Ga0075364_10202272 3300006051 Bacteria 1346
107 Ga0075364_10208663 3300006051 Bacteria 1324
108 Ga0075364_10683225 3300006051 Bacteria 701
109 Ga0075369_10032174 3300006186 Bacteria 2218
110 Ga0075369_10361646 3300006186 Bacteria 681
111 Ga0075366_10421996 3300006195 Bacteria 822
112 Ga0097621_100222109 3300006237 Bacteria 1646
113 Ga0075370_10988178 3300006353 Bacteria 516
114 Ga0068871_101351922 3300006358 Bacteria 671
115 Ga0068865_100534181 3300006881 Bacteria 983
116 Ga0097620_100743961 3300006931 Bacteria 1070
117 Ga0105244_10272877 3300009036 Bacteria 785
118 Ga0105244_10576351 3300009036 Bacteria 517
119 Ga0105250_10195966 3300009092 Bacteria 851
120 Ga0111539_11678634 3300009094 Bacteria 737
121 Ga0105245_10059566 3300009098 Bacteria 3438
122 Ga0105245_10078141 3300009098 Bacteria 3019
123 Ga0105245_10116828 3300009098 Bacteria 2488
124 Ga0105245_10388478 3300009098 Bacteria 1392
125 Ga0105247_10161516 3300009101 Bacteria 1484
126 Ga0105247_10252526 3300009101 Bacteria 1206
127 Ga0105247_11306377 3300009101 Bacteria 583
128 Ga0105243_10683988 3300009148 Bacteria 998
129 Ga0105243_10987054 3300009148 Bacteria 844
130 Ga0105243_11658954 3300009148 Bacteria 667
131 Ga0105241_10074305 3300009174 Bacteria 2647
132 Ga0105241_10738320 3300009174 Bacteria 902
133 Ga0105241_11899740 3300009174 Bacteria 583
134 Ga0105242_10262583 3300009176 Bacteria 1560
135 Ga0105242_10413133 3300009176 Bacteria 1262
136 Ga0105242_10643137 3300009176 Bacteria 1030
137 Ga0105248_10096561 3300009177 Bacteria 3329
138 Ga0105248_10150854 3300009177 Bacteria 2622
139 Ga0105248_10372568 3300009177 Bacteria 1607
140 Ga0105248_11187432 3300009177 Bacteria 863
141 Ga0105237_10009127 3300009545 Bacteria 10656
142 Ga0105238_10409424 3300009551 Bacteria 1350
143 Ga0105238_11431897 3300009551 Bacteria 719
144 Ga0105249_10632895 3300009553 Bacteria 1126
145 Ga0105249_11724993 3300009553 Bacteria 699
146 Ga0105249_12478515 3300009553 Bacteria 591
147 Ga0105239_10005526 3300010375 Bacteria 14802
148 Ga0105239_10942334 3300010375 Bacteria 991
149 Ga0105239_11459766 3300010375 Bacteria 790
150 Ga0105246_10813620 3300011119 Bacteria 830
151 Ga0105246_10995822 3300011119 Bacteria 758
152 Ga0105246_11572961 3300011119 Bacteria 620
153 Ga0105246_12571340 3300011119 Bacteria 502
154 Ga0157337_1005161 3300012483 Bacteria 861
155 Ga0157322_1001742 3300012490 Bacteria 1132
156 Ga0157327_1044190 3300012512 Bacteria 611
157 Ga0157326_1022361 3300012513 Bacteria 789
158 Ga0157371_10483286 3300013102 Bacteria 913
159 Ga0157370_10950512 3300013104 Bacteria 779
160 Ga0157370_11509372 3300013104 Bacteria 604
161 Ga0157369_10156154 3300013105 Bacteria 2410
162 Ga0157369_10990050 3300013105 Bacteria 861
163 Ga0157369_12484095 3300013105 Bacteria 525
164 Ga0157374_10290071 3300013296 Bacteria 1617
165 Ga0157374_11027292 3300013296 Bacteria 844
166 Ga0157374_11830770 3300013296 Bacteria 632
167 Ga0157374_12382849 3300013296 Bacteria 557
168 Ga0157378_11790932 3300013297 Bacteria 662
169 Ga0157378_11996588 3300013297 Bacteria 630
170 Ga0157378_12095641 3300013297 Bacteria 616
171 Ga0163162_10127782 3300013306 Bacteria 2649
172 Ga0163162_10882261 3300013306 Bacteria 1008
173 Ga0163162_12321706 3300013306 Bacteria 616
174 Ga0157372_11358944 3300013307 Bacteria 819
175 Ga0157372_11397875 3300013307 Bacteria 807
176 Ga0157372_11521351 3300013307 Bacteria 771
177 Ga0157372_12980673 3300013307 Bacteria 541
178 Ga0157375_10016636 3300013308 Bacteria 6614
179 Ga0157375_10268334 3300013308 Bacteria 1868
180 Ga0157375_11680425 3300013308 Bacteria 751
181 Ga0157375_12579190 3300013308 Bacteria 607
182 Ga0163163_10057195 3300014325 Bacteria 3855
183 Ga0163163_10395536 3300014325 Bacteria 1440
184 Ga0163163_10743846 3300014325 Bacteria 1044
185 Ga0163163_11532606 3300014325 Bacteria 728
186 Ga0157380_10408869 3300014326 Bacteria 1290
187 Ga0157380_11088257 3300014326 Bacteria 838
188 Ga0157380_11921502 3300014326 Bacteria 653
189 Ga0157380_12077116 3300014326 Bacteria 631
190 Ga0157380_12279246 3300014326 Bacteria 606
191 Ga0182008_10724126 3300014497 Bacteria 570
192 Ga0157377_10099821 3300014745 Bacteria 1727
193 Ga0157377_11215011 3300014745 Bacteria 584
194 Ga0157379_10000012 3300014968 Bacteria 110577
195 Ga0157379_10579836 3300014968 Bacteria 1045
196 Ga0157376_10234942 3300014969 Bacteria 1705
197 Ga0163161_11128673 3300017792 Bacteria 675
198 Ga0163161_11297982 3300017792 Bacteria 633
199 Ga0197907_10433734 3300020069 Bacteria 1096
200 Ga0197907_10477661 3300020069 Bacteria 2104
201 Ga0197907_11152397 3300020069 Bacteria 516
202 Ga0206356_10344010 3300020070 Bacteria 3475
203 Ga0206356_11141088 3300020070 Bacteria 4448
204 Ga0206356_11473966 3300020070 Bacteria 2324
205 Ga0206349_1334537 3300020075 Bacteria 709
206 Ga0206349_1527023 3300020075 Bacteria 1001
207 Ga0206349_1563816 3300020075 Bacteria 667
208 Ga0206349_1899702 3300020075 Bacteria 921
209 Ga0206355_1431124 3300020076 Bacteria 811
210 Ga0206355_1519402 3300020076 Bacteria 867
211 Ga0206355_1612783 3300020076 Bacteria 545
212 Ga0206351_10233981 3300020077 Bacteria 673
213 Ga0206351_10393194 3300020077 Bacteria 686
214 Ga0206351_10580594 3300020077 Bacteria 535
215 Ga0206351_10619467 3300020077 Bacteria 1073
216 Ga0206352_10732747 3300020078 Bacteria 804
217 Ga0206352_10762487 3300020078 Bacteria 2048
218 Ga0206352_11111464 3300020078 Bacteria 913
219 Ga0206352_11329365 3300020078 Bacteria 637
220 Ga0206350_10015308 3300020080 Bacteria 744
221 Ga0206350_10952296 3300020080 Bacteria 662
222 Ga0206354_10008953 3300020081 Bacteria 614
223 Ga0206354_10314494 3300020081 Bacteria 529
224 Ga0206354_10395367 3300020081 Bacteria 3493
225 Ga0206354_10448514 3300020081 Bacteria 3241
226 Ga0206354_10954251 3300020081 Bacteria 2646
227 Ga0206353_10604234 3300020082 Bacteria 2528
228 Ga0206353_10689809 3300020082 Bacteria 3757
229 Ga0206353_11202414 3300020082 Bacteria 1066
230 Ga0206353_11207679 3300020082 Bacteria 2102
231 Ga0154015_1295976 3300020610 Bacteria 569
232 Ga0154015_1675542 3300020610 Bacteria 593
233 Ga0213874_10080966 3300021377 Bacteria 1052
234 Ga0224712_10023353 3300022467 Bacteria 2146
235 Ga0224712_10040311 3300022467 Bacteria 1756
236 Ga0224712_10086555 3300022467 Bacteria 1304
237 Ga0224712_10528619 3300022467 Bacteria 572
238 Ga0207426_1005083 3300025302 Bacteria 6146
239 Ga0207642_10194015 3300025899 Bacteria 1117
240 Ga0207710_10331840 3300025900 Bacteria 772
241 Ga0207710_10333422 3300025900 Bacteria 771
242 Ga0207688_10159887 3300025901 Bacteria 1335
243 Ga0207688_10291667 3300025901 Bacteria 996
244 Ga0207688_10509774 3300025901 Bacteria 754
245 Ga0207688_10820536 3300025901 Bacteria 589
246 Ga0207685_10425936 3300025905 Bacteria 685
247 Ga0207699_10406267 3300025906 Bacteria 971
248 Ga0207645_10336741 3300025907 Bacteria 1008
249 Ga0207643_10187159 3300025908 Bacteria 1255
250 Ga0207671_10006629 3300025914 Bacteria 10272
251 Ga0207663_10375064 3300025916 Bacteria 1082
252 Ga0207660_10438245 3300025917 Bacteria 1055
253 Ga0207662_11366387 3300025918 Bacteria 503
254 Ga0207657_10200846 3300025919 Bacteria 1604
255 Ga0207657_10758866 3300025919 Bacteria 751
256 Ga0207649_11014735 3300025920 Bacteria 653
257 Ga0207652_10917546 3300025921 Bacteria 773
258 Ga0207652_11159145 3300025921 Bacteria 674
259 Ga0207694_10412143 3300025924 Bacteria 1125
260 Ga0207694_11227433 3300025924 Bacteria 634
261 Ga0207694_11451090 3300025924 Bacteria 579
262 Ga0207650_10769763 3300025925 Bacteria 815
263 Ga0207650_10933591 3300025925 Bacteria 737
264 Ga0207659_10867105 3300025926 Bacteria 776
265 Ga0207687_10020152 3300025927 Bacteria 4423
266 Ga0207687_10623126 3300025927 Bacteria 911
267 Ga0207687_10709849 3300025927 Bacteria 854
268 Ga0207700_10020037 3300025928 Bacteria 4532
269 Ga0207664_10340891 3300025929 Bacteria 1325
270 Ga0207664_10666031 3300025929 Bacteria 936
271 Ga0207664_11664844 3300025929 Bacteria 560
272 Ga0207644_10268217 3300025931 Bacteria 1367
273 Ga0207690_10460364 3300025932 Bacteria 1023
274 Ga0207690_11111234 3300025932 Bacteria 659
275 Ga0207690_11444636 3300025932 Bacteria 575
276 Ga0207690_11650152 3300025932 Bacteria 536
277 Ga0207706_10613371 3300025933 Bacteria 934
278 Ga0207686_10310339 3300025934 Bacteria 1175
279 Ga0207686_10672721 3300025934 Bacteria 821
280 Ga0207709_10027907 3300025935 Bacteria 3258
281 Ga0207709_11655727 3300025935 Bacteria 532
282 Ga0207670_10534365 3300025936 Bacteria 956
283 Ga0207670_11317845 3300025936 Bacteria 612
284 Ga0207669_10564610 3300025937 Bacteria 920
285 Ga0207669_11398796 3300025937 Bacteria 596
286 Ga0207665_11137336 3300025939 Bacteria 623
287 Ga0207691_10097609 3300025940 Bacteria 2626
288 Ga0207711_10006894 3300025941 Bacteria 9541
289 Ga0207711_10377122 3300025941 Bacteria 1316
290 Ga0207711_10548816 3300025941 Bacteria 1078
291 Ga0207661_10127477 3300025944 Bacteria 2175
292 Ga0207661_11804645 3300025944 Bacteria 557
293 Ga0207661_11938976 3300025944 Bacteria 535
294 Ga0207679_10943575 3300025945 Bacteria 790
295 Ga0207667_10075039 3300025949 Bacteria 3512
296 Ga0207667_11504646 3300025949 Bacteria 644
297 Ga0207651_12109538 3300025960 Bacteria 506
298 Ga0207712_10076377 3300025961 Bacteria 2425
299 Ga0207712_11805054 3300025961 Bacteria 548
300 Ga0207668_10057966 3300025972 Bacteria 2704
301 Ga0207677_10702486 3300026023 Bacteria 897
302 Ga0207677_10877598 3300026023 Bacteria 807
303 Ga0207677_11331521 3300026023 Bacteria 660
304 Ga0207703_10000009 3300026035 Bacteria 343983
305 Ga0207703_10194578 3300026035 Bacteria 1798
306 Ga0207703_10326404 3300026035 Bacteria 1407
307 Ga0207639_12078028 3300026041 Bacteria 529
308 Ga0207678_10545886 3300026067 Bacteria 1013
309 Ga0207678_10611791 3300026067 Bacteria 956
310 Ga0207678_11371858 3300026067 Bacteria 625
311 Ga0207678_11828408 3300026067 Bacteria 531
312 Ga0207708_11452155 3300026075 Bacteria 602
313 Ga0207708_11694808 3300026075 Bacteria 555
314 Ga0207702_10244783 3300026078 Bacteria 1681
315 Ga0207702_10578113 3300026078 Bacteria 1101
316 Ga0207648_10078394 3300026089 Bacteria 2882
317 Ga0207648_10717003 3300026089 Bacteria 927
318 Ga0207648_11616099 3300026089 Bacteria 609
319 Ga0207648_12065211 3300026089 Bacteria 531
320 Ga0207676_10825903 3300026095 Bacteria 905
321 Ga0207676_12386186 3300026095 Bacteria 526
322 Ga0207674_10310004 3300026116 Bacteria 1527
323 Ga0207674_10357195 3300026116 Bacteria 1412
324 Ga0207674_11370290 3300026116 Bacteria 677
325 Ga0207675_100689343 3300026118 Bacteria 1030
326 Ga0207675_100829545 3300026118 Bacteria 939
327 Ga0207683_10080520 3300026121 Bacteria 2889
328 Ga0207683_10527233 3300026121 Bacteria 1092
329 Ga0207683_10885094 3300026121 Bacteria 829
330 Ga0207683_11631060 3300026121 Bacteria 594
331 Ga0207698_10273345 3300026142 Bacteria 1559
332 Ga0207698_10346174 3300026142 Bacteria 1402
333 Ga0268266_10027754 3300028379 Bacteria 4813
334 Ga0268266_10099981 3300028379 Bacteria 2554
335 Ga0268266_10867680 3300028379 Bacteria 872
336 Ga0268265_10042371 3300028380 Bacteria 3377
337 Ga0268264_10198362 3300028381 Bacteria 1834
338 Ga0307517_10001351 3300028786 Bacteria 41147
339 Ga0307517_10156088 3300028786 Bacteria 1548
340 Ga0307515_10001812 3300028794 Bacteria 47673
341 Ga0310981_1091162 3300029285 Bacteria 761
342 Ga0268256_1062540 3300030500 Bacteria 742
343 Ga0307511_10108881 3300030521 Bacteria 1775
344 Ga0307511_10285694 3300030521 Bacteria 758
345 Ga0307512_10207419 3300030522 Bacteria 1048
346 Ga0307509_10011154 3300031507 Bacteria 10930
347 Ga0307509_10012707 3300031507 Bacteria 10038
348 Ga0307509_10256568 3300031507 Bacteria 1527
349 Ga0307408_100606623 3300031548 Bacteria 973
350 Ga0307508_10000924 3300031616 Bacteria 34111
351 Ga0307508_10003351 3300031616 Bacteria 16261
352 Ga0307508_10012942 3300031616 Bacteria 7628
353 Ga0307508_10097570 3300031616 Bacteria 2531
354 Ga0307508_10263909 3300031616 Bacteria 1316
355 Ga0307514_10107474 3300031649 Bacteria 1987
356 Ga0307516_10039371 3300031730 Bacteria 4712
357 Ga0307516_10045595 3300031730 Bacteria 4329
358 Ga0307516_10190827 3300031730 Bacteria 1775
359 Ga0307405_10100649 3300031731 Bacteria 1937
360 Ga0307405_10147227 3300031731 Bacteria 1651
361 Ga0307405_10541356 3300031731 Bacteria 940
362 Ga0307413_10082563 3300031824 Bacteria 2065
363 Ga0307413_10091348 3300031824 Bacteria 1983
364 Ga0307413_10860122 3300031824 Bacteria 767
365 Ga0307410_10352523 3300031852 Bacteria 1176
366 Ga0326468_10001555 3300031889 Bacteria 1973
367 Ga0307406_10030532 3300031901 Bacteria 3273
368 Ga0307406_10058669 3300031901 Bacteria 2474
369 Ga0307407_10087218 3300031903 Bacteria 1903
370 Ga0307412_11003713 3300031911 Bacteria 738
371 Ga0307409_100142156 3300031995 Bacteria 2069
372 Ga0307409_100354129 3300031995 Bacteria 1386
373 Ga0307409_100452788 3300031995 Bacteria 1239
374 Ga0307409_100640842 3300031995 Bacteria 1055
375 Ga0307409_102710985 3300031995 Bacteria 524
376 Ga0307416_100096719 3300032002 Bacteria 2554
377 Ga0307416_100587117 3300032002 Bacteria 1192
378 Ga0307416_100750823 3300032002 Bacteria 1068
379 Ga0307416_101733795 3300032002 Bacteria 729
380 Ga0307414_10679703 3300032004 Bacteria 930
381 Ga0307411_10082097 3300032005 Bacteria 2222
382 Ga0307411_12138770 3300032005 Bacteria 524
383 Ga0307415_100074865 3300032126 Bacteria 2394
384 Ga0307415_100145656 3300032126 Bacteria 1815
385 Ga0307415_100285088 3300032126 Bacteria 1360
386 Ga0307415_100517647 3300032126 Bacteria 1046
387 Ga0307507_10000482 3300033179 Bacteria 83990
388 Ga0307507_10096663 3300033179 Bacteria 2497
389 Ga0307507_10120549 3300033179 Bacteria 2100
390 Ga0307507_10444868 3300033179 Bacteria 718
391 Ga0307510_10095977 3300033180 Bacteria 2783
392 Ga0307510_10106134 3300033180 Bacteria 2574
393 Ga0307510_10136518 3300033180 Bacteria 2109
394 Ga0316214_1026290 3300033545 Bacteria 820
395 Ga0373949_0069568 3300035090 Bacteria 920
396 Ga0373951_0000463 3300035091 Bacteria 11707
397 Ga0373941_0239828 3300035115 Bacteria 704
398 Ga0373945_0273118 3300035116 Bacteria 719
399 Ga0373960_0108571 3300035121 Bacteria 908
400 Ga0373935_0022806 3300035692 Bacteria 3843
401 Ga0373925_0389249 3300037068 Bacteria 1136
402 Ga0395900_0050861 3300037418 Bacteria 4268
403 Ga0395898_0953350 3300037466 Bacteria 795
404 Ga0395905_0764432 3300037471 Bacteria 869
405 Ga0436364_0164890 3300037853 Bacteria 592
406 Ga0436364_1556898 3300037853 Bacteria 865
407 Ga0395901_0808086 3300038443 Bacteria 926
408 Ga0436365_0905729 3300039437 Bacteria 13103
409 Ga0436363_0026914 3300039450 Bacteria 1052
410 Ga0436363_0492081 3300039450 Bacteria 669
411 Ga0439461_0000353 3300041410 Bacteria 6532
412 Ga0439466_0001023 3300041411 Bacteria 10766
413 Ga0439465_0003128 3300041413 Bacteria 5402
414 Ga0439465_0367819 3300041413 Bacteria 545
415 Ga0451787_802906 3300041441 Bacteria 538
416 Ga0451789_0187238 3300041443 Bacteria 755
417 Ga0451789_1330385 3300041443 Bacteria 2034
418 Ga0451790_07178 3300041444 Bacteria 1719
419 Ga0451794_25357 3300041446 Bacteria 1138
420 Ga0451791_1814107 3300041451 Bacteria 987
421 Ga0451793_0621849 3300041452 Bacteria 588
422 Ga0451793_1066416 3300041452 Bacteria 1069
423 Ga0451797_0774478 3300041453 Bacteria 588
424 Ga0451797_0864649 3300041453 Bacteria 1122
425 Ga0451797_1211872 3300041453 Bacteria 1347
426 Ga0451795_1621111 3300041456 Bacteria 781
427 Ga0451800_0489214 3300041459 Bacteria 553
428 Ga0451802_1113913 3300041460 Bacteria 621
429 Ga0451802_1643678 3300041460 Bacteria 1320
430 Ga0451804_0462733 3300041463 Bacteria 562
431 Ga0451807_0482340 3300041486 Bacteria 545
432 Ga0451807_1220677 3300041486 Bacteria 1168
433 Ga0451833_0393181 3300041491 Bacteria 2121
434 Ga0451837_1730739 3300041494 Bacteria 811
435 Ga0451839_0406887 3300041496 Bacteria 645
436 Ga0451841_0603908 3300041498 Bacteria 1351
437 Ga0451843_0866875 3300041509 Bacteria 2401
438 Ga0451855_0151320 3300041511 Bacteria 635
439 Ga0451853_0729236 3300041512 Bacteria 5080
440 Ga0451853_1021921 3300041512 Bacteria 512
441 Ga0439431_0000355 3300041997 Bacteria 9648
442 Ga0439433_0051694 3300041999 Bacteria 970
443 Ga0439445_0000630 3300042004 Bacteria 7241
444 Ga0439463_074968 3300042016 Bacteria 868
445 Ga0439458_0138275 3300042157 Bacteria 648
446 Ga0439434_0063102 3300042435 Bacteria 1160
447 Ga0439459_0101286 3300042438 Bacteria 705
448 Ga0451577_0513648 3300042876 Bacteria 1088
449 Ga0451577_0518485 3300042876 Bacteria 1082
450 Ga0466969_0018916 3300044656 Bacteria 3586
451 Ga0466972_0004559 3300044658 Bacteria 6941
452 Ga0466972_0261256 3300044658 Bacteria 809
453 Ga0466972_0526363 3300044658 Bacteria 557
454 Ga0466965_0001377 3300044683 Bacteria 9751
455 Ga0466965_0009434 3300044683 Bacteria 4536
456 Ga0466966_0003375 3300044684 Bacteria 10524
457 Ga0466966_0043302 3300044684 Bacteria 2886
458 Ga0466966_0170526 3300044684 Bacteria 1322
459 Ga0466961_0030780 3300044693 Bacteria 3448
460 Ga0466961_0037140 3300044693 Bacteria 3125
461 Ga0466961_0491407 3300044693 Bacteria 741
462 Ga0466963_0187646 3300044694 Bacteria 1444
463 Ga0466964_0299145 3300044706 Bacteria 811
464 Ga0466964_0549402 3300044706 Bacteria 627
465 Ga0453684_1418889 3300044712 Bacteria 719
466 Ga0466971_0000675 3300044719 Bacteria 13616
467 Ga0466971_0123465 3300044719 Bacteria 1199
468 Ga0466971_0136311 3300044719 Bacteria 1142
469 Ga0466971_0513118 3300044719 Bacteria 592
470 Ga0466968_0028149 3300044735 Bacteria 2316
471 Ga0466968_0212703 3300044735 Bacteria 909
472 Ga0466970_0001021 3300044765 Bacteria 13508
473 Ga0466970_0206977 3300044765 Bacteria 1092
474 Ga0466970_0797442 3300044765 Bacteria 553
475 Ga0466970_0837813 3300044765 Bacteria 539
476 Ga0466970_0964420 3300044765 Bacteria 503
477 Ga0466957_0001124 3300044842 Bacteria 13849
478 Ga0466957_0074145 3300044842 Bacteria 2110
479 Ga0466957_0089846 3300044842 Bacteria 1923
480 Ga0466957_0650656 3300044842 Bacteria 741
481 Ga0466960_0002753 3300044901 Bacteria 6654
482 Ga0466959_0003800 3300045049 Bacteria 10015
483 Ga0466959_0015907 3300045049 Bacteria 5489
484 Ga0466959_0025593 3300045049 Bacteria 4375
485 Ga0466959_0041912 3300045049 Bacteria 3378
486 Ga0466959_0677759 3300045049 Bacteria 691
487 Ga0466958_0011830 3300045836 Bacteria 4927
488 Ga0466958_0026511 3300045836 Bacteria 3425
489 Ga0466967_0007609 3300045976 Bacteria 7833
490 Ga0466967_0101371 3300045976 Bacteria 2631
491 Ga0466967_0238227 3300045976 Bacteria 1735
492 Ga0466967_0363566 3300045976 Bacteria 1402
493 Ga0495627_039442 3300046453 Bacteria 1457
494 Ga0495627_100262 3300046453 Bacteria 827
495 Ga0495592_0005017 3300046454 Bacteria 9736
496 Ga0495592_0008230 3300046454 Bacteria 7828
497 Ga0495603_0159931 3300046455 Bacteria 1306
498 Ga0495603_0206622 3300046455 Bacteria 1135
499 Ga0495590_0211305 3300046457 Bacteria 715
500 Ga0495629_0060688 3300046459 Bacteria 2642
501 Ga0495629_0099847 3300046459 Bacteria 2025
502 Ga0495629_0201351 3300046459 Bacteria 1376
503 Ga0495638_0154030 3300046460 Bacteria 1331
504 Ga0495651_0000169 3300046462 Bacteria 48128
505 Ga0495651_0005300 3300046462 Bacteria 9832
506 Ga0495639_0174429 3300046475 Bacteria 1045
507 Ga0495662_0096445 3300046476 Bacteria 1445
508 Ga0495664_0030225 3300046477 Bacteria 3172
509 Ga0495664_0082835 3300046477 Bacteria 1924
510 Ga0495584_0119624 3300046491 Bacteria 1334
511 Ga0495585_0102174 3300046492 Bacteria 1532
512 Ga0495585_0147735 3300046492 Bacteria 1227
513 Ga0495594_0060133 3300046499 Bacteria 2101
514 Ga0495594_0308584 3300046499 Bacteria 901
515 Ga0495608_0060019 3300046511 Bacteria 2504
516 Ga0495608_0756532 3300046511 Bacteria 575
517 Ga0495618_0004578 3300046514 Bacteria 8485
518 Ga0495618_0078305 3300046514 Bacteria 2107
519 Ga0495620_0158527 3300046515 Bacteria 880
520 Ga0495628_0062544 3300046516 Bacteria 2917
521 Ga0495628_0262913 3300046516 Bacteria 1285
522 Ga0495630_0095803 3300046517 Bacteria 2244
523 Ga0495632_0010084 3300046519 Bacteria 5626
524 Ga0495643_0003566 3300046522 Bacteria 11309
525 Ga0495666_0065533 3300046526 Bacteria 1732
526 Ga0495642_0072089 3300046528 Bacteria 1446
527 Ga0495652_0001361 3300046529 Bacteria 27215
528 Ga0495652_0006542 3300046529 Bacteria 10830
529 Ga0495652_0549370 3300046529 Bacteria 794
530 Ga0495640_0007026 3300046533 Bacteria 8862
531 Ga0495586_0673227 3300046535 Bacteria 598
532 Ga0495587_0033543 3300046536 Bacteria 3099
533 Ga0495598_0085680 3300046537 Bacteria 1019
534 Ga0495621_0166726 3300046539 Bacteria 874
535 Ga0495645_0013381 3300046543 Bacteria 5798
536 Ga0495622_0019219 3300046557 Bacteria 3182
537 Ga0495633_0035752 3300046558 Bacteria 2384
538 Ga0495667_0034127 3300046559 Bacteria 3401
539 Ga0495667_0343976 3300046559 Bacteria 943
540 Ga0495656_0044151 3300046615 Bacteria 1875
541 Ga0495634_0003443 3300046642 Bacteria 12687
542 Ga0495634_0121401 3300046642 Bacteria 1673
543 Ga0495611_0048818 3300046648 Bacteria 1903
544 Ga0495635_0010690 3300046663 Bacteria 6426
545 Ga0495635_1068681 3300046663 Bacteria 512
546 Ga0495588_0032147 3300046674 Bacteria 2643
547 Ga0495657_0004038 3300046675 Bacteria 11767
548 Ga0495623_0003245 3300046679 Bacteria 10749
549 Ga0495623_0004870 3300046679 Bacteria 8804
550 Ga0495623_0420944 3300046679 Bacteria 716
551 Ga0495646_0008701 3300046680 Bacteria 6449
552 Ga0495658_0040123 3300046683 Bacteria 2601
553 Ga0495613_0005971 3300046689 Bacteria 9111
554 Ga0495613_0209276 3300046689 Bacteria 1372
555 Ga0495624_0059145 3300046690 Bacteria 2405
556 Ga0495670_0007585 3300046691 Bacteria 5334
557 Ga0495671_0120169 3300046692 Bacteria 1282
558 Ga0495600_0007794 3300046809 Bacteria 6556
559 Ga0495600_0039421 3300046809 Bacteria 3076
560 Ga0495600_0373910 3300046809 Bacteria 890
561 Ga0495600_0721783 3300046809 Bacteria 598
562 Ga0495660_0002768 3300046810 Bacteria 11062
563 Ga0495604_0003385 3300047317 Bacteria 12717
564 Ga0495604_0004624 3300047317 Bacteria 10906
565 Ga0495604_0617798 3300047317 Bacteria 694
566 Ga0495604_0800277 3300047317 Bacteria 594
567 Ga0495636_0182572 3300047318 Bacteria 953
568 Ga0495636_0498302 3300047318 Bacteria 589
569 Ga0495676_0015246 3300047321 Bacteria 6851
570 Ga0495676_0879911 3300047321 Bacteria 574
571 Ga0495680_0125418 3300047322 Bacteria 1892
572 Ga0495680_0673789 3300047322 Bacteria 685
573 Ga0495680_1052841 3300047322 Bacteria 517
574 Ga0495683_0013097 3300047323 Bacteria 4342
575 Ga0495687_025550 3300047443 Bacteria 2789
576 Ga0495687_259525 3300047443 Bacteria 514
577 Ga0495675_0001497 3300047444 Bacteria 14149
578 Ga0495675_0088539 3300047444 Bacteria 1944
579 Ga0495675_0089338 3300047444 Bacteria 1934
580 Ga0495675_0225518 3300047444 Bacteria 1132
581 Ga0495675_0435149 3300047444 Bacteria 760
582 Ga0495677_0116944 3300047445 Bacteria 1016
583 Ga0495679_019249 3300047446 Bacteria 2403
584 Ga0495685_000455 3300047447 Bacteria 12772
585 Ga0495685_013987 3300047447 Bacteria 2723
586 Ga0495681_0001916 3300047470 Bacteria 15254
587 Ga0495681_0305262 3300047470 Bacteria 615
588 Ga0495686_0041778 3300047472 Bacteria 2918
589 Ga0495602_0070215 3300048088 Bacteria 2999
590 Ga0495614_0076371 3300048089 Bacteria 1448
591 Ga0496100_0035427 3300048903 Bacteria 3139
592 Ga0496100_0059373 3300048903 Bacteria 2513
593 Ga0496100_1238589 3300048903 Bacteria 589
594 Ga0496101_0000075 3300048904 Bacteria 112785
595 Ga0496101_0011872 3300048904 Bacteria 5799
596 Ga0496101_0023265 3300048904 Bacteria 4279
597 Ga0496101_0488628 3300048904 Bacteria 972
598 Ga0496102_0000003 3300048905 Bacteria 592263
599 Ga0496102_0067122 3300048905 Bacteria 3289
600 Ga0496102_0096537 3300048905 Bacteria 2740
601 Ga0496102_0577213 3300048905 Bacteria 1047
602 Ga0496103_0000014 3300048906 Bacteria 290397
603 Ga0496104_0093759 3300048907 Bacteria 2872
604 Ga0496104_0096185 3300048907 Bacteria 2833
605 Ga0496104_0117995 3300048907 Bacteria 2547
606 Ga0496105_0269046 3300048908 Bacteria 1377
607 Ga0496105_0832106 3300048908 Bacteria 700
608 Ga0496106_0138601 3300048909 Bacteria 1912
609 Ga0496106_0147980 3300048909 Bacteria 1851
610 Ga0496107_0061966 3300048910 Bacteria 2709
611 Ga0496107_1119752 3300048910 Bacteria 568
612 Ga0496107_1382665 3300048910 Bacteria 501
613 Ga0496108_0085000 3300048911 Bacteria 2685
614 Ga0496108_0253120 3300048911 Bacteria 1532
615 Ga0496108_0360301 3300048911 Bacteria 1269
616 Ga0496108_0462748 3300048911 Bacteria 1108
617 Ga0496109_0058771 3300048912 Bacteria 3512
618 Ga0496109_0165475 3300048912 Bacteria 2073
619 Ga0496109_0181473 3300048912 Bacteria 1977
620 Ga0496109_0540907 3300048912 Bacteria 1099
621 Ga0496110_0085776 3300048913 Bacteria 2810
622 Ga0496110_0275300 3300048913 Bacteria 1533
623 Ga0496111_0039375 3300048914 Bacteria 3388
624 Ga0496112_0011626 3300048915 Bacteria 8051
625 Ga0496112_0155384 3300048915 Bacteria 2254
626 Ga0496113_0003233 3300048916 Bacteria 9720
627 Ga0496113_0018053 3300048916 Bacteria 4908
628 Ga0496114_0009605 3300048917 Bacteria 7684
629 Ga0496114_0020960 3300048917 Bacteria 5309
630 Ga0496114_0535943 3300048917 Bacteria 1035
631 Ga0496115_0326798 3300048918 Bacteria 1254
632 Ga0496116_0000071 3300048919 Bacteria 244521
633 Ga0496117_0000003 3300048920 Bacteria 1881097
634 Ga0496118_0000001 3300048921 Bacteria 1881100
635 Ga0496119_0000527 3300048922 Bacteria 52100
636 Ga0496119_0121327 3300048922 Bacteria 1436
637 Ga0496119_0181343 3300048922 Bacteria 1104
638 Ga0496120_0000235 3300048923 Bacteria 94653
639 Ga0496121_0000019 3300048924 Bacteria 499976
640 Ga0496122_0015410 3300048925 Bacteria 7309
641 Ga0496123_0006264 3300048926 Bacteria 11592
642 Ga0496126_0000951 3300048929 Bacteria 49637
643 Ga0496126_0011441 3300048929 Bacteria 9184
644 Ga0496126_0020119 3300048929 Bacteria 6552
645 Ga0496126_0432601 3300048929 Bacteria 1062
646 Ga0496126_0495762 3300048929 Bacteria 977
647 Ga0496126_1242094 3300048929 Bacteria 546
648 Ga0496126_1308979 3300048929 Bacteria 527
649 Ga0501306_008396 3300049127 Bacteria 1259
650 Ga0501306_030508 3300049127 Bacteria 799
651 Ga0501308_020253 3300049128 Bacteria 827
652 Ga0501309_013241 3300049129 Bacteria 1095
653 Ga0501309_044144 3300049129 Bacteria 687
654 Ga0501310_021149 3300049130 Bacteria 812
655 Ga0501304_040726 3300049160 Bacteria 518
656 Ga0501305_022556 3300049161 Bacteria 937
657 Ga0501307_036495 3300049162 Bacteria 701
658 Ga0501307_053000 3300049162 Bacteria 614
659 Ga0501311_014031 3300049527 Bacteria 1019
660 Ga0501311_101720 3300049527 Bacteria 509
661 Ga0501312_023268 3300049528 Bacteria 932
662 Ga0501312_053178 3300049528 Bacteria 687
663 Ga0501312_075695 3300049528 Bacteria 603
664 Ga0501314_001561 3300049530 Bacteria 1674
665 Ga0501315_100865 3300049531 Bacteria 510
666 Ga0501316_006966 3300049532 Bacteria 1217
667 Ga0501316_008288 3300049532 Bacteria 1145
668 Ga0501317_013188 3300049533 Bacteria 1030
669 Ga0501317_013275 3300049533 Bacteria 1028
670 Ga0501317_050835 3300049533 Bacteria 658
671 Ga0501318_012530 3300049534 Bacteria 974
672 Ga0501321_005201 3300049537 Bacteria 1277
673 Ga0501321_061930 3300049537 Bacteria 567
674 Ga0501324_014639 3300049540 Bacteria 754
675 Ga0501324_047228 3300049540 Bacteria 503
676 Ga0501325_011299 3300049541 Bacteria 823
677 Ga0501336_025574 3300049552 Bacteria 559
678 Ga0501031_0003261 3300049568 Bacteria 10426
679 Ga0501032_0001347 3300049569 Bacteria 19514
680 Ga0501032_0221765 3300049569 Bacteria 1230
681 Ga0501032_0650407 3300049569 Bacteria 669
682 Ga0501033_0005545 3300049570 Bacteria 9978
683 Ga0501034_0011756 3300049571 Bacteria 9058
684 Ga0501034_0177975 3300049571 Bacteria 2092
685 Ga0501036_0074674 3300049572 Bacteria 2867
686 Ga0501036_0302136 3300049572 Bacteria 1338
687 Ga0501037_0004030 3300049573 Bacteria 10649
688 Ga0501037_0392039 3300049573 Bacteria 953
689 Ga0501038_0007465 3300049574 Bacteria 10087
690 Ga0501038_0130009 3300049574 Bacteria 2068
691 Ga0501038_0992853 3300049574 Bacteria 617
692 Ga0501039_0003016 3300049575 Bacteria 12590
693 Ga0501039_0341118 3300049575 Bacteria 1177
694 Ga0501040_0002706 3300049576 Bacteria 11426
695 Ga0501040_0047321 3300049576 Bacteria 2938
696 Ga0501041_0002671 3300049577 Bacteria 10179
697 Ga0501041_0723543 3300049577 Bacteria 637
698 Ga0501042_0073359 3300049578 Bacteria 2448
699 Ga0501042_0088501 3300049578 Bacteria 2221
700 Ga0501042_0736570 3300049578 Bacteria 717
701 Ga0501043_0028012 3300049579 Bacteria 4421
702 Ga0501043_0274529 3300049579 Bacteria 1293
703 Ga0501046_0002011 3300049580 Bacteria 19297
704 Ga0501046_0473748 3300049580 Bacteria 899
705 Ga0501047_0000278 3300049581 Bacteria 59271
706 Ga0501047_0008040 3300049581 Bacteria 9951
707 Ga0501047_0119157 3300049581 Bacteria 2521
708 Ga0501047_0220639 3300049581 Bacteria 1752
709 Ga0501048_0001026 3300049582 Bacteria 20878
710 Ga0501067_0000592 3300049583 Bacteria 19503
711 Ga0501068_0003271 3300049584 Bacteria 8684
712 Ga0501069_0005589 3300049585 Bacteria 6539
713 Ga0501070_0004123 3300049586 Bacteria 12503
714 Ga0501071_0045415 3300049587 Bacteria 3153
715 Ga0501072_0001152 3300049588 Bacteria 19660
716 Ga0501072_0054085 3300049588 Bacteria 3162
717 Ga0501073_0004460 3300049589 Bacteria 10515
718 Ga0501074_0003829 3300049590 Bacteria 10704
719 Ga0501074_0881490 3300049590 Bacteria 630
720 Ga0501075_0343782 3300049591 Bacteria 1137
721 Ga0501076_0010773 3300049592 Bacteria 6796
722 Ga0501077_0031876 3300049593 Bacteria 3353
723 Ga0501221_200839 3300049704 Bacteria 554
724 Ga0501079_0007489 3300049741 Bacteria 8256
725 Ga0501080_0091006 3300049742 Bacteria 2833
726 Ga0501080_0144771 3300049742 Bacteria 2197
727 Ga0501083_0008844 3300049744 Bacteria 7110
728 Ga0501035_0097200 3300049822 Bacteria 2586
729 Ga0501035_0122555 3300049822 Bacteria 2271
730 Ga0501044_0010423 3300049823 Bacteria 10087
731 Ga0501044_0301918 3300049823 Bacteria 1529
732 Ga0501044_1015399 3300049823 Bacteria 701
733 Ga0501045_0005656 3300049824 Bacteria 8648
734 Ga0501045_0366432 3300049824 Bacteria 1072
735 nmdc:mga03683_482660_c1 3300050489 Bacteria 599
736 nmdc:mga03n38_128391_c1 3300050490 Bacteria 1254
737 nmdc:mga00v17_286344_c1 3300050491 Bacteria 1070
738 nmdc:mga00v17_326959_c1 3300050491 Bacteria 996
739 nmdc:mga00v17_361571_c1 3300050491 Bacteria 944
740 nmdc:mga00v17_452689_c1 3300050491 Bacteria 833
741 nmdc:mga00v17_64510_c1 3300050491 Bacteria 2257
742 nmdc:mga00v17_72839_c1 3300050491 Bacteria 2132
743 nmdc:mga0yw44_21262_c1 3300050492 Bacteria 3616
744 nmdc:mga0yw44_59749_c1 3300050492 Bacteria 2333
745 nmdc:mga07m45_696255_c1 3300050496 Bacteria 584
746 nmdc:mga05p37_64020_c1 3300050507 Bacteria 4524
747 nmdc:mga0rr50_1593263_c1 3300050513 Bacteria 551
748 nmdc:mga0sz30_13994_c1 3300050516 Bacteria 3151
749 nmdc:mga0sz30_86476_c1 3300050516 Bacteria 1361
750 Ga0495601_0044431 3300053077 Bacteria 2792
751 Ga0495612_0001114 3300053078 Bacteria 11005
752 Ga0495655_0105304 3300053083 Bacteria 841
753 Ga0495595_0600755 3300053084 Bacteria 563
754 Ga0495619_0039496 3300053085 Bacteria 3081
755 Ga0500578_0006009 3300053086 Bacteria 8160
756 Ga0500583_0132654 3300053092 Bacteria 1236
757 Ga0500651_0490205 3300053093 Bacteria 679
758 Ga0500566_0009561 3300053094 Bacteria 5727
759 Ga0500654_002699 3300053099 Bacteria 12710
760 Ga0500660_024964 3300053100 Bacteria 3158
761 Ga0500558_064320 3300053106 Bacteria 1525
762 Ga0500560_117181 3300053107 Bacteria 893
763 Ga0500569_000210 3300053109 Bacteria 9330
764 Ga0500580_110091 3300053113 Bacteria 1067
765 Ga0500594_0039080 3300053118 Bacteria 1289
766 Ga0500608_308905 3300053122 Bacteria 582
767 Ga0500614_165070 3300053123 Bacteria 672
768 Ga0500621_092407 3300053126 Bacteria 1202
769 Ga0500628_080887 3300053129 Bacteria 831
770 Ga0500652_001087 3300053131 Bacteria 8784
771 Ga0500658_0002819 3300053134 Bacteria 6668
772 Ga0500659_0289263 3300053135 Bacteria 742
773 Ga0500559_0449843 3300053136 Bacteria 596
774 Ga0500561_0000167 3300053137 Bacteria 12188
775 Ga0500568_0027056 3300053139 Bacteria 2401
776 Ga0500573_0032934 3300053140 Bacteria 2990
777 Ga0500573_0180499 3300053140 Bacteria 1135
778 Ga0500573_0332596 3300053140 Bacteria 745
779 Ga0500577_0183465 3300053142 Bacteria 898
780 Ga0500579_134694 3300053143 Bacteria 1140
781 Ga0500586_242712 3300053145 Bacteria 569
782 Ga0500588_0313911 3300053146 Bacteria 594
783 Ga0500600_0006438 3300053149 Bacteria 7001
784 Ga0500603_051840 3300053150 Bacteria 1125
785 Ga0500616_0004474 3300053153 Bacteria 9936
786 Ga0500616_0006073 3300053153 Bacteria 8012
787 Ga0500627_0195703 3300053158 Bacteria 907
788 Ga0500630_091102 3300053159 Bacteria 1408
789 Ga0500633_0000736 3300053160 Bacteria 5570
790 Ga0500634_0024229 3300053161 Bacteria 3300
791 Ga0500636_0215330 3300053177 Bacteria 1005
792 Ga0500636_0313595 3300053177 Bacteria 766
793 Ga0500656_000179 3300053732 Bacteria 4156
794 Ga0500587_000176 3300053739 Bacteria 6411
795 Ga0500587_012825 3300053739 Bacteria 1057
796 Ga0501084_0001550 3300054114 Bacteria 18271
797 Ga0587084_020265 3300059477 Bacteria 987
798 Ga0587084_033914 3300059477 Bacteria 836
799 Ga0587073_0074026 3300059492 Bacteria 830
800 Ga0587073_0078929 3300059492 Bacteria 813
801 Ga0587073_0116826 3300059492 Bacteria 715
802 Ga0587077_085610 3300059493 Bacteria 732
803 Ga0587077_113410 3300059493 Bacteria 667
804 Ga0587080_099869 3300059503 Bacteria 620
805 Ga0587082_022401 3300059504 Bacteria 1039
806 Ga0587083_0206547 3300059505 Bacteria 564
807 Ga0587085_178273 3300059506 Bacteria 508
808 Ga0587088_042869 3300059508 Bacteria 859
809 Ga0587090_028502 3300059510 Bacteria 920
810 Ga0587090_082861 3300059510 Bacteria 645
811 Ga0587092_044616 3300059512 Bacteria 783
812 Ga0587098_005666 3300059604 Bacteria 1235
813 Ga0587098_007546 3300059604 Bacteria 1135
814 Ga0587106_009824 3300059605 Bacteria 1226
815 Ga0587125_038170 3300059607 Bacteria 639
816 Ga0587129_006660 3300059608 Bacteria 821
817 Ga0587101_032470 3300059623 Bacteria 822
818 Ga0587109_046161 3300059624 Bacteria 880
819 Ga0587117_028126 3300059627 Bacteria 831
820 Ga0587067_023577 3300059640 Bacteria 1080
821 Ga0587067_028532 3300059640 Bacteria 1014
822 Ga0587072_107055 3300059643 Bacteria 634
823 Ga0587079_076859 3300059647 Bacteria 756
824 Ga0587100_018129 3300059648 Bacteria 666
825 Ga0587102_015709 3300059649 Bacteria 807
826 Ga0587107_014459 3300059652 Bacteria 1015
827 Ga0587119_018189 3300059658 Bacteria 875
828 Ga0587124_012606 3300059660 Bacteria 783
829 Ga0587071_016330 3300060344 Bacteria 1313
830 Ga0587071_163019 3300060344 Bacteria 562
831 Ga0587111_0001599 3300060346 Bacteria 2785
832 Ga0587111_0082473 3300060346 Bacteria 771
833 Ga0501082_0013322 3300060353 Bacteria 7070
834 Ga0501082_0309796 3300060353 Bacteria 1375
835 Ga0466962_0000160 3300061719 Bacteria 28430
836 Ga0466962_0032722 3300061719 Bacteria 2488
837 Ga0466962_0111398 3300061719 Bacteria 1318
838 Ga0466962_0111769 3300061719 Bacteria 1315
839 Ga0466962_0454679 3300061719 Bacteria 645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100005984 Ga0070667_1000059848 97
2 3300005616 Ga0068852_100025908 Ga0068852_1000259085 97
3 3300009098 Ga0105245_10078141 Ga0105245_100781415 97
4 3300009174 Ga0105241_10074305 Ga0105241_100743054 97
5 3300009177 Ga0105248_10372568 Ga0105248_103725682 97
6 3300041459 Ga0451800_0489214 Ga0451800_0489214_48_344 97
7 3300005329 Ga0070683_101138786 Ga0070683_1011387862 98
8 3300005356 Ga0070674_101177552 Ga0070674_1011775522 98
9 3300005616 Ga0068852_100649273 Ga0068852_1006492732 98
10 3300005842 Ga0068858_100000013 Ga0068858_10000001358 98
11 3300005937 Ga0081455_10106856 Ga0081455_101068562 98
12 3300005937 Ga0081455_10386216 Ga0081455_103862163 98
13 3300005937 Ga0081455_10547032 Ga0081455_105470322 98
14 3300009177 Ga0105248_10096561 Ga0105248_100965612 98
15 3300014325 Ga0163163_10395536 Ga0163163_103955363 98
16 3300014326 Ga0157380_11921502 Ga0157380_119215021 98
17 3300014968 Ga0157379_10000012 Ga0157379_1000001263 98
18 3300020077 Ga0206351_10580594 Ga0206351_105805941 98
19 3300020610 Ga0154015_1675542 Ga0154015_16755421 98
20 3300022467 Ga0224712_10086555 Ga0224712_100865552 98
21 3300025941 Ga0207711_10006894 Ga0207711_1000689411 98
22 3300026035 Ga0207703_10000009 Ga0207703_1000000958 98
23 3300033180 Ga0307510_10106134 Ga0307510_101061343 98
24 3300039450 Ga0436363_0492081 Ga0436363_0492081_267_563 98
25 3300044765 Ga0466970_0797442 Ga0466970_0797442_108_404 98
26 3300049128 Ga0501308_020253 Ga0501308_020253_391_687 98
27 3300053139 Ga0500568_0027056 Ga0500568_0027056_1408_1704 98
28 3300053153 Ga0500616_0006073 Ga0500616_0006073_6333_6629 98
29 3300059607 Ga0587125_038170 Ga0587125_038170_270_569 98
30 3300060344 Ga0587071_163019 Ga0587071_163019_78_374 98
31 3300005340 Ga0070689_100898597 Ga0070689_1008985972 99
32 3300005435 Ga0070714_100233697 Ga0070714_1002336971 99
33 3300005456 Ga0070678_101280762 Ga0070678_1012807622 99
34 3300005457 Ga0070662_101939477 Ga0070662_1019394771 99
35 3300005548 Ga0070665_102611067 Ga0070665_1026110671 99
36 3300005578 Ga0068854_101954602 Ga0068854_1019546022 99
37 3300005616 Ga0068852_101215577 Ga0068852_1012155772 99
38 3300006038 Ga0075365_10006681 Ga0075365_100066819 99
39 3300006038 Ga0075365_10075797 Ga0075365_100757974 99
40 3300006038 Ga0075365_10855404 Ga0075365_108554042 99
41 3300006038 Ga0075365_10948699 Ga0075365_109486992 99
42 3300006048 Ga0075363_100038892 Ga0075363_1000388922 99
43 3300006051 Ga0075364_10048616 Ga0075364_100486162 99
44 3300006051 Ga0075364_10202272 Ga0075364_102022722 99
45 3300006051 Ga0075364_10208663 Ga0075364_102086632 99
46 3300006186 Ga0075369_10032174 Ga0075369_100321743 99
47 3300006186 Ga0075369_10361646 Ga0075369_103616462 99
48 3300006353 Ga0075370_10988178 Ga0075370_109881781 99
49 3300009148 Ga0105243_11658954 Ga0105243_116589542 99
50 3300009176 Ga0105242_10643137 Ga0105242_106431372 99
51 3300009545 Ga0105237_10009127 Ga0105237_100091272 99
52 3300010375 Ga0105239_10005526 Ga0105239_1000552612 99
53 3300011119 Ga0105246_10995822 Ga0105246_109958222 99
54 3300012483 Ga0157337_1005161 Ga0157337_10051612 99
55 3300012490 Ga0157322_1001742 Ga0157322_10017422 99
56 3300012513 Ga0157326_1022361 Ga0157326_10223612 99
57 3300013104 Ga0157370_10950512 Ga0157370_109505122 99
58 3300013105 Ga0157369_12484095 Ga0157369_124840951 99
59 3300013296 Ga0157374_11830770 Ga0157374_118307702 99
60 3300013297 Ga0157378_11790932 Ga0157378_117909322 99
61 3300013297 Ga0157378_11996588 Ga0157378_119965882 99
62 3300013306 Ga0163162_10882261 Ga0163162_108822612 99
63 3300013307 Ga0157372_11358944 Ga0157372_113589442 99
64 3300013308 Ga0157375_11680425 Ga0157375_116804252 99
65 3300020070 Ga0206356_11473966 Ga0206356_114739663 99
66 3300020075 Ga0206349_1563816 Ga0206349_15638162 99
67 3300020081 Ga0206354_10954251 Ga0206354_109542513 99
68 3300020082 Ga0206353_11207679 Ga0206353_112076793 99
69 3300021377 Ga0213874_10080966 Ga0213874_100809662 99
70 3300022467 Ga0224712_10040311 Ga0224712_100403113 99
71 3300025900 Ga0207710_10331840 Ga0207710_103318402 99
72 3300025901 Ga0207688_10820536 Ga0207688_108205362 99
73 3300025914 Ga0207671_10006629 Ga0207671_100066293 99
74 3300025921 Ga0207652_10917546 Ga0207652_109175462 99
75 3300025929 Ga0207664_10666031 Ga0207664_106660312 99
76 3300025936 Ga0207670_10534365 Ga0207670_105343652 99
77 3300025937 Ga0207669_11398796 Ga0207669_113987962 99
78 3300025939 Ga0207665_11137336 Ga0207665_111373362 99
79 3300025944 Ga0207661_11804645 Ga0207661_118046452 99
80 3300025944 Ga0207661_11938976 Ga0207661_119389762 99
81 3300025949 Ga0207667_10075039 Ga0207667_100750394 99
82 3300025949 Ga0207667_11504646 Ga0207667_115046461 99
83 3300026035 Ga0207703_10326404 Ga0207703_103264042 99
84 3300026041 Ga0207639_12078028 Ga0207639_120780282 99
85 3300026089 Ga0207648_12065211 Ga0207648_120652111 99
86 3300026116 Ga0207674_11370290 Ga0207674_113702902 99
87 3300026121 Ga0207683_10527233 Ga0207683_105272332 99
88 3300031731 Ga0307405_10147227 Ga0307405_101472272 99
89 3300031901 Ga0307406_10030532 Ga0307406_100305324 99
90 3300031995 Ga0307409_100452788 Ga0307409_1004527882 99
91 3300032005 Ga0307411_12138770 Ga0307411_121387701 99
92 3300035116 Ga0373945_0273118 Ga0373945_0273118_64_363 99
93 3300037853 Ga0436364_1556898 Ga0436364_1556898_258_560 99
94 3300038443 Ga0395901_0808086 Ga0395901_0808086_572_874 99
95 3300039437 Ga0436365_0905729 Ga0436365_0905729_10006_10308 99
96 3300039450 Ga0436363_0026914 Ga0436363_0026914_296_598 99
97 3300041410 Ga0439461_0000353 Ga0439461_0000353_2514_2816 99
98 3300041411 Ga0439466_0001023 Ga0439466_0001023_4796_5098 99
99 3300041413 Ga0439465_0003128 Ga0439465_0003128_1230_1532 99
100 3300041997 Ga0439431_0000355 Ga0439431_0000355_3697_3999 99
101 3300041999 Ga0439433_0051694 Ga0439433_0051694_615_917 99
102 3300042004 Ga0439445_0000630 Ga0439445_0000630_5974_6276 99
103 3300042435 Ga0439434_0063102 Ga0439434_0063102_699_1001 99
104 3300042876 Ga0451577_0513648 Ga0451577_0513648_105_404 99
105 3300042876 Ga0451577_0518485 Ga0451577_0518485_34_333 99
106 3300044658 Ga0466972_0004559 Ga0466972_0004559_5247_5549 99
107 3300044683 Ga0466965_0001377 Ga0466965_0001377_4256_4558 99
108 3300044712 Ga0453684_1418889 Ga0453684_1418889_405_704 99
109 3300044719 Ga0466971_0136311 Ga0466971_0136311_331_633 99
110 3300044735 Ga0466968_0028149 Ga0466968_0028149_1853_2155 99
111 3300044765 Ga0466970_0001021 Ga0466970_0001021_2738_3040 99
112 3300044842 Ga0466957_0001124 Ga0466957_0001124_6272_6574 99
113 3300044901 Ga0466960_0002753 Ga0466960_0002753_4178_4480 99
114 3300045049 Ga0466959_0015907 Ga0466959_0015907_3215_3517 99
115 3300045976 Ga0466967_0007609 Ga0466967_0007609_2323_2625 99
116 3300045976 Ga0466967_0101371 Ga0466967_0101371_367_669 99
117 3300045976 Ga0466967_0363566 Ga0466967_0363566_942_1244 99
118 3300046453 Ga0495627_100262 Ga0495627_100262_347_649 99
119 3300046663 Ga0495635_1068681 Ga0495635_1068681_99_401 99
120 3300047317 Ga0495604_0800277 Ga0495604_0800277_97_396 99
121 3300047322 Ga0495680_1052841 Ga0495680_1052841_144_443 99
122 3300048903 Ga0496100_0035427 Ga0496100_0035427_2701_3003 99
123 3300048903 Ga0496100_0059373 Ga0496100_0059373_996_1298 99
124 3300048904 Ga0496101_0000075 Ga0496101_0000075_57383_57685 99
125 3300048904 Ga0496101_0011872 Ga0496101_0011872_955_1257 99
126 3300048904 Ga0496101_0023265 Ga0496101_0023265_1963_2265 99
127 3300048905 Ga0496102_0000003 Ga0496102_0000003_226156_226458 99
128 3300048905 Ga0496102_0096537 Ga0496102_0096537_1355_1657 99
129 3300048906 Ga0496103_0000014 Ga0496103_0000014_64158_64460 99
130 3300048907 Ga0496104_0093759 Ga0496104_0093759_1954_2256 99
131 3300048907 Ga0496104_0117995 Ga0496104_0117995_1652_1954 99
132 3300048908 Ga0496105_0269046 Ga0496105_0269046_323_625 99
133 3300048908 Ga0496105_0832106 Ga0496105_0832106_338_640 99
134 3300048910 Ga0496107_0061966 Ga0496107_0061966_35_337 99
135 3300048911 Ga0496108_0462748 Ga0496108_0462748_472_774 99
136 3300048915 Ga0496112_0155384 Ga0496112_0155384_1540_1842 99
137 3300048916 Ga0496113_0003233 Ga0496113_0003233_3307_3609 99
138 3300048919 Ga0496116_0000071 Ga0496116_0000071_225291_225593 99
139 3300048920 Ga0496117_0000003 Ga0496117_0000003_365806_366108 99
140 3300048921 Ga0496118_0000001 Ga0496118_0000001_365809_366111 99
141 3300048922 Ga0496119_0000527 Ga0496119_0000527_15562_15864 99
142 3300048922 Ga0496119_0121327 Ga0496119_0121327_490_792 99
143 3300048923 Ga0496120_0000235 Ga0496120_0000235_18926_19228 99
144 3300048924 Ga0496121_0000019 Ga0496121_0000019_235576_235878 99
145 3300048925 Ga0496122_0015410 Ga0496122_0015410_2692_2994 99
146 3300048926 Ga0496123_0006264 Ga0496123_0006264_8415_8717 99
147 3300048929 Ga0496126_0000951 Ga0496126_0000951_18930_19232 99
148 3300048929 Ga0496126_0011441 Ga0496126_0011441_7728_8030 99
149 3300048929 Ga0496126_0020119 Ga0496126_0020119_985_1287 99
150 3300048929 Ga0496126_0432601 Ga0496126_0432601_22_324 99
151 3300048929 Ga0496126_1242094 Ga0496126_1242094_56_358 99
152 3300049528 Ga0501312_053178 Ga0501312_053178_100_399 99
153 3300049533 Ga0501317_013188 Ga0501317_013188_250_552 99
154 3300049537 Ga0501321_061930 Ga0501321_061930_240_539 99
155 3300050489 nmdc:mga03683_482660_c1 nmdc:mga03683_482660_c1_283_585 99
156 3300050490 nmdc:mga03n38_128391_c1 nmdc:mga03n38_128391_c1_530_832 99
157 3300050491 nmdc:mga00v17_286344_c1 nmdc:mga00v17_286344_c1_659_961 99
158 3300050491 nmdc:mga00v17_326959_c1 nmdc:mga00v17_326959_c1_648_950 99
159 3300050491 nmdc:mga00v17_361571_c1 nmdc:mga00v17_361571_c1_293_595 99
160 3300050491 nmdc:mga00v17_452689_c1 nmdc:mga00v17_452689_c1_88_390 99
161 3300050491 nmdc:mga00v17_64510_c1 nmdc:mga00v17_64510_c1_803_1105 99
162 3300050491 nmdc:mga00v17_72839_c1 nmdc:mga00v17_72839_c1_1186_1488 99
163 3300050492 nmdc:mga0yw44_21262_c1 nmdc:mga0yw44_21262_c1_1683_1985 99
164 3300050492 nmdc:mga0yw44_59749_c1 nmdc:mga0yw44_59749_c1_1470_1772 99
165 3300050496 nmdc:mga07m45_696255_c1 nmdc:mga07m45_696255_c1_188_490 99
166 3300050513 nmdc:mga0rr50_1593263_c1 nmdc:mga0rr50_1593263_c1_145_447 99
167 3300050516 nmdc:mga0sz30_13994_c1 nmdc:mga0sz30_13994_c1_1477_1779 99
168 3300050516 nmdc:mga0sz30_86476_c1 nmdc:mga0sz30_86476_c1_577_879 99
169 3300059505 Ga0587083_0206547 Ga0587083_0206547_238_540 99
170 3300059510 Ga0587090_082861 Ga0587090_082861_289_591 99
171 3300061719 Ga0466962_0111398 Ga0466962_0111398_655_957 99
172 3300004798 Ga0058859_10027059 Ga0058859_100270592 100
173 3300004800 Ga0058861_12031117 Ga0058861_120311171 100
174 3300004803 Ga0058862_10019043 Ga0058862_100190432 100
175 3300005327 Ga0070658_11036574 Ga0070658_110365742 100
176 3300005331 Ga0070670_100425233 Ga0070670_1004252332 100
177 3300005331 Ga0070670_100760505 Ga0070670_1007605052 100
178 3300005334 Ga0068869_100293072 Ga0068869_1002930722 100
179 3300005338 Ga0068868_100719583 Ga0068868_1007195831 100
180 3300005338 Ga0068868_101528756 Ga0068868_1015287562 100
181 3300005339 Ga0070660_100392575 Ga0070660_1003925752 100
182 3300005344 Ga0070661_100303924 Ga0070661_1003039242 100
183 3300005345 Ga0070692_10467664 Ga0070692_104676642 100
184 3300005347 Ga0070668_100198226 Ga0070668_1001982263 100
185 3300005347 Ga0070668_101450308 Ga0070668_1014503081 100
186 3300005353 Ga0070669_101860188 Ga0070669_1018601881 100
187 3300005354 Ga0070675_100820281 Ga0070675_1008202812 100
188 3300005355 Ga0070671_100314327 Ga0070671_1003143272 100
189 3300005364 Ga0070673_100855117 Ga0070673_1008551171 100
190 3300005364 Ga0070673_101041985 Ga0070673_1010419851 100
191 3300005366 Ga0070659_100346616 Ga0070659_1003466162 100
192 3300005367 Ga0070667_100552437 Ga0070667_1005524371 100
193 3300005406 Ga0070703_10117275 Ga0070703_101172752 100
194 3300005435 Ga0070714_100319510 Ga0070714_1003195102 100
195 3300005438 Ga0070701_10842954 Ga0070701_108429541 100
196 3300005441 Ga0070700_100780034 Ga0070700_1007800342 100
197 3300005455 Ga0070663_100166935 Ga0070663_1001669352 100
198 3300005456 Ga0070678_100132027 Ga0070678_1001320274 100
199 3300005456 Ga0070678_101247103 Ga0070678_1012471032 100
200 3300005457 Ga0070662_100552981 Ga0070662_1005529812 100
201 3300005466 Ga0070685_10284947 Ga0070685_102849472 100
202 3300005466 Ga0070685_11481707 Ga0070685_114817072 100
203 3300005467 Ga0070706_101774999 Ga0070706_1017749991 100
204 3300005530 Ga0070679_101137379 Ga0070679_1011373792 100
205 3300005530 Ga0070679_101800756 Ga0070679_1018007562 100
206 3300005543 Ga0070672_100582283 Ga0070672_1005822832 100
207 3300005544 Ga0070686_100186467 Ga0070686_1001864673 100
208 3300005547 Ga0070693_100400377 Ga0070693_1004003772 100
209 3300005564 Ga0070664_100611988 Ga0070664_1006119882 100
210 3300005577 Ga0068857_100367935 Ga0068857_1003679352 100
211 3300005614 Ga0068856_101071620 Ga0068856_1010716202 100
212 3300005617 Ga0068859_100743950 Ga0068859_1007439502 100
213 3300005618 Ga0068864_100521326 Ga0068864_1005213262 100
214 3300005618 Ga0068864_100627925 Ga0068864_1006279252 100
215 3300005718 Ga0068866_10632194 Ga0068866_106321942 100
216 3300005719 Ga0068861_100130584 Ga0068861_1001305842 100
217 3300005834 Ga0068851_10299893 Ga0068851_102998932 100
218 3300005840 Ga0068870_10582921 Ga0068870_105829212 100
219 3300005841 Ga0068863_100342072 Ga0068863_1003420723 100
220 3300005842 Ga0068858_100212121 Ga0068858_1002121213 100
221 3300005843 Ga0068860_100780105 Ga0068860_1007801052 100
222 3300005983 Ga0081540_1005568 Ga0081540_10055685 100
223 3300006051 Ga0075364_10683225 Ga0075364_106832252 100
224 3300006195 Ga0075366_10421996 Ga0075366_104219962 100
225 3300006237 Ga0097621_100222109 Ga0097621_1002221093 100
226 3300006881 Ga0068865_100534181 Ga0068865_1005341812 100
227 3300006931 Ga0097620_100743961 Ga0097620_1007439612 100
228 3300009036 Ga0105244_10272877 Ga0105244_102728771 100
229 3300009098 Ga0105245_10116828 Ga0105245_101168282 100
230 3300009098 Ga0105245_10388478 Ga0105245_103884783 100
231 3300009101 Ga0105247_10252526 Ga0105247_102525262 100
232 3300009174 Ga0105241_11899740 Ga0105241_118997401 100
233 3300009176 Ga0105242_10262583 Ga0105242_102625831 100
234 3300010375 Ga0105239_11459766 Ga0105239_114597662 100
235 3300011119 Ga0105246_10813620 Ga0105246_108136202 100
236 3300011119 Ga0105246_11572961 Ga0105246_115729612 100
237 3300013104 Ga0157370_11509372 Ga0157370_115093722 100
238 3300013105 Ga0157369_10990050 Ga0157369_109900501 100
239 3300013296 Ga0157374_10290071 Ga0157374_102900712 100
240 3300013296 Ga0157374_12382849 Ga0157374_123828492 100
241 3300013307 Ga0157372_11521351 Ga0157372_115213512 100
242 3300013308 Ga0157375_10268334 Ga0157375_102683344 100
243 3300013308 Ga0157375_12579190 Ga0157375_125791901 100
244 3300014325 Ga0163163_11532606 Ga0163163_115326062 100
245 3300014326 Ga0157380_12279246 Ga0157380_122792462 100
246 3300014497 Ga0182008_10724126 Ga0182008_107241261 100
247 3300014745 Ga0157377_10099821 Ga0157377_100998212 100
248 3300014745 Ga0157377_11215011 Ga0157377_112150111 100
249 3300014968 Ga0157379_10579836 Ga0157379_105798362 100
250 3300017792 Ga0163161_11297982 Ga0163161_112979822 100
251 3300020069 Ga0197907_11152397 Ga0197907_111523972 100
252 3300020076 Ga0206355_1431124 Ga0206355_14311242 100
253 3300020078 Ga0206352_11111464 Ga0206352_111114642 100
254 3300020080 Ga0206350_10952296 Ga0206350_109522962 100
255 3300020081 Ga0206354_10008953 Ga0206354_100089531 100
256 3300025899 Ga0207642_10194015 Ga0207642_101940152 100
257 3300025900 Ga0207710_10333422 Ga0207710_103334222 100
258 3300025901 Ga0207688_10291667 Ga0207688_102916672 100
259 3300025907 Ga0207645_10336741 Ga0207645_103367412 100
260 3300025908 Ga0207643_10187159 Ga0207643_101871592 100
261 3300025917 Ga0207660_10438245 Ga0207660_104382452 100
262 3300025919 Ga0207657_10200846 Ga0207657_102008463 100
263 3300025919 Ga0207657_10758866 Ga0207657_107588662 100
264 3300025920 Ga0207649_11014735 Ga0207649_110147352 100
265 3300025921 Ga0207652_11159145 Ga0207652_111591452 100
266 3300025924 Ga0207694_11451090 Ga0207694_114510902 100
267 3300025925 Ga0207650_10769763 Ga0207650_107697632 100
268 3300025926 Ga0207659_10867105 Ga0207659_108671052 100
269 3300025927 Ga0207687_10623126 Ga0207687_106231262 100
270 3300025931 Ga0207644_10268217 Ga0207644_102682172 100
271 3300025932 Ga0207690_10460364 Ga0207690_104603642 100
272 3300025933 Ga0207706_10613371 Ga0207706_106133712 100
273 3300025934 Ga0207686_10672721 Ga0207686_106727211 100
274 3300025936 Ga0207670_11317845 Ga0207670_113178451 100
275 3300025940 Ga0207691_10097609 Ga0207691_100976094 100
276 3300025960 Ga0207651_12109538 Ga0207651_121095382 100
277 3300025972 Ga0207668_10057966 Ga0207668_100579663 100
278 3300026023 Ga0207677_10702486 Ga0207677_107024862 100
279 3300026035 Ga0207703_10194578 Ga0207703_101945783 100
280 3300026067 Ga0207678_10545886 Ga0207678_105458862 100
281 3300026067 Ga0207678_11828408 Ga0207678_118284082 100
282 3300026075 Ga0207708_11452155 Ga0207708_114521552 100
283 3300026078 Ga0207702_10244783 Ga0207702_102447832 100
284 3300026089 Ga0207648_10717003 Ga0207648_107170032 100
285 3300026095 Ga0207676_10825903 Ga0207676_108259032 100
286 3300026116 Ga0207674_10357195 Ga0207674_103571952 100
287 3300026118 Ga0207675_100689343 Ga0207675_1006893432 100
288 3300026118 Ga0207675_100829545 Ga0207675_1008295452 100
289 3300026121 Ga0207683_10080520 Ga0207683_100805204 100
290 3300028379 Ga0268266_10867680 Ga0268266_108676802 100
291 3300028380 Ga0268265_10042371 Ga0268265_100423715 100
292 3300028381 Ga0268264_10198362 Ga0268264_101983622 100
293 3300028794 Ga0307515_10001812 Ga0307515_1000181258 100
294 3300029285 Ga0310981_1091162 Ga0310981_10911622 100
295 3300030522 Ga0307512_10207419 Ga0307512_102074192 100
296 3300031507 Ga0307509_10011154 Ga0307509_1001115411 100
297 3300031548 Ga0307408_100606623 Ga0307408_1006066231 100
298 3300031616 Ga0307508_10003351 Ga0307508_100033513 100
299 3300031730 Ga0307516_10039371 Ga0307516_100393716 100
300 3300031731 Ga0307405_10100649 Ga0307405_101006493 100
301 3300031731 Ga0307405_10541356 Ga0307405_105413562 100
302 3300031824 Ga0307413_10091348 Ga0307413_100913482 100
303 3300031852 Ga0307410_10352523 Ga0307410_103525232 100
304 3300031889 Ga0326468_10001555 Ga0326468_100015552 100
305 3300031901 Ga0307406_10058669 Ga0307406_100586693 100
306 3300031903 Ga0307407_10087218 Ga0307407_100872183 100
307 3300031911 Ga0307412_11003713 Ga0307412_110037132 100
308 3300031995 Ga0307409_100142156 Ga0307409_1001421563 100
309 3300031995 Ga0307409_100354129 Ga0307409_1003541292 100
310 3300032002 Ga0307416_100096719 Ga0307416_1000967193 100
311 3300032002 Ga0307416_100587117 Ga0307416_1005871172 100
312 3300032005 Ga0307411_10082097 Ga0307411_100820972 100
313 3300032126 Ga0307415_100074865 Ga0307415_1000748652 100
314 3300032126 Ga0307415_100145656 Ga0307415_1001456563 100
315 3300032126 Ga0307415_100517647 Ga0307415_1005176471 100
316 3300033179 Ga0307507_10096663 Ga0307507_100966633 100
317 3300033179 Ga0307507_10444868 Ga0307507_104448682 100
318 3300035090 Ga0373949_0069568 Ga0373949_0069568_231_533 100
319 3300035091 Ga0373951_0000463 Ga0373951_0000463_9372_9674 100
320 3300035121 Ga0373960_0108571 Ga0373960_0108571_26_328 100
321 3300035692 Ga0373935_0022806 Ga0373935_0022806_2808_3110 100
322 3300037853 Ga0436364_0164890 Ga0436364_0164890_90_392 100
323 3300041413 Ga0439465_0367819 Ga0439465_0367819_58_360 100
324 3300041453 Ga0451797_0864649 Ga0451797_0864649_614_916 100
325 3300041460 Ga0451802_1113913 Ga0451802_1113913_254_556 100
326 3300041463 Ga0451804_0462733 Ga0451804_0462733_21_323 100
327 3300041486 Ga0451807_0482340 Ga0451807_0482340_97_399 100
328 3300041494 Ga0451837_1730739 Ga0451837_1730739_229_531 100
329 3300042016 Ga0439463_074968 Ga0439463_074968_250_552 100
330 3300042438 Ga0439459_0101286 Ga0439459_0101286_318_620 100
331 3300044658 Ga0466972_0526363 Ga0466972_0526363_173_475 100
332 3300044765 Ga0466970_0964420 Ga0466970_0964420_145_447 100
333 3300047443 Ga0495687_259525 Ga0495687_259525_98_400 100
334 3300048918 Ga0496115_0326798 Ga0496115_0326798_231_533 100
335 3300049162 Ga0501307_053000 Ga0501307_053000_171_473 100
336 3300049527 Ga0501311_101720 Ga0501311_101720_115_417 100
337 3300049531 Ga0501315_100865 Ga0501315_100865_36_338 100
338 3300049532 Ga0501316_006966 Ga0501316_006966_271_573 100
339 3300049533 Ga0501317_013275 Ga0501317_013275_619_921 100
340 3300049537 Ga0501321_005201 Ga0501321_005201_269_571 100
341 3300049540 Ga0501324_047228 Ga0501324_047228_176_478 100
342 3300049552 Ga0501336_025574 Ga0501336_025574_185_487 100
343 3300049574 Ga0501038_0992853 Ga0501038_0992853_67_369 100
344 3300053136 Ga0500559_0449843 Ga0500559_0449843_180_482 100
345 3300053158 Ga0500627_0195703 Ga0500627_0195703_28_330 100
346 3300053159 Ga0500630_091102 Ga0500630_091102_900_1202 100
347 3300053739 Ga0500587_012825 Ga0500587_012825_34_336 100
348 3300059477 Ga0587084_020265 Ga0587084_020265_291_593 100
349 3300059477 Ga0587084_033914 Ga0587084_033914_124_426 100
350 3300059492 Ga0587073_0078929 Ga0587073_0078929_261_563 100
351 3300059493 Ga0587077_085610 Ga0587077_085610_262_564 100
352 3300059504 Ga0587082_022401 Ga0587082_022401_329_631 100
353 3300059508 Ga0587088_042869 Ga0587088_042869_270_572 100
354 3300059510 Ga0587090_028502 Ga0587090_028502_116_418 100
355 3300059512 Ga0587092_044616 Ga0587092_044616_136_438 100
356 3300059604 Ga0587098_007546 Ga0587098_007546_599_901 100
357 3300059608 Ga0587129_006660 Ga0587129_006660_69_371 100
358 3300059623 Ga0587101_032470 Ga0587101_032470_276_578 100
359 3300059624 Ga0587109_046161 Ga0587109_046161_306_608 100
360 3300059627 Ga0587117_028126 Ga0587117_028126_117_419 100
361 3300059640 Ga0587067_028532 Ga0587067_028532_377_679 100
362 3300059643 Ga0587072_107055 Ga0587072_107055_84_386 100
363 3300059648 Ga0587100_018129 Ga0587100_018129_79_381 100
364 3300059649 Ga0587102_015709 Ga0587102_015709_384_686 100
365 3300059652 Ga0587107_014459 Ga0587107_014459_319_621 100
366 3300059658 Ga0587119_018189 Ga0587119_018189_482_784 100
367 3300059660 Ga0587124_012606 Ga0587124_012606_64_366 100
368 3300060346 Ga0587111_0001599 Ga0587111_0001599_537_839 100
369 3300060346 Ga0587111_0082473 Ga0587111_0082473_198_500 100
370 3300061719 Ga0466962_0454679 Ga0466962_0454679_252_554 100
371 3300005329 Ga0070683_100243292 Ga0070683_1002432922 101
372 3300005329 Ga0070683_100730630 Ga0070683_1007306302 101
373 3300005337 Ga0070682_100283454 Ga0070682_1002834542 101
374 3300005343 Ga0070687_100565731 Ga0070687_1005657311 101
375 3300005345 Ga0070692_11211312 Ga0070692_112113121 101
376 3300005355 Ga0070671_100546495 Ga0070671_1005464952 101
377 3300005366 Ga0070659_101468914 Ga0070659_1014689142 101
378 3300005367 Ga0070667_100313417 Ga0070667_1003134172 101
379 3300005441 Ga0070700_101998074 Ga0070700_1019980742 101
380 3300005456 Ga0070678_100420815 Ga0070678_1004208152 101
381 3300005466 Ga0070685_11409986 Ga0070685_114099862 101
382 3300005530 Ga0070679_101142826 Ga0070679_1011428262 101
383 3300005535 Ga0070684_100285523 Ga0070684_1002855232 101
384 3300005544 Ga0070686_101484268 Ga0070686_1014842681 101
385 3300005548 Ga0070665_100125445 Ga0070665_1001254454 101
386 3300005564 Ga0070664_100964697 Ga0070664_1009646972 101
387 3300005615 Ga0070702_100134868 Ga0070702_1001348682 101
388 3300005840 Ga0068870_11409036 Ga0068870_114090362 101
389 3300006358 Ga0068871_101351922 Ga0068871_1013519222 101
390 3300009094 Ga0111539_11678634 Ga0111539_116786342 101
391 3300009098 Ga0105245_10059566 Ga0105245_100595665 101
392 3300009101 Ga0105247_10161516 Ga0105247_101615162 101
393 3300009101 Ga0105247_11306377 Ga0105247_113063772 101
394 3300009148 Ga0105243_10683988 Ga0105243_106839882 101
395 3300009174 Ga0105241_10738320 Ga0105241_107383202 101
396 3300009176 Ga0105242_10413133 Ga0105242_104131332 101
397 3300009177 Ga0105248_10150854 Ga0105248_101508544 101
398 3300009177 Ga0105248_11187432 Ga0105248_111874322 101
399 3300009551 Ga0105238_10409424 Ga0105238_104094242 101
400 3300009551 Ga0105238_11431897 Ga0105238_114318971 101
401 3300009553 Ga0105249_10632895 Ga0105249_106328952 101
402 3300009553 Ga0105249_11724993 Ga0105249_117249932 101
403 3300011119 Ga0105246_12571340 Ga0105246_125713401 101
404 3300013102 Ga0157371_10483286 Ga0157371_104832862 101
405 3300013296 Ga0157374_11027292 Ga0157374_110272922 101
406 3300013297 Ga0157378_12095641 Ga0157378_120956412 101
407 3300013306 Ga0163162_10127782 Ga0163162_101277822 101
408 3300013307 Ga0157372_11397875 Ga0157372_113978752 101
409 3300013308 Ga0157375_10016636 Ga0157375_100166363 101
410 3300014325 Ga0163163_10057195 Ga0163163_100571955 101
411 3300014326 Ga0157380_11088257 Ga0157380_110882572 101
412 3300014326 Ga0157380_12077116 Ga0157380_120771162 101
413 3300017792 Ga0163161_11128673 Ga0163161_111286731 101
414 3300025901 Ga0207688_10509774 Ga0207688_105097742 101
415 3300025905 Ga0207685_10425936 Ga0207685_104259362 101
416 3300025918 Ga0207662_11366387 Ga0207662_113663872 101
417 3300025924 Ga0207694_10412143 Ga0207694_104121432 101
418 3300025924 Ga0207694_11227433 Ga0207694_112274332 101
419 3300025927 Ga0207687_10020152 Ga0207687_100201525 101
420 3300025927 Ga0207687_10709849 Ga0207687_107098492 101
421 3300025932 Ga0207690_11444636 Ga0207690_114446362 101
422 3300025932 Ga0207690_11650152 Ga0207690_116501521 101
423 3300025934 Ga0207686_10310339 Ga0207686_103103392 101
424 3300025935 Ga0207709_10027907 Ga0207709_100279071 101
425 3300025935 Ga0207709_11655727 Ga0207709_116557272 101
426 3300025941 Ga0207711_10377122 Ga0207711_103771222 101
427 3300025941 Ga0207711_10548816 Ga0207711_105488162 101
428 3300025944 Ga0207661_10127477 Ga0207661_101274774 101
429 3300025945 Ga0207679_10943575 Ga0207679_109435752 101
430 3300025961 Ga0207712_10076377 Ga0207712_100763774 101
431 3300025961 Ga0207712_11805054 Ga0207712_118050541 101
432 3300026023 Ga0207677_10877598 Ga0207677_108775982 101
433 3300026023 Ga0207677_11331521 Ga0207677_113315212 101
434 3300026067 Ga0207678_10611791 Ga0207678_106117912 101
435 3300026075 Ga0207708_11694808 Ga0207708_116948081 101
436 3300026089 Ga0207648_11616099 Ga0207648_116160992 101
437 3300026116 Ga0207674_10310004 Ga0207674_103100043 101
438 3300026142 Ga0207698_10273345 Ga0207698_102733453 101
439 3300026142 Ga0207698_10346174 Ga0207698_103461742 101
440 3300028379 Ga0268266_10027754 Ga0268266_100277545 101
441 3300028786 Ga0307517_10001351 Ga0307517_1000135127 101
442 3300030521 Ga0307511_10108881 Ga0307511_101088812 101
443 3300031507 Ga0307509_10256568 Ga0307509_102565682 101
444 3300031616 Ga0307508_10012942 Ga0307508_100129425 101
445 3300031649 Ga0307514_10107474 Ga0307514_101074744 101
446 3300031730 Ga0307516_10045595 Ga0307516_100455955 101
447 3300031824 Ga0307413_10082563 Ga0307413_100825634 101
448 3300031824 Ga0307413_10860122 Ga0307413_108601222 101
449 3300031995 Ga0307409_100640842 Ga0307409_1006408422 101
450 3300031995 Ga0307409_102710985 Ga0307409_1027109851 101
451 3300032002 Ga0307416_100750823 Ga0307416_1007508232 101
452 3300032002 Ga0307416_101733795 Ga0307416_1017337952 101
453 3300032004 Ga0307414_10679703 Ga0307414_106797032 101
454 3300032126 Ga0307415_100285088 Ga0307415_1002850882 101
455 3300033179 Ga0307507_10120549 Ga0307507_101205493 101
456 3300033180 Ga0307510_10136518 Ga0307510_101365182 101
457 3300037418 Ga0395900_0050861 Ga0395900_0050861_745_1050 101
458 3300037471 Ga0395905_0764432 Ga0395905_0764432_280_585 101
459 3300041511 Ga0451855_0151320 Ga0451855_0151320_214_519 101
460 3300041512 Ga0451853_1021921 Ga0451853_1021921_101_406 101
461 3300042157 Ga0439458_0138275 Ga0439458_0138275_203_508 101
462 3300044842 Ga0466957_0074145 Ga0466957_0074145_496_804 101
463 3300046453 Ga0495627_039442 Ga0495627_039442_784_1110 101
464 3300046455 Ga0495603_0159931 Ga0495603_0159931_830_1156 101
465 3300046457 Ga0495590_0211305 Ga0495590_0211305_331_657 101
466 3300046459 Ga0495629_0099847 Ga0495629_0099847_1553_1879 101
467 3300046460 Ga0495638_0154030 Ga0495638_0154030_139_465 101
468 3300046475 Ga0495639_0174429 Ga0495639_0174429_175_501 101
469 3300046491 Ga0495584_0119624 Ga0495584_0119624_162_467 101
470 3300046492 Ga0495585_0102174 Ga0495585_0102174_150_476 101
471 3300046499 Ga0495594_0060133 Ga0495594_0060133_1386_1712 101
472 3300046511 Ga0495608_0060019 Ga0495608_0060019_457_783 101
473 3300046515 Ga0495620_0158527 Ga0495620_0158527_239_544 101
474 3300046519 Ga0495632_0010084 Ga0495632_0010084_3827_4153 101
475 3300046522 Ga0495643_0003566 Ga0495643_0003566_605_931 101
476 3300046528 Ga0495642_0072089 Ga0495642_0072089_435_761 101
477 3300046537 Ga0495598_0085680 Ga0495598_0085680_405_710 101
478 3300046539 Ga0495621_0166726 Ga0495621_0166726_286_591 101
479 3300046557 Ga0495622_0019219 Ga0495622_0019219_2738_3064 101
480 3300046558 Ga0495633_0035752 Ga0495633_0035752_557_883 101
481 3300046615 Ga0495656_0044151 Ga0495656_0044151_1316_1621 101
482 3300046683 Ga0495658_0040123 Ga0495658_0040123_1018_1344 101
483 3300046691 Ga0495670_0007585 Ga0495670_0007585_1446_1772 101
484 3300046692 Ga0495671_0120169 Ga0495671_0120169_912_1238 101
485 3300046810 Ga0495660_0002768 Ga0495660_0002768_8295_8621 101
486 3300047318 Ga0495636_0498302 Ga0495636_0498302_155_460 101
487 3300047321 Ga0495676_0879911 Ga0495676_0879911_169_495 101
488 3300047323 Ga0495683_0013097 Ga0495683_0013097_3276_3602 101
489 3300047443 Ga0495687_025550 Ga0495687_025550_1310_1636 101
490 3300047445 Ga0495677_0116944 Ga0495677_0116944_231_536 101
491 3300047446 Ga0495679_019249 Ga0495679_019249_1976_2302 101
492 3300047447 Ga0495685_000455 Ga0495685_000455_10920_11246 101
493 3300047470 Ga0495681_0001916 Ga0495681_0001916_2791_3117 101
494 3300047470 Ga0495681_0305262 Ga0495681_0305262_178_483 101
495 3300047472 Ga0495686_0041778 Ga0495686_0041778_1051_1377 101
496 3300048904 Ga0496101_0488628 Ga0496101_0488628_57_362 101
497 3300048905 Ga0496102_0067122 Ga0496102_0067122_2752_3057 101
498 3300048907 Ga0496104_0096185 Ga0496104_0096185_93_398 101
499 3300048909 Ga0496106_0147980 Ga0496106_0147980_447_752 101
500 3300048910 Ga0496107_1119752 Ga0496107_1119752_180_485 101
501 3300048911 Ga0496108_0085000 Ga0496108_0085000_2289_2594 101
502 3300048911 Ga0496108_0253120 Ga0496108_0253120_474_779 101
503 3300048911 Ga0496108_0360301 Ga0496108_0360301_291_596 101
504 3300048912 Ga0496109_0058771 Ga0496109_0058771_181_486 101
505 3300048912 Ga0496109_0165475 Ga0496109_0165475_215_520 101
506 3300048912 Ga0496109_0181473 Ga0496109_0181473_1028_1333 101
507 3300048913 Ga0496110_0085776 Ga0496110_0085776_177_482 101
508 3300048914 Ga0496111_0039375 Ga0496111_0039375_2925_3230 101
509 3300048915 Ga0496112_0011626 Ga0496112_0011626_632_937 101
510 3300048916 Ga0496113_0018053 Ga0496113_0018053_2582_2887 101
511 3300048917 Ga0496114_0009605 Ga0496114_0009605_282_587 101
512 3300048917 Ga0496114_0535943 Ga0496114_0535943_325_630 101
513 3300049127 Ga0501306_008396 Ga0501306_008396_76_381 101
514 3300049127 Ga0501306_030508 Ga0501306_030508_200_505 101
515 3300049129 Ga0501309_013241 Ga0501309_013241_450_755 101
516 3300049129 Ga0501309_044144 Ga0501309_044144_216_521 101
517 3300049130 Ga0501310_021149 Ga0501310_021149_258_563 101
518 3300049160 Ga0501304_040726 Ga0501304_040726_186_491 101
519 3300049161 Ga0501305_022556 Ga0501305_022556_345_650 101
520 3300049162 Ga0501307_036495 Ga0501307_036495_82_387 101
521 3300049527 Ga0501311_014031 Ga0501311_014031_290_595 101
522 3300049528 Ga0501312_023268 Ga0501312_023268_274_579 101
523 3300049528 Ga0501312_075695 Ga0501312_075695_241_546 101
524 3300049530 Ga0501314_001561 Ga0501314_001561_1118_1423 101
525 3300049532 Ga0501316_008288 Ga0501316_008288_464_769 101
526 3300049533 Ga0501317_050835 Ga0501317_050835_266_571 101
527 3300049534 Ga0501318_012530 Ga0501318_012530_228_533 101
528 3300049540 Ga0501324_014639 Ga0501324_014639_68_373 101
529 3300049541 Ga0501325_011299 Ga0501325_011299_156_461 101
530 3300049576 Ga0501040_0047321 Ga0501040_0047321_2068_2373 101
531 3300049577 Ga0501041_0723543 Ga0501041_0723543_37_342 101
532 3300049578 Ga0501042_0736570 Ga0501042_0736570_95_400 101
533 3300049580 Ga0501046_0473748 Ga0501046_0473748_209_514 101
534 3300049581 Ga0501047_0000278 Ga0501047_0000278_54117_54422 101
535 3300049588 Ga0501072_0054085 Ga0501072_0054085_2192_2497 101
536 3300049590 Ga0501074_0881490 Ga0501074_0881490_281_586 101
537 3300049704 Ga0501221_200839 Ga0501221_200839_117_422 101
538 3300049742 Ga0501080_0144771 Ga0501080_0144771_242_547 101
539 3300049824 Ga0501045_0366432 Ga0501045_0366432_516_821 101
540 3300050507 nmdc:mga05p37_64020_c1 nmdc:mga05p37_64020_c1_625_930 101
541 3300053084 Ga0495595_0600755 Ga0495595_0600755_97_423 101
542 3300053086 Ga0500578_0006009 Ga0500578_0006009_5216_5542 101
543 3300053092 Ga0500583_0132654 Ga0500583_0132654_462_788 101
544 3300053093 Ga0500651_0490205 Ga0500651_0490205_86_412 101
545 3300053094 Ga0500566_0009561 Ga0500566_0009561_126_452 101
546 3300053099 Ga0500654_002699 Ga0500654_002699_2437_2763 101
547 3300053100 Ga0500660_024964 Ga0500660_024964_2054_2380 101
548 3300053106 Ga0500558_064320 Ga0500558_064320_13_339 101
549 3300053107 Ga0500560_117181 Ga0500560_117181_187_513 101
550 3300053109 Ga0500569_000210 Ga0500569_000210_2097_2423 101
551 3300053113 Ga0500580_110091 Ga0500580_110091_534_860 101
552 3300053123 Ga0500614_165070 Ga0500614_165070_311_637 101
553 3300053126 Ga0500621_092407 Ga0500621_092407_169_495 101
554 3300053129 Ga0500628_080887 Ga0500628_080887_355_681 101
555 3300053131 Ga0500652_001087 Ga0500652_001087_4383_4709 101
556 3300053134 Ga0500658_0002819 Ga0500658_0002819_2458_2784 101
557 3300053135 Ga0500659_0289263 Ga0500659_0289263_394_720 101
558 3300053137 Ga0500561_0000167 Ga0500561_0000167_9591_9917 101
559 3300053140 Ga0500573_0032934 Ga0500573_0032934_1941_2267 101
560 3300053142 Ga0500577_0183465 Ga0500577_0183465_238_564 101
561 3300053143 Ga0500579_134694 Ga0500579_134694_164_490 101
562 3300053145 Ga0500586_242712 Ga0500586_242712_232_558 101
563 3300053146 Ga0500588_0313911 Ga0500588_0313911_157_483 101
564 3300053149 Ga0500600_0006438 Ga0500600_0006438_3757_4083 101
565 3300053150 Ga0500603_051840 Ga0500603_051840_363_689 101
566 3300053153 Ga0500616_0004474 Ga0500616_0004474_5854_6180 101
567 3300053160 Ga0500633_0000736 Ga0500633_0000736_1340_1666 101
568 3300053161 Ga0500634_0024229 Ga0500634_0024229_356_682 101
569 3300053177 Ga0500636_0215330 Ga0500636_0215330_381_707 101
570 3300053732 Ga0500656_000179 Ga0500656_000179_3673_3999 101
571 3300053739 Ga0500587_000176 Ga0500587_000176_5070_5396 101
572 3300059506 Ga0587085_178273 Ga0587085_178273_72_377 101
573 3300060353 Ga0501082_0309796 Ga0501082_0309796_977_1282 101
574 iso_pu_bacteria 8056447290 8056447903 101
575 3300005337 Ga0070682_100420354 Ga0070682_1004203542 102
576 3300005356 Ga0070674_101090453 Ga0070674_1010904531 102
577 3300005436 Ga0070713_100004669 Ga0070713_1000046697 102
578 3300005439 Ga0070711_100253031 Ga0070711_1002530311 102
579 3300005459 Ga0068867_100312233 Ga0068867_1003122332 102
580 3300005543 Ga0070672_101372942 Ga0070672_1013729422 102
581 3300005547 Ga0070693_101028264 Ga0070693_1010282642 102
582 3300005614 Ga0068856_100781514 Ga0068856_1007815142 102
583 3300005841 Ga0068863_101686661 Ga0068863_1016866612 102
584 3300006028 Ga0070717_11314727 Ga0070717_113147272 102
585 3300013105 Ga0157369_10156154 Ga0157369_101561542 102
586 3300013306 Ga0163162_12321706 Ga0163162_123217062 102
587 3300013307 Ga0157372_12980673 Ga0157372_129806732 102
588 3300014325 Ga0163163_10743846 Ga0163163_107438462 102
589 3300014326 Ga0157380_10408869 Ga0157380_104088692 102
590 3300020069 Ga0197907_10433734 Ga0197907_104337342 102
591 3300020069 Ga0197907_10477661 Ga0197907_104776612 102
592 3300020070 Ga0206356_10344010 Ga0206356_103440104 102
593 3300020070 Ga0206356_11141088 Ga0206356_111410884 102
594 3300020075 Ga0206349_1334537 Ga0206349_13345371 102
595 3300020075 Ga0206349_1527023 Ga0206349_15270232 102
596 3300020075 Ga0206349_1899702 Ga0206349_18997022 102
597 3300020076 Ga0206355_1519402 Ga0206355_15194021 102
598 3300020076 Ga0206355_1612783 Ga0206355_16127832 102
599 3300020077 Ga0206351_10233981 Ga0206351_102339811 102
600 3300020077 Ga0206351_10393194 Ga0206351_103931942 102
601 3300020077 Ga0206351_10619467 Ga0206351_106194672 102
602 3300020078 Ga0206352_10732747 Ga0206352_107327472 102
603 3300020078 Ga0206352_10762487 Ga0206352_107624873 102
604 3300020078 Ga0206352_11329365 Ga0206352_113293651 102
605 3300020080 Ga0206350_10015308 Ga0206350_100153081 102
606 3300020081 Ga0206354_10314494 Ga0206354_103144941 102
607 3300020081 Ga0206354_10395367 Ga0206354_103953675 102
608 3300020081 Ga0206354_10448514 Ga0206354_104485142 102
609 3300020082 Ga0206353_10604234 Ga0206353_106042344 102
610 3300020082 Ga0206353_10689809 Ga0206353_106898094 102
611 3300020082 Ga0206353_11202414 Ga0206353_112024142 102
612 3300020610 Ga0154015_1295976 Ga0154015_12959762 102
613 3300022467 Ga0224712_10023353 Ga0224712_100233534 102
614 3300025901 Ga0207688_10159887 Ga0207688_101598872 102
615 3300025906 Ga0207699_10406267 Ga0207699_104062672 102
616 3300025916 Ga0207663_10375064 Ga0207663_103750642 102
617 3300025925 Ga0207650_10933591 Ga0207650_109335911 102
618 3300025928 Ga0207700_10020037 Ga0207700_100200372 102
619 3300025929 Ga0207664_10340891 Ga0207664_103408912 102
620 3300025929 Ga0207664_11664844 Ga0207664_116648442 102
621 3300025937 Ga0207669_10564610 Ga0207669_105646102 102
622 3300026078 Ga0207702_10578113 Ga0207702_105781132 102
623 3300026089 Ga0207648_10078394 Ga0207648_100783945 102
624 3300026095 Ga0207676_12386186 Ga0207676_123861861 102
625 3300026121 Ga0207683_10885094 Ga0207683_108850942 102
626 3300026121 Ga0207683_11631060 Ga0207683_116310602 102
627 3300028786 Ga0307517_10156088 Ga0307517_101560882 102
628 3300031507 Ga0307509_10012707 Ga0307509_100127075 102
629 3300031616 Ga0307508_10097570 Ga0307508_100975705 102
630 3300033179 Ga0307507_10000482 Ga0307507_1000048222 102
631 3300033180 Ga0307510_10095977 Ga0307510_100959774 102
632 3300033545 Ga0316214_1026290 Ga0316214_10262901 102
633 3300037068 Ga0373925_0389249 Ga0373925_0389249_368_700 102
634 3300041441 Ga0451787_802906 Ga0451787_802906_87_398 102
635 3300041443 Ga0451789_0187238 Ga0451789_0187238_315_626 102
636 3300041443 Ga0451789_1330385 Ga0451789_1330385_1365_1676 102
637 3300041444 Ga0451790_07178 Ga0451790_07178_947_1258 102
638 3300041446 Ga0451794_25357 Ga0451794_25357_367_678 102
639 3300041451 Ga0451791_1814107 Ga0451791_1814107_394_705 102
640 3300041452 Ga0451793_0621849 Ga0451793_0621849_148_459 102
641 3300041452 Ga0451793_1066416 Ga0451793_1066416_629_940 102
642 3300041453 Ga0451797_0774478 Ga0451797_0774478_148_459 102
643 3300041453 Ga0451797_1211872 Ga0451797_1211872_898_1209 102
644 3300041456 Ga0451795_1621111 Ga0451795_1621111_217_528 102
645 3300041460 Ga0451802_1643678 Ga0451802_1643678_508_819 102
646 3300041486 Ga0451807_1220677 Ga0451807_1220677_380_691 102
647 3300041491 Ga0451833_0393181 Ga0451833_0393181_1454_1765 102
648 3300041496 Ga0451839_0406887 Ga0451839_0406887_320_631 102
649 3300041498 Ga0451841_0603908 Ga0451841_0603908_672_983 102
650 3300041509 Ga0451843_0866875 Ga0451843_0866875_1706_2017 102
651 3300041512 Ga0451853_0729236 Ga0451853_0729236_4505_4816 102
652 3300044656 Ga0466969_0018916 Ga0466969_0018916_1558_1893 102
653 3300044684 Ga0466966_0043302 Ga0466966_0043302_1012_1347 102
654 3300044684 Ga0466966_0170526 Ga0466966_0170526_668_1000 102
655 3300044693 Ga0466961_0030780 Ga0466961_0030780_773_1105 102
656 3300044693 Ga0466961_0491407 Ga0466961_0491407_115_447 102
657 3300044694 Ga0466963_0187646 Ga0466963_0187646_553_885 102
658 3300044706 Ga0466964_0299145 Ga0466964_0299145_364_696 102
659 3300044706 Ga0466964_0549402 Ga0466964_0549402_69_401 102
660 3300044719 Ga0466971_0000675 Ga0466971_0000675_817_1152 102
661 3300044719 Ga0466971_0123465 Ga0466971_0123465_203_535 102
662 3300044719 Ga0466971_0513118 Ga0466971_0513118_183_515 102
663 3300044765 Ga0466970_0837813 Ga0466970_0837813_68_400 102
664 3300044842 Ga0466957_0089846 Ga0466957_0089846_811_1143 102
665 3300045049 Ga0466959_0003800 Ga0466959_0003800_4059_4394 102
666 3300045049 Ga0466959_0025593 Ga0466959_0025593_2084_2416 102
667 3300045049 Ga0466959_0677759 Ga0466959_0677759_338_670 102
668 3300045836 Ga0466958_0011830 Ga0466958_0011830_3965_4300 102
669 3300045836 Ga0466958_0026511 Ga0466958_0026511_2390_2722 102
670 3300046454 Ga0495592_0008230 Ga0495592_0008230_3984_4319 102
671 3300046462 Ga0495651_0000169 Ga0495651_0000169_20601_20936 102
672 3300046477 Ga0495664_0030225 Ga0495664_0030225_1080_1415 102
673 3300046514 Ga0495618_0078305 Ga0495618_0078305_893_1228 102
674 3300046516 Ga0495628_0262913 Ga0495628_0262913_900_1235 102
675 3300046529 Ga0495652_0001361 Ga0495652_0001361_1022_1357 102
676 3300046536 Ga0495587_0033543 Ga0495587_0033543_2203_2538 102
677 3300046543 Ga0495645_0013381 Ga0495645_0013381_2875_3210 102
678 3300046663 Ga0495635_0010690 Ga0495635_0010690_5134_5469 102
679 3300046679 Ga0495623_0003245 Ga0495623_0003245_7411_7746 102
680 3300046680 Ga0495646_0008701 Ga0495646_0008701_3799_4134 102
681 3300046809 Ga0495600_0039421 Ga0495600_0039421_2242_2577 102
682 3300047317 Ga0495604_0617798 Ga0495604_0617798_177_512 102
683 3300047322 Ga0495680_0125418 Ga0495680_0125418_912_1244 102
684 3300048088 Ga0495602_0070215 Ga0495602_0070215_484_819 102
685 3300048913 Ga0496110_0275300 Ga0496110_0275300_120_431 102
686 3300048917 Ga0496114_0020960 Ga0496114_0020960_3185_3496 102
687 3300048922 Ga0496119_0181343 Ga0496119_0181343_614_949 102
688 3300048929 Ga0496126_0495762 Ga0496126_0495762_402_737 102
689 3300048929 Ga0496126_1308979 Ga0496126_1308979_21_353 102
690 3300049823 Ga0501044_1015399 Ga0501044_1015399_70_405 102
691 3300053077 Ga0495601_0044431 Ga0495601_0044431_1107_1442 102
692 3300053078 Ga0495612_0001114 Ga0495612_0001114_8516_8851 102
693 3300053085 Ga0495619_0039496 Ga0495619_0039496_652_987 102
694 3300053118 Ga0500594_0039080 Ga0500594_0039080_928_1236 102
695 3300053122 Ga0500608_308905 Ga0500608_308905_127_462 102
696 3300053140 Ga0500573_0332596 Ga0500573_0332596_88_420 102
697 3300059492 Ga0587073_0074026 Ga0587073_0074026_226_558 102
698 3300061719 Ga0466962_0000160 Ga0466962_0000160_5731_6066 102
699 3300061719 Ga0466962_0032722 Ga0466962_0032722_1353_1685 102
700 3300061719 Ga0466962_0111769 Ga0466962_0111769_275_607 102
701 iso_pu_bacteria 2643221601 2644014453 102
702 iso_pu_bacteria 2643221631 2644175890 102
703 iso_pu_bacteria 2818991472 2819742258 102
704 iso_pu_bacteria 2554235005 2554256784 103
705 iso_pu_bacteria 2867475112 2867481061 103
706 iso_pu_bacteria 8025478263 8025486085 103
707 iso_pu_bacteria 8054160619 8054160791 103
708 iso_pu_bacteria 8056667051 8056673136 103
709 3300044683 Ga0466965_0009434 Ga0466965_0009434_623_940 104
710 3300044684 Ga0466966_0003375 Ga0466966_0003375_8080_8397 104
711 3300044693 Ga0466961_0037140 Ga0466961_0037140_2374_2691 104
712 3300045049 Ga0466959_0041912 Ga0466959_0041912_990_1307 104
713 iso_pu_bacteria 2791355406 2793976332 104
714 iso_pu_bacteria 2990088156 2990092165 104
715 iso_pu_bacteria 3006321560 3006326219 104
716 iso_pu_bacteria 8047893842 8047896979 104
717 iso_pu_bacteria 8048127548 8048132579 104
718 iso_pu_bacteria 8048356638 8048361973 104
719 iso_pu_bacteria 8048369669 8048373964 104
720 iso_pu_bacteria 8048379754 8048384263 104
721 3300004801 Ga0058860_12055840 Ga0058860_120558401 105
722 3300009092 Ga0105250_10195966 Ga0105250_101959662 105
723 3300009148 Ga0105243_10987054 Ga0105243_109870542 105
724 3300009553 Ga0105249_12478515 Ga0105249_124785152 105
725 3300044658 Ga0466972_0261256 Ga0466972_0261256_10_327 105
726 3300044735 Ga0466968_0212703 Ga0466968_0212703_276_593 105
727 3300044765 Ga0466970_0206977 Ga0466970_0206977_334_651 105
728 3300046517 Ga0495630_0095803 Ga0495630_0095803_1097_1420 105
729 3300046642 Ga0495634_0121401 Ga0495634_0121401_562_885 105
730 3300046674 Ga0495588_0032147 Ga0495588_0032147_756_1076 105
731 3300046679 Ga0495623_0004870 Ga0495623_0004870_5860_6183 105
732 3300046689 Ga0495613_0209276 Ga0495613_0209276_749_1069 105
733 3300046809 Ga0495600_0373910 Ga0495600_0373910_23_346 105
734 3300046809 Ga0495600_0721783 Ga0495600_0721783_115_435 105
735 3300047317 Ga0495604_0004624 Ga0495604_0004624_7794_8117 105
736 3300047318 Ga0495636_0182572 Ga0495636_0182572_429_749 105
737 3300047444 Ga0495675_0001497 Ga0495675_0001497_6687_7010 105
738 3300047444 Ga0495675_0225518 Ga0495675_0225518_316_636 105
739 3300047444 Ga0495675_0435149 Ga0495675_0435149_245_565 105
740 3300047447 Ga0495685_013987 Ga0495685_013987_858_1178 105
741 3300048903 Ga0496100_1238589 Ga0496100_1238589_190_513 105
742 3300048905 Ga0496102_0577213 Ga0496102_0577213_193_513 105
743 3300048909 Ga0496106_0138601 Ga0496106_0138601_28_351 105
744 3300048910 Ga0496107_1382665 Ga0496107_1382665_124_447 105
745 3300048912 Ga0496109_0540907 Ga0496109_0540907_360_683 105
746 3300059492 Ga0587073_0116826 Ga0587073_0116826_65_385 105
747 3300059493 Ga0587077_113410 Ga0587077_113410_319_639 105
748 3300059503 Ga0587080_099869 Ga0587080_099869_108_428 105
749 3300059604 Ga0587098_005666 Ga0587098_005666_485_802 105
750 3300059605 Ga0587106_009824 Ga0587106_009824_458_775 105
751 3300059640 Ga0587067_023577 Ga0587067_023577_456_776 105
752 3300060344 Ga0587071_016330 Ga0587071_016330_595_918 105
753 iso_pu_bacteria 3006425503 3006427943 105
754 3300012512 Ga0157327_1044190 Ga0157327_10441902 106
755 3300037466 Ga0395898_0953350 Ga0395898_0953350_207_530 106
756 3300049568 Ga0501031_0003261 Ga0501031_0003261_3295_3618 106
757 3300049569 Ga0501032_0001347 Ga0501032_0001347_3327_3650 106
758 3300049570 Ga0501033_0005545 Ga0501033_0005545_2970_3293 106
759 3300049571 Ga0501034_0011756 Ga0501034_0011756_6686_7009 106
760 3300049572 Ga0501036_0074674 Ga0501036_0074674_2050_2373 106
761 3300049573 Ga0501037_0004030 Ga0501037_0004030_6703_7026 106
762 3300049574 Ga0501038_0007465 Ga0501038_0007465_6691_7014 106
763 3300049575 Ga0501039_0003016 Ga0501039_0003016_1640_1963 106
764 3300049576 Ga0501040_0002706 Ga0501040_0002706_3478_3801 106
765 3300049577 Ga0501041_0002671 Ga0501041_0002671_2902_3225 106
766 3300049578 Ga0501042_0088501 Ga0501042_0088501_1532_1855 106
767 3300049579 Ga0501043_0028012 Ga0501043_0028012_2049_2372 106
768 3300049580 Ga0501046_0002011 Ga0501046_0002011_2050_2373 106
769 3300049581 Ga0501047_0008040 Ga0501047_0008040_6659_6982 106
770 3300049582 Ga0501048_0001026 Ga0501048_0001026_4352_4675 106
771 3300049583 Ga0501067_0000592 Ga0501067_0000592_3098_3421 106
772 3300049584 Ga0501068_0003271 Ga0501068_0003271_6722_7045 106
773 3300049585 Ga0501069_0005589 Ga0501069_0005589_5722_6045 106
774 3300049586 Ga0501070_0004123 Ga0501070_0004123_1532_1855 106
775 3300049587 Ga0501071_0045415 Ga0501071_0045415_1299_1622 106
776 3300049588 Ga0501072_0001152 Ga0501072_0001152_3331_3654 106
777 3300049589 Ga0501073_0004460 Ga0501073_0004460_6686_7009 106
778 3300049590 Ga0501074_0003829 Ga0501074_0003829_2050_2373 106
779 3300049591 Ga0501075_0343782 Ga0501075_0343782_345_668 106
780 3300049592 Ga0501076_0010773 Ga0501076_0010773_2507_2830 106
781 3300049593 Ga0501077_0031876 Ga0501077_0031876_2145_2468 106
782 3300049741 Ga0501079_0007489 Ga0501079_0007489_3478_3801 106
783 3300049742 Ga0501080_0091006 Ga0501080_0091006_2144_2467 106
784 3300049744 Ga0501083_0008844 Ga0501083_0008844_3733_4056 106
785 3300049822 Ga0501035_0097200 Ga0501035_0097200_2050_2373 106
786 3300049823 Ga0501044_0010423 Ga0501044_0010423_6691_7014 106
787 3300049824 Ga0501045_0005656 Ga0501045_0005656_6686_7009 106
788 3300053140 Ga0500573_0180499 Ga0500573_0180499_171_491 106
789 3300054114 Ga0501084_0001550 Ga0501084_0001550_2560_2883 106
790 3300060353 Ga0501082_0013322 Ga0501082_0013322_2070_2393 106
791 3300003354 JGI25160J50197_1032287 JGI25160J50197_10322872 107
792 3300004801 Ga0058860_10020864 Ga0058860_100208642 107
793 3300004803 Ga0058862_12685021 Ga0058862_126850212 107
794 3300009036 Ga0105244_10576351 Ga0105244_105763511 107
795 3300010375 Ga0105239_10942334 Ga0105239_109423342 107
796 3300014969 Ga0157376_10234942 Ga0157376_102349423 107
797 3300022467 Ga0224712_10528619 Ga0224712_105286192 107
798 3300025302 Ga0207426_1005083 Ga0207426_10050836 107
799 3300025932 Ga0207690_11111234 Ga0207690_111112342 107
800 3300026067 Ga0207678_11371858 Ga0207678_113718582 107
801 3300028379 Ga0268266_10099981 Ga0268266_100999815 107
802 3300030500 Ga0268256_1062540 Ga0268256_10625401 107
803 3300030521 Ga0307511_10285694 Ga0307511_102856942 107
804 3300031616 Ga0307508_10000924 Ga0307508_1000092442 107
805 3300031616 Ga0307508_10263909 Ga0307508_102639093 107
806 3300031730 Ga0307516_10190827 Ga0307516_101908273 107
807 3300035115 Ga0373941_0239828 Ga0373941_0239828_273_605 107
808 3300044842 Ga0466957_0650656 Ga0466957_0650656_148_495 107
809 3300045976 Ga0466967_0238227 Ga0466967_0238227_584_931 107
810 3300046454 Ga0495592_0005017 Ga0495592_0005017_7936_8268 107
811 3300046455 Ga0495603_0206622 Ga0495603_0206622_649_981 107
812 3300046459 Ga0495629_0060688 Ga0495629_0060688_857_1189 107
813 3300046459 Ga0495629_0201351 Ga0495629_0201351_912_1238 107
814 3300046462 Ga0495651_0005300 Ga0495651_0005300_8876_9208 107
815 3300046476 Ga0495662_0096445 Ga0495662_0096445_846_1178 107
816 3300046477 Ga0495664_0082835 Ga0495664_0082835_232_564 107
817 3300046492 Ga0495585_0147735 Ga0495585_0147735_743_1084 107
818 3300046499 Ga0495594_0308584 Ga0495594_0308584_397_729 107
819 3300046511 Ga0495608_0756532 Ga0495608_0756532_133_465 107
820 3300046514 Ga0495618_0004578 Ga0495618_0004578_1231_1563 107
821 3300046516 Ga0495628_0062544 Ga0495628_0062544_1436_1768 107
822 3300046526 Ga0495666_0065533 Ga0495666_0065533_228_560 107
823 3300046529 Ga0495652_0006542 Ga0495652_0006542_2199_2531 107
824 3300046529 Ga0495652_0549370 Ga0495652_0549370_249_590 107
825 3300046533 Ga0495640_0007026 Ga0495640_0007026_283_615 107
826 3300046535 Ga0495586_0673227 Ga0495586_0673227_112_438 107
827 3300046559 Ga0495667_0034127 Ga0495667_0034127_2784_3116 107
828 3300046559 Ga0495667_0343976 Ga0495667_0343976_138_479 107
829 3300046642 Ga0495634_0003443 Ga0495634_0003443_3129_3461 107
830 3300046648 Ga0495611_0048818 Ga0495611_0048818_1449_1790 107
831 3300046675 Ga0495657_0004038 Ga0495657_0004038_3039_3371 107
832 3300046679 Ga0495623_0420944 Ga0495623_0420944_347_679 107
833 3300046689 Ga0495613_0005971 Ga0495613_0005971_7286_7618 107
834 3300046690 Ga0495624_0059145 Ga0495624_0059145_1601_1933 107
835 3300046809 Ga0495600_0007794 Ga0495600_0007794_3324_3656 107
836 3300047317 Ga0495604_0003385 Ga0495604_0003385_8387_8719 107
837 3300047321 Ga0495676_0015246 Ga0495676_0015246_3484_3816 107
838 3300047322 Ga0495680_0673789 Ga0495680_0673789_73_405 107
839 3300047444 Ga0495675_0088539 Ga0495675_0088539_852_1184 107
840 3300047444 Ga0495675_0089338 Ga0495675_0089338_271_612 107
841 3300048089 Ga0495614_0076371 Ga0495614_0076371_828_1154 107
842 3300049569 Ga0501032_0221765 Ga0501032_0221765_253_600 107
843 3300049569 Ga0501032_0650407 Ga0501032_0650407_216_635 107
844 3300049571 Ga0501034_0177975 Ga0501034_0177975_426_773 107
845 3300049572 Ga0501036_0302136 Ga0501036_0302136_224_571 107
846 3300049573 Ga0501037_0392039 Ga0501037_0392039_337_756 107
847 3300049574 Ga0501038_0130009 Ga0501038_0130009_115_534 107
848 3300049575 Ga0501039_0341118 Ga0501039_0341118_309_656 107
849 3300049578 Ga0501042_0073359 Ga0501042_0073359_687_1022 107
850 3300049579 Ga0501043_0274529 Ga0501043_0274529_335_682 107
851 3300049581 Ga0501047_0119157 Ga0501047_0119157_686_1021 107
852 3300049581 Ga0501047_0220639 Ga0501047_0220639_773_1120 107
853 3300049822 Ga0501035_0122555 Ga0501035_0122555_1291_1638 107
854 3300049823 Ga0501044_0301918 Ga0501044_0301918_474_821 107
855 3300053083 Ga0495655_0105304 Ga0495655_0105304_132_458 107
856 3300053177 Ga0500636_0313595 Ga0500636_0313595_136_480 107
857 3300059647 Ga0587079_076859 Ga0587079_076859_197_523 107
858 iso_pu_bacteria 2912715099 2912718451 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

31

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9555 14 104
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9537 13 98
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9529 11 101
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9438 14 98
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9431 14 100
ID Description Score Start End Superfamily
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9489 13 95 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9374 13 99 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9308 16 99 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9215 16 101 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9075 13 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A419EVM5-F1-model_v4 Large ribosomal subunit protein uL23 0.9787 13 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A369VT02-F1-model_v4 Large ribosomal subunit protein uL23 0.978 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A399FYL2-F1-model_v4 Large ribosomal subunit protein uL23 0.9778 13 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7V9E522-F1-model_v4 50S ribosomal protein L23 0.9774 13 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6YI82-F1-model_v4 Large ribosomal subunit protein uL23 0.977 14 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.13 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map