F483681

General Info

Members Datasets Scaffolds Average Seq Length
857 370 1714 235

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10029209|Ga0070703_100292092
Length 283
Sequence MSAGLLNFGGRRPPLQFQRWTFDVQRSMFFPMRIDIVTLFPEICRAPLSESMMKRAKDKQIVDLHIHNLRDWTTDKHHVVDDAPFGGGQGMVMKPEPIFAAVEALKKTPNSDESRAGAQRPSAFAEATADKTSNVQVQSPKVILMSPAGRRFDQQIATHLSREPHLIIISGHYEGVDHRVIEHLIDLEISIGDYVLTNGAIAAVVLVDSIVRLLPGTLGHEQSADDDSFSDGLLEAPQYTRPADFRGWKVPGVLLSGNHAEIAAWRKEQAIKRTRENRPDLFR

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
215 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
221 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
247 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
255 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
260 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
337 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
338 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
339 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
360 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
361 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
362 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
369 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
370 2841917233 Bosea caraganae RCAM04680 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 1.05
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0.12
Rhizoplane 4.9
Rhizosphere 91.02
Stem 0
Stem Tuber 0
Unclassified 16.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10029209 3300005406 Unclassified 1653
2 MBSR1b_contig_7586419 2162886012 Bacteria 1113
3 CNXas_1000173 3300000545 Bacteria 10476
4 JGI24737J22298_10053954 3300001990 Bacteria 1217
5 JGI24035J26624_1001641 3300002126 Bacteria 2104
6 JGI25154J39366_1000021 3300002738 Bacteria 221559
7 JGI25157J39369_1004223 3300002741 Bacteria 2669
8 JGI25406J46586_10000033 3300003203 Bacteria 65430
9 rootH2_10252392 3300003320 Bacteria 3143
10 rootL2_10090880 3300003322 Bacteria 3946
11 rootH1_10015975 3300003323 Bacteria 21495
12 rootH1_10030944 3300003323 Bacteria 14680
13 JGI25160J50197_1004110 3300003354 Bacteria 6342
14 JGI25405J52794_10000071 3300003911 Bacteria 11109
15 Ga0058860_10016173 3300004801 Bacteria 1134
16 Ga0065165_1008080 3300005262 Bacteria 5020
17 Ga0065703_1019259 3300005272 Unclassified 3377
18 Ga0065704_10081204 3300005289 Unclassified 3803
19 Ga0065704_10105669 3300005289 Bacteria 2104
20 Ga0065712_10021943 3300005290 Unclassified 1777
21 Ga0065712_10035301 3300005290 Bacteria 1295
22 Ga0065712_10036074 3300005290 Unclassified 981
23 Ga0065712_10087329 3300005290 Unclassified 2580
24 Ga0065715_10000818 3300005293 Bacteria 11586
25 Ga0065715_10089774 3300005293 Bacteria 8553
26 Ga0065715_10141888 3300005293 Unclassified 1841
27 Ga0065715_10239743 3300005293 Unclassified 1203
28 Ga0065707_10013292 3300005295 Unclassified 2318
29 Ga0065707_10033018 3300005295 Bacteria 1175
30 Ga0065707_10110072 3300005295 Bacteria 2438
31 Ga0065707_10156512 3300005295 Bacteria 1604
32 Ga0070676_10068433 3300005328 Bacteria 2125
33 Ga0070676_10091736 3300005328 Bacteria 1862
34 Ga0070676_10154840 3300005328 Bacteria 1470
35 Ga0070683_100000659 3300005329 Bacteria 24948
36 Ga0070683_100047367 3300005329 Unclassified 3972
37 Ga0070683_100216842 3300005329 Bacteria 1818
38 Ga0070683_100610802 3300005329 Bacteria 1044
39 Ga0070690_100017352 3300005330 Bacteria 4326
40 Ga0070690_100078704 3300005330 Unclassified 2154
41 Ga0070690_100231428 3300005330 Unclassified 1300
42 Ga0070670_100076633 3300005331 Bacteria 2873
43 Ga0068869_100004530 3300005334 Bacteria 8648
44 Ga0068869_100184530 3300005334 Unclassified 1637
45 Ga0070666_10193830 3300005335 Unclassified 1428
46 Ga0070666_10583953 3300005335 Unclassified 815
47 Ga0070680_100002447 3300005336 Bacteria 13759
48 Ga0070680_100079457 3300005336 Bacteria 2703
49 Ga0070680_100565455 3300005336 Bacteria 975
50 Ga0068868_100130426 3300005338 Bacteria 2057
51 Ga0068868_100131474 3300005338 Bacteria 2048
52 Ga0068868_100221531 3300005338 Bacteria 1584
53 Ga0068868_100363113 3300005338 Bacteria 1243
54 Ga0070660_100109268 3300005339 Bacteria 2199
55 Ga0070660_100395116 3300005339 Unclassified 1143
56 Ga0070689_100008263 3300005340 Bacteria 7324
57 Ga0070689_100034716 3300005340 Unclassified 3848
58 Ga0070689_100179317 3300005340 Unclassified 1720
59 Ga0070689_100511303 3300005340 Bacteria 1030
60 Ga0070691_10005767 3300005341 Bacteria 5648
61 Ga0070691_10032834 3300005341 Bacteria 2440
62 Ga0070661_100000952 3300005344 Bacteria 20625
63 Ga0070661_100123174 3300005344 Bacteria 1943
64 Ga0070661_100239683 3300005344 Bacteria 1396
65 Ga0070661_100253920 3300005344 Bacteria 1358
66 Ga0070661_100265666 3300005344 Unclassified 1327
67 Ga0070668_100018032 3300005347 Bacteria 5295
68 Ga0070668_100053780 3300005347 Bacteria 3104
69 Ga0070669_100020563 3300005353 Bacteria 4714
70 Ga0070669_100033012 3300005353 Unclassified 3741
71 Ga0070675_100007201 3300005354 Bacteria 8574
72 Ga0070675_100029889 3300005354 Bacteria 4396
73 Ga0070675_100040375 3300005354 Unclassified 3809
74 Ga0070675_100048421 3300005354 Bacteria 3485
75 Ga0070675_100097464 3300005354 Unclassified 2472
76 Ga0070675_100139940 3300005354 Bacteria 2068
77 Ga0070675_100141355 3300005354 Bacteria 2058
78 Ga0070675_100202070 3300005354 Bacteria 1725
79 Ga0070671_100010731 3300005355 Bacteria 7354
80 Ga0070671_100200603 3300005355 Bacteria 1691
81 Ga0070671_100476199 3300005355 Unclassified 1072
82 Ga0070674_100059729 3300005356 Bacteria 2655
83 Ga0070674_100119364 3300005356 Bacteria 1950
84 Ga0070673_100282283 3300005364 Unclassified 1457
85 Ga0070688_100022421 3300005365 Bacteria 3700
86 Ga0070688_100354113 3300005365 Bacteria 1075
87 Ga0070659_100002818 3300005366 Bacteria 12381
88 Ga0070667_100014676 3300005367 Bacteria 6472
89 Ga0070667_100086230 3300005367 Unclassified 2693
90 Ga0070667_100133588 3300005367 Bacteria 2168
91 Ga0070667_100274312 3300005367 Bacteria 1513
92 Ga0070667_100497314 3300005367 Unclassified 1117
93 Ga0070703_10000413 3300005406 Bacteria 17664
94 Ga0070709_10002322 3300005434 Bacteria 10306
95 Ga0070709_10244599 3300005434 Unclassified 1290
96 Ga0070714_100684739 3300005435 Bacteria 989
97 Ga0070713_100057130 3300005436 Bacteria 3247
98 Ga0070713_100068469 3300005436 Bacteria 2991
99 Ga0070701_10027627 3300005438 Bacteria 2782
100 Ga0070705_100001251 3300005440 Bacteria 13709
101 Ga0070700_100002720 3300005441 Bacteria 9036
102 Ga0070694_100014391 3300005444 Bacteria 4952
103 Ga0070694_100020561 3300005444 Bacteria 4210
104 Ga0070694_100072541 3300005444 Unclassified 2375
105 Ga0070694_100207616 3300005444 Bacteria 1463
106 Ga0070708_100032254 3300005445 Bacteria 4542
107 Ga0070708_100034795 3300005445 Unclassified 4384
108 Ga0070708_100040417 3300005445 Bacteria 4084
109 Ga0070708_100048315 3300005445 Bacteria 3761
110 Ga0070708_100087214 3300005445 Unclassified 2836
111 Ga0070708_100112762 3300005445 Unclassified 2501
112 Ga0070708_100122396 3300005445 Unclassified 2401
113 Ga0070708_100128086 3300005445 Bacteria 2348
114 Ga0070708_100313602 3300005445 Bacteria 1477
115 Ga0070708_100630462 3300005445 Unclassified 1010
116 Ga0070663_100024635 3300005455 Bacteria 4054
117 Ga0070663_100160017 3300005455 Bacteria 1733
118 Ga0070678_100037047 3300005456 Bacteria 3421
119 Ga0070678_100380241 3300005456 Bacteria 1221
120 Ga0070662_100029761 3300005457 Unclassified 3814
121 Ga0070662_100196548 3300005457 Bacteria 1598
122 Ga0070662_100275438 3300005457 Bacteria 1360
123 Ga0070681_10003953 3300005458 Bacteria 13971
124 Ga0070681_10021678 3300005458 Bacteria 6442
125 Ga0070681_10124558 3300005458 Bacteria 2510
126 Ga0068867_100130568 3300005459 Unclassified 1952
127 Ga0068867_100486000 3300005459 Bacteria 1059
128 Ga0070685_10389269 3300005466 Unclassified 963
129 Ga0070706_100002101 3300005467 Bacteria 20309
130 Ga0070706_100023080 3300005467 Bacteria 5730
131 Ga0070706_100041915 3300005467 Bacteria 4228
132 Ga0070706_100068717 3300005467 Unclassified 3276
133 Ga0070706_100101253 3300005467 Unclassified 2677
134 Ga0070706_100129303 3300005467 Bacteria 2356
135 Ga0070706_100353727 3300005467 Bacteria 1369
136 Ga0070706_100388441 3300005467 Bacteria 1299
137 Ga0070706_100552553 3300005467 Bacteria 1071
138 Ga0070707_100056199 3300005468 Bacteria 3775
139 Ga0070707_100066081 3300005468 Unclassified 3475
140 Ga0070707_100076353 3300005468 Bacteria 3232
141 Ga0070707_100085864 3300005468 Bacteria 3042
142 Ga0070707_100231094 3300005468 Bacteria 1800
143 Ga0070698_100002787 3300005471 Bacteria 19245
144 Ga0070698_100013682 3300005471 Bacteria 8590
145 Ga0070698_100015916 3300005471 Bacteria 7941
146 Ga0070698_100217232 3300005471 Unclassified 1846
147 Ga0070698_100226942 3300005471 Bacteria 1801
148 Ga0070698_100469777 3300005471 Bacteria 1194
149 Ga0070699_100000167 3300005518 Bacteria 63239
150 Ga0070699_100085600 3300005518 Bacteria 2750
151 Ga0070699_100119632 3300005518 Bacteria 2315
152 Ga0070679_100026678 3300005530 Bacteria 5680
153 Ga0070679_100618874 3300005530 Bacteria 1026
154 Ga0070684_100019533 3300005535 Bacteria 5606
155 Ga0070684_100074348 3300005535 Bacteria 2995
156 Ga0070684_100095622 3300005535 Bacteria 2647
157 Ga0070684_100349065 3300005535 Bacteria 1361
158 Ga0070697_100000048 3300005536 Bacteria 90644
159 Ga0070697_100000474 3300005536 Bacteria 30635
160 Ga0070697_100004757 3300005536 Bacteria 10407
161 Ga0070697_100015869 3300005536 Bacteria 5919
162 Ga0070697_100123199 3300005536 Bacteria 2170
163 Ga0070697_100292293 3300005536 Bacteria 1400
164 Ga0070697_100406547 3300005536 Bacteria 1182
165 Ga0068853_100002491 3300005539 Bacteria 13803
166 Ga0068853_100068883 3300005539 Unclassified 3077
167 Ga0068853_100174164 3300005539 Bacteria 1948
168 Ga0068853_100734542 3300005539 Unclassified 943
169 Ga0068853_100901922 3300005539 Unclassified 849
170 Ga0070672_100257951 3300005543 Bacteria 1470
171 Ga0070686_100116977 3300005544 Bacteria 1825
172 Ga0070695_100001686 3300005545 Bacteria 12461
173 Ga0070695_100004004 3300005545 Bacteria 8613
174 Ga0070695_100472990 3300005545 Bacteria 964
175 Ga0070696_100000097 3300005546 Bacteria 44009
176 Ga0070696_100198488 3300005546 Unclassified 1497
177 Ga0070696_100313726 3300005546 Bacteria 1205
178 Ga0070693_100017105 3300005547 Bacteria 3764
179 Ga0070665_100071750 3300005548 Unclassified 3470
180 Ga0070665_100100354 3300005548 Unclassified 2898
181 Ga0070665_100246681 3300005548 Unclassified 1786
182 Ga0070704_100107341 3300005549 Bacteria 2117
183 Ga0068855_100383466 3300005563 Unclassified 1543
184 Ga0070664_100000140 3300005564 Bacteria 49126
185 Ga0070664_100018951 3300005564 Bacteria 5658
186 Ga0070664_100227169 3300005564 Unclassified 1672
187 Ga0070664_100301195 3300005564 Bacteria 1449
188 Ga0070664_100675592 3300005564 Unclassified 961
189 Ga0068857_100000920 3300005577 Bacteria 22265
190 Ga0068857_100035103 3300005577 Unclassified 4438
191 Ga0068857_100259336 3300005577 Unclassified 1595
192 Ga0068857_100269346 3300005577 Bacteria 1565
193 Ga0068854_100172272 3300005578 Bacteria 1685
194 Ga0068854_100299563 3300005578 Bacteria 1300
195 Ga0068856_100049346 3300005614 Unclassified 4149
196 Ga0068856_100083204 3300005614 Bacteria 3177
197 Ga0068856_100119934 3300005614 Bacteria 2632
198 Ga0068852_100014947 3300005616 Bacteria 6000
199 Ga0068852_100025251 3300005616 Unclassified 4812
200 Ga0068852_100029671 3300005616 Bacteria 4495
201 Ga0068859_100008885 3300005617 Bacteria 10145
202 Ga0068859_100018252 3300005617 Bacteria 7053
203 Ga0068859_100030786 3300005617 Bacteria 5385
204 Ga0068859_100105063 3300005617 Bacteria 2884
205 Ga0068859_100399564 3300005617 Bacteria 1470
206 Ga0068859_100632947 3300005617 Bacteria 1162
207 Ga0068864_100009521 3300005618 Bacteria 8016
208 Ga0068864_100060004 3300005618 Bacteria 3293
209 Ga0068864_100073539 3300005618 Bacteria 2980
210 Ga0068866_10042241 3300005718 Bacteria 2268
211 Ga0068866_10364679 3300005718 Bacteria 922
212 Ga0068861_100031378 3300005719 Bacteria 3903
213 Ga0068861_100055663 3300005719 Bacteria 3017
214 Ga0068861_100110550 3300005719 Bacteria 2201
215 Ga0068861_100494260 3300005719 Bacteria 1105
216 Ga0068863_100068582 3300005841 Bacteria 3354
217 Ga0068858_100017598 3300005842 Bacteria 6700
218 Ga0068858_100047472 3300005842 Bacteria 3980
219 Ga0068858_100275989 3300005842 Bacteria 1600
220 Ga0068860_100008192 3300005843 Bacteria 10403
221 Ga0068860_100029806 3300005843 Bacteria 5249
222 Ga0068860_100032276 3300005843 Bacteria 5032
223 Ga0068860_100051810 3300005843 Bacteria 3904
224 Ga0068860_100114058 3300005843 Bacteria 2584
225 Ga0068862_100014430 3300005844 Bacteria 6555
226 Ga0081455_10000017 3300005937 Bacteria 174550
227 Ga0081455_10002335 3300005937 Bacteria 22643
228 Ga0081455_10006179 3300005937 Bacteria 12918
229 Ga0081455_10007060 3300005937 Bacteria 11921
230 Ga0081455_10073714 3300005937 Bacteria 2821
231 Ga0081455_10149208 3300005937 Bacteria 1805
232 Ga0081540_1000059 3300005983 Bacteria 120226
233 Ga0081540_1004731 3300005983 Bacteria 10293
234 Ga0081540_1036976 3300005983 Bacteria 2594
235 Ga0081540_1064959 3300005983 Bacteria 1719
236 Ga0081539_10000138 3300005985 Bacteria 170633
237 Ga0081539_10007397 3300005985 Bacteria 10038
238 Ga0081539_10031515 3300005985 Bacteria 3266
239 Ga0081539_10037765 3300005985 Bacteria 2871
240 Ga0070717_10347379 3300006028 Bacteria 1326
241 Ga0070715_10235339 3300006163 Bacteria 949
242 Ga0070716_100000803 3300006173 Bacteria 13498
243 Ga0070716_100095930 3300006173 Bacteria 1806
244 Ga0070712_100021078 3300006175 Bacteria 4274
245 Ga0070712_100186381 3300006175 Bacteria 1620
246 Ga0097621_100043533 3300006237 Unclassified 3619
247 Ga0097621_100393316 3300006237 Bacteria 1240
248 Ga0075370_10110949 3300006353 Bacteria 1593
249 Ga0068871_100023395 3300006358 Unclassified 4779
250 Ga0068871_100146109 3300006358 Bacteria 2013
251 Ga0075428_100051385 3300006844 Bacteria 4520
252 Ga0075428_100051603 3300006844 Bacteria 4510
253 Ga0075428_100297550 3300006844 Bacteria 1735
254 Ga0075428_100733243 3300006844 Bacteria 1052
255 Ga0075430_100065315 3300006846 Bacteria 3057
256 Ga0075431_100000652 3300006847 Bacteria 29451
257 Ga0075431_100025306 3300006847 Bacteria 6085
258 Ga0075431_100113527 3300006847 Unclassified 2796
259 Ga0075434_100054243 3300006871 Bacteria 3983
260 Ga0075434_100065221 3300006871 Bacteria 3626
261 Ga0075434_100164826 3300006871 Bacteria 2236
262 Ga0075429_100097920 3300006880 Bacteria 2559
263 Ga0075429_100166401 3300006880 Unclassified 1931
264 Ga0068865_100423651 3300006881 Bacteria 1095
265 Ga0075436_100081698 3300006914 Bacteria 2241
266 Ga0097620_100008885 3300006931 Bacteria 10145
267 Ga0097620_100018252 3300006931 Bacteria 7053
268 Ga0097620_100030786 3300006931 Bacteria 5385
269 Ga0097620_100105060 3300006931 Bacteria 2884
270 Ga0097620_100399566 3300006931 Bacteria 1470
271 Ga0075435_100224923 3300007076 Unclassified 1594
272 Ga0075435_100395589 3300007076 Bacteria 1188
273 Ga0099795_10076067 3300007788 Bacteria 1276
274 Ga0105250_10213031 3300009092 Bacteria 817
275 Ga0105240_10000150 3300009093 Bacteria 141609
276 Ga0105240_10030562 3300009093 Bacteria 6999
277 Ga0105240_10056656 3300009093 Bacteria 4903
278 Ga0111539_10034190 3300009094 Bacteria 6167
279 Ga0111539_10054417 3300009094 Bacteria 4762
280 Ga0111539_10282784 3300009094 Bacteria 1930
281 Ga0111539_10492719 3300009094 Bacteria 1427
282 Ga0105245_10011604 3300009098 Bacteria 7676
283 Ga0105245_10022684 3300009098 Bacteria 5509
284 Ga0105245_10315678 3300009098 Bacteria 1538
285 Ga0105245_10368595 3300009098 Unclassified 1427
286 Ga0105247_10155816 3300009101 Unclassified 1509
287 Ga0105247_10168914 3300009101 Unclassified 1453
288 Ga0114129_10066808 3300009147 Bacteria 5015
289 Ga0114129_10361169 3300009147 Bacteria 1921
290 Ga0114129_10368295 3300009147 Bacteria 1900
291 Ga0114129_10691740 3300009147 Bacteria 1311
292 Ga0114129_11662856 3300009147 Bacteria 780
293 Ga0105243_10240869 3300009148 Bacteria 1610
294 Ga0105243_10528117 3300009148 Bacteria 1123
295 Ga0105243_10595996 3300009148 Bacteria 1063
296 Ga0105242_10005788 3300009176 Bacteria 9518
297 Ga0105242_10025578 3300009176 Bacteria 4673
298 Ga0105242_10367419 3300009176 Bacteria 1333
299 Ga0105248_10013050 3300009177 Bacteria 9155
300 Ga0105248_10137908 3300009177 Unclassified 2752
301 Ga0105238_10022856 3300009551 Bacteria 6374
302 Ga0105238_10254095 3300009551 Bacteria 1736
303 Ga0105249_10000885 3300009553 Bacteria 26607
304 Ga0105249_10001888 3300009553 Bacteria 18137
305 Ga0105249_10020942 3300009553 Bacteria 5849
306 Ga0105249_10079215 3300009553 Bacteria 3050
307 Ga0105249_10128855 3300009553 Bacteria 2413
308 Ga0105249_10187315 3300009553 Unclassified 2017
309 Ga0105249_10198234 3300009553 Bacteria 1963
310 Ga0105249_10220301 3300009553 Bacteria 1867
311 Ga0099796_10104135 3300010159 Bacteria 1072
312 Ga0105239_10101601 3300010375 Bacteria 3181
313 Ga0105239_10104460 3300010375 Bacteria 3137
314 Ga0105239_10302179 3300010375 Bacteria 1802
315 Ga0105239_10326497 3300010375 Bacteria 1731
316 Ga0105239_10520802 3300010375 Bacteria 1353
317 Ga0105239_10616425 3300010375 Bacteria 1238
318 Ga0105246_10021393 3300011119 Bacteria 4163
319 Ga0105246_10424948 3300011119 Bacteria 1110
320 Ga0157371_10045029 3300013102 Unclassified 3141
321 Ga0157371_10201852 3300013102 Bacteria 1425
322 Ga0157370_10001950 3300013104 Bacteria 25407
323 Ga0157370_10073759 3300013104 Unclassified 3220
324 Ga0157370_10097252 3300013104 Bacteria 2761
325 Ga0157369_10037193 3300013105 Bacteria 5329
326 Ga0157369_10092769 3300013105 Bacteria 3223
327 Ga0157369_10100499 3300013105 Unclassified 3083
328 Ga0157369_10418254 3300013105 Bacteria 1390
329 Ga0157374_10083296 3300013296 Bacteria 3039
330 Ga0157374_10163185 3300013296 Bacteria 2171
331 Ga0157374_10170898 3300013296 Bacteria 2120
332 Ga0157374_10188952 3300013296 Bacteria 2015
333 Ga0157374_10310855 3300013296 Unclassified 1560
334 Ga0157374_11076090 3300013296 Bacteria 824
335 Ga0157378_10008938 3300013297 Bacteria 8720
336 Ga0157378_10032506 3300013297 Bacteria 4610
337 Ga0157378_10088482 3300013297 Bacteria 2811
338 Ga0157378_10113278 3300013297 Bacteria 2490
339 Ga0157378_10212186 3300013297 Bacteria 1836
340 Ga0157378_10517332 3300013297 Bacteria 1194
341 Ga0157378_10801352 3300013297 Bacteria 968
342 Ga0163162_10000958 3300013306 Bacteria 26782
343 Ga0163162_10001067 3300013306 Bacteria 25476
344 Ga0163162_10001504 3300013306 Bacteria 21712
345 Ga0163162_10009864 3300013306 Bacteria 9289
346 Ga0163162_10051756 3300013306 Bacteria 4121
347 Ga0163162_10240077 3300013306 Unclassified 1943
348 Ga0163162_10302260 3300013306 Bacteria 1732
349 Ga0163162_10429061 3300013306 Bacteria 1454
350 Ga0163162_10470564 3300013306 Unclassified 1388
351 Ga0157372_10001731 3300013307 Bacteria 23669
352 Ga0157372_10034222 3300013307 Bacteria 5585
353 Ga0157372_10085768 3300013307 Bacteria 3572
354 Ga0157372_10117456 3300013307 Bacteria 3051
355 Ga0157372_10212079 3300013307 Bacteria 2244
356 Ga0157372_10224609 3300013307 Bacteria 2177
357 Ga0157372_10309134 3300013307 Unclassified 1840
358 Ga0157372_11422903 3300013307 Bacteria 799
359 Ga0157372_11574593 3300013307 Bacteria 756
360 Ga0157375_10022047 3300013308 Bacteria 5858
361 Ga0157375_10078964 3300013308 Bacteria 3325
362 Ga0157375_10118033 3300013308 Bacteria 2759
363 Ga0157375_10142890 3300013308 Unclassified 2521
364 Ga0157375_10185586 3300013308 Bacteria 2233
365 Ga0157375_10647761 3300013308 Bacteria 1213
366 Ga0157375_10891644 3300013308 Unclassified 1034
367 Ga0163163_10000244 3300014325 Bacteria 55634
368 Ga0163163_10010322 3300014325 Bacteria 8396
369 Ga0163163_10056274 3300014325 Unclassified 3888
370 Ga0163163_10360419 3300014325 Bacteria 1510
371 Ga0157380_11312593 3300014326 Bacteria 771
372 Ga0182008_10158309 3300014497 Bacteria 1138
373 Ga0157377_10198680 3300014745 Bacteria 1272
374 Ga0157377_10250241 3300014745 Unclassified 1148
375 Ga0157379_10036725 3300014968 Unclassified 4368
376 Ga0157379_10047334 3300014968 Bacteria 3837
377 Ga0157379_10241082 3300014968 Bacteria 1640
378 Ga0157379_10295203 3300014968 Bacteria 1476
379 Ga0157379_10541886 3300014968 Bacteria 1082
380 Ga0157376_10069089 3300014969 Bacteria 2994
381 Ga0157376_10086393 3300014969 Unclassified 2704
382 Ga0157376_10115339 3300014969 Bacteria 2371
383 Ga0157376_10365445 3300014969 Bacteria 1385
384 Ga0157376_10678005 3300014969 Unclassified 1034
385 Ga0182007_10046842 3300015262 Bacteria 1431
386 Ga0163161_10012978 3300017792 Bacteria 5789
387 Ga0209646_1000050 3300025246 Bacteria 296599
388 Ga0209026_1000826 3300025250 Bacteria 16529
389 Ga0207673_1003722 3300025290 Bacteria 1795
390 Ga0209758_1010862 3300025297 Bacteria 5371
391 Ga0207426_1000815 3300025302 Bacteria 33471
392 Ga0207697_10001007 3300025315 Bacteria 15769
393 Ga0207697_10002439 3300025315 Bacteria 9640
394 Ga0207697_10003119 3300025315 Bacteria 8285
395 Ga0207697_10006339 3300025315 Bacteria 5366
396 Ga0207697_10011610 3300025315 Bacteria 3720
397 Ga0207697_10056003 3300025315 Bacteria 1635
398 Ga0207656_10197099 3300025321 Bacteria 972
399 Ga0207653_10000588 3300025885 Bacteria 12860
400 Ga0207682_10150367 3300025893 Bacteria 1050
401 Ga0207642_10421082 3300025899 Bacteria 803
402 Ga0207688_10010957 3300025901 Bacteria 4933
403 Ga0207688_10198658 3300025901 Bacteria 1201
404 Ga0207680_10250176 3300025903 Bacteria 1224
405 Ga0207647_10053713 3300025904 Bacteria 2482
406 Ga0207647_10154981 3300025904 Bacteria 1338
407 Ga0207699_10000705 3300025906 Bacteria 15926
408 Ga0207699_10194231 3300025906 Unclassified 1371
409 Ga0207645_10004672 3300025907 Bacteria 10081
410 Ga0207684_10001884 3300025910 Bacteria 21813
411 Ga0207684_10021932 3300025910 Bacteria 5454
412 Ga0207684_10033922 3300025910 Bacteria 4340
413 Ga0207684_10036451 3300025910 Bacteria 4174
414 Ga0207684_10082150 3300025910 Bacteria 2743
415 Ga0207684_10137537 3300025910 Bacteria 2098
416 Ga0207684_10155114 3300025910 Bacteria 1971
417 Ga0207684_10267007 3300025910 Unclassified 1476
418 Ga0207684_10392006 3300025910 Unclassified 1194
419 Ga0207707_10109752 3300025912 Bacteria 2411
420 Ga0207695_10000238 3300025913 Bacteria 144406
421 Ga0207695_10078235 3300025913 Unclassified 3356
422 Ga0207671_10000255 3300025914 Bacteria 79933
423 Ga0207693_10055800 3300025915 Bacteria 3099
424 Ga0207693_10137522 3300025915 Bacteria 1921
425 Ga0207693_10198905 3300025915 Bacteria 1576
426 Ga0207693_10371589 3300025915 Bacteria 1119
427 Ga0207693_10469597 3300025915 Unclassified 983
428 Ga0207663_10004157 3300025916 Bacteria 7166
429 Ga0207663_10235386 3300025916 Bacteria 1340
430 Ga0207660_10003429 3300025917 Bacteria 10340
431 Ga0207660_10027842 3300025917 Bacteria 3861
432 Ga0207662_10148813 3300025918 Bacteria 1488
433 Ga0207662_10216868 3300025918 Bacteria 1244
434 Ga0207662_10287076 3300025918 Bacteria 1090
435 Ga0207657_10092555 3300025919 Bacteria 2520
436 Ga0207657_10149035 3300025919 Bacteria 1907
437 Ga0207649_10006771 3300025920 Bacteria 6225
438 Ga0207649_10093111 3300025920 Unclassified 1977
439 Ga0207652_10025689 3300025921 Bacteria 4899
440 Ga0207652_10421044 3300025921 Unclassified 1204
441 Ga0207652_10738418 3300025921 Bacteria 877
442 Ga0207646_10026757 3300025922 Bacteria 5262
443 Ga0207646_10059083 3300025922 Bacteria 3424
444 Ga0207646_10162489 3300025922 Unclassified 2015
445 Ga0207646_10189038 3300025922 Bacteria 1860
446 Ga0207646_10228675 3300025922 Unclassified 1680
447 Ga0207681_10065876 3300025923 Bacteria 2506
448 Ga0207681_10083374 3300025923 Bacteria 2262
449 Ga0207694_10112111 3300025924 Unclassified 2170
450 Ga0207650_10570193 3300025925 Bacteria 950
451 Ga0207650_10726505 3300025925 Bacteria 840
452 Ga0207659_10173601 3300025926 Bacteria 1702
453 Ga0207659_10182719 3300025926 Bacteria 1663
454 Ga0207659_10185682 3300025926 Bacteria 1651
455 Ga0207659_10434366 3300025926 Bacteria 1103
456 Ga0207659_10502505 3300025926 Unclassified 1026
457 Ga0207659_10840136 3300025926 Bacteria 789
458 Ga0207687_10318444 3300025927 Bacteria 1258
459 Ga0207700_10011937 3300025928 Bacteria 5570
460 Ga0207700_10092984 3300025928 Unclassified 2386
461 Ga0207700_10145586 3300025928 Unclassified 1952
462 Ga0207644_10072440 3300025931 Unclassified 2523
463 Ga0207644_10117041 3300025931 Unclassified 2023
464 Ga0207644_10167442 3300025931 Bacteria 1713
465 Ga0207644_10450950 3300025931 Bacteria 1057
466 Ga0207690_10268060 3300025932 Bacteria 1325
467 Ga0207690_10301255 3300025932 Bacteria 1254
468 Ga0207706_10022719 3300025933 Bacteria 5630
469 Ga0207706_10035490 3300025933 Bacteria 4433
470 Ga0207706_10053098 3300025933 Bacteria 3578
471 Ga0207706_10070895 3300025933 Unclassified 3065
472 Ga0207686_10192942 3300025934 Bacteria 1453
473 Ga0207670_10031551 3300025936 Bacteria 3397
474 Ga0207670_10059432 3300025936 Unclassified 2600
475 Ga0207670_10539321 3300025936 Bacteria 952
476 Ga0207670_10562192 3300025936 Unclassified 933
477 Ga0207669_10569582 3300025937 Bacteria 916
478 Ga0207704_10274805 3300025938 Bacteria 1277
479 Ga0207704_10402823 3300025938 Bacteria 1080
480 Ga0207665_10001465 3300025939 Bacteria 15884
481 Ga0207665_10007229 3300025939 Bacteria 7348
482 Ga0207691_10428532 3300025940 Unclassified 1127
483 Ga0207691_10446246 3300025940 Bacteria 1101
484 Ga0207691_10719061 3300025940 Unclassified 842
485 Ga0207691_10753584 3300025940 Bacteria 820
486 Ga0207711_10124524 3300025941 Unclassified 2304
487 Ga0207689_10085678 3300025942 Unclassified 2590
488 Ga0207689_10128113 3300025942 Bacteria 2088
489 Ga0207661_10009616 3300025944 Bacteria 6940
490 Ga0207661_10107956 3300025944 Bacteria 2349
491 Ga0207661_10148874 3300025944 Bacteria 2022
492 Ga0207661_10321829 3300025944 Unclassified 1390
493 Ga0207661_10343102 3300025944 Bacteria 1346
494 Ga0207679_10000266 3300025945 Bacteria 39927
495 Ga0207679_10130269 3300025945 Bacteria 2017
496 Ga0207679_10472333 3300025945 Bacteria 1115
497 Ga0207679_10512257 3300025945 Bacteria 1072
498 Ga0207667_10002275 3300025949 Bacteria 24140
499 Ga0207667_10552810 3300025949 Unclassified 1164
500 Ga0207667_10648869 3300025949 Bacteria 1061
501 Ga0207667_10839793 3300025949 Bacteria 913
502 Ga0207651_10018983 3300025960 Bacteria 4109
503 Ga0207651_10246222 3300025960 Unclassified 1460
504 Ga0207651_10618954 3300025960 Unclassified 948
505 Ga0207712_10000022 3300025961 Bacteria 284365
506 Ga0207712_10001350 3300025961 Bacteria 16801
507 Ga0207712_10061811 3300025961 Unclassified 2660
508 Ga0207668_10011168 3300025972 Bacteria 5450
509 Ga0207668_10011813 3300025972 Bacteria 5322
510 Ga0207668_10048345 3300025972 Bacteria 2919
511 Ga0207668_10138784 3300025972 Bacteria 1866
512 Ga0207668_10813237 3300025972 Bacteria 828
513 Ga0207640_10224144 3300025981 Bacteria 1441
514 Ga0207658_10135661 3300025986 Bacteria 1984
515 Ga0207677_10172167 3300026023 Bacteria 1694
516 Ga0207677_10329769 3300026023 Bacteria 1271
517 Ga0207677_10454010 3300026023 Bacteria 1099
518 Ga0207703_10054457 3300026035 Bacteria 3253
519 Ga0207639_10053177 3300026041 Bacteria 3089
520 Ga0207639_10104706 3300026041 Bacteria 2294
521 Ga0207639_10181260 3300026041 Bacteria 1792
522 Ga0207678_10001436 3300026067 Bacteria 21863
523 Ga0207678_10037896 3300026067 Bacteria 4192
524 Ga0207678_10058362 3300026067 Bacteria 3321
525 Ga0207708_10017756 3300026075 Bacteria 5356
526 Ga0207708_10024230 3300026075 Bacteria 4588
527 Ga0207708_10122660 3300026075 Bacteria 2026
528 Ga0207702_10220388 3300026078 Unclassified 1768
529 Ga0207641_10373961 3300026088 Bacteria 1363
530 Ga0207648_10191469 3300026089 Unclassified 1813
531 Ga0207676_10050860 3300026095 Bacteria 3233
532 Ga0207676_10455044 3300026095 Bacteria 1207
533 Ga0207674_10002088 3300026116 Bacteria 25283
534 Ga0207674_10006580 3300026116 Bacteria 13660
535 Ga0207674_10016158 3300026116 Bacteria 8177
536 Ga0207674_10281960 3300026116 Bacteria 1609
537 Ga0207674_10349164 3300026116 Unclassified 1430
538 Ga0207675_100061307 3300026118 Bacteria 3511
539 Ga0207675_100076129 3300026118 Bacteria 3142
540 Ga0207675_100152069 3300026118 Bacteria 2203
541 Ga0207683_10014801 3300026121 Bacteria 6639
542 Ga0207683_10158736 3300026121 Bacteria 2043
543 Ga0207683_10250859 3300026121 Unclassified 1615
544 Ga0207698_10003451 3300026142 Bacteria 9518
545 Ga0207698_10044423 3300026142 Unclassified 3338
546 Ga0268266_10073837 3300028379 Unclassified 2961
547 Ga0268266_10646974 3300028379 Unclassified 1017
548 Ga0268265_10000508 3300028380 Bacteria 40027
549 Ga0268265_10445318 3300028380 Bacteria 1208
550 Ga0268264_10000197 3300028381 Bacteria 123614
551 Ga0268264_10001291 3300028381 Bacteria 23642
552 Ga0268264_10007443 3300028381 Bacteria 9138
553 Ga0268264_10042968 3300028381 Bacteria 3743
554 Ga0307517_10006811 3300028786 Bacteria 16811
555 Ga0265338_10015716 3300028800 Bacteria 8294
556 Ga0265325_10087029 3300031241 Bacteria 1545
557 Ga0265339_10114024 3300031249 Bacteria 1396
558 Ga0265327_10000561 3300031251 Bacteria 63538
559 Ga0307513_10083524 3300031456 Bacteria 3284
560 Ga0307509_10035458 3300031507 Bacteria 5475
561 Ga0307509_10172469 3300031507 Bacteria 2040
562 Ga0265313_10138187 3300031595 Bacteria 1050
563 Ga0307508_10004669 3300031616 Bacteria 13286
564 Ga0316579_10000521 3300031691 Bacteria 12601
565 Ga0316579_10107466 3300031691 Bacteria 1338
566 Ga0265342_10019029 3300031712 Bacteria 4434
567 Ga0316576_10196928 3300031727 Bacteria 1518
568 Ga0316578_10047919 3300031728 Bacteria 2494
569 Ga0307516_10000966 3300031730 Bacteria 39704
570 Ga0307405_10380116 3300031731 Bacteria 1099
571 Ga0316577_10004181 3300031733 Bacteria 7414
572 Ga0307409_100233052 3300031995 Bacteria 1670
573 Ga0316585_10058021 3300032137 Unclassified 1247
574 Ga0316593_10019654 3300032168 Bacteria 2090
575 Ga0316593_10030415 3300032168 Bacteria 1753
576 Ga0316593_10088125 3300032168 Bacteria 1091
577 Ga0316592_1004811 3300033524 Bacteria 2530
578 Ga0316586_1002434 3300033527 Bacteria 2318
579 Ga0316588_1010076 3300033528 Bacteria 1984
580 Ga0316587_1002109 3300033529 Bacteria 2604
581 Ga0316596_1004536 3300033541 Bacteria 3122
582 Ga0373938_0005961 3300034957 Bacteria 2088
583 Ga0373928_0054528 3300035084 Bacteria 952
584 Ga0373934_0202892 3300035086 Unclassified 817
585 Ga0373940_0011843 3300035088 Bacteria 2080
586 Ga0373949_0005781 3300035090 Bacteria 2752
587 Ga0373941_0001726 3300035115 Bacteria 4694
588 Ga0373941_0013113 3300035115 Bacteria 2184
589 Ga0373945_0054651 3300035116 Bacteria 1477
590 Ga0373953_0033590 3300035117 Bacteria 2008
591 Ga0373943_0023734 3300035170 Bacteria 2854
592 Ga0373943_0129123 3300035170 Bacteria 1351
593 Ga0373946_0130202 3300035171 Bacteria 1157
594 Ga0373942_0022065 3300035207 Bacteria 1612
595 Ga0373942_0057512 3300035207 Bacteria 1107
596 Ga0373961_0003998 3300035241 Bacteria 3594
597 Ga0373962_0005834 3300035242 Bacteria 2972
598 Ga0373962_0048263 3300035242 Bacteria 1220
599 Ga0316574_0000247 3300035398 Bacteria 19636
600 Ga0316574_0499523 3300035398 Bacteria 759
601 Ga0373931_0000298 3300035691 Bacteria 20823
602 Ga0373931_0008938 3300035691 Bacteria 4774
603 Ga0373935_0009788 3300035692 Bacteria 5742
604 Ga0373935_0044051 3300035692 Bacteria 2811
605 Ga0373935_0184803 3300035692 Bacteria 1433
606 Ga0373927_0330383 3300035695 Bacteria 1004
607 Ga0373927_0452934 3300035695 Bacteria 848
608 Ga0373947_0097588 3300035725 Bacteria 1842
609 Ga0373947_0104905 3300035725 Bacteria 1780
610 Ga0373947_0157484 3300035725 Unclassified 1467
611 Ga0373937_0094486 3300036401 Bacteria 2772
612 Ga0373937_0175444 3300036401 Bacteria 2012
613 Ga0316582_0001370 3300036647 Bacteria 10613
614 Ga0316582_0412936 3300036647 Bacteria 930
615 Ga0316584_0018038 3300036712 Bacteria 5086
616 Ga0373925_0186234 3300037068 Bacteria 1646
617 Ga0373925_0198361 3300037068 Bacteria 1595
618 Ga0373925_0336197 3300037068 Unclassified 1224
619 Ga0373925_0736596 3300037068 Bacteria 813
620 Ga0395900_0124671 3300037418 Bacteria 2642
621 Ga0395898_0078886 3300037466 Bacteria 3177
622 Ga0395898_0233823 3300037466 Bacteria 1753
623 Ga0395905_0555959 3300037471 Unclassified 1049
624 Ga0316581_0007238 3300037588 Bacteria 2970
625 Ga0395901_0738991 3300038443 Bacteria 978
626 Ga0400486_18173 3300038742 Bacteria 1493
627 Ga0400487_27411 3300039110 Bacteria 3283
628 Ga0436361_0756768 3300039447 Bacteria 12131
629 Ga0436363_0343849 3300039450 Bacteria 803
630 Ga0436362_0792311 3300039453 Bacteria 1044
631 Ga0439451_007700 3300042009 Bacteria 2189
632 Ga0439455_0006330 3300042012 Bacteria 2453
633 Ga0451577_0036179 3300042876 Unclassified 4446
634 Ga0451577_0063609 3300042876 Bacteria 3290
635 Ga0466972_0000010 3300044658 Bacteria 256339
636 Ga0453683_0067696 3300044673 Bacteria 2232
637 Ga0453684_0001795 3300044712 Bacteria 56980
638 Ga0453684_0004535 3300044712 Bacteria 29128
639 Ga0453684_0148033 3300044712 Unclassified 2794
640 Ga0453684_0501094 3300044712 Unclassified 1344
641 Ga0451576_0115891 3300045051 Unclassified 2789
642 Ga0451576_0832790 3300045051 Bacteria 969
643 Ga0466967_0013442 3300045976 Bacteria 6326
644 Ga0495592_0031447 3300046454 Unclassified 4011
645 Ga0495641_0023049 3300046461 Bacteria 3102
646 Ga0495582_0230992 3300046473 Unclassified 1059
647 Ga0495605_0148677 3300046474 Bacteria 1047
648 Ga0495662_0033762 3300046476 Bacteria 2472
649 Ga0495662_0105686 3300046476 Bacteria 1378
650 Ga0495664_0045359 3300046477 Bacteria 2607
651 Ga0495628_0022456 3300046516 Bacteria 5182
652 Ga0495630_0027280 3300046517 Bacteria 4235
653 Ga0495637_0097222 3300046520 Bacteria 1155
654 Ga0495652_0012541 3300046529 Bacteria 7642
655 Ga0495587_0145719 3300046536 Bacteria 1350
656 Ga0495598_0030400 3300046537 Unclassified 1513
657 Ga0495621_0057622 3300046539 Bacteria 1403
658 Ga0495645_0011316 3300046543 Bacteria 6274
659 Ga0495667_0087215 3300046559 Unclassified 2024
660 Ga0495656_0055649 3300046615 Bacteria 1707
661 Ga0495668_0000138 3300046616 Bacteria 109654
662 Ga0495611_0000657 3300046648 Bacteria 19740
663 Ga0495635_0157111 3300046663 Bacteria 1548
664 Ga0495659_0014669 3300046664 Bacteria 2569
665 Ga0495599_0007832 3300046678 Bacteria 6485
666 Ga0495623_0015384 3300046679 Bacteria 4944
667 Ga0495613_0044243 3300046689 Bacteria 3295
668 Ga0495613_0105248 3300046689 Bacteria 2037
669 Ga0495624_0427017 3300046690 Unclassified 795
670 Ga0495649_0013184 3300046694 Bacteria 4774
671 Ga0495581_0226277 3300047315 Bacteria 1094
672 Ga0495636_0000135 3300047318 Bacteria 29480
673 Ga0495680_0255097 3300047322 Unclassified 1242
674 Ga0495687_000422 3300047443 Bacteria 52393
675 Ga0495675_0255221 3300047444 Unclassified 1052
676 Ga0495684_0151353 3300047471 Bacteria 1734
677 Ga0495686_0000265 3300047472 Bacteria 93838
678 Ga0495602_0043870 3300048088 Bacteria 4060
679 Ga0495614_0256543 3300048089 Bacteria 801
680 Ga0496100_0119869 3300048903 Unclassified 1839
681 Ga0496100_0230150 3300048903 Unclassified 1363
682 Ga0496100_0251796 3300048903 Bacteria 1307
683 Ga0496101_0013714 3300048904 Bacteria 5435
684 Ga0496101_0477194 3300048904 Unclassified 985
685 Ga0496102_0014638 3300048905 Bacteria 6818
686 Ga0496102_0069801 3300048905 Bacteria 3225
687 Ga0496102_0170928 3300048905 Bacteria 2046
688 Ga0496103_0075182 3300048906 Bacteria 2118
689 Ga0496103_0106043 3300048906 Bacteria 1782
690 Ga0496104_0081363 3300048907 Bacteria 3089
691 Ga0496104_0086153 3300048907 Unclassified 2999
692 Ga0496104_0119197 3300048907 Bacteria 2534
693 Ga0496104_0189826 3300048907 Bacteria 1966
694 Ga0496104_0312936 3300048907 Unclassified 1483
695 Ga0496105_0087775 3300048908 Bacteria 2570
696 Ga0496105_0102859 3300048908 Bacteria 2359
697 Ga0496106_0003553 3300048909 Bacteria 11611
698 Ga0496106_0025767 3300048909 Bacteria 4376
699 Ga0496108_0039382 3300048911 Bacteria 3940
700 Ga0496108_0487400 3300048911 Bacteria 1077
701 Ga0496109_0032212 3300048912 Unclassified 4711
702 Ga0496109_0061483 3300048912 Bacteria 3434
703 Ga0496109_0162697 3300048912 Unclassified 2091
704 Ga0496109_0313488 3300048912 Bacteria 1480
705 Ga0496109_0786623 3300048912 Bacteria 889
706 Ga0496110_0068266 3300048913 Unclassified 3147
707 Ga0496111_0195920 3300048914 Bacteria 1502
708 Ga0496112_0010080 3300048915 Bacteria 8557
709 Ga0496112_0178072 3300048915 Bacteria 2090
710 Ga0496112_0193518 3300048915 Bacteria 1995
711 Ga0496112_0264988 3300048915 Bacteria 1667
712 Ga0496113_0534377 3300048916 Unclassified 941
713 Ga0496113_0795923 3300048916 Bacteria 751
714 Ga0496114_0053668 3300048917 Unclassified 3359
715 Ga0496114_0110099 3300048917 Bacteria 2359
716 Ga0496114_0472415 3300048917 Unclassified 1110
717 Ga0496115_0008973 3300048918 Bacteria 7412
718 Ga0496115_0021153 3300048918 Bacteria 5022
719 Ga0496115_0076693 3300048918 Bacteria 2717
720 Ga0496115_0082513 3300048918 Bacteria 2619
721 Ga0496115_0112319 3300048918 Bacteria 2239
722 Ga0501031_0000153 3300049568 Bacteria 39050
723 Ga0501032_0000456 3300049569 Bacteria 32973
724 Ga0501032_0021619 3300049569 Bacteria 4472
725 Ga0501032_0035881 3300049569 Bacteria 3387
726 Ga0501033_0008105 3300049570 Bacteria 8140
727 Ga0501033_0032436 3300049570 Bacteria 3924
728 Ga0501034_0003873 3300049571 Bacteria 16843
729 Ga0501034_0009091 3300049571 Bacteria 10436
730 Ga0501034_0014329 3300049571 Bacteria 8171
731 Ga0501034_0015090 3300049571 Bacteria 7942
732 Ga0501034_0081815 3300049571 Bacteria 3231
733 Ga0501034_0610647 3300049571 Bacteria 995
734 Ga0501034_0674412 3300049571 Bacteria 934
735 Ga0501036_0002791 3300049572 Bacteria 13834
736 Ga0501036_0044485 3300049572 Bacteria 3761
737 Ga0501036_0098518 3300049572 Bacteria 2471
738 Ga0501037_0000343 3300049573 Bacteria 39227
739 Ga0501037_0002896 3300049573 Bacteria 12445
740 Ga0501037_0009568 3300049573 Bacteria 7114
741 Ga0501037_0142050 3300049573 Bacteria 1718
742 Ga0501037_0281334 3300049573 Bacteria 1159
743 Ga0501038_0008496 3300049574 Bacteria 9438
744 Ga0501038_0011895 3300049574 Bacteria 7942
745 Ga0501038_0028160 3300049574 Bacteria 4992
746 Ga0501039_0002968 3300049575 Bacteria 12695
747 Ga0501039_0028739 3300049575 Bacteria 4281
748 Ga0501039_0084025 3300049575 Bacteria 2479
749 Ga0501039_0253016 3300049575 Bacteria 1385
750 Ga0501039_0599930 3300049575 Bacteria 863
751 Ga0501040_0040603 3300049576 Bacteria 3166
752 Ga0501041_0122539 3300049577 Bacteria 1616
753 Ga0501043_0000764 3300049579 Bacteria 28593
754 Ga0501043_0017731 3300049579 Bacteria 5582
755 Ga0501043_0029801 3300049579 Bacteria 4287
756 Ga0501043_0091633 3300049579 Bacteria 2390
757 Ga0501046_0000677 3300049580 Bacteria 33065
758 Ga0501046_0012855 3300049580 Bacteria 7120
759 Ga0501046_0124122 3300049580 Bacteria 1963
760 Ga0501046_0147180 3300049580 Bacteria 1778
761 Ga0501046_0208460 3300049580 Bacteria 1452
762 Ga0501046_0209370 3300049580 Bacteria 1448
763 Ga0501047_0005336 3300049581 Bacteria 12081
764 Ga0501047_0007824 3300049581 Bacteria 10066
765 Ga0501047_0026451 3300049581 Bacteria 5582
766 Ga0501047_0119847 3300049581 Bacteria 2514
767 Ga0501047_0358057 3300049581 Bacteria 1295
768 Ga0501048_0010659 3300049582 Bacteria 6856
769 Ga0501067_0081217 3300049583 Bacteria 1797
770 Ga0501069_0000436 3300049585 Bacteria 18984
771 Ga0501070_0000684 3300049586 Bacteria 31074
772 Ga0501070_0004266 3300049586 Bacteria 12293
773 Ga0501070_0656602 3300049586 Bacteria 832
774 Ga0501071_0279205 3300049587 Bacteria 1264
775 Ga0501071_0361793 3300049587 Bacteria 1105
776 Ga0501072_0182435 3300049588 Bacteria 1674
777 Ga0501072_0292701 3300049588 Bacteria 1294
778 Ga0501073_0050198 3300049589 Bacteria 2924
779 Ga0501073_0050937 3300049589 Bacteria 2900
780 Ga0501074_0006737 3300049590 Bacteria 8288
781 Ga0501074_0067027 3300049590 Bacteria 2582
782 Ga0501075_0102758 3300049591 Bacteria 2171
783 Ga0501075_0120709 3300049591 Bacteria 1995
784 Ga0501075_0153200 3300049591 Bacteria 1757
785 Ga0501075_0336452 3300049591 Bacteria 1150
786 Ga0501076_0431936 3300049592 Bacteria 1084
787 Ga0501077_0012932 3300049593 Bacteria 5228
788 Ga0501079_0019576 3300049741 Bacteria 5170
789 Ga0501079_0027791 3300049741 Bacteria 4339
790 Ga0501079_0229249 3300049741 Bacteria 1451
791 Ga0501080_0000676 3300049742 Bacteria 27213
792 Ga0501080_0055007 3300049742 Bacteria 3706
793 Ga0501080_0560839 3300049742 Bacteria 1017
794 Ga0501081_0003747 3300049743 Bacteria 9734
795 Ga0501081_0020321 3300049743 Bacteria 4425
796 Ga0501081_0446346 3300049743 Bacteria 961
797 Ga0501083_0052215 3300049744 Bacteria 2747
798 Ga0501269_000381 3300049766 Bacteria 10694
799 Ga0501035_0006623 3300049822 Bacteria 10843
800 Ga0501035_0009852 3300049822 Bacteria 8873
801 Ga0501035_0025455 3300049822 Bacteria 5425
802 Ga0501044_0003064 3300049823 Bacteria 18914
803 Ga0501044_0007585 3300049823 Bacteria 11925
804 Ga0501044_0024840 3300049823 Bacteria 6356
805 Ga0501044_0047754 3300049823 Bacteria 4427
806 Ga0501044_0122104 3300049823 Bacteria 2605
807 Ga0501044_0162376 3300049823 Unclassified 2210
808 Ga0501044_0248406 3300049823 Bacteria 1721
809 Ga0501044_0252819 3300049823 Bacteria 1703
810 Ga0501045_0151188 3300049824 Bacteria 1727
811 Ga0501045_0167510 3300049824 Bacteria 1636
812 nmdc:mga0k408_15196_c1 3300050493 Bacteria 4254
813 nmdc:mga0k408_18452_c1 3300050493 Bacteria 3896
814 nmdc:mga05p37_207663_c1 3300050507 Bacteria 2368
815 nmdc:mga05p37_216407_c1 3300050507 Unclassified 2314
816 nmdc:mga05p37_435508_c1 3300050507 Bacteria 1522
817 nmdc:mga05p37_488230_c1 3300050507 Bacteria 1417
818 nmdc:mga05p37_739280_c1 3300050507 Bacteria 1086
819 nmdc:mga05p37_989227_c1 3300050507 Unclassified 895
820 nmdc:mga09592_126461_c1 3300050508 Bacteria 2197
821 nmdc:mga0qj67_64889_c1 3300050509 Bacteria 2906
822 nmdc:mga06r32_229289_c1 3300050510 Unclassified 1845
823 nmdc:mga06r32_407227_c1 3300050510 Bacteria 1342
824 nmdc:mga06r32_423349_c1 3300050510 Bacteria 1313
825 nmdc:mga06r32_427557_c1 3300050510 Bacteria 1305
826 nmdc:mga06r32_433871_c1 3300050510 Bacteria 1294
827 nmdc:mga06r32_479493_c1 3300050510 Bacteria 1222
828 nmdc:mga06r32_49787_c1 3300050510 Bacteria 4008
829 nmdc:mga06r32_9161_c1 3300050510 Bacteria 8920
830 nmdc:mga08y16_161046_c1 3300050511 Bacteria 2332
831 nmdc:mga08y16_162128_c1 3300050511 Bacteria 2323
832 nmdc:mga08y16_73156_c1 3300050511 Bacteria 3571
833 nmdc:mga0n895_281261_c1 3300050512 Bacteria 1687
834 nmdc:mga0n895_443705_c1 3300050512 Unclassified 1311
835 nmdc:mga0n895_538945_c1 3300050512 Bacteria 1173
836 nmdc:mga0n895_8224_c1 3300050512 Bacteria 9019
837 nmdc:mga0a205_13478_c1 3300050515 Bacteria 7612
838 nmdc:mga0a205_744965_c1 3300050515 Bacteria 828
839 Ga0495601_0012825 3300053077 Bacteria 5030
840 Ga0495612_0010520 3300053078 Bacteria 3739
841 Ga0495595_0072118 3300053084 Unclassified 1634
842 Ga0500646_0001454 3300053090 Bacteria 6272
843 Ga0500646_0027597 3300053090 Bacteria 1546
844 Ga0500583_0044381 3300053092 Bacteria 2036
845 Ga0500556_0035822 3300053104 Bacteria 1717
846 Ga0500594_0054022 3300053118 Bacteria 1140
847 Ga0500616_0002320 3300053153 Bacteria 16058
848 Ga0500622_0049763 3300053156 Bacteria 2160
849 Ga0501084_0005256 3300054114 Bacteria 10596
850 Ga0501082_0169310 3300060353 Bacteria 1899
851 Ga0501082_0287563 3300060353 Bacteria 1431
852 Ga0501082_0646907 3300060353 Bacteria 925
853 Ga0530510_0006543 3300061734 Bacteria 8119
854 Ga0530510_0353246 3300061734 Bacteria 1104
855 2740004033 2739367857 Bacteria 5433684
856 2740008850 2739367858 Bacteria 5432813
857 2841917994 2841917233 Bacteria 6173500
858 Ga0070703_10029209
859 MBSR1b_contig_7586419
860 CNXas_1000173
861 JGI24737J22298_10053954
862 JGI24035J26624_1001641
863 JGI25154J39366_1000021
864 JGI25157J39369_1004223
865 JGI25406J46586_10000033
866 rootH2_10252392
867 rootL2_10090880
868 rootH1_10015975
869 rootH1_10030944
870 JGI25160J50197_1004110
871 JGI25405J52794_10000071
872 Ga0058860_10016173
873 Ga0065165_1008080
874 Ga0065703_1019259
875 Ga0065704_10081204
876 Ga0065704_10105669
877 Ga0065712_10021943
878 Ga0065712_10035301
879 Ga0065712_10036074
880 Ga0065712_10087329
881 Ga0065715_10000818
882 Ga0065715_10089774
883 Ga0065715_10141888
884 Ga0065715_10239743
885 Ga0065707_10013292
886 Ga0065707_10033018
887 Ga0065707_10110072
888 Ga0065707_10156512
889 Ga0070676_10068433
890 Ga0070676_10091736
891 Ga0070676_10154840
892 Ga0070683_100000659
893 Ga0070683_100047367
894 Ga0070683_100216842
895 Ga0070683_100610802
896 Ga0070690_100017352
897 Ga0070690_100078704
898 Ga0070690_100231428
899 Ga0070670_100076633
900 Ga0068869_100004530
901 Ga0068869_100184530
902 Ga0070666_10193830
903 Ga0070666_10583953
904 Ga0070680_100002447
905 Ga0070680_100079457
906 Ga0070680_100565455
907 Ga0068868_100130426
908 Ga0068868_100131474
909 Ga0068868_100221531
910 Ga0068868_100363113
911 Ga0070660_100109268
912 Ga0070660_100395116
913 Ga0070689_100008263
914 Ga0070689_100034716
915 Ga0070689_100179317
916 Ga0070689_100511303
917 Ga0070691_10005767
918 Ga0070691_10032834
919 Ga0070661_100000952
920 Ga0070661_100123174
921 Ga0070661_100239683
922 Ga0070661_100253920
923 Ga0070661_100265666
924 Ga0070668_100018032
925 Ga0070668_100053780
926 Ga0070669_100020563
927 Ga0070669_100033012
928 Ga0070675_100007201
929 Ga0070675_100029889
930 Ga0070675_100040375
931 Ga0070675_100048421
932 Ga0070675_100097464
933 Ga0070675_100139940
934 Ga0070675_100141355
935 Ga0070675_100202070
936 Ga0070671_100010731
937 Ga0070671_100200603
938 Ga0070671_100476199
939 Ga0070674_100059729
940 Ga0070674_100119364
941 Ga0070673_100282283
942 Ga0070688_100022421
943 Ga0070688_100354113
944 Ga0070659_100002818
945 Ga0070667_100014676
946 Ga0070667_100086230
947 Ga0070667_100133588
948 Ga0070667_100274312
949 Ga0070667_100497314
950 Ga0070703_10000413
951 Ga0070709_10002322
952 Ga0070709_10244599
953 Ga0070714_100684739
954 Ga0070713_100057130
955 Ga0070713_100068469
956 Ga0070701_10027627
957 Ga0070705_100001251
958 Ga0070700_100002720
959 Ga0070694_100014391
960 Ga0070694_100020561
961 Ga0070694_100072541
962 Ga0070694_100207616
963 Ga0070708_100032254
964 Ga0070708_100034795
965 Ga0070708_100040417
966 Ga0070708_100048315
967 Ga0070708_100087214
968 Ga0070708_100112762
969 Ga0070708_100122396
970 Ga0070708_100128086
971 Ga0070708_100313602
972 Ga0070708_100630462
973 Ga0070663_100024635
974 Ga0070663_100160017
975 Ga0070678_100037047
976 Ga0070678_100380241
977 Ga0070662_100029761
978 Ga0070662_100196548
979 Ga0070662_100275438
980 Ga0070681_10003953
981 Ga0070681_10021678
982 Ga0070681_10124558
983 Ga0068867_100130568
984 Ga0068867_100486000
985 Ga0070685_10389269
986 Ga0070706_100002101
987 Ga0070706_100023080
988 Ga0070706_100041915
989 Ga0070706_100068717
990 Ga0070706_100101253
991 Ga0070706_100129303
992 Ga0070706_100353727
993 Ga0070706_100388441
994 Ga0070706_100552553
995 Ga0070707_100056199
996 Ga0070707_100066081
997 Ga0070707_100076353
998 Ga0070707_100085864
999 Ga0070707_100231094
1000 Ga0070698_100002787
1001 Ga0070698_100013682
1002 Ga0070698_100015916
1003 Ga0070698_100217232
1004 Ga0070698_100226942
1005 Ga0070698_100469777
1006 Ga0070699_100000167
1007 Ga0070699_100085600
1008 Ga0070699_100119632
1009 Ga0070679_100026678
1010 Ga0070679_100618874
1011 Ga0070684_100019533
1012 Ga0070684_100074348
1013 Ga0070684_100095622
1014 Ga0070684_100349065
1015 Ga0070697_100000048
1016 Ga0070697_100000474
1017 Ga0070697_100004757
1018 Ga0070697_100015869
1019 Ga0070697_100123199
1020 Ga0070697_100292293
1021 Ga0070697_100406547
1022 Ga0068853_100002491
1023 Ga0068853_100068883
1024 Ga0068853_100174164
1025 Ga0068853_100734542
1026 Ga0068853_100901922
1027 Ga0070672_100257951
1028 Ga0070686_100116977
1029 Ga0070695_100001686
1030 Ga0070695_100004004
1031 Ga0070695_100472990
1032 Ga0070696_100000097
1033 Ga0070696_100198488
1034 Ga0070696_100313726
1035 Ga0070693_100017105
1036 Ga0070665_100071750
1037 Ga0070665_100100354
1038 Ga0070665_100246681
1039 Ga0070704_100107341
1040 Ga0068855_100383466
1041 Ga0070664_100000140
1042 Ga0070664_100018951
1043 Ga0070664_100227169
1044 Ga0070664_100301195
1045 Ga0070664_100675592
1046 Ga0068857_100000920
1047 Ga0068857_100035103
1048 Ga0068857_100259336
1049 Ga0068857_100269346
1050 Ga0068854_100172272
1051 Ga0068854_100299563
1052 Ga0068856_100049346
1053 Ga0068856_100083204
1054 Ga0068856_100119934
1055 Ga0068852_100014947
1056 Ga0068852_100025251
1057 Ga0068852_100029671
1058 Ga0068859_100008885
1059 Ga0068859_100018252
1060 Ga0068859_100030786
1061 Ga0068859_100105063
1062 Ga0068859_100399564
1063 Ga0068859_100632947
1064 Ga0068864_100009521
1065 Ga0068864_100060004
1066 Ga0068864_100073539
1067 Ga0068866_10042241
1068 Ga0068866_10364679
1069 Ga0068861_100031378
1070 Ga0068861_100055663
1071 Ga0068861_100110550
1072 Ga0068861_100494260
1073 Ga0068863_100068582
1074 Ga0068858_100017598
1075 Ga0068858_100047472
1076 Ga0068858_100275989
1077 Ga0068860_100008192
1078 Ga0068860_100029806
1079 Ga0068860_100032276
1080 Ga0068860_100051810
1081 Ga0068860_100114058
1082 Ga0068862_100014430
1083 Ga0081455_10000017
1084 Ga0081455_10002335
1085 Ga0081455_10006179
1086 Ga0081455_10007060
1087 Ga0081455_10073714
1088 Ga0081455_10149208
1089 Ga0081540_1000059
1090 Ga0081540_1004731
1091 Ga0081540_1036976
1092 Ga0081540_1064959
1093 Ga0081539_10000138
1094 Ga0081539_10007397
1095 Ga0081539_10031515
1096 Ga0081539_10037765
1097 Ga0070717_10347379
1098 Ga0070715_10235339
1099 Ga0070716_100000803
1100 Ga0070716_100095930
1101 Ga0070712_100021078
1102 Ga0070712_100186381
1103 Ga0097621_100043533
1104 Ga0097621_100393316
1105 Ga0075370_10110949
1106 Ga0068871_100023395
1107 Ga0068871_100146109
1108 Ga0075428_100051385
1109 Ga0075428_100051603
1110 Ga0075428_100297550
1111 Ga0075428_100733243
1112 Ga0075430_100065315
1113 Ga0075431_100000652
1114 Ga0075431_100025306
1115 Ga0075431_100113527
1116 Ga0075434_100054243
1117 Ga0075434_100065221
1118 Ga0075434_100164826
1119 Ga0075429_100097920
1120 Ga0075429_100166401
1121 Ga0068865_100423651
1122 Ga0075436_100081698
1123 Ga0097620_100008885
1124 Ga0097620_100018252
1125 Ga0097620_100030786
1126 Ga0097620_100105060
1127 Ga0097620_100399566
1128 Ga0075435_100224923
1129 Ga0075435_100395589
1130 Ga0099795_10076067
1131 Ga0105250_10213031
1132 Ga0105240_10000150
1133 Ga0105240_10030562
1134 Ga0105240_10056656
1135 Ga0111539_10034190
1136 Ga0111539_10054417
1137 Ga0111539_10282784
1138 Ga0111539_10492719
1139 Ga0105245_10011604
1140 Ga0105245_10022684
1141 Ga0105245_10315678
1142 Ga0105245_10368595
1143 Ga0105247_10155816
1144 Ga0105247_10168914
1145 Ga0114129_10066808
1146 Ga0114129_10361169
1147 Ga0114129_10368295
1148 Ga0114129_10691740
1149 Ga0114129_11662856
1150 Ga0105243_10240869
1151 Ga0105243_10528117
1152 Ga0105243_10595996
1153 Ga0105242_10005788
1154 Ga0105242_10025578
1155 Ga0105242_10367419
1156 Ga0105248_10013050
1157 Ga0105248_10137908
1158 Ga0105238_10022856
1159 Ga0105238_10254095
1160 Ga0105249_10000885
1161 Ga0105249_10001888
1162 Ga0105249_10020942
1163 Ga0105249_10079215
1164 Ga0105249_10128855
1165 Ga0105249_10187315
1166 Ga0105249_10198234
1167 Ga0105249_10220301
1168 Ga0099796_10104135
1169 Ga0105239_10101601
1170 Ga0105239_10104460
1171 Ga0105239_10302179
1172 Ga0105239_10326497
1173 Ga0105239_10520802
1174 Ga0105239_10616425
1175 Ga0105246_10021393
1176 Ga0105246_10424948
1177 Ga0157371_10045029
1178 Ga0157371_10201852
1179 Ga0157370_10001950
1180 Ga0157370_10073759
1181 Ga0157370_10097252
1182 Ga0157369_10037193
1183 Ga0157369_10092769
1184 Ga0157369_10100499
1185 Ga0157369_10418254
1186 Ga0157374_10083296
1187 Ga0157374_10163185
1188 Ga0157374_10170898
1189 Ga0157374_10188952
1190 Ga0157374_10310855
1191 Ga0157374_11076090
1192 Ga0157378_10008938
1193 Ga0157378_10032506
1194 Ga0157378_10088482
1195 Ga0157378_10113278
1196 Ga0157378_10212186
1197 Ga0157378_10517332
1198 Ga0157378_10801352
1199 Ga0163162_10000958
1200 Ga0163162_10001067
1201 Ga0163162_10001504
1202 Ga0163162_10009864
1203 Ga0163162_10051756
1204 Ga0163162_10240077
1205 Ga0163162_10302260
1206 Ga0163162_10429061
1207 Ga0163162_10470564
1208 Ga0157372_10001731
1209 Ga0157372_10034222
1210 Ga0157372_10085768
1211 Ga0157372_10117456
1212 Ga0157372_10212079
1213 Ga0157372_10224609
1214 Ga0157372_10309134
1215 Ga0157372_11422903
1216 Ga0157372_11574593
1217 Ga0157375_10022047
1218 Ga0157375_10078964
1219 Ga0157375_10118033
1220 Ga0157375_10142890
1221 Ga0157375_10185586
1222 Ga0157375_10647761
1223 Ga0157375_10891644
1224 Ga0163163_10000244
1225 Ga0163163_10010322
1226 Ga0163163_10056274
1227 Ga0163163_10360419
1228 Ga0157380_11312593
1229 Ga0182008_10158309
1230 Ga0157377_10198680
1231 Ga0157377_10250241
1232 Ga0157379_10036725
1233 Ga0157379_10047334
1234 Ga0157379_10241082
1235 Ga0157379_10295203
1236 Ga0157379_10541886
1237 Ga0157376_10069089
1238 Ga0157376_10086393
1239 Ga0157376_10115339
1240 Ga0157376_10365445
1241 Ga0157376_10678005
1242 Ga0182007_10046842
1243 Ga0163161_10012978
1244 Ga0209646_1000050
1245 Ga0209026_1000826
1246 Ga0207673_1003722
1247 Ga0209758_1010862
1248 Ga0207426_1000815
1249 Ga0207697_10001007
1250 Ga0207697_10002439
1251 Ga0207697_10003119
1252 Ga0207697_10006339
1253 Ga0207697_10011610
1254 Ga0207697_10056003
1255 Ga0207656_10197099
1256 Ga0207653_10000588
1257 Ga0207682_10150367
1258 Ga0207642_10421082
1259 Ga0207688_10010957
1260 Ga0207688_10198658
1261 Ga0207680_10250176
1262 Ga0207647_10053713
1263 Ga0207647_10154981
1264 Ga0207699_10000705
1265 Ga0207699_10194231
1266 Ga0207645_10004672
1267 Ga0207684_10001884
1268 Ga0207684_10021932
1269 Ga0207684_10033922
1270 Ga0207684_10036451
1271 Ga0207684_10082150
1272 Ga0207684_10137537
1273 Ga0207684_10155114
1274 Ga0207684_10267007
1275 Ga0207684_10392006
1276 Ga0207707_10109752
1277 Ga0207695_10000238
1278 Ga0207695_10078235
1279 Ga0207671_10000255
1280 Ga0207693_10055800
1281 Ga0207693_10137522
1282 Ga0207693_10198905
1283 Ga0207693_10371589
1284 Ga0207693_10469597
1285 Ga0207663_10004157
1286 Ga0207663_10235386
1287 Ga0207660_10003429
1288 Ga0207660_10027842
1289 Ga0207662_10148813
1290 Ga0207662_10216868
1291 Ga0207662_10287076
1292 Ga0207657_10092555
1293 Ga0207657_10149035
1294 Ga0207649_10006771
1295 Ga0207649_10093111
1296 Ga0207652_10025689
1297 Ga0207652_10421044
1298 Ga0207652_10738418
1299 Ga0207646_10026757
1300 Ga0207646_10059083
1301 Ga0207646_10162489
1302 Ga0207646_10189038
1303 Ga0207646_10228675
1304 Ga0207681_10065876
1305 Ga0207681_10083374
1306 Ga0207694_10112111
1307 Ga0207650_10570193
1308 Ga0207650_10726505
1309 Ga0207659_10173601
1310 Ga0207659_10182719
1311 Ga0207659_10185682
1312 Ga0207659_10434366
1313 Ga0207659_10502505
1314 Ga0207659_10840136
1315 Ga0207687_10318444
1316 Ga0207700_10011937
1317 Ga0207700_10092984
1318 Ga0207700_10145586
1319 Ga0207644_10072440
1320 Ga0207644_10117041
1321 Ga0207644_10167442
1322 Ga0207644_10450950
1323 Ga0207690_10268060
1324 Ga0207690_10301255
1325 Ga0207706_10022719
1326 Ga0207706_10035490
1327 Ga0207706_10053098
1328 Ga0207706_10070895
1329 Ga0207686_10192942
1330 Ga0207670_10031551
1331 Ga0207670_10059432
1332 Ga0207670_10539321
1333 Ga0207670_10562192
1334 Ga0207669_10569582
1335 Ga0207704_10274805
1336 Ga0207704_10402823
1337 Ga0207665_10001465
1338 Ga0207665_10007229
1339 Ga0207691_10428532
1340 Ga0207691_10446246
1341 Ga0207691_10719061
1342 Ga0207691_10753584
1343 Ga0207711_10124524
1344 Ga0207689_10085678
1345 Ga0207689_10128113
1346 Ga0207661_10009616
1347 Ga0207661_10107956
1348 Ga0207661_10148874
1349 Ga0207661_10321829
1350 Ga0207661_10343102
1351 Ga0207679_10000266
1352 Ga0207679_10130269
1353 Ga0207679_10472333
1354 Ga0207679_10512257
1355 Ga0207667_10002275
1356 Ga0207667_10552810
1357 Ga0207667_10648869
1358 Ga0207667_10839793
1359 Ga0207651_10018983
1360 Ga0207651_10246222
1361 Ga0207651_10618954
1362 Ga0207712_10000022
1363 Ga0207712_10001350
1364 Ga0207712_10061811
1365 Ga0207668_10011168
1366 Ga0207668_10011813
1367 Ga0207668_10048345
1368 Ga0207668_10138784
1369 Ga0207668_10813237
1370 Ga0207640_10224144
1371 Ga0207658_10135661
1372 Ga0207677_10172167
1373 Ga0207677_10329769
1374 Ga0207677_10454010
1375 Ga0207703_10054457
1376 Ga0207639_10053177
1377 Ga0207639_10104706
1378 Ga0207639_10181260
1379 Ga0207678_10001436
1380 Ga0207678_10037896
1381 Ga0207678_10058362
1382 Ga0207708_10017756
1383 Ga0207708_10024230
1384 Ga0207708_10122660
1385 Ga0207702_10220388
1386 Ga0207641_10373961
1387 Ga0207648_10191469
1388 Ga0207676_10050860
1389 Ga0207676_10455044
1390 Ga0207674_10002088
1391 Ga0207674_10006580
1392 Ga0207674_10016158
1393 Ga0207674_10281960
1394 Ga0207674_10349164
1395 Ga0207675_100061307
1396 Ga0207675_100076129
1397 Ga0207675_100152069
1398 Ga0207683_10014801
1399 Ga0207683_10158736
1400 Ga0207683_10250859
1401 Ga0207698_10003451
1402 Ga0207698_10044423
1403 Ga0268266_10073837
1404 Ga0268266_10646974
1405 Ga0268265_10000508
1406 Ga0268265_10445318
1407 Ga0268264_10000197
1408 Ga0268264_10001291
1409 Ga0268264_10007443
1410 Ga0268264_10042968
1411 Ga0307517_10006811
1412 Ga0265338_10015716
1413 Ga0265325_10087029
1414 Ga0265339_10114024
1415 Ga0265327_10000561
1416 Ga0307513_10083524
1417 Ga0307509_10035458
1418 Ga0307509_10172469
1419 Ga0265313_10138187
1420 Ga0307508_10004669
1421 Ga0316579_10000521
1422 Ga0316579_10107466
1423 Ga0265342_10019029
1424 Ga0316576_10196928
1425 Ga0316578_10047919
1426 Ga0307516_10000966
1427 Ga0307405_10380116
1428 Ga0316577_10004181
1429 Ga0307409_100233052
1430 Ga0316585_10058021
1431 Ga0316593_10019654
1432 Ga0316593_10030415
1433 Ga0316593_10088125
1434 Ga0316592_1004811
1435 Ga0316586_1002434
1436 Ga0316588_1010076
1437 Ga0316587_1002109
1438 Ga0316596_1004536
1439 Ga0373938_0005961
1440 Ga0373928_0054528
1441 Ga0373934_0202892
1442 Ga0373940_0011843
1443 Ga0373949_0005781
1444 Ga0373941_0001726
1445 Ga0373941_0013113
1446 Ga0373945_0054651
1447 Ga0373953_0033590
1448 Ga0373943_0023734
1449 Ga0373943_0129123
1450 Ga0373946_0130202
1451 Ga0373942_0022065
1452 Ga0373942_0057512
1453 Ga0373961_0003998
1454 Ga0373962_0005834
1455 Ga0373962_0048263
1456 Ga0316574_0000247
1457 Ga0316574_0499523
1458 Ga0373931_0000298
1459 Ga0373931_0008938
1460 Ga0373935_0009788
1461 Ga0373935_0044051
1462 Ga0373935_0184803
1463 Ga0373927_0330383
1464 Ga0373927_0452934
1465 Ga0373947_0097588
1466 Ga0373947_0104905
1467 Ga0373947_0157484
1468 Ga0373937_0094486
1469 Ga0373937_0175444
1470 Ga0316582_0001370
1471 Ga0316582_0412936
1472 Ga0316584_0018038
1473 Ga0373925_0186234
1474 Ga0373925_0198361
1475 Ga0373925_0336197
1476 Ga0373925_0736596
1477 Ga0395900_0124671
1478 Ga0395898_0078886
1479 Ga0395898_0233823
1480 Ga0395905_0555959
1481 Ga0316581_0007238
1482 Ga0395901_0738991
1483 Ga0400486_18173
1484 Ga0400487_27411
1485 Ga0436361_0756768
1486 Ga0436363_0343849
1487 Ga0436362_0792311
1488 Ga0439451_007700
1489 Ga0439455_0006330
1490 Ga0451577_0036179
1491 Ga0451577_0063609
1492 Ga0466972_0000010
1493 Ga0453683_0067696
1494 Ga0453684_0001795
1495 Ga0453684_0004535
1496 Ga0453684_0148033
1497 Ga0453684_0501094
1498 Ga0451576_0115891
1499 Ga0451576_0832790
1500 Ga0466967_0013442
1501 Ga0495592_0031447
1502 Ga0495641_0023049
1503 Ga0495582_0230992
1504 Ga0495605_0148677
1505 Ga0495662_0033762
1506 Ga0495662_0105686
1507 Ga0495664_0045359
1508 Ga0495628_0022456
1509 Ga0495630_0027280
1510 Ga0495637_0097222
1511 Ga0495652_0012541
1512 Ga0495587_0145719
1513 Ga0495598_0030400
1514 Ga0495621_0057622
1515 Ga0495645_0011316
1516 Ga0495667_0087215
1517 Ga0495656_0055649
1518 Ga0495668_0000138
1519 Ga0495611_0000657
1520 Ga0495635_0157111
1521 Ga0495659_0014669
1522 Ga0495599_0007832
1523 Ga0495623_0015384
1524 Ga0495613_0044243
1525 Ga0495613_0105248
1526 Ga0495624_0427017
1527 Ga0495649_0013184
1528 Ga0495581_0226277
1529 Ga0495636_0000135
1530 Ga0495680_0255097
1531 Ga0495687_000422
1532 Ga0495675_0255221
1533 Ga0495684_0151353
1534 Ga0495686_0000265
1535 Ga0495602_0043870
1536 Ga0495614_0256543
1537 Ga0496100_0119869
1538 Ga0496100_0230150
1539 Ga0496100_0251796
1540 Ga0496101_0013714
1541 Ga0496101_0477194
1542 Ga0496102_0014638
1543 Ga0496102_0069801
1544 Ga0496102_0170928
1545 Ga0496103_0075182
1546 Ga0496103_0106043
1547 Ga0496104_0081363
1548 Ga0496104_0086153
1549 Ga0496104_0119197
1550 Ga0496104_0189826
1551 Ga0496104_0312936
1552 Ga0496105_0087775
1553 Ga0496105_0102859
1554 Ga0496106_0003553
1555 Ga0496106_0025767
1556 Ga0496108_0039382
1557 Ga0496108_0487400
1558 Ga0496109_0032212
1559 Ga0496109_0061483
1560 Ga0496109_0162697
1561 Ga0496109_0313488
1562 Ga0496109_0786623
1563 Ga0496110_0068266
1564 Ga0496111_0195920
1565 Ga0496112_0010080
1566 Ga0496112_0178072
1567 Ga0496112_0193518
1568 Ga0496112_0264988
1569 Ga0496113_0534377
1570 Ga0496113_0795923
1571 Ga0496114_0053668
1572 Ga0496114_0110099
1573 Ga0496114_0472415
1574 Ga0496115_0008973
1575 Ga0496115_0021153
1576 Ga0496115_0076693
1577 Ga0496115_0082513
1578 Ga0496115_0112319
1579 Ga0501031_0000153
1580 Ga0501032_0000456
1581 Ga0501032_0021619
1582 Ga0501032_0035881
1583 Ga0501033_0008105
1584 Ga0501033_0032436
1585 Ga0501034_0003873
1586 Ga0501034_0009091
1587 Ga0501034_0014329
1588 Ga0501034_0015090
1589 Ga0501034_0081815
1590 Ga0501034_0610647
1591 Ga0501034_0674412
1592 Ga0501036_0002791
1593 Ga0501036_0044485
1594 Ga0501036_0098518
1595 Ga0501037_0000343
1596 Ga0501037_0002896
1597 Ga0501037_0009568
1598 Ga0501037_0142050
1599 Ga0501037_0281334
1600 Ga0501038_0008496
1601 Ga0501038_0011895
1602 Ga0501038_0028160
1603 Ga0501039_0002968
1604 Ga0501039_0028739
1605 Ga0501039_0084025
1606 Ga0501039_0253016
1607 Ga0501039_0599930
1608 Ga0501040_0040603
1609 Ga0501041_0122539
1610 Ga0501043_0000764
1611 Ga0501043_0017731
1612 Ga0501043_0029801
1613 Ga0501043_0091633
1614 Ga0501046_0000677
1615 Ga0501046_0012855
1616 Ga0501046_0124122
1617 Ga0501046_0147180
1618 Ga0501046_0208460
1619 Ga0501046_0209370
1620 Ga0501047_0005336
1621 Ga0501047_0007824
1622 Ga0501047_0026451
1623 Ga0501047_0119847
1624 Ga0501047_0358057
1625 Ga0501048_0010659
1626 Ga0501067_0081217
1627 Ga0501069_0000436
1628 Ga0501070_0000684
1629 Ga0501070_0004266
1630 Ga0501070_0656602
1631 Ga0501071_0279205
1632 Ga0501071_0361793
1633 Ga0501072_0182435
1634 Ga0501072_0292701
1635 Ga0501073_0050198
1636 Ga0501073_0050937
1637 Ga0501074_0006737
1638 Ga0501074_0067027
1639 Ga0501075_0102758
1640 Ga0501075_0120709
1641 Ga0501075_0153200
1642 Ga0501075_0336452
1643 Ga0501076_0431936
1644 Ga0501077_0012932
1645 Ga0501079_0019576
1646 Ga0501079_0027791
1647 Ga0501079_0229249
1648 Ga0501080_0000676
1649 Ga0501080_0055007
1650 Ga0501080_0560839
1651 Ga0501081_0003747
1652 Ga0501081_0020321
1653 Ga0501081_0446346
1654 Ga0501083_0052215
1655 Ga0501269_000381
1656 Ga0501035_0006623
1657 Ga0501035_0009852
1658 Ga0501035_0025455
1659 Ga0501044_0003064
1660 Ga0501044_0007585
1661 Ga0501044_0024840
1662 Ga0501044_0047754
1663 Ga0501044_0122104
1664 Ga0501044_0162376
1665 Ga0501044_0248406
1666 Ga0501044_0252819
1667 Ga0501045_0151188
1668 Ga0501045_0167510
1669 nmdc:mga0k408_15196_c1
1670 nmdc:mga0k408_18452_c1
1671 nmdc:mga05p37_207663_c1
1672 nmdc:mga05p37_216407_c1
1673 nmdc:mga05p37_435508_c1
1674 nmdc:mga05p37_488230_c1
1675 nmdc:mga05p37_739280_c1
1676 nmdc:mga05p37_989227_c1
1677 nmdc:mga09592_126461_c1
1678 nmdc:mga0qj67_64889_c1
1679 nmdc:mga06r32_229289_c1
1680 nmdc:mga06r32_407227_c1
1681 nmdc:mga06r32_423349_c1
1682 nmdc:mga06r32_427557_c1
1683 nmdc:mga06r32_433871_c1
1684 nmdc:mga06r32_479493_c1
1685 nmdc:mga06r32_49787_c1
1686 nmdc:mga06r32_9161_c1
1687 nmdc:mga08y16_161046_c1
1688 nmdc:mga08y16_162128_c1
1689 nmdc:mga08y16_73156_c1
1690 nmdc:mga0n895_281261_c1
1691 nmdc:mga0n895_443705_c1
1692 nmdc:mga0n895_538945_c1
1693 nmdc:mga0n895_8224_c1
1694 nmdc:mga0a205_13478_c1
1695 nmdc:mga0a205_744965_c1
1696 Ga0495601_0012825
1697 Ga0495612_0010520
1698 Ga0495595_0072118
1699 Ga0500646_0001454
1700 Ga0500646_0027597
1701 Ga0500583_0044381
1702 Ga0500556_0035822
1703 Ga0500594_0054022
1704 Ga0500616_0002320
1705 Ga0500622_0049763
1706 Ga0501084_0005256
1707 Ga0501082_0169310
1708 Ga0501082_0287563
1709 Ga0501082_0646907
1710 Ga0530510_0006543
1711 Ga0530510_0353246
1712 2740004033
1713 2740008850
1714 2841917994

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

115

279

0.96

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

53

116

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3knu-assembly1.cif.gz_B crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.9116 1 211
3knu-assembly2.cif.gz_C crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.9041 1 211
4yq1-assembly1.cif.gz_A crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds 0.903 1 211
3knu-assembly1.cif.gz_A crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.9028 1 211
3knu-assembly2.cif.gz_D crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum 0.902 1 211
ID Description Score Start End Superfamily
3ky7A01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9284 1 155 3.40.1280.10
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9255 1 160 3.40.1280.10
3iefB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9197 1 155 3.40.1280.10
1oy5C01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9176 1 160 3.40.1280.10
3ky7A01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.917 1 155 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A368B863-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9674 1 155 GO:0002939
GO:0005829
GO:0052906
AF-A0A2H0VR85-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.966 1 169 GO:0002939
GO:0005829
GO:0052906
AF-A0A0G1ZQZ9-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9659 1 166 GO:0002939
GO:0005829
GO:0052906
AF-A0A7W1JH08-F1-model_v4 tRNA (Guanosine(37)-N1)-methyltransferase TrmD 0.9647 1 152 GO:0002939
GO:0005829
GO:0052906
AF-A0A524PE26-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9636 1 155 GO:0002939
GO:0005829
GO:0052906

Map