F483681
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 857 | 370 | 1714 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300005406|Ga0070703_10029209|Ga0070703_100292092 |
| Length | 283 |
| Sequence | MSAGLLNFGGRRPPLQFQRWTFDVQRSMFFPMRIDIVTLFPEICRAPLSESMMKRAKDKQIVDLHIHNLRDWTTDKHHVVDDAPFGGGQGMVMKPEPIFAAVEALKKTPNSDESRAGAQRPSAFAEATADKTSNVQVQSPKVILMSPAGRRFDQQIATHLSREPHLIIISGHYEGVDHRVIEHLIDLEISIGDYVLTNGAIAAVVLVDSIVRLLPGTLGHEQSADDDSFSDGLLEAPQYTRPADFRGWKVPGVLLSGNHAEIAAWRKEQAIKRTRENRPDLFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 215 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 221 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 247 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 255 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 258 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 259 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 260 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 360 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 361 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 368 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 369 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 370 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.6 |
| Metatranscriptomes | 1.05 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.63 |
| Nodule | 0.12 |
| Rhizoplane | 4.9 |
| Rhizosphere | 91.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070703_10029209 | 3300005406 | Unclassified | 1653 |
| 2 | MBSR1b_contig_7586419 | 2162886012 | Bacteria | 1113 |
| 3 | CNXas_1000173 | 3300000545 | Bacteria | 10476 |
| 4 | JGI24737J22298_10053954 | 3300001990 | Bacteria | 1217 |
| 5 | JGI24035J26624_1001641 | 3300002126 | Bacteria | 2104 |
| 6 | JGI25154J39366_1000021 | 3300002738 | Bacteria | 221559 |
| 7 | JGI25157J39369_1004223 | 3300002741 | Bacteria | 2669 |
| 8 | JGI25406J46586_10000033 | 3300003203 | Bacteria | 65430 |
| 9 | rootH2_10252392 | 3300003320 | Bacteria | 3143 |
| 10 | rootL2_10090880 | 3300003322 | Bacteria | 3946 |
| 11 | rootH1_10015975 | 3300003323 | Bacteria | 21495 |
| 12 | rootH1_10030944 | 3300003323 | Bacteria | 14680 |
| 13 | JGI25160J50197_1004110 | 3300003354 | Bacteria | 6342 |
| 14 | JGI25405J52794_10000071 | 3300003911 | Bacteria | 11109 |
| 15 | Ga0058860_10016173 | 3300004801 | Bacteria | 1134 |
| 16 | Ga0065165_1008080 | 3300005262 | Bacteria | 5020 |
| 17 | Ga0065703_1019259 | 3300005272 | Unclassified | 3377 |
| 18 | Ga0065704_10081204 | 3300005289 | Unclassified | 3803 |
| 19 | Ga0065704_10105669 | 3300005289 | Bacteria | 2104 |
| 20 | Ga0065712_10021943 | 3300005290 | Unclassified | 1777 |
| 21 | Ga0065712_10035301 | 3300005290 | Bacteria | 1295 |
| 22 | Ga0065712_10036074 | 3300005290 | Unclassified | 981 |
| 23 | Ga0065712_10087329 | 3300005290 | Unclassified | 2580 |
| 24 | Ga0065715_10000818 | 3300005293 | Bacteria | 11586 |
| 25 | Ga0065715_10089774 | 3300005293 | Bacteria | 8553 |
| 26 | Ga0065715_10141888 | 3300005293 | Unclassified | 1841 |
| 27 | Ga0065715_10239743 | 3300005293 | Unclassified | 1203 |
| 28 | Ga0065707_10013292 | 3300005295 | Unclassified | 2318 |
| 29 | Ga0065707_10033018 | 3300005295 | Bacteria | 1175 |
| 30 | Ga0065707_10110072 | 3300005295 | Bacteria | 2438 |
| 31 | Ga0065707_10156512 | 3300005295 | Bacteria | 1604 |
| 32 | Ga0070676_10068433 | 3300005328 | Bacteria | 2125 |
| 33 | Ga0070676_10091736 | 3300005328 | Bacteria | 1862 |
| 34 | Ga0070676_10154840 | 3300005328 | Bacteria | 1470 |
| 35 | Ga0070683_100000659 | 3300005329 | Bacteria | 24948 |
| 36 | Ga0070683_100047367 | 3300005329 | Unclassified | 3972 |
| 37 | Ga0070683_100216842 | 3300005329 | Bacteria | 1818 |
| 38 | Ga0070683_100610802 | 3300005329 | Bacteria | 1044 |
| 39 | Ga0070690_100017352 | 3300005330 | Bacteria | 4326 |
| 40 | Ga0070690_100078704 | 3300005330 | Unclassified | 2154 |
| 41 | Ga0070690_100231428 | 3300005330 | Unclassified | 1300 |
| 42 | Ga0070670_100076633 | 3300005331 | Bacteria | 2873 |
| 43 | Ga0068869_100004530 | 3300005334 | Bacteria | 8648 |
| 44 | Ga0068869_100184530 | 3300005334 | Unclassified | 1637 |
| 45 | Ga0070666_10193830 | 3300005335 | Unclassified | 1428 |
| 46 | Ga0070666_10583953 | 3300005335 | Unclassified | 815 |
| 47 | Ga0070680_100002447 | 3300005336 | Bacteria | 13759 |
| 48 | Ga0070680_100079457 | 3300005336 | Bacteria | 2703 |
| 49 | Ga0070680_100565455 | 3300005336 | Bacteria | 975 |
| 50 | Ga0068868_100130426 | 3300005338 | Bacteria | 2057 |
| 51 | Ga0068868_100131474 | 3300005338 | Bacteria | 2048 |
| 52 | Ga0068868_100221531 | 3300005338 | Bacteria | 1584 |
| 53 | Ga0068868_100363113 | 3300005338 | Bacteria | 1243 |
| 54 | Ga0070660_100109268 | 3300005339 | Bacteria | 2199 |
| 55 | Ga0070660_100395116 | 3300005339 | Unclassified | 1143 |
| 56 | Ga0070689_100008263 | 3300005340 | Bacteria | 7324 |
| 57 | Ga0070689_100034716 | 3300005340 | Unclassified | 3848 |
| 58 | Ga0070689_100179317 | 3300005340 | Unclassified | 1720 |
| 59 | Ga0070689_100511303 | 3300005340 | Bacteria | 1030 |
| 60 | Ga0070691_10005767 | 3300005341 | Bacteria | 5648 |
| 61 | Ga0070691_10032834 | 3300005341 | Bacteria | 2440 |
| 62 | Ga0070661_100000952 | 3300005344 | Bacteria | 20625 |
| 63 | Ga0070661_100123174 | 3300005344 | Bacteria | 1943 |
| 64 | Ga0070661_100239683 | 3300005344 | Bacteria | 1396 |
| 65 | Ga0070661_100253920 | 3300005344 | Bacteria | 1358 |
| 66 | Ga0070661_100265666 | 3300005344 | Unclassified | 1327 |
| 67 | Ga0070668_100018032 | 3300005347 | Bacteria | 5295 |
| 68 | Ga0070668_100053780 | 3300005347 | Bacteria | 3104 |
| 69 | Ga0070669_100020563 | 3300005353 | Bacteria | 4714 |
| 70 | Ga0070669_100033012 | 3300005353 | Unclassified | 3741 |
| 71 | Ga0070675_100007201 | 3300005354 | Bacteria | 8574 |
| 72 | Ga0070675_100029889 | 3300005354 | Bacteria | 4396 |
| 73 | Ga0070675_100040375 | 3300005354 | Unclassified | 3809 |
| 74 | Ga0070675_100048421 | 3300005354 | Bacteria | 3485 |
| 75 | Ga0070675_100097464 | 3300005354 | Unclassified | 2472 |
| 76 | Ga0070675_100139940 | 3300005354 | Bacteria | 2068 |
| 77 | Ga0070675_100141355 | 3300005354 | Bacteria | 2058 |
| 78 | Ga0070675_100202070 | 3300005354 | Bacteria | 1725 |
| 79 | Ga0070671_100010731 | 3300005355 | Bacteria | 7354 |
| 80 | Ga0070671_100200603 | 3300005355 | Bacteria | 1691 |
| 81 | Ga0070671_100476199 | 3300005355 | Unclassified | 1072 |
| 82 | Ga0070674_100059729 | 3300005356 | Bacteria | 2655 |
| 83 | Ga0070674_100119364 | 3300005356 | Bacteria | 1950 |
| 84 | Ga0070673_100282283 | 3300005364 | Unclassified | 1457 |
| 85 | Ga0070688_100022421 | 3300005365 | Bacteria | 3700 |
| 86 | Ga0070688_100354113 | 3300005365 | Bacteria | 1075 |
| 87 | Ga0070659_100002818 | 3300005366 | Bacteria | 12381 |
| 88 | Ga0070667_100014676 | 3300005367 | Bacteria | 6472 |
| 89 | Ga0070667_100086230 | 3300005367 | Unclassified | 2693 |
| 90 | Ga0070667_100133588 | 3300005367 | Bacteria | 2168 |
| 91 | Ga0070667_100274312 | 3300005367 | Bacteria | 1513 |
| 92 | Ga0070667_100497314 | 3300005367 | Unclassified | 1117 |
| 93 | Ga0070703_10000413 | 3300005406 | Bacteria | 17664 |
| 94 | Ga0070709_10002322 | 3300005434 | Bacteria | 10306 |
| 95 | Ga0070709_10244599 | 3300005434 | Unclassified | 1290 |
| 96 | Ga0070714_100684739 | 3300005435 | Bacteria | 989 |
| 97 | Ga0070713_100057130 | 3300005436 | Bacteria | 3247 |
| 98 | Ga0070713_100068469 | 3300005436 | Bacteria | 2991 |
| 99 | Ga0070701_10027627 | 3300005438 | Bacteria | 2782 |
| 100 | Ga0070705_100001251 | 3300005440 | Bacteria | 13709 |
| 101 | Ga0070700_100002720 | 3300005441 | Bacteria | 9036 |
| 102 | Ga0070694_100014391 | 3300005444 | Bacteria | 4952 |
| 103 | Ga0070694_100020561 | 3300005444 | Bacteria | 4210 |
| 104 | Ga0070694_100072541 | 3300005444 | Unclassified | 2375 |
| 105 | Ga0070694_100207616 | 3300005444 | Bacteria | 1463 |
| 106 | Ga0070708_100032254 | 3300005445 | Bacteria | 4542 |
| 107 | Ga0070708_100034795 | 3300005445 | Unclassified | 4384 |
| 108 | Ga0070708_100040417 | 3300005445 | Bacteria | 4084 |
| 109 | Ga0070708_100048315 | 3300005445 | Bacteria | 3761 |
| 110 | Ga0070708_100087214 | 3300005445 | Unclassified | 2836 |
| 111 | Ga0070708_100112762 | 3300005445 | Unclassified | 2501 |
| 112 | Ga0070708_100122396 | 3300005445 | Unclassified | 2401 |
| 113 | Ga0070708_100128086 | 3300005445 | Bacteria | 2348 |
| 114 | Ga0070708_100313602 | 3300005445 | Bacteria | 1477 |
| 115 | Ga0070708_100630462 | 3300005445 | Unclassified | 1010 |
| 116 | Ga0070663_100024635 | 3300005455 | Bacteria | 4054 |
| 117 | Ga0070663_100160017 | 3300005455 | Bacteria | 1733 |
| 118 | Ga0070678_100037047 | 3300005456 | Bacteria | 3421 |
| 119 | Ga0070678_100380241 | 3300005456 | Bacteria | 1221 |
| 120 | Ga0070662_100029761 | 3300005457 | Unclassified | 3814 |
| 121 | Ga0070662_100196548 | 3300005457 | Bacteria | 1598 |
| 122 | Ga0070662_100275438 | 3300005457 | Bacteria | 1360 |
| 123 | Ga0070681_10003953 | 3300005458 | Bacteria | 13971 |
| 124 | Ga0070681_10021678 | 3300005458 | Bacteria | 6442 |
| 125 | Ga0070681_10124558 | 3300005458 | Bacteria | 2510 |
| 126 | Ga0068867_100130568 | 3300005459 | Unclassified | 1952 |
| 127 | Ga0068867_100486000 | 3300005459 | Bacteria | 1059 |
| 128 | Ga0070685_10389269 | 3300005466 | Unclassified | 963 |
| 129 | Ga0070706_100002101 | 3300005467 | Bacteria | 20309 |
| 130 | Ga0070706_100023080 | 3300005467 | Bacteria | 5730 |
| 131 | Ga0070706_100041915 | 3300005467 | Bacteria | 4228 |
| 132 | Ga0070706_100068717 | 3300005467 | Unclassified | 3276 |
| 133 | Ga0070706_100101253 | 3300005467 | Unclassified | 2677 |
| 134 | Ga0070706_100129303 | 3300005467 | Bacteria | 2356 |
| 135 | Ga0070706_100353727 | 3300005467 | Bacteria | 1369 |
| 136 | Ga0070706_100388441 | 3300005467 | Bacteria | 1299 |
| 137 | Ga0070706_100552553 | 3300005467 | Bacteria | 1071 |
| 138 | Ga0070707_100056199 | 3300005468 | Bacteria | 3775 |
| 139 | Ga0070707_100066081 | 3300005468 | Unclassified | 3475 |
| 140 | Ga0070707_100076353 | 3300005468 | Bacteria | 3232 |
| 141 | Ga0070707_100085864 | 3300005468 | Bacteria | 3042 |
| 142 | Ga0070707_100231094 | 3300005468 | Bacteria | 1800 |
| 143 | Ga0070698_100002787 | 3300005471 | Bacteria | 19245 |
| 144 | Ga0070698_100013682 | 3300005471 | Bacteria | 8590 |
| 145 | Ga0070698_100015916 | 3300005471 | Bacteria | 7941 |
| 146 | Ga0070698_100217232 | 3300005471 | Unclassified | 1846 |
| 147 | Ga0070698_100226942 | 3300005471 | Bacteria | 1801 |
| 148 | Ga0070698_100469777 | 3300005471 | Bacteria | 1194 |
| 149 | Ga0070699_100000167 | 3300005518 | Bacteria | 63239 |
| 150 | Ga0070699_100085600 | 3300005518 | Bacteria | 2750 |
| 151 | Ga0070699_100119632 | 3300005518 | Bacteria | 2315 |
| 152 | Ga0070679_100026678 | 3300005530 | Bacteria | 5680 |
| 153 | Ga0070679_100618874 | 3300005530 | Bacteria | 1026 |
| 154 | Ga0070684_100019533 | 3300005535 | Bacteria | 5606 |
| 155 | Ga0070684_100074348 | 3300005535 | Bacteria | 2995 |
| 156 | Ga0070684_100095622 | 3300005535 | Bacteria | 2647 |
| 157 | Ga0070684_100349065 | 3300005535 | Bacteria | 1361 |
| 158 | Ga0070697_100000048 | 3300005536 | Bacteria | 90644 |
| 159 | Ga0070697_100000474 | 3300005536 | Bacteria | 30635 |
| 160 | Ga0070697_100004757 | 3300005536 | Bacteria | 10407 |
| 161 | Ga0070697_100015869 | 3300005536 | Bacteria | 5919 |
| 162 | Ga0070697_100123199 | 3300005536 | Bacteria | 2170 |
| 163 | Ga0070697_100292293 | 3300005536 | Bacteria | 1400 |
| 164 | Ga0070697_100406547 | 3300005536 | Bacteria | 1182 |
| 165 | Ga0068853_100002491 | 3300005539 | Bacteria | 13803 |
| 166 | Ga0068853_100068883 | 3300005539 | Unclassified | 3077 |
| 167 | Ga0068853_100174164 | 3300005539 | Bacteria | 1948 |
| 168 | Ga0068853_100734542 | 3300005539 | Unclassified | 943 |
| 169 | Ga0068853_100901922 | 3300005539 | Unclassified | 849 |
| 170 | Ga0070672_100257951 | 3300005543 | Bacteria | 1470 |
| 171 | Ga0070686_100116977 | 3300005544 | Bacteria | 1825 |
| 172 | Ga0070695_100001686 | 3300005545 | Bacteria | 12461 |
| 173 | Ga0070695_100004004 | 3300005545 | Bacteria | 8613 |
| 174 | Ga0070695_100472990 | 3300005545 | Bacteria | 964 |
| 175 | Ga0070696_100000097 | 3300005546 | Bacteria | 44009 |
| 176 | Ga0070696_100198488 | 3300005546 | Unclassified | 1497 |
| 177 | Ga0070696_100313726 | 3300005546 | Bacteria | 1205 |
| 178 | Ga0070693_100017105 | 3300005547 | Bacteria | 3764 |
| 179 | Ga0070665_100071750 | 3300005548 | Unclassified | 3470 |
| 180 | Ga0070665_100100354 | 3300005548 | Unclassified | 2898 |
| 181 | Ga0070665_100246681 | 3300005548 | Unclassified | 1786 |
| 182 | Ga0070704_100107341 | 3300005549 | Bacteria | 2117 |
| 183 | Ga0068855_100383466 | 3300005563 | Unclassified | 1543 |
| 184 | Ga0070664_100000140 | 3300005564 | Bacteria | 49126 |
| 185 | Ga0070664_100018951 | 3300005564 | Bacteria | 5658 |
| 186 | Ga0070664_100227169 | 3300005564 | Unclassified | 1672 |
| 187 | Ga0070664_100301195 | 3300005564 | Bacteria | 1449 |
| 188 | Ga0070664_100675592 | 3300005564 | Unclassified | 961 |
| 189 | Ga0068857_100000920 | 3300005577 | Bacteria | 22265 |
| 190 | Ga0068857_100035103 | 3300005577 | Unclassified | 4438 |
| 191 | Ga0068857_100259336 | 3300005577 | Unclassified | 1595 |
| 192 | Ga0068857_100269346 | 3300005577 | Bacteria | 1565 |
| 193 | Ga0068854_100172272 | 3300005578 | Bacteria | 1685 |
| 194 | Ga0068854_100299563 | 3300005578 | Bacteria | 1300 |
| 195 | Ga0068856_100049346 | 3300005614 | Unclassified | 4149 |
| 196 | Ga0068856_100083204 | 3300005614 | Bacteria | 3177 |
| 197 | Ga0068856_100119934 | 3300005614 | Bacteria | 2632 |
| 198 | Ga0068852_100014947 | 3300005616 | Bacteria | 6000 |
| 199 | Ga0068852_100025251 | 3300005616 | Unclassified | 4812 |
| 200 | Ga0068852_100029671 | 3300005616 | Bacteria | 4495 |
| 201 | Ga0068859_100008885 | 3300005617 | Bacteria | 10145 |
| 202 | Ga0068859_100018252 | 3300005617 | Bacteria | 7053 |
| 203 | Ga0068859_100030786 | 3300005617 | Bacteria | 5385 |
| 204 | Ga0068859_100105063 | 3300005617 | Bacteria | 2884 |
| 205 | Ga0068859_100399564 | 3300005617 | Bacteria | 1470 |
| 206 | Ga0068859_100632947 | 3300005617 | Bacteria | 1162 |
| 207 | Ga0068864_100009521 | 3300005618 | Bacteria | 8016 |
| 208 | Ga0068864_100060004 | 3300005618 | Bacteria | 3293 |
| 209 | Ga0068864_100073539 | 3300005618 | Bacteria | 2980 |
| 210 | Ga0068866_10042241 | 3300005718 | Bacteria | 2268 |
| 211 | Ga0068866_10364679 | 3300005718 | Bacteria | 922 |
| 212 | Ga0068861_100031378 | 3300005719 | Bacteria | 3903 |
| 213 | Ga0068861_100055663 | 3300005719 | Bacteria | 3017 |
| 214 | Ga0068861_100110550 | 3300005719 | Bacteria | 2201 |
| 215 | Ga0068861_100494260 | 3300005719 | Bacteria | 1105 |
| 216 | Ga0068863_100068582 | 3300005841 | Bacteria | 3354 |
| 217 | Ga0068858_100017598 | 3300005842 | Bacteria | 6700 |
| 218 | Ga0068858_100047472 | 3300005842 | Bacteria | 3980 |
| 219 | Ga0068858_100275989 | 3300005842 | Bacteria | 1600 |
| 220 | Ga0068860_100008192 | 3300005843 | Bacteria | 10403 |
| 221 | Ga0068860_100029806 | 3300005843 | Bacteria | 5249 |
| 222 | Ga0068860_100032276 | 3300005843 | Bacteria | 5032 |
| 223 | Ga0068860_100051810 | 3300005843 | Bacteria | 3904 |
| 224 | Ga0068860_100114058 | 3300005843 | Bacteria | 2584 |
| 225 | Ga0068862_100014430 | 3300005844 | Bacteria | 6555 |
| 226 | Ga0081455_10000017 | 3300005937 | Bacteria | 174550 |
| 227 | Ga0081455_10002335 | 3300005937 | Bacteria | 22643 |
| 228 | Ga0081455_10006179 | 3300005937 | Bacteria | 12918 |
| 229 | Ga0081455_10007060 | 3300005937 | Bacteria | 11921 |
| 230 | Ga0081455_10073714 | 3300005937 | Bacteria | 2821 |
| 231 | Ga0081455_10149208 | 3300005937 | Bacteria | 1805 |
| 232 | Ga0081540_1000059 | 3300005983 | Bacteria | 120226 |
| 233 | Ga0081540_1004731 | 3300005983 | Bacteria | 10293 |
| 234 | Ga0081540_1036976 | 3300005983 | Bacteria | 2594 |
| 235 | Ga0081540_1064959 | 3300005983 | Bacteria | 1719 |
| 236 | Ga0081539_10000138 | 3300005985 | Bacteria | 170633 |
| 237 | Ga0081539_10007397 | 3300005985 | Bacteria | 10038 |
| 238 | Ga0081539_10031515 | 3300005985 | Bacteria | 3266 |
| 239 | Ga0081539_10037765 | 3300005985 | Bacteria | 2871 |
| 240 | Ga0070717_10347379 | 3300006028 | Bacteria | 1326 |
| 241 | Ga0070715_10235339 | 3300006163 | Bacteria | 949 |
| 242 | Ga0070716_100000803 | 3300006173 | Bacteria | 13498 |
| 243 | Ga0070716_100095930 | 3300006173 | Bacteria | 1806 |
| 244 | Ga0070712_100021078 | 3300006175 | Bacteria | 4274 |
| 245 | Ga0070712_100186381 | 3300006175 | Bacteria | 1620 |
| 246 | Ga0097621_100043533 | 3300006237 | Unclassified | 3619 |
| 247 | Ga0097621_100393316 | 3300006237 | Bacteria | 1240 |
| 248 | Ga0075370_10110949 | 3300006353 | Bacteria | 1593 |
| 249 | Ga0068871_100023395 | 3300006358 | Unclassified | 4779 |
| 250 | Ga0068871_100146109 | 3300006358 | Bacteria | 2013 |
| 251 | Ga0075428_100051385 | 3300006844 | Bacteria | 4520 |
| 252 | Ga0075428_100051603 | 3300006844 | Bacteria | 4510 |
| 253 | Ga0075428_100297550 | 3300006844 | Bacteria | 1735 |
| 254 | Ga0075428_100733243 | 3300006844 | Bacteria | 1052 |
| 255 | Ga0075430_100065315 | 3300006846 | Bacteria | 3057 |
| 256 | Ga0075431_100000652 | 3300006847 | Bacteria | 29451 |
| 257 | Ga0075431_100025306 | 3300006847 | Bacteria | 6085 |
| 258 | Ga0075431_100113527 | 3300006847 | Unclassified | 2796 |
| 259 | Ga0075434_100054243 | 3300006871 | Bacteria | 3983 |
| 260 | Ga0075434_100065221 | 3300006871 | Bacteria | 3626 |
| 261 | Ga0075434_100164826 | 3300006871 | Bacteria | 2236 |
| 262 | Ga0075429_100097920 | 3300006880 | Bacteria | 2559 |
| 263 | Ga0075429_100166401 | 3300006880 | Unclassified | 1931 |
| 264 | Ga0068865_100423651 | 3300006881 | Bacteria | 1095 |
| 265 | Ga0075436_100081698 | 3300006914 | Bacteria | 2241 |
| 266 | Ga0097620_100008885 | 3300006931 | Bacteria | 10145 |
| 267 | Ga0097620_100018252 | 3300006931 | Bacteria | 7053 |
| 268 | Ga0097620_100030786 | 3300006931 | Bacteria | 5385 |
| 269 | Ga0097620_100105060 | 3300006931 | Bacteria | 2884 |
| 270 | Ga0097620_100399566 | 3300006931 | Bacteria | 1470 |
| 271 | Ga0075435_100224923 | 3300007076 | Unclassified | 1594 |
| 272 | Ga0075435_100395589 | 3300007076 | Bacteria | 1188 |
| 273 | Ga0099795_10076067 | 3300007788 | Bacteria | 1276 |
| 274 | Ga0105250_10213031 | 3300009092 | Bacteria | 817 |
| 275 | Ga0105240_10000150 | 3300009093 | Bacteria | 141609 |
| 276 | Ga0105240_10030562 | 3300009093 | Bacteria | 6999 |
| 277 | Ga0105240_10056656 | 3300009093 | Bacteria | 4903 |
| 278 | Ga0111539_10034190 | 3300009094 | Bacteria | 6167 |
| 279 | Ga0111539_10054417 | 3300009094 | Bacteria | 4762 |
| 280 | Ga0111539_10282784 | 3300009094 | Bacteria | 1930 |
| 281 | Ga0111539_10492719 | 3300009094 | Bacteria | 1427 |
| 282 | Ga0105245_10011604 | 3300009098 | Bacteria | 7676 |
| 283 | Ga0105245_10022684 | 3300009098 | Bacteria | 5509 |
| 284 | Ga0105245_10315678 | 3300009098 | Bacteria | 1538 |
| 285 | Ga0105245_10368595 | 3300009098 | Unclassified | 1427 |
| 286 | Ga0105247_10155816 | 3300009101 | Unclassified | 1509 |
| 287 | Ga0105247_10168914 | 3300009101 | Unclassified | 1453 |
| 288 | Ga0114129_10066808 | 3300009147 | Bacteria | 5015 |
| 289 | Ga0114129_10361169 | 3300009147 | Bacteria | 1921 |
| 290 | Ga0114129_10368295 | 3300009147 | Bacteria | 1900 |
| 291 | Ga0114129_10691740 | 3300009147 | Bacteria | 1311 |
| 292 | Ga0114129_11662856 | 3300009147 | Bacteria | 780 |
| 293 | Ga0105243_10240869 | 3300009148 | Bacteria | 1610 |
| 294 | Ga0105243_10528117 | 3300009148 | Bacteria | 1123 |
| 295 | Ga0105243_10595996 | 3300009148 | Bacteria | 1063 |
| 296 | Ga0105242_10005788 | 3300009176 | Bacteria | 9518 |
| 297 | Ga0105242_10025578 | 3300009176 | Bacteria | 4673 |
| 298 | Ga0105242_10367419 | 3300009176 | Bacteria | 1333 |
| 299 | Ga0105248_10013050 | 3300009177 | Bacteria | 9155 |
| 300 | Ga0105248_10137908 | 3300009177 | Unclassified | 2752 |
| 301 | Ga0105238_10022856 | 3300009551 | Bacteria | 6374 |
| 302 | Ga0105238_10254095 | 3300009551 | Bacteria | 1736 |
| 303 | Ga0105249_10000885 | 3300009553 | Bacteria | 26607 |
| 304 | Ga0105249_10001888 | 3300009553 | Bacteria | 18137 |
| 305 | Ga0105249_10020942 | 3300009553 | Bacteria | 5849 |
| 306 | Ga0105249_10079215 | 3300009553 | Bacteria | 3050 |
| 307 | Ga0105249_10128855 | 3300009553 | Bacteria | 2413 |
| 308 | Ga0105249_10187315 | 3300009553 | Unclassified | 2017 |
| 309 | Ga0105249_10198234 | 3300009553 | Bacteria | 1963 |
| 310 | Ga0105249_10220301 | 3300009553 | Bacteria | 1867 |
| 311 | Ga0099796_10104135 | 3300010159 | Bacteria | 1072 |
| 312 | Ga0105239_10101601 | 3300010375 | Bacteria | 3181 |
| 313 | Ga0105239_10104460 | 3300010375 | Bacteria | 3137 |
| 314 | Ga0105239_10302179 | 3300010375 | Bacteria | 1802 |
| 315 | Ga0105239_10326497 | 3300010375 | Bacteria | 1731 |
| 316 | Ga0105239_10520802 | 3300010375 | Bacteria | 1353 |
| 317 | Ga0105239_10616425 | 3300010375 | Bacteria | 1238 |
| 318 | Ga0105246_10021393 | 3300011119 | Bacteria | 4163 |
| 319 | Ga0105246_10424948 | 3300011119 | Bacteria | 1110 |
| 320 | Ga0157371_10045029 | 3300013102 | Unclassified | 3141 |
| 321 | Ga0157371_10201852 | 3300013102 | Bacteria | 1425 |
| 322 | Ga0157370_10001950 | 3300013104 | Bacteria | 25407 |
| 323 | Ga0157370_10073759 | 3300013104 | Unclassified | 3220 |
| 324 | Ga0157370_10097252 | 3300013104 | Bacteria | 2761 |
| 325 | Ga0157369_10037193 | 3300013105 | Bacteria | 5329 |
| 326 | Ga0157369_10092769 | 3300013105 | Bacteria | 3223 |
| 327 | Ga0157369_10100499 | 3300013105 | Unclassified | 3083 |
| 328 | Ga0157369_10418254 | 3300013105 | Bacteria | 1390 |
| 329 | Ga0157374_10083296 | 3300013296 | Bacteria | 3039 |
| 330 | Ga0157374_10163185 | 3300013296 | Bacteria | 2171 |
| 331 | Ga0157374_10170898 | 3300013296 | Bacteria | 2120 |
| 332 | Ga0157374_10188952 | 3300013296 | Bacteria | 2015 |
| 333 | Ga0157374_10310855 | 3300013296 | Unclassified | 1560 |
| 334 | Ga0157374_11076090 | 3300013296 | Bacteria | 824 |
| 335 | Ga0157378_10008938 | 3300013297 | Bacteria | 8720 |
| 336 | Ga0157378_10032506 | 3300013297 | Bacteria | 4610 |
| 337 | Ga0157378_10088482 | 3300013297 | Bacteria | 2811 |
| 338 | Ga0157378_10113278 | 3300013297 | Bacteria | 2490 |
| 339 | Ga0157378_10212186 | 3300013297 | Bacteria | 1836 |
| 340 | Ga0157378_10517332 | 3300013297 | Bacteria | 1194 |
| 341 | Ga0157378_10801352 | 3300013297 | Bacteria | 968 |
| 342 | Ga0163162_10000958 | 3300013306 | Bacteria | 26782 |
| 343 | Ga0163162_10001067 | 3300013306 | Bacteria | 25476 |
| 344 | Ga0163162_10001504 | 3300013306 | Bacteria | 21712 |
| 345 | Ga0163162_10009864 | 3300013306 | Bacteria | 9289 |
| 346 | Ga0163162_10051756 | 3300013306 | Bacteria | 4121 |
| 347 | Ga0163162_10240077 | 3300013306 | Unclassified | 1943 |
| 348 | Ga0163162_10302260 | 3300013306 | Bacteria | 1732 |
| 349 | Ga0163162_10429061 | 3300013306 | Bacteria | 1454 |
| 350 | Ga0163162_10470564 | 3300013306 | Unclassified | 1388 |
| 351 | Ga0157372_10001731 | 3300013307 | Bacteria | 23669 |
| 352 | Ga0157372_10034222 | 3300013307 | Bacteria | 5585 |
| 353 | Ga0157372_10085768 | 3300013307 | Bacteria | 3572 |
| 354 | Ga0157372_10117456 | 3300013307 | Bacteria | 3051 |
| 355 | Ga0157372_10212079 | 3300013307 | Bacteria | 2244 |
| 356 | Ga0157372_10224609 | 3300013307 | Bacteria | 2177 |
| 357 | Ga0157372_10309134 | 3300013307 | Unclassified | 1840 |
| 358 | Ga0157372_11422903 | 3300013307 | Bacteria | 799 |
| 359 | Ga0157372_11574593 | 3300013307 | Bacteria | 756 |
| 360 | Ga0157375_10022047 | 3300013308 | Bacteria | 5858 |
| 361 | Ga0157375_10078964 | 3300013308 | Bacteria | 3325 |
| 362 | Ga0157375_10118033 | 3300013308 | Bacteria | 2759 |
| 363 | Ga0157375_10142890 | 3300013308 | Unclassified | 2521 |
| 364 | Ga0157375_10185586 | 3300013308 | Bacteria | 2233 |
| 365 | Ga0157375_10647761 | 3300013308 | Bacteria | 1213 |
| 366 | Ga0157375_10891644 | 3300013308 | Unclassified | 1034 |
| 367 | Ga0163163_10000244 | 3300014325 | Bacteria | 55634 |
| 368 | Ga0163163_10010322 | 3300014325 | Bacteria | 8396 |
| 369 | Ga0163163_10056274 | 3300014325 | Unclassified | 3888 |
| 370 | Ga0163163_10360419 | 3300014325 | Bacteria | 1510 |
| 371 | Ga0157380_11312593 | 3300014326 | Bacteria | 771 |
| 372 | Ga0182008_10158309 | 3300014497 | Bacteria | 1138 |
| 373 | Ga0157377_10198680 | 3300014745 | Bacteria | 1272 |
| 374 | Ga0157377_10250241 | 3300014745 | Unclassified | 1148 |
| 375 | Ga0157379_10036725 | 3300014968 | Unclassified | 4368 |
| 376 | Ga0157379_10047334 | 3300014968 | Bacteria | 3837 |
| 377 | Ga0157379_10241082 | 3300014968 | Bacteria | 1640 |
| 378 | Ga0157379_10295203 | 3300014968 | Bacteria | 1476 |
| 379 | Ga0157379_10541886 | 3300014968 | Bacteria | 1082 |
| 380 | Ga0157376_10069089 | 3300014969 | Bacteria | 2994 |
| 381 | Ga0157376_10086393 | 3300014969 | Unclassified | 2704 |
| 382 | Ga0157376_10115339 | 3300014969 | Bacteria | 2371 |
| 383 | Ga0157376_10365445 | 3300014969 | Bacteria | 1385 |
| 384 | Ga0157376_10678005 | 3300014969 | Unclassified | 1034 |
| 385 | Ga0182007_10046842 | 3300015262 | Bacteria | 1431 |
| 386 | Ga0163161_10012978 | 3300017792 | Bacteria | 5789 |
| 387 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 388 | Ga0209026_1000826 | 3300025250 | Bacteria | 16529 |
| 389 | Ga0207673_1003722 | 3300025290 | Bacteria | 1795 |
| 390 | Ga0209758_1010862 | 3300025297 | Bacteria | 5371 |
| 391 | Ga0207426_1000815 | 3300025302 | Bacteria | 33471 |
| 392 | Ga0207697_10001007 | 3300025315 | Bacteria | 15769 |
| 393 | Ga0207697_10002439 | 3300025315 | Bacteria | 9640 |
| 394 | Ga0207697_10003119 | 3300025315 | Bacteria | 8285 |
| 395 | Ga0207697_10006339 | 3300025315 | Bacteria | 5366 |
| 396 | Ga0207697_10011610 | 3300025315 | Bacteria | 3720 |
| 397 | Ga0207697_10056003 | 3300025315 | Bacteria | 1635 |
| 398 | Ga0207656_10197099 | 3300025321 | Bacteria | 972 |
| 399 | Ga0207653_10000588 | 3300025885 | Bacteria | 12860 |
| 400 | Ga0207682_10150367 | 3300025893 | Bacteria | 1050 |
| 401 | Ga0207642_10421082 | 3300025899 | Bacteria | 803 |
| 402 | Ga0207688_10010957 | 3300025901 | Bacteria | 4933 |
| 403 | Ga0207688_10198658 | 3300025901 | Bacteria | 1201 |
| 404 | Ga0207680_10250176 | 3300025903 | Bacteria | 1224 |
| 405 | Ga0207647_10053713 | 3300025904 | Bacteria | 2482 |
| 406 | Ga0207647_10154981 | 3300025904 | Bacteria | 1338 |
| 407 | Ga0207699_10000705 | 3300025906 | Bacteria | 15926 |
| 408 | Ga0207699_10194231 | 3300025906 | Unclassified | 1371 |
| 409 | Ga0207645_10004672 | 3300025907 | Bacteria | 10081 |
| 410 | Ga0207684_10001884 | 3300025910 | Bacteria | 21813 |
| 411 | Ga0207684_10021932 | 3300025910 | Bacteria | 5454 |
| 412 | Ga0207684_10033922 | 3300025910 | Bacteria | 4340 |
| 413 | Ga0207684_10036451 | 3300025910 | Bacteria | 4174 |
| 414 | Ga0207684_10082150 | 3300025910 | Bacteria | 2743 |
| 415 | Ga0207684_10137537 | 3300025910 | Bacteria | 2098 |
| 416 | Ga0207684_10155114 | 3300025910 | Bacteria | 1971 |
| 417 | Ga0207684_10267007 | 3300025910 | Unclassified | 1476 |
| 418 | Ga0207684_10392006 | 3300025910 | Unclassified | 1194 |
| 419 | Ga0207707_10109752 | 3300025912 | Bacteria | 2411 |
| 420 | Ga0207695_10000238 | 3300025913 | Bacteria | 144406 |
| 421 | Ga0207695_10078235 | 3300025913 | Unclassified | 3356 |
| 422 | Ga0207671_10000255 | 3300025914 | Bacteria | 79933 |
| 423 | Ga0207693_10055800 | 3300025915 | Bacteria | 3099 |
| 424 | Ga0207693_10137522 | 3300025915 | Bacteria | 1921 |
| 425 | Ga0207693_10198905 | 3300025915 | Bacteria | 1576 |
| 426 | Ga0207693_10371589 | 3300025915 | Bacteria | 1119 |
| 427 | Ga0207693_10469597 | 3300025915 | Unclassified | 983 |
| 428 | Ga0207663_10004157 | 3300025916 | Bacteria | 7166 |
| 429 | Ga0207663_10235386 | 3300025916 | Bacteria | 1340 |
| 430 | Ga0207660_10003429 | 3300025917 | Bacteria | 10340 |
| 431 | Ga0207660_10027842 | 3300025917 | Bacteria | 3861 |
| 432 | Ga0207662_10148813 | 3300025918 | Bacteria | 1488 |
| 433 | Ga0207662_10216868 | 3300025918 | Bacteria | 1244 |
| 434 | Ga0207662_10287076 | 3300025918 | Bacteria | 1090 |
| 435 | Ga0207657_10092555 | 3300025919 | Bacteria | 2520 |
| 436 | Ga0207657_10149035 | 3300025919 | Bacteria | 1907 |
| 437 | Ga0207649_10006771 | 3300025920 | Bacteria | 6225 |
| 438 | Ga0207649_10093111 | 3300025920 | Unclassified | 1977 |
| 439 | Ga0207652_10025689 | 3300025921 | Bacteria | 4899 |
| 440 | Ga0207652_10421044 | 3300025921 | Unclassified | 1204 |
| 441 | Ga0207652_10738418 | 3300025921 | Bacteria | 877 |
| 442 | Ga0207646_10026757 | 3300025922 | Bacteria | 5262 |
| 443 | Ga0207646_10059083 | 3300025922 | Bacteria | 3424 |
| 444 | Ga0207646_10162489 | 3300025922 | Unclassified | 2015 |
| 445 | Ga0207646_10189038 | 3300025922 | Bacteria | 1860 |
| 446 | Ga0207646_10228675 | 3300025922 | Unclassified | 1680 |
| 447 | Ga0207681_10065876 | 3300025923 | Bacteria | 2506 |
| 448 | Ga0207681_10083374 | 3300025923 | Bacteria | 2262 |
| 449 | Ga0207694_10112111 | 3300025924 | Unclassified | 2170 |
| 450 | Ga0207650_10570193 | 3300025925 | Bacteria | 950 |
| 451 | Ga0207650_10726505 | 3300025925 | Bacteria | 840 |
| 452 | Ga0207659_10173601 | 3300025926 | Bacteria | 1702 |
| 453 | Ga0207659_10182719 | 3300025926 | Bacteria | 1663 |
| 454 | Ga0207659_10185682 | 3300025926 | Bacteria | 1651 |
| 455 | Ga0207659_10434366 | 3300025926 | Bacteria | 1103 |
| 456 | Ga0207659_10502505 | 3300025926 | Unclassified | 1026 |
| 457 | Ga0207659_10840136 | 3300025926 | Bacteria | 789 |
| 458 | Ga0207687_10318444 | 3300025927 | Bacteria | 1258 |
| 459 | Ga0207700_10011937 | 3300025928 | Bacteria | 5570 |
| 460 | Ga0207700_10092984 | 3300025928 | Unclassified | 2386 |
| 461 | Ga0207700_10145586 | 3300025928 | Unclassified | 1952 |
| 462 | Ga0207644_10072440 | 3300025931 | Unclassified | 2523 |
| 463 | Ga0207644_10117041 | 3300025931 | Unclassified | 2023 |
| 464 | Ga0207644_10167442 | 3300025931 | Bacteria | 1713 |
| 465 | Ga0207644_10450950 | 3300025931 | Bacteria | 1057 |
| 466 | Ga0207690_10268060 | 3300025932 | Bacteria | 1325 |
| 467 | Ga0207690_10301255 | 3300025932 | Bacteria | 1254 |
| 468 | Ga0207706_10022719 | 3300025933 | Bacteria | 5630 |
| 469 | Ga0207706_10035490 | 3300025933 | Bacteria | 4433 |
| 470 | Ga0207706_10053098 | 3300025933 | Bacteria | 3578 |
| 471 | Ga0207706_10070895 | 3300025933 | Unclassified | 3065 |
| 472 | Ga0207686_10192942 | 3300025934 | Bacteria | 1453 |
| 473 | Ga0207670_10031551 | 3300025936 | Bacteria | 3397 |
| 474 | Ga0207670_10059432 | 3300025936 | Unclassified | 2600 |
| 475 | Ga0207670_10539321 | 3300025936 | Bacteria | 952 |
| 476 | Ga0207670_10562192 | 3300025936 | Unclassified | 933 |
| 477 | Ga0207669_10569582 | 3300025937 | Bacteria | 916 |
| 478 | Ga0207704_10274805 | 3300025938 | Bacteria | 1277 |
| 479 | Ga0207704_10402823 | 3300025938 | Bacteria | 1080 |
| 480 | Ga0207665_10001465 | 3300025939 | Bacteria | 15884 |
| 481 | Ga0207665_10007229 | 3300025939 | Bacteria | 7348 |
| 482 | Ga0207691_10428532 | 3300025940 | Unclassified | 1127 |
| 483 | Ga0207691_10446246 | 3300025940 | Bacteria | 1101 |
| 484 | Ga0207691_10719061 | 3300025940 | Unclassified | 842 |
| 485 | Ga0207691_10753584 | 3300025940 | Bacteria | 820 |
| 486 | Ga0207711_10124524 | 3300025941 | Unclassified | 2304 |
| 487 | Ga0207689_10085678 | 3300025942 | Unclassified | 2590 |
| 488 | Ga0207689_10128113 | 3300025942 | Bacteria | 2088 |
| 489 | Ga0207661_10009616 | 3300025944 | Bacteria | 6940 |
| 490 | Ga0207661_10107956 | 3300025944 | Bacteria | 2349 |
| 491 | Ga0207661_10148874 | 3300025944 | Bacteria | 2022 |
| 492 | Ga0207661_10321829 | 3300025944 | Unclassified | 1390 |
| 493 | Ga0207661_10343102 | 3300025944 | Bacteria | 1346 |
| 494 | Ga0207679_10000266 | 3300025945 | Bacteria | 39927 |
| 495 | Ga0207679_10130269 | 3300025945 | Bacteria | 2017 |
| 496 | Ga0207679_10472333 | 3300025945 | Bacteria | 1115 |
| 497 | Ga0207679_10512257 | 3300025945 | Bacteria | 1072 |
| 498 | Ga0207667_10002275 | 3300025949 | Bacteria | 24140 |
| 499 | Ga0207667_10552810 | 3300025949 | Unclassified | 1164 |
| 500 | Ga0207667_10648869 | 3300025949 | Bacteria | 1061 |
| 501 | Ga0207667_10839793 | 3300025949 | Bacteria | 913 |
| 502 | Ga0207651_10018983 | 3300025960 | Bacteria | 4109 |
| 503 | Ga0207651_10246222 | 3300025960 | Unclassified | 1460 |
| 504 | Ga0207651_10618954 | 3300025960 | Unclassified | 948 |
| 505 | Ga0207712_10000022 | 3300025961 | Bacteria | 284365 |
| 506 | Ga0207712_10001350 | 3300025961 | Bacteria | 16801 |
| 507 | Ga0207712_10061811 | 3300025961 | Unclassified | 2660 |
| 508 | Ga0207668_10011168 | 3300025972 | Bacteria | 5450 |
| 509 | Ga0207668_10011813 | 3300025972 | Bacteria | 5322 |
| 510 | Ga0207668_10048345 | 3300025972 | Bacteria | 2919 |
| 511 | Ga0207668_10138784 | 3300025972 | Bacteria | 1866 |
| 512 | Ga0207668_10813237 | 3300025972 | Bacteria | 828 |
| 513 | Ga0207640_10224144 | 3300025981 | Bacteria | 1441 |
| 514 | Ga0207658_10135661 | 3300025986 | Bacteria | 1984 |
| 515 | Ga0207677_10172167 | 3300026023 | Bacteria | 1694 |
| 516 | Ga0207677_10329769 | 3300026023 | Bacteria | 1271 |
| 517 | Ga0207677_10454010 | 3300026023 | Bacteria | 1099 |
| 518 | Ga0207703_10054457 | 3300026035 | Bacteria | 3253 |
| 519 | Ga0207639_10053177 | 3300026041 | Bacteria | 3089 |
| 520 | Ga0207639_10104706 | 3300026041 | Bacteria | 2294 |
| 521 | Ga0207639_10181260 | 3300026041 | Bacteria | 1792 |
| 522 | Ga0207678_10001436 | 3300026067 | Bacteria | 21863 |
| 523 | Ga0207678_10037896 | 3300026067 | Bacteria | 4192 |
| 524 | Ga0207678_10058362 | 3300026067 | Bacteria | 3321 |
| 525 | Ga0207708_10017756 | 3300026075 | Bacteria | 5356 |
| 526 | Ga0207708_10024230 | 3300026075 | Bacteria | 4588 |
| 527 | Ga0207708_10122660 | 3300026075 | Bacteria | 2026 |
| 528 | Ga0207702_10220388 | 3300026078 | Unclassified | 1768 |
| 529 | Ga0207641_10373961 | 3300026088 | Bacteria | 1363 |
| 530 | Ga0207648_10191469 | 3300026089 | Unclassified | 1813 |
| 531 | Ga0207676_10050860 | 3300026095 | Bacteria | 3233 |
| 532 | Ga0207676_10455044 | 3300026095 | Bacteria | 1207 |
| 533 | Ga0207674_10002088 | 3300026116 | Bacteria | 25283 |
| 534 | Ga0207674_10006580 | 3300026116 | Bacteria | 13660 |
| 535 | Ga0207674_10016158 | 3300026116 | Bacteria | 8177 |
| 536 | Ga0207674_10281960 | 3300026116 | Bacteria | 1609 |
| 537 | Ga0207674_10349164 | 3300026116 | Unclassified | 1430 |
| 538 | Ga0207675_100061307 | 3300026118 | Bacteria | 3511 |
| 539 | Ga0207675_100076129 | 3300026118 | Bacteria | 3142 |
| 540 | Ga0207675_100152069 | 3300026118 | Bacteria | 2203 |
| 541 | Ga0207683_10014801 | 3300026121 | Bacteria | 6639 |
| 542 | Ga0207683_10158736 | 3300026121 | Bacteria | 2043 |
| 543 | Ga0207683_10250859 | 3300026121 | Unclassified | 1615 |
| 544 | Ga0207698_10003451 | 3300026142 | Bacteria | 9518 |
| 545 | Ga0207698_10044423 | 3300026142 | Unclassified | 3338 |
| 546 | Ga0268266_10073837 | 3300028379 | Unclassified | 2961 |
| 547 | Ga0268266_10646974 | 3300028379 | Unclassified | 1017 |
| 548 | Ga0268265_10000508 | 3300028380 | Bacteria | 40027 |
| 549 | Ga0268265_10445318 | 3300028380 | Bacteria | 1208 |
| 550 | Ga0268264_10000197 | 3300028381 | Bacteria | 123614 |
| 551 | Ga0268264_10001291 | 3300028381 | Bacteria | 23642 |
| 552 | Ga0268264_10007443 | 3300028381 | Bacteria | 9138 |
| 553 | Ga0268264_10042968 | 3300028381 | Bacteria | 3743 |
| 554 | Ga0307517_10006811 | 3300028786 | Bacteria | 16811 |
| 555 | Ga0265338_10015716 | 3300028800 | Bacteria | 8294 |
| 556 | Ga0265325_10087029 | 3300031241 | Bacteria | 1545 |
| 557 | Ga0265339_10114024 | 3300031249 | Bacteria | 1396 |
| 558 | Ga0265327_10000561 | 3300031251 | Bacteria | 63538 |
| 559 | Ga0307513_10083524 | 3300031456 | Bacteria | 3284 |
| 560 | Ga0307509_10035458 | 3300031507 | Bacteria | 5475 |
| 561 | Ga0307509_10172469 | 3300031507 | Bacteria | 2040 |
| 562 | Ga0265313_10138187 | 3300031595 | Bacteria | 1050 |
| 563 | Ga0307508_10004669 | 3300031616 | Bacteria | 13286 |
| 564 | Ga0316579_10000521 | 3300031691 | Bacteria | 12601 |
| 565 | Ga0316579_10107466 | 3300031691 | Bacteria | 1338 |
| 566 | Ga0265342_10019029 | 3300031712 | Bacteria | 4434 |
| 567 | Ga0316576_10196928 | 3300031727 | Bacteria | 1518 |
| 568 | Ga0316578_10047919 | 3300031728 | Bacteria | 2494 |
| 569 | Ga0307516_10000966 | 3300031730 | Bacteria | 39704 |
| 570 | Ga0307405_10380116 | 3300031731 | Bacteria | 1099 |
| 571 | Ga0316577_10004181 | 3300031733 | Bacteria | 7414 |
| 572 | Ga0307409_100233052 | 3300031995 | Bacteria | 1670 |
| 573 | Ga0316585_10058021 | 3300032137 | Unclassified | 1247 |
| 574 | Ga0316593_10019654 | 3300032168 | Bacteria | 2090 |
| 575 | Ga0316593_10030415 | 3300032168 | Bacteria | 1753 |
| 576 | Ga0316593_10088125 | 3300032168 | Bacteria | 1091 |
| 577 | Ga0316592_1004811 | 3300033524 | Bacteria | 2530 |
| 578 | Ga0316586_1002434 | 3300033527 | Bacteria | 2318 |
| 579 | Ga0316588_1010076 | 3300033528 | Bacteria | 1984 |
| 580 | Ga0316587_1002109 | 3300033529 | Bacteria | 2604 |
| 581 | Ga0316596_1004536 | 3300033541 | Bacteria | 3122 |
| 582 | Ga0373938_0005961 | 3300034957 | Bacteria | 2088 |
| 583 | Ga0373928_0054528 | 3300035084 | Bacteria | 952 |
| 584 | Ga0373934_0202892 | 3300035086 | Unclassified | 817 |
| 585 | Ga0373940_0011843 | 3300035088 | Bacteria | 2080 |
| 586 | Ga0373949_0005781 | 3300035090 | Bacteria | 2752 |
| 587 | Ga0373941_0001726 | 3300035115 | Bacteria | 4694 |
| 588 | Ga0373941_0013113 | 3300035115 | Bacteria | 2184 |
| 589 | Ga0373945_0054651 | 3300035116 | Bacteria | 1477 |
| 590 | Ga0373953_0033590 | 3300035117 | Bacteria | 2008 |
| 591 | Ga0373943_0023734 | 3300035170 | Bacteria | 2854 |
| 592 | Ga0373943_0129123 | 3300035170 | Bacteria | 1351 |
| 593 | Ga0373946_0130202 | 3300035171 | Bacteria | 1157 |
| 594 | Ga0373942_0022065 | 3300035207 | Bacteria | 1612 |
| 595 | Ga0373942_0057512 | 3300035207 | Bacteria | 1107 |
| 596 | Ga0373961_0003998 | 3300035241 | Bacteria | 3594 |
| 597 | Ga0373962_0005834 | 3300035242 | Bacteria | 2972 |
| 598 | Ga0373962_0048263 | 3300035242 | Bacteria | 1220 |
| 599 | Ga0316574_0000247 | 3300035398 | Bacteria | 19636 |
| 600 | Ga0316574_0499523 | 3300035398 | Bacteria | 759 |
| 601 | Ga0373931_0000298 | 3300035691 | Bacteria | 20823 |
| 602 | Ga0373931_0008938 | 3300035691 | Bacteria | 4774 |
| 603 | Ga0373935_0009788 | 3300035692 | Bacteria | 5742 |
| 604 | Ga0373935_0044051 | 3300035692 | Bacteria | 2811 |
| 605 | Ga0373935_0184803 | 3300035692 | Bacteria | 1433 |
| 606 | Ga0373927_0330383 | 3300035695 | Bacteria | 1004 |
| 607 | Ga0373927_0452934 | 3300035695 | Bacteria | 848 |
| 608 | Ga0373947_0097588 | 3300035725 | Bacteria | 1842 |
| 609 | Ga0373947_0104905 | 3300035725 | Bacteria | 1780 |
| 610 | Ga0373947_0157484 | 3300035725 | Unclassified | 1467 |
| 611 | Ga0373937_0094486 | 3300036401 | Bacteria | 2772 |
| 612 | Ga0373937_0175444 | 3300036401 | Bacteria | 2012 |
| 613 | Ga0316582_0001370 | 3300036647 | Bacteria | 10613 |
| 614 | Ga0316582_0412936 | 3300036647 | Bacteria | 930 |
| 615 | Ga0316584_0018038 | 3300036712 | Bacteria | 5086 |
| 616 | Ga0373925_0186234 | 3300037068 | Bacteria | 1646 |
| 617 | Ga0373925_0198361 | 3300037068 | Bacteria | 1595 |
| 618 | Ga0373925_0336197 | 3300037068 | Unclassified | 1224 |
| 619 | Ga0373925_0736596 | 3300037068 | Bacteria | 813 |
| 620 | Ga0395900_0124671 | 3300037418 | Bacteria | 2642 |
| 621 | Ga0395898_0078886 | 3300037466 | Bacteria | 3177 |
| 622 | Ga0395898_0233823 | 3300037466 | Bacteria | 1753 |
| 623 | Ga0395905_0555959 | 3300037471 | Unclassified | 1049 |
| 624 | Ga0316581_0007238 | 3300037588 | Bacteria | 2970 |
| 625 | Ga0395901_0738991 | 3300038443 | Bacteria | 978 |
| 626 | Ga0400486_18173 | 3300038742 | Bacteria | 1493 |
| 627 | Ga0400487_27411 | 3300039110 | Bacteria | 3283 |
| 628 | Ga0436361_0756768 | 3300039447 | Bacteria | 12131 |
| 629 | Ga0436363_0343849 | 3300039450 | Bacteria | 803 |
| 630 | Ga0436362_0792311 | 3300039453 | Bacteria | 1044 |
| 631 | Ga0439451_007700 | 3300042009 | Bacteria | 2189 |
| 632 | Ga0439455_0006330 | 3300042012 | Bacteria | 2453 |
| 633 | Ga0451577_0036179 | 3300042876 | Unclassified | 4446 |
| 634 | Ga0451577_0063609 | 3300042876 | Bacteria | 3290 |
| 635 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 636 | Ga0453683_0067696 | 3300044673 | Bacteria | 2232 |
| 637 | Ga0453684_0001795 | 3300044712 | Bacteria | 56980 |
| 638 | Ga0453684_0004535 | 3300044712 | Bacteria | 29128 |
| 639 | Ga0453684_0148033 | 3300044712 | Unclassified | 2794 |
| 640 | Ga0453684_0501094 | 3300044712 | Unclassified | 1344 |
| 641 | Ga0451576_0115891 | 3300045051 | Unclassified | 2789 |
| 642 | Ga0451576_0832790 | 3300045051 | Bacteria | 969 |
| 643 | Ga0466967_0013442 | 3300045976 | Bacteria | 6326 |
| 644 | Ga0495592_0031447 | 3300046454 | Unclassified | 4011 |
| 645 | Ga0495641_0023049 | 3300046461 | Bacteria | 3102 |
| 646 | Ga0495582_0230992 | 3300046473 | Unclassified | 1059 |
| 647 | Ga0495605_0148677 | 3300046474 | Bacteria | 1047 |
| 648 | Ga0495662_0033762 | 3300046476 | Bacteria | 2472 |
| 649 | Ga0495662_0105686 | 3300046476 | Bacteria | 1378 |
| 650 | Ga0495664_0045359 | 3300046477 | Bacteria | 2607 |
| 651 | Ga0495628_0022456 | 3300046516 | Bacteria | 5182 |
| 652 | Ga0495630_0027280 | 3300046517 | Bacteria | 4235 |
| 653 | Ga0495637_0097222 | 3300046520 | Bacteria | 1155 |
| 654 | Ga0495652_0012541 | 3300046529 | Bacteria | 7642 |
| 655 | Ga0495587_0145719 | 3300046536 | Bacteria | 1350 |
| 656 | Ga0495598_0030400 | 3300046537 | Unclassified | 1513 |
| 657 | Ga0495621_0057622 | 3300046539 | Bacteria | 1403 |
| 658 | Ga0495645_0011316 | 3300046543 | Bacteria | 6274 |
| 659 | Ga0495667_0087215 | 3300046559 | Unclassified | 2024 |
| 660 | Ga0495656_0055649 | 3300046615 | Bacteria | 1707 |
| 661 | Ga0495668_0000138 | 3300046616 | Bacteria | 109654 |
| 662 | Ga0495611_0000657 | 3300046648 | Bacteria | 19740 |
| 663 | Ga0495635_0157111 | 3300046663 | Bacteria | 1548 |
| 664 | Ga0495659_0014669 | 3300046664 | Bacteria | 2569 |
| 665 | Ga0495599_0007832 | 3300046678 | Bacteria | 6485 |
| 666 | Ga0495623_0015384 | 3300046679 | Bacteria | 4944 |
| 667 | Ga0495613_0044243 | 3300046689 | Bacteria | 3295 |
| 668 | Ga0495613_0105248 | 3300046689 | Bacteria | 2037 |
| 669 | Ga0495624_0427017 | 3300046690 | Unclassified | 795 |
| 670 | Ga0495649_0013184 | 3300046694 | Bacteria | 4774 |
| 671 | Ga0495581_0226277 | 3300047315 | Bacteria | 1094 |
| 672 | Ga0495636_0000135 | 3300047318 | Bacteria | 29480 |
| 673 | Ga0495680_0255097 | 3300047322 | Unclassified | 1242 |
| 674 | Ga0495687_000422 | 3300047443 | Bacteria | 52393 |
| 675 | Ga0495675_0255221 | 3300047444 | Unclassified | 1052 |
| 676 | Ga0495684_0151353 | 3300047471 | Bacteria | 1734 |
| 677 | Ga0495686_0000265 | 3300047472 | Bacteria | 93838 |
| 678 | Ga0495602_0043870 | 3300048088 | Bacteria | 4060 |
| 679 | Ga0495614_0256543 | 3300048089 | Bacteria | 801 |
| 680 | Ga0496100_0119869 | 3300048903 | Unclassified | 1839 |
| 681 | Ga0496100_0230150 | 3300048903 | Unclassified | 1363 |
| 682 | Ga0496100_0251796 | 3300048903 | Bacteria | 1307 |
| 683 | Ga0496101_0013714 | 3300048904 | Bacteria | 5435 |
| 684 | Ga0496101_0477194 | 3300048904 | Unclassified | 985 |
| 685 | Ga0496102_0014638 | 3300048905 | Bacteria | 6818 |
| 686 | Ga0496102_0069801 | 3300048905 | Bacteria | 3225 |
| 687 | Ga0496102_0170928 | 3300048905 | Bacteria | 2046 |
| 688 | Ga0496103_0075182 | 3300048906 | Bacteria | 2118 |
| 689 | Ga0496103_0106043 | 3300048906 | Bacteria | 1782 |
| 690 | Ga0496104_0081363 | 3300048907 | Bacteria | 3089 |
| 691 | Ga0496104_0086153 | 3300048907 | Unclassified | 2999 |
| 692 | Ga0496104_0119197 | 3300048907 | Bacteria | 2534 |
| 693 | Ga0496104_0189826 | 3300048907 | Bacteria | 1966 |
| 694 | Ga0496104_0312936 | 3300048907 | Unclassified | 1483 |
| 695 | Ga0496105_0087775 | 3300048908 | Bacteria | 2570 |
| 696 | Ga0496105_0102859 | 3300048908 | Bacteria | 2359 |
| 697 | Ga0496106_0003553 | 3300048909 | Bacteria | 11611 |
| 698 | Ga0496106_0025767 | 3300048909 | Bacteria | 4376 |
| 699 | Ga0496108_0039382 | 3300048911 | Bacteria | 3940 |
| 700 | Ga0496108_0487400 | 3300048911 | Bacteria | 1077 |
| 701 | Ga0496109_0032212 | 3300048912 | Unclassified | 4711 |
| 702 | Ga0496109_0061483 | 3300048912 | Bacteria | 3434 |
| 703 | Ga0496109_0162697 | 3300048912 | Unclassified | 2091 |
| 704 | Ga0496109_0313488 | 3300048912 | Bacteria | 1480 |
| 705 | Ga0496109_0786623 | 3300048912 | Bacteria | 889 |
| 706 | Ga0496110_0068266 | 3300048913 | Unclassified | 3147 |
| 707 | Ga0496111_0195920 | 3300048914 | Bacteria | 1502 |
| 708 | Ga0496112_0010080 | 3300048915 | Bacteria | 8557 |
| 709 | Ga0496112_0178072 | 3300048915 | Bacteria | 2090 |
| 710 | Ga0496112_0193518 | 3300048915 | Bacteria | 1995 |
| 711 | Ga0496112_0264988 | 3300048915 | Bacteria | 1667 |
| 712 | Ga0496113_0534377 | 3300048916 | Unclassified | 941 |
| 713 | Ga0496113_0795923 | 3300048916 | Bacteria | 751 |
| 714 | Ga0496114_0053668 | 3300048917 | Unclassified | 3359 |
| 715 | Ga0496114_0110099 | 3300048917 | Bacteria | 2359 |
| 716 | Ga0496114_0472415 | 3300048917 | Unclassified | 1110 |
| 717 | Ga0496115_0008973 | 3300048918 | Bacteria | 7412 |
| 718 | Ga0496115_0021153 | 3300048918 | Bacteria | 5022 |
| 719 | Ga0496115_0076693 | 3300048918 | Bacteria | 2717 |
| 720 | Ga0496115_0082513 | 3300048918 | Bacteria | 2619 |
| 721 | Ga0496115_0112319 | 3300048918 | Bacteria | 2239 |
| 722 | Ga0501031_0000153 | 3300049568 | Bacteria | 39050 |
| 723 | Ga0501032_0000456 | 3300049569 | Bacteria | 32973 |
| 724 | Ga0501032_0021619 | 3300049569 | Bacteria | 4472 |
| 725 | Ga0501032_0035881 | 3300049569 | Bacteria | 3387 |
| 726 | Ga0501033_0008105 | 3300049570 | Bacteria | 8140 |
| 727 | Ga0501033_0032436 | 3300049570 | Bacteria | 3924 |
| 728 | Ga0501034_0003873 | 3300049571 | Bacteria | 16843 |
| 729 | Ga0501034_0009091 | 3300049571 | Bacteria | 10436 |
| 730 | Ga0501034_0014329 | 3300049571 | Bacteria | 8171 |
| 731 | Ga0501034_0015090 | 3300049571 | Bacteria | 7942 |
| 732 | Ga0501034_0081815 | 3300049571 | Bacteria | 3231 |
| 733 | Ga0501034_0610647 | 3300049571 | Bacteria | 995 |
| 734 | Ga0501034_0674412 | 3300049571 | Bacteria | 934 |
| 735 | Ga0501036_0002791 | 3300049572 | Bacteria | 13834 |
| 736 | Ga0501036_0044485 | 3300049572 | Bacteria | 3761 |
| 737 | Ga0501036_0098518 | 3300049572 | Bacteria | 2471 |
| 738 | Ga0501037_0000343 | 3300049573 | Bacteria | 39227 |
| 739 | Ga0501037_0002896 | 3300049573 | Bacteria | 12445 |
| 740 | Ga0501037_0009568 | 3300049573 | Bacteria | 7114 |
| 741 | Ga0501037_0142050 | 3300049573 | Bacteria | 1718 |
| 742 | Ga0501037_0281334 | 3300049573 | Bacteria | 1159 |
| 743 | Ga0501038_0008496 | 3300049574 | Bacteria | 9438 |
| 744 | Ga0501038_0011895 | 3300049574 | Bacteria | 7942 |
| 745 | Ga0501038_0028160 | 3300049574 | Bacteria | 4992 |
| 746 | Ga0501039_0002968 | 3300049575 | Bacteria | 12695 |
| 747 | Ga0501039_0028739 | 3300049575 | Bacteria | 4281 |
| 748 | Ga0501039_0084025 | 3300049575 | Bacteria | 2479 |
| 749 | Ga0501039_0253016 | 3300049575 | Bacteria | 1385 |
| 750 | Ga0501039_0599930 | 3300049575 | Bacteria | 863 |
| 751 | Ga0501040_0040603 | 3300049576 | Bacteria | 3166 |
| 752 | Ga0501041_0122539 | 3300049577 | Bacteria | 1616 |
| 753 | Ga0501043_0000764 | 3300049579 | Bacteria | 28593 |
| 754 | Ga0501043_0017731 | 3300049579 | Bacteria | 5582 |
| 755 | Ga0501043_0029801 | 3300049579 | Bacteria | 4287 |
| 756 | Ga0501043_0091633 | 3300049579 | Bacteria | 2390 |
| 757 | Ga0501046_0000677 | 3300049580 | Bacteria | 33065 |
| 758 | Ga0501046_0012855 | 3300049580 | Bacteria | 7120 |
| 759 | Ga0501046_0124122 | 3300049580 | Bacteria | 1963 |
| 760 | Ga0501046_0147180 | 3300049580 | Bacteria | 1778 |
| 761 | Ga0501046_0208460 | 3300049580 | Bacteria | 1452 |
| 762 | Ga0501046_0209370 | 3300049580 | Bacteria | 1448 |
| 763 | Ga0501047_0005336 | 3300049581 | Bacteria | 12081 |
| 764 | Ga0501047_0007824 | 3300049581 | Bacteria | 10066 |
| 765 | Ga0501047_0026451 | 3300049581 | Bacteria | 5582 |
| 766 | Ga0501047_0119847 | 3300049581 | Bacteria | 2514 |
| 767 | Ga0501047_0358057 | 3300049581 | Bacteria | 1295 |
| 768 | Ga0501048_0010659 | 3300049582 | Bacteria | 6856 |
| 769 | Ga0501067_0081217 | 3300049583 | Bacteria | 1797 |
| 770 | Ga0501069_0000436 | 3300049585 | Bacteria | 18984 |
| 771 | Ga0501070_0000684 | 3300049586 | Bacteria | 31074 |
| 772 | Ga0501070_0004266 | 3300049586 | Bacteria | 12293 |
| 773 | Ga0501070_0656602 | 3300049586 | Bacteria | 832 |
| 774 | Ga0501071_0279205 | 3300049587 | Bacteria | 1264 |
| 775 | Ga0501071_0361793 | 3300049587 | Bacteria | 1105 |
| 776 | Ga0501072_0182435 | 3300049588 | Bacteria | 1674 |
| 777 | Ga0501072_0292701 | 3300049588 | Bacteria | 1294 |
| 778 | Ga0501073_0050198 | 3300049589 | Bacteria | 2924 |
| 779 | Ga0501073_0050937 | 3300049589 | Bacteria | 2900 |
| 780 | Ga0501074_0006737 | 3300049590 | Bacteria | 8288 |
| 781 | Ga0501074_0067027 | 3300049590 | Bacteria | 2582 |
| 782 | Ga0501075_0102758 | 3300049591 | Bacteria | 2171 |
| 783 | Ga0501075_0120709 | 3300049591 | Bacteria | 1995 |
| 784 | Ga0501075_0153200 | 3300049591 | Bacteria | 1757 |
| 785 | Ga0501075_0336452 | 3300049591 | Bacteria | 1150 |
| 786 | Ga0501076_0431936 | 3300049592 | Bacteria | 1084 |
| 787 | Ga0501077_0012932 | 3300049593 | Bacteria | 5228 |
| 788 | Ga0501079_0019576 | 3300049741 | Bacteria | 5170 |
| 789 | Ga0501079_0027791 | 3300049741 | Bacteria | 4339 |
| 790 | Ga0501079_0229249 | 3300049741 | Bacteria | 1451 |
| 791 | Ga0501080_0000676 | 3300049742 | Bacteria | 27213 |
| 792 | Ga0501080_0055007 | 3300049742 | Bacteria | 3706 |
| 793 | Ga0501080_0560839 | 3300049742 | Bacteria | 1017 |
| 794 | Ga0501081_0003747 | 3300049743 | Bacteria | 9734 |
| 795 | Ga0501081_0020321 | 3300049743 | Bacteria | 4425 |
| 796 | Ga0501081_0446346 | 3300049743 | Bacteria | 961 |
| 797 | Ga0501083_0052215 | 3300049744 | Bacteria | 2747 |
| 798 | Ga0501269_000381 | 3300049766 | Bacteria | 10694 |
| 799 | Ga0501035_0006623 | 3300049822 | Bacteria | 10843 |
| 800 | Ga0501035_0009852 | 3300049822 | Bacteria | 8873 |
| 801 | Ga0501035_0025455 | 3300049822 | Bacteria | 5425 |
| 802 | Ga0501044_0003064 | 3300049823 | Bacteria | 18914 |
| 803 | Ga0501044_0007585 | 3300049823 | Bacteria | 11925 |
| 804 | Ga0501044_0024840 | 3300049823 | Bacteria | 6356 |
| 805 | Ga0501044_0047754 | 3300049823 | Bacteria | 4427 |
| 806 | Ga0501044_0122104 | 3300049823 | Bacteria | 2605 |
| 807 | Ga0501044_0162376 | 3300049823 | Unclassified | 2210 |
| 808 | Ga0501044_0248406 | 3300049823 | Bacteria | 1721 |
| 809 | Ga0501044_0252819 | 3300049823 | Bacteria | 1703 |
| 810 | Ga0501045_0151188 | 3300049824 | Bacteria | 1727 |
| 811 | Ga0501045_0167510 | 3300049824 | Bacteria | 1636 |
| 812 | nmdc:mga0k408_15196_c1 | 3300050493 | Bacteria | 4254 |
| 813 | nmdc:mga0k408_18452_c1 | 3300050493 | Bacteria | 3896 |
| 814 | nmdc:mga05p37_207663_c1 | 3300050507 | Bacteria | 2368 |
| 815 | nmdc:mga05p37_216407_c1 | 3300050507 | Unclassified | 2314 |
| 816 | nmdc:mga05p37_435508_c1 | 3300050507 | Bacteria | 1522 |
| 817 | nmdc:mga05p37_488230_c1 | 3300050507 | Bacteria | 1417 |
| 818 | nmdc:mga05p37_739280_c1 | 3300050507 | Bacteria | 1086 |
| 819 | nmdc:mga05p37_989227_c1 | 3300050507 | Unclassified | 895 |
| 820 | nmdc:mga09592_126461_c1 | 3300050508 | Bacteria | 2197 |
| 821 | nmdc:mga0qj67_64889_c1 | 3300050509 | Bacteria | 2906 |
| 822 | nmdc:mga06r32_229289_c1 | 3300050510 | Unclassified | 1845 |
| 823 | nmdc:mga06r32_407227_c1 | 3300050510 | Bacteria | 1342 |
| 824 | nmdc:mga06r32_423349_c1 | 3300050510 | Bacteria | 1313 |
| 825 | nmdc:mga06r32_427557_c1 | 3300050510 | Bacteria | 1305 |
| 826 | nmdc:mga06r32_433871_c1 | 3300050510 | Bacteria | 1294 |
| 827 | nmdc:mga06r32_479493_c1 | 3300050510 | Bacteria | 1222 |
| 828 | nmdc:mga06r32_49787_c1 | 3300050510 | Bacteria | 4008 |
| 829 | nmdc:mga06r32_9161_c1 | 3300050510 | Bacteria | 8920 |
| 830 | nmdc:mga08y16_161046_c1 | 3300050511 | Bacteria | 2332 |
| 831 | nmdc:mga08y16_162128_c1 | 3300050511 | Bacteria | 2323 |
| 832 | nmdc:mga08y16_73156_c1 | 3300050511 | Bacteria | 3571 |
| 833 | nmdc:mga0n895_281261_c1 | 3300050512 | Bacteria | 1687 |
| 834 | nmdc:mga0n895_443705_c1 | 3300050512 | Unclassified | 1311 |
| 835 | nmdc:mga0n895_538945_c1 | 3300050512 | Bacteria | 1173 |
| 836 | nmdc:mga0n895_8224_c1 | 3300050512 | Bacteria | 9019 |
| 837 | nmdc:mga0a205_13478_c1 | 3300050515 | Bacteria | 7612 |
| 838 | nmdc:mga0a205_744965_c1 | 3300050515 | Bacteria | 828 |
| 839 | Ga0495601_0012825 | 3300053077 | Bacteria | 5030 |
| 840 | Ga0495612_0010520 | 3300053078 | Bacteria | 3739 |
| 841 | Ga0495595_0072118 | 3300053084 | Unclassified | 1634 |
| 842 | Ga0500646_0001454 | 3300053090 | Bacteria | 6272 |
| 843 | Ga0500646_0027597 | 3300053090 | Bacteria | 1546 |
| 844 | Ga0500583_0044381 | 3300053092 | Bacteria | 2036 |
| 845 | Ga0500556_0035822 | 3300053104 | Bacteria | 1717 |
| 846 | Ga0500594_0054022 | 3300053118 | Bacteria | 1140 |
| 847 | Ga0500616_0002320 | 3300053153 | Bacteria | 16058 |
| 848 | Ga0500622_0049763 | 3300053156 | Bacteria | 2160 |
| 849 | Ga0501084_0005256 | 3300054114 | Bacteria | 10596 |
| 850 | Ga0501082_0169310 | 3300060353 | Bacteria | 1899 |
| 851 | Ga0501082_0287563 | 3300060353 | Bacteria | 1431 |
| 852 | Ga0501082_0646907 | 3300060353 | Bacteria | 925 |
| 853 | Ga0530510_0006543 | 3300061734 | Bacteria | 8119 |
| 854 | Ga0530510_0353246 | 3300061734 | Bacteria | 1104 |
| 855 | 2740004033 | 2739367857 | Bacteria | 5433684 |
| 856 | 2740008850 | 2739367858 | Bacteria | 5432813 |
| 857 | 2841917994 | 2841917233 | Bacteria | 6173500 |
| 858 | Ga0070703_10029209 | |||
| 859 | MBSR1b_contig_7586419 | |||
| 860 | CNXas_1000173 | |||
| 861 | JGI24737J22298_10053954 | |||
| 862 | JGI24035J26624_1001641 | |||
| 863 | JGI25154J39366_1000021 | |||
| 864 | JGI25157J39369_1004223 | |||
| 865 | JGI25406J46586_10000033 | |||
| 866 | rootH2_10252392 | |||
| 867 | rootL2_10090880 | |||
| 868 | rootH1_10015975 | |||
| 869 | rootH1_10030944 | |||
| 870 | JGI25160J50197_1004110 | |||
| 871 | JGI25405J52794_10000071 | |||
| 872 | Ga0058860_10016173 | |||
| 873 | Ga0065165_1008080 | |||
| 874 | Ga0065703_1019259 | |||
| 875 | Ga0065704_10081204 | |||
| 876 | Ga0065704_10105669 | |||
| 877 | Ga0065712_10021943 | |||
| 878 | Ga0065712_10035301 | |||
| 879 | Ga0065712_10036074 | |||
| 880 | Ga0065712_10087329 | |||
| 881 | Ga0065715_10000818 | |||
| 882 | Ga0065715_10089774 | |||
| 883 | Ga0065715_10141888 | |||
| 884 | Ga0065715_10239743 | |||
| 885 | Ga0065707_10013292 | |||
| 886 | Ga0065707_10033018 | |||
| 887 | Ga0065707_10110072 | |||
| 888 | Ga0065707_10156512 | |||
| 889 | Ga0070676_10068433 | |||
| 890 | Ga0070676_10091736 | |||
| 891 | Ga0070676_10154840 | |||
| 892 | Ga0070683_100000659 | |||
| 893 | Ga0070683_100047367 | |||
| 894 | Ga0070683_100216842 | |||
| 895 | Ga0070683_100610802 | |||
| 896 | Ga0070690_100017352 | |||
| 897 | Ga0070690_100078704 | |||
| 898 | Ga0070690_100231428 | |||
| 899 | Ga0070670_100076633 | |||
| 900 | Ga0068869_100004530 | |||
| 901 | Ga0068869_100184530 | |||
| 902 | Ga0070666_10193830 | |||
| 903 | Ga0070666_10583953 | |||
| 904 | Ga0070680_100002447 | |||
| 905 | Ga0070680_100079457 | |||
| 906 | Ga0070680_100565455 | |||
| 907 | Ga0068868_100130426 | |||
| 908 | Ga0068868_100131474 | |||
| 909 | Ga0068868_100221531 | |||
| 910 | Ga0068868_100363113 | |||
| 911 | Ga0070660_100109268 | |||
| 912 | Ga0070660_100395116 | |||
| 913 | Ga0070689_100008263 | |||
| 914 | Ga0070689_100034716 | |||
| 915 | Ga0070689_100179317 | |||
| 916 | Ga0070689_100511303 | |||
| 917 | Ga0070691_10005767 | |||
| 918 | Ga0070691_10032834 | |||
| 919 | Ga0070661_100000952 | |||
| 920 | Ga0070661_100123174 | |||
| 921 | Ga0070661_100239683 | |||
| 922 | Ga0070661_100253920 | |||
| 923 | Ga0070661_100265666 | |||
| 924 | Ga0070668_100018032 | |||
| 925 | Ga0070668_100053780 | |||
| 926 | Ga0070669_100020563 | |||
| 927 | Ga0070669_100033012 | |||
| 928 | Ga0070675_100007201 | |||
| 929 | Ga0070675_100029889 | |||
| 930 | Ga0070675_100040375 | |||
| 931 | Ga0070675_100048421 | |||
| 932 | Ga0070675_100097464 | |||
| 933 | Ga0070675_100139940 | |||
| 934 | Ga0070675_100141355 | |||
| 935 | Ga0070675_100202070 | |||
| 936 | Ga0070671_100010731 | |||
| 937 | Ga0070671_100200603 | |||
| 938 | Ga0070671_100476199 | |||
| 939 | Ga0070674_100059729 | |||
| 940 | Ga0070674_100119364 | |||
| 941 | Ga0070673_100282283 | |||
| 942 | Ga0070688_100022421 | |||
| 943 | Ga0070688_100354113 | |||
| 944 | Ga0070659_100002818 | |||
| 945 | Ga0070667_100014676 | |||
| 946 | Ga0070667_100086230 | |||
| 947 | Ga0070667_100133588 | |||
| 948 | Ga0070667_100274312 | |||
| 949 | Ga0070667_100497314 | |||
| 950 | Ga0070703_10000413 | |||
| 951 | Ga0070709_10002322 | |||
| 952 | Ga0070709_10244599 | |||
| 953 | Ga0070714_100684739 | |||
| 954 | Ga0070713_100057130 | |||
| 955 | Ga0070713_100068469 | |||
| 956 | Ga0070701_10027627 | |||
| 957 | Ga0070705_100001251 | |||
| 958 | Ga0070700_100002720 | |||
| 959 | Ga0070694_100014391 | |||
| 960 | Ga0070694_100020561 | |||
| 961 | Ga0070694_100072541 | |||
| 962 | Ga0070694_100207616 | |||
| 963 | Ga0070708_100032254 | |||
| 964 | Ga0070708_100034795 | |||
| 965 | Ga0070708_100040417 | |||
| 966 | Ga0070708_100048315 | |||
| 967 | Ga0070708_100087214 | |||
| 968 | Ga0070708_100112762 | |||
| 969 | Ga0070708_100122396 | |||
| 970 | Ga0070708_100128086 | |||
| 971 | Ga0070708_100313602 | |||
| 972 | Ga0070708_100630462 | |||
| 973 | Ga0070663_100024635 | |||
| 974 | Ga0070663_100160017 | |||
| 975 | Ga0070678_100037047 | |||
| 976 | Ga0070678_100380241 | |||
| 977 | Ga0070662_100029761 | |||
| 978 | Ga0070662_100196548 | |||
| 979 | Ga0070662_100275438 | |||
| 980 | Ga0070681_10003953 | |||
| 981 | Ga0070681_10021678 | |||
| 982 | Ga0070681_10124558 | |||
| 983 | Ga0068867_100130568 | |||
| 984 | Ga0068867_100486000 | |||
| 985 | Ga0070685_10389269 | |||
| 986 | Ga0070706_100002101 | |||
| 987 | Ga0070706_100023080 | |||
| 988 | Ga0070706_100041915 | |||
| 989 | Ga0070706_100068717 | |||
| 990 | Ga0070706_100101253 | |||
| 991 | Ga0070706_100129303 | |||
| 992 | Ga0070706_100353727 | |||
| 993 | Ga0070706_100388441 | |||
| 994 | Ga0070706_100552553 | |||
| 995 | Ga0070707_100056199 | |||
| 996 | Ga0070707_100066081 | |||
| 997 | Ga0070707_100076353 | |||
| 998 | Ga0070707_100085864 | |||
| 999 | Ga0070707_100231094 | |||
| 1000 | Ga0070698_100002787 | |||
| 1001 | Ga0070698_100013682 | |||
| 1002 | Ga0070698_100015916 | |||
| 1003 | Ga0070698_100217232 | |||
| 1004 | Ga0070698_100226942 | |||
| 1005 | Ga0070698_100469777 | |||
| 1006 | Ga0070699_100000167 | |||
| 1007 | Ga0070699_100085600 | |||
| 1008 | Ga0070699_100119632 | |||
| 1009 | Ga0070679_100026678 | |||
| 1010 | Ga0070679_100618874 | |||
| 1011 | Ga0070684_100019533 | |||
| 1012 | Ga0070684_100074348 | |||
| 1013 | Ga0070684_100095622 | |||
| 1014 | Ga0070684_100349065 | |||
| 1015 | Ga0070697_100000048 | |||
| 1016 | Ga0070697_100000474 | |||
| 1017 | Ga0070697_100004757 | |||
| 1018 | Ga0070697_100015869 | |||
| 1019 | Ga0070697_100123199 | |||
| 1020 | Ga0070697_100292293 | |||
| 1021 | Ga0070697_100406547 | |||
| 1022 | Ga0068853_100002491 | |||
| 1023 | Ga0068853_100068883 | |||
| 1024 | Ga0068853_100174164 | |||
| 1025 | Ga0068853_100734542 | |||
| 1026 | Ga0068853_100901922 | |||
| 1027 | Ga0070672_100257951 | |||
| 1028 | Ga0070686_100116977 | |||
| 1029 | Ga0070695_100001686 | |||
| 1030 | Ga0070695_100004004 | |||
| 1031 | Ga0070695_100472990 | |||
| 1032 | Ga0070696_100000097 | |||
| 1033 | Ga0070696_100198488 | |||
| 1034 | Ga0070696_100313726 | |||
| 1035 | Ga0070693_100017105 | |||
| 1036 | Ga0070665_100071750 | |||
| 1037 | Ga0070665_100100354 | |||
| 1038 | Ga0070665_100246681 | |||
| 1039 | Ga0070704_100107341 | |||
| 1040 | Ga0068855_100383466 | |||
| 1041 | Ga0070664_100000140 | |||
| 1042 | Ga0070664_100018951 | |||
| 1043 | Ga0070664_100227169 | |||
| 1044 | Ga0070664_100301195 | |||
| 1045 | Ga0070664_100675592 | |||
| 1046 | Ga0068857_100000920 | |||
| 1047 | Ga0068857_100035103 | |||
| 1048 | Ga0068857_100259336 | |||
| 1049 | Ga0068857_100269346 | |||
| 1050 | Ga0068854_100172272 | |||
| 1051 | Ga0068854_100299563 | |||
| 1052 | Ga0068856_100049346 | |||
| 1053 | Ga0068856_100083204 | |||
| 1054 | Ga0068856_100119934 | |||
| 1055 | Ga0068852_100014947 | |||
| 1056 | Ga0068852_100025251 | |||
| 1057 | Ga0068852_100029671 | |||
| 1058 | Ga0068859_100008885 | |||
| 1059 | Ga0068859_100018252 | |||
| 1060 | Ga0068859_100030786 | |||
| 1061 | Ga0068859_100105063 | |||
| 1062 | Ga0068859_100399564 | |||
| 1063 | Ga0068859_100632947 | |||
| 1064 | Ga0068864_100009521 | |||
| 1065 | Ga0068864_100060004 | |||
| 1066 | Ga0068864_100073539 | |||
| 1067 | Ga0068866_10042241 | |||
| 1068 | Ga0068866_10364679 | |||
| 1069 | Ga0068861_100031378 | |||
| 1070 | Ga0068861_100055663 | |||
| 1071 | Ga0068861_100110550 | |||
| 1072 | Ga0068861_100494260 | |||
| 1073 | Ga0068863_100068582 | |||
| 1074 | Ga0068858_100017598 | |||
| 1075 | Ga0068858_100047472 | |||
| 1076 | Ga0068858_100275989 | |||
| 1077 | Ga0068860_100008192 | |||
| 1078 | Ga0068860_100029806 | |||
| 1079 | Ga0068860_100032276 | |||
| 1080 | Ga0068860_100051810 | |||
| 1081 | Ga0068860_100114058 | |||
| 1082 | Ga0068862_100014430 | |||
| 1083 | Ga0081455_10000017 | |||
| 1084 | Ga0081455_10002335 | |||
| 1085 | Ga0081455_10006179 | |||
| 1086 | Ga0081455_10007060 | |||
| 1087 | Ga0081455_10073714 | |||
| 1088 | Ga0081455_10149208 | |||
| 1089 | Ga0081540_1000059 | |||
| 1090 | Ga0081540_1004731 | |||
| 1091 | Ga0081540_1036976 | |||
| 1092 | Ga0081540_1064959 | |||
| 1093 | Ga0081539_10000138 | |||
| 1094 | Ga0081539_10007397 | |||
| 1095 | Ga0081539_10031515 | |||
| 1096 | Ga0081539_10037765 | |||
| 1097 | Ga0070717_10347379 | |||
| 1098 | Ga0070715_10235339 | |||
| 1099 | Ga0070716_100000803 | |||
| 1100 | Ga0070716_100095930 | |||
| 1101 | Ga0070712_100021078 | |||
| 1102 | Ga0070712_100186381 | |||
| 1103 | Ga0097621_100043533 | |||
| 1104 | Ga0097621_100393316 | |||
| 1105 | Ga0075370_10110949 | |||
| 1106 | Ga0068871_100023395 | |||
| 1107 | Ga0068871_100146109 | |||
| 1108 | Ga0075428_100051385 | |||
| 1109 | Ga0075428_100051603 | |||
| 1110 | Ga0075428_100297550 | |||
| 1111 | Ga0075428_100733243 | |||
| 1112 | Ga0075430_100065315 | |||
| 1113 | Ga0075431_100000652 | |||
| 1114 | Ga0075431_100025306 | |||
| 1115 | Ga0075431_100113527 | |||
| 1116 | Ga0075434_100054243 | |||
| 1117 | Ga0075434_100065221 | |||
| 1118 | Ga0075434_100164826 | |||
| 1119 | Ga0075429_100097920 | |||
| 1120 | Ga0075429_100166401 | |||
| 1121 | Ga0068865_100423651 | |||
| 1122 | Ga0075436_100081698 | |||
| 1123 | Ga0097620_100008885 | |||
| 1124 | Ga0097620_100018252 | |||
| 1125 | Ga0097620_100030786 | |||
| 1126 | Ga0097620_100105060 | |||
| 1127 | Ga0097620_100399566 | |||
| 1128 | Ga0075435_100224923 | |||
| 1129 | Ga0075435_100395589 | |||
| 1130 | Ga0099795_10076067 | |||
| 1131 | Ga0105250_10213031 | |||
| 1132 | Ga0105240_10000150 | |||
| 1133 | Ga0105240_10030562 | |||
| 1134 | Ga0105240_10056656 | |||
| 1135 | Ga0111539_10034190 | |||
| 1136 | Ga0111539_10054417 | |||
| 1137 | Ga0111539_10282784 | |||
| 1138 | Ga0111539_10492719 | |||
| 1139 | Ga0105245_10011604 | |||
| 1140 | Ga0105245_10022684 | |||
| 1141 | Ga0105245_10315678 | |||
| 1142 | Ga0105245_10368595 | |||
| 1143 | Ga0105247_10155816 | |||
| 1144 | Ga0105247_10168914 | |||
| 1145 | Ga0114129_10066808 | |||
| 1146 | Ga0114129_10361169 | |||
| 1147 | Ga0114129_10368295 | |||
| 1148 | Ga0114129_10691740 | |||
| 1149 | Ga0114129_11662856 | |||
| 1150 | Ga0105243_10240869 | |||
| 1151 | Ga0105243_10528117 | |||
| 1152 | Ga0105243_10595996 | |||
| 1153 | Ga0105242_10005788 | |||
| 1154 | Ga0105242_10025578 | |||
| 1155 | Ga0105242_10367419 | |||
| 1156 | Ga0105248_10013050 | |||
| 1157 | Ga0105248_10137908 | |||
| 1158 | Ga0105238_10022856 | |||
| 1159 | Ga0105238_10254095 | |||
| 1160 | Ga0105249_10000885 | |||
| 1161 | Ga0105249_10001888 | |||
| 1162 | Ga0105249_10020942 | |||
| 1163 | Ga0105249_10079215 | |||
| 1164 | Ga0105249_10128855 | |||
| 1165 | Ga0105249_10187315 | |||
| 1166 | Ga0105249_10198234 | |||
| 1167 | Ga0105249_10220301 | |||
| 1168 | Ga0099796_10104135 | |||
| 1169 | Ga0105239_10101601 | |||
| 1170 | Ga0105239_10104460 | |||
| 1171 | Ga0105239_10302179 | |||
| 1172 | Ga0105239_10326497 | |||
| 1173 | Ga0105239_10520802 | |||
| 1174 | Ga0105239_10616425 | |||
| 1175 | Ga0105246_10021393 | |||
| 1176 | Ga0105246_10424948 | |||
| 1177 | Ga0157371_10045029 | |||
| 1178 | Ga0157371_10201852 | |||
| 1179 | Ga0157370_10001950 | |||
| 1180 | Ga0157370_10073759 | |||
| 1181 | Ga0157370_10097252 | |||
| 1182 | Ga0157369_10037193 | |||
| 1183 | Ga0157369_10092769 | |||
| 1184 | Ga0157369_10100499 | |||
| 1185 | Ga0157369_10418254 | |||
| 1186 | Ga0157374_10083296 | |||
| 1187 | Ga0157374_10163185 | |||
| 1188 | Ga0157374_10170898 | |||
| 1189 | Ga0157374_10188952 | |||
| 1190 | Ga0157374_10310855 | |||
| 1191 | Ga0157374_11076090 | |||
| 1192 | Ga0157378_10008938 | |||
| 1193 | Ga0157378_10032506 | |||
| 1194 | Ga0157378_10088482 | |||
| 1195 | Ga0157378_10113278 | |||
| 1196 | Ga0157378_10212186 | |||
| 1197 | Ga0157378_10517332 | |||
| 1198 | Ga0157378_10801352 | |||
| 1199 | Ga0163162_10000958 | |||
| 1200 | Ga0163162_10001067 | |||
| 1201 | Ga0163162_10001504 | |||
| 1202 | Ga0163162_10009864 | |||
| 1203 | Ga0163162_10051756 | |||
| 1204 | Ga0163162_10240077 | |||
| 1205 | Ga0163162_10302260 | |||
| 1206 | Ga0163162_10429061 | |||
| 1207 | Ga0163162_10470564 | |||
| 1208 | Ga0157372_10001731 | |||
| 1209 | Ga0157372_10034222 | |||
| 1210 | Ga0157372_10085768 | |||
| 1211 | Ga0157372_10117456 | |||
| 1212 | Ga0157372_10212079 | |||
| 1213 | Ga0157372_10224609 | |||
| 1214 | Ga0157372_10309134 | |||
| 1215 | Ga0157372_11422903 | |||
| 1216 | Ga0157372_11574593 | |||
| 1217 | Ga0157375_10022047 | |||
| 1218 | Ga0157375_10078964 | |||
| 1219 | Ga0157375_10118033 | |||
| 1220 | Ga0157375_10142890 | |||
| 1221 | Ga0157375_10185586 | |||
| 1222 | Ga0157375_10647761 | |||
| 1223 | Ga0157375_10891644 | |||
| 1224 | Ga0163163_10000244 | |||
| 1225 | Ga0163163_10010322 | |||
| 1226 | Ga0163163_10056274 | |||
| 1227 | Ga0163163_10360419 | |||
| 1228 | Ga0157380_11312593 | |||
| 1229 | Ga0182008_10158309 | |||
| 1230 | Ga0157377_10198680 | |||
| 1231 | Ga0157377_10250241 | |||
| 1232 | Ga0157379_10036725 | |||
| 1233 | Ga0157379_10047334 | |||
| 1234 | Ga0157379_10241082 | |||
| 1235 | Ga0157379_10295203 | |||
| 1236 | Ga0157379_10541886 | |||
| 1237 | Ga0157376_10069089 | |||
| 1238 | Ga0157376_10086393 | |||
| 1239 | Ga0157376_10115339 | |||
| 1240 | Ga0157376_10365445 | |||
| 1241 | Ga0157376_10678005 | |||
| 1242 | Ga0182007_10046842 | |||
| 1243 | Ga0163161_10012978 | |||
| 1244 | Ga0209646_1000050 | |||
| 1245 | Ga0209026_1000826 | |||
| 1246 | Ga0207673_1003722 | |||
| 1247 | Ga0209758_1010862 | |||
| 1248 | Ga0207426_1000815 | |||
| 1249 | Ga0207697_10001007 | |||
| 1250 | Ga0207697_10002439 | |||
| 1251 | Ga0207697_10003119 | |||
| 1252 | Ga0207697_10006339 | |||
| 1253 | Ga0207697_10011610 | |||
| 1254 | Ga0207697_10056003 | |||
| 1255 | Ga0207656_10197099 | |||
| 1256 | Ga0207653_10000588 | |||
| 1257 | Ga0207682_10150367 | |||
| 1258 | Ga0207642_10421082 | |||
| 1259 | Ga0207688_10010957 | |||
| 1260 | Ga0207688_10198658 | |||
| 1261 | Ga0207680_10250176 | |||
| 1262 | Ga0207647_10053713 | |||
| 1263 | Ga0207647_10154981 | |||
| 1264 | Ga0207699_10000705 | |||
| 1265 | Ga0207699_10194231 | |||
| 1266 | Ga0207645_10004672 | |||
| 1267 | Ga0207684_10001884 | |||
| 1268 | Ga0207684_10021932 | |||
| 1269 | Ga0207684_10033922 | |||
| 1270 | Ga0207684_10036451 | |||
| 1271 | Ga0207684_10082150 | |||
| 1272 | Ga0207684_10137537 | |||
| 1273 | Ga0207684_10155114 | |||
| 1274 | Ga0207684_10267007 | |||
| 1275 | Ga0207684_10392006 | |||
| 1276 | Ga0207707_10109752 | |||
| 1277 | Ga0207695_10000238 | |||
| 1278 | Ga0207695_10078235 | |||
| 1279 | Ga0207671_10000255 | |||
| 1280 | Ga0207693_10055800 | |||
| 1281 | Ga0207693_10137522 | |||
| 1282 | Ga0207693_10198905 | |||
| 1283 | Ga0207693_10371589 | |||
| 1284 | Ga0207693_10469597 | |||
| 1285 | Ga0207663_10004157 | |||
| 1286 | Ga0207663_10235386 | |||
| 1287 | Ga0207660_10003429 | |||
| 1288 | Ga0207660_10027842 | |||
| 1289 | Ga0207662_10148813 | |||
| 1290 | Ga0207662_10216868 | |||
| 1291 | Ga0207662_10287076 | |||
| 1292 | Ga0207657_10092555 | |||
| 1293 | Ga0207657_10149035 | |||
| 1294 | Ga0207649_10006771 | |||
| 1295 | Ga0207649_10093111 | |||
| 1296 | Ga0207652_10025689 | |||
| 1297 | Ga0207652_10421044 | |||
| 1298 | Ga0207652_10738418 | |||
| 1299 | Ga0207646_10026757 | |||
| 1300 | Ga0207646_10059083 | |||
| 1301 | Ga0207646_10162489 | |||
| 1302 | Ga0207646_10189038 | |||
| 1303 | Ga0207646_10228675 | |||
| 1304 | Ga0207681_10065876 | |||
| 1305 | Ga0207681_10083374 | |||
| 1306 | Ga0207694_10112111 | |||
| 1307 | Ga0207650_10570193 | |||
| 1308 | Ga0207650_10726505 | |||
| 1309 | Ga0207659_10173601 | |||
| 1310 | Ga0207659_10182719 | |||
| 1311 | Ga0207659_10185682 | |||
| 1312 | Ga0207659_10434366 | |||
| 1313 | Ga0207659_10502505 | |||
| 1314 | Ga0207659_10840136 | |||
| 1315 | Ga0207687_10318444 | |||
| 1316 | Ga0207700_10011937 | |||
| 1317 | Ga0207700_10092984 | |||
| 1318 | Ga0207700_10145586 | |||
| 1319 | Ga0207644_10072440 | |||
| 1320 | Ga0207644_10117041 | |||
| 1321 | Ga0207644_10167442 | |||
| 1322 | Ga0207644_10450950 | |||
| 1323 | Ga0207690_10268060 | |||
| 1324 | Ga0207690_10301255 | |||
| 1325 | Ga0207706_10022719 | |||
| 1326 | Ga0207706_10035490 | |||
| 1327 | Ga0207706_10053098 | |||
| 1328 | Ga0207706_10070895 | |||
| 1329 | Ga0207686_10192942 | |||
| 1330 | Ga0207670_10031551 | |||
| 1331 | Ga0207670_10059432 | |||
| 1332 | Ga0207670_10539321 | |||
| 1333 | Ga0207670_10562192 | |||
| 1334 | Ga0207669_10569582 | |||
| 1335 | Ga0207704_10274805 | |||
| 1336 | Ga0207704_10402823 | |||
| 1337 | Ga0207665_10001465 | |||
| 1338 | Ga0207665_10007229 | |||
| 1339 | Ga0207691_10428532 | |||
| 1340 | Ga0207691_10446246 | |||
| 1341 | Ga0207691_10719061 | |||
| 1342 | Ga0207691_10753584 | |||
| 1343 | Ga0207711_10124524 | |||
| 1344 | Ga0207689_10085678 | |||
| 1345 | Ga0207689_10128113 | |||
| 1346 | Ga0207661_10009616 | |||
| 1347 | Ga0207661_10107956 | |||
| 1348 | Ga0207661_10148874 | |||
| 1349 | Ga0207661_10321829 | |||
| 1350 | Ga0207661_10343102 | |||
| 1351 | Ga0207679_10000266 | |||
| 1352 | Ga0207679_10130269 | |||
| 1353 | Ga0207679_10472333 | |||
| 1354 | Ga0207679_10512257 | |||
| 1355 | Ga0207667_10002275 | |||
| 1356 | Ga0207667_10552810 | |||
| 1357 | Ga0207667_10648869 | |||
| 1358 | Ga0207667_10839793 | |||
| 1359 | Ga0207651_10018983 | |||
| 1360 | Ga0207651_10246222 | |||
| 1361 | Ga0207651_10618954 | |||
| 1362 | Ga0207712_10000022 | |||
| 1363 | Ga0207712_10001350 | |||
| 1364 | Ga0207712_10061811 | |||
| 1365 | Ga0207668_10011168 | |||
| 1366 | Ga0207668_10011813 | |||
| 1367 | Ga0207668_10048345 | |||
| 1368 | Ga0207668_10138784 | |||
| 1369 | Ga0207668_10813237 | |||
| 1370 | Ga0207640_10224144 | |||
| 1371 | Ga0207658_10135661 | |||
| 1372 | Ga0207677_10172167 | |||
| 1373 | Ga0207677_10329769 | |||
| 1374 | Ga0207677_10454010 | |||
| 1375 | Ga0207703_10054457 | |||
| 1376 | Ga0207639_10053177 | |||
| 1377 | Ga0207639_10104706 | |||
| 1378 | Ga0207639_10181260 | |||
| 1379 | Ga0207678_10001436 | |||
| 1380 | Ga0207678_10037896 | |||
| 1381 | Ga0207678_10058362 | |||
| 1382 | Ga0207708_10017756 | |||
| 1383 | Ga0207708_10024230 | |||
| 1384 | Ga0207708_10122660 | |||
| 1385 | Ga0207702_10220388 | |||
| 1386 | Ga0207641_10373961 | |||
| 1387 | Ga0207648_10191469 | |||
| 1388 | Ga0207676_10050860 | |||
| 1389 | Ga0207676_10455044 | |||
| 1390 | Ga0207674_10002088 | |||
| 1391 | Ga0207674_10006580 | |||
| 1392 | Ga0207674_10016158 | |||
| 1393 | Ga0207674_10281960 | |||
| 1394 | Ga0207674_10349164 | |||
| 1395 | Ga0207675_100061307 | |||
| 1396 | Ga0207675_100076129 | |||
| 1397 | Ga0207675_100152069 | |||
| 1398 | Ga0207683_10014801 | |||
| 1399 | Ga0207683_10158736 | |||
| 1400 | Ga0207683_10250859 | |||
| 1401 | Ga0207698_10003451 | |||
| 1402 | Ga0207698_10044423 | |||
| 1403 | Ga0268266_10073837 | |||
| 1404 | Ga0268266_10646974 | |||
| 1405 | Ga0268265_10000508 | |||
| 1406 | Ga0268265_10445318 | |||
| 1407 | Ga0268264_10000197 | |||
| 1408 | Ga0268264_10001291 | |||
| 1409 | Ga0268264_10007443 | |||
| 1410 | Ga0268264_10042968 | |||
| 1411 | Ga0307517_10006811 | |||
| 1412 | Ga0265338_10015716 | |||
| 1413 | Ga0265325_10087029 | |||
| 1414 | Ga0265339_10114024 | |||
| 1415 | Ga0265327_10000561 | |||
| 1416 | Ga0307513_10083524 | |||
| 1417 | Ga0307509_10035458 | |||
| 1418 | Ga0307509_10172469 | |||
| 1419 | Ga0265313_10138187 | |||
| 1420 | Ga0307508_10004669 | |||
| 1421 | Ga0316579_10000521 | |||
| 1422 | Ga0316579_10107466 | |||
| 1423 | Ga0265342_10019029 | |||
| 1424 | Ga0316576_10196928 | |||
| 1425 | Ga0316578_10047919 | |||
| 1426 | Ga0307516_10000966 | |||
| 1427 | Ga0307405_10380116 | |||
| 1428 | Ga0316577_10004181 | |||
| 1429 | Ga0307409_100233052 | |||
| 1430 | Ga0316585_10058021 | |||
| 1431 | Ga0316593_10019654 | |||
| 1432 | Ga0316593_10030415 | |||
| 1433 | Ga0316593_10088125 | |||
| 1434 | Ga0316592_1004811 | |||
| 1435 | Ga0316586_1002434 | |||
| 1436 | Ga0316588_1010076 | |||
| 1437 | Ga0316587_1002109 | |||
| 1438 | Ga0316596_1004536 | |||
| 1439 | Ga0373938_0005961 | |||
| 1440 | Ga0373928_0054528 | |||
| 1441 | Ga0373934_0202892 | |||
| 1442 | Ga0373940_0011843 | |||
| 1443 | Ga0373949_0005781 | |||
| 1444 | Ga0373941_0001726 | |||
| 1445 | Ga0373941_0013113 | |||
| 1446 | Ga0373945_0054651 | |||
| 1447 | Ga0373953_0033590 | |||
| 1448 | Ga0373943_0023734 | |||
| 1449 | Ga0373943_0129123 | |||
| 1450 | Ga0373946_0130202 | |||
| 1451 | Ga0373942_0022065 | |||
| 1452 | Ga0373942_0057512 | |||
| 1453 | Ga0373961_0003998 | |||
| 1454 | Ga0373962_0005834 | |||
| 1455 | Ga0373962_0048263 | |||
| 1456 | Ga0316574_0000247 | |||
| 1457 | Ga0316574_0499523 | |||
| 1458 | Ga0373931_0000298 | |||
| 1459 | Ga0373931_0008938 | |||
| 1460 | Ga0373935_0009788 | |||
| 1461 | Ga0373935_0044051 | |||
| 1462 | Ga0373935_0184803 | |||
| 1463 | Ga0373927_0330383 | |||
| 1464 | Ga0373927_0452934 | |||
| 1465 | Ga0373947_0097588 | |||
| 1466 | Ga0373947_0104905 | |||
| 1467 | Ga0373947_0157484 | |||
| 1468 | Ga0373937_0094486 | |||
| 1469 | Ga0373937_0175444 | |||
| 1470 | Ga0316582_0001370 | |||
| 1471 | Ga0316582_0412936 | |||
| 1472 | Ga0316584_0018038 | |||
| 1473 | Ga0373925_0186234 | |||
| 1474 | Ga0373925_0198361 | |||
| 1475 | Ga0373925_0336197 | |||
| 1476 | Ga0373925_0736596 | |||
| 1477 | Ga0395900_0124671 | |||
| 1478 | Ga0395898_0078886 | |||
| 1479 | Ga0395898_0233823 | |||
| 1480 | Ga0395905_0555959 | |||
| 1481 | Ga0316581_0007238 | |||
| 1482 | Ga0395901_0738991 | |||
| 1483 | Ga0400486_18173 | |||
| 1484 | Ga0400487_27411 | |||
| 1485 | Ga0436361_0756768 | |||
| 1486 | Ga0436363_0343849 | |||
| 1487 | Ga0436362_0792311 | |||
| 1488 | Ga0439451_007700 | |||
| 1489 | Ga0439455_0006330 | |||
| 1490 | Ga0451577_0036179 | |||
| 1491 | Ga0451577_0063609 | |||
| 1492 | Ga0466972_0000010 | |||
| 1493 | Ga0453683_0067696 | |||
| 1494 | Ga0453684_0001795 | |||
| 1495 | Ga0453684_0004535 | |||
| 1496 | Ga0453684_0148033 | |||
| 1497 | Ga0453684_0501094 | |||
| 1498 | Ga0451576_0115891 | |||
| 1499 | Ga0451576_0832790 | |||
| 1500 | Ga0466967_0013442 | |||
| 1501 | Ga0495592_0031447 | |||
| 1502 | Ga0495641_0023049 | |||
| 1503 | Ga0495582_0230992 | |||
| 1504 | Ga0495605_0148677 | |||
| 1505 | Ga0495662_0033762 | |||
| 1506 | Ga0495662_0105686 | |||
| 1507 | Ga0495664_0045359 | |||
| 1508 | Ga0495628_0022456 | |||
| 1509 | Ga0495630_0027280 | |||
| 1510 | Ga0495637_0097222 | |||
| 1511 | Ga0495652_0012541 | |||
| 1512 | Ga0495587_0145719 | |||
| 1513 | Ga0495598_0030400 | |||
| 1514 | Ga0495621_0057622 | |||
| 1515 | Ga0495645_0011316 | |||
| 1516 | Ga0495667_0087215 | |||
| 1517 | Ga0495656_0055649 | |||
| 1518 | Ga0495668_0000138 | |||
| 1519 | Ga0495611_0000657 | |||
| 1520 | Ga0495635_0157111 | |||
| 1521 | Ga0495659_0014669 | |||
| 1522 | Ga0495599_0007832 | |||
| 1523 | Ga0495623_0015384 | |||
| 1524 | Ga0495613_0044243 | |||
| 1525 | Ga0495613_0105248 | |||
| 1526 | Ga0495624_0427017 | |||
| 1527 | Ga0495649_0013184 | |||
| 1528 | Ga0495581_0226277 | |||
| 1529 | Ga0495636_0000135 | |||
| 1530 | Ga0495680_0255097 | |||
| 1531 | Ga0495687_000422 | |||
| 1532 | Ga0495675_0255221 | |||
| 1533 | Ga0495684_0151353 | |||
| 1534 | Ga0495686_0000265 | |||
| 1535 | Ga0495602_0043870 | |||
| 1536 | Ga0495614_0256543 | |||
| 1537 | Ga0496100_0119869 | |||
| 1538 | Ga0496100_0230150 | |||
| 1539 | Ga0496100_0251796 | |||
| 1540 | Ga0496101_0013714 | |||
| 1541 | Ga0496101_0477194 | |||
| 1542 | Ga0496102_0014638 | |||
| 1543 | Ga0496102_0069801 | |||
| 1544 | Ga0496102_0170928 | |||
| 1545 | Ga0496103_0075182 | |||
| 1546 | Ga0496103_0106043 | |||
| 1547 | Ga0496104_0081363 | |||
| 1548 | Ga0496104_0086153 | |||
| 1549 | Ga0496104_0119197 | |||
| 1550 | Ga0496104_0189826 | |||
| 1551 | Ga0496104_0312936 | |||
| 1552 | Ga0496105_0087775 | |||
| 1553 | Ga0496105_0102859 | |||
| 1554 | Ga0496106_0003553 | |||
| 1555 | Ga0496106_0025767 | |||
| 1556 | Ga0496108_0039382 | |||
| 1557 | Ga0496108_0487400 | |||
| 1558 | Ga0496109_0032212 | |||
| 1559 | Ga0496109_0061483 | |||
| 1560 | Ga0496109_0162697 | |||
| 1561 | Ga0496109_0313488 | |||
| 1562 | Ga0496109_0786623 | |||
| 1563 | Ga0496110_0068266 | |||
| 1564 | Ga0496111_0195920 | |||
| 1565 | Ga0496112_0010080 | |||
| 1566 | Ga0496112_0178072 | |||
| 1567 | Ga0496112_0193518 | |||
| 1568 | Ga0496112_0264988 | |||
| 1569 | Ga0496113_0534377 | |||
| 1570 | Ga0496113_0795923 | |||
| 1571 | Ga0496114_0053668 | |||
| 1572 | Ga0496114_0110099 | |||
| 1573 | Ga0496114_0472415 | |||
| 1574 | Ga0496115_0008973 | |||
| 1575 | Ga0496115_0021153 | |||
| 1576 | Ga0496115_0076693 | |||
| 1577 | Ga0496115_0082513 | |||
| 1578 | Ga0496115_0112319 | |||
| 1579 | Ga0501031_0000153 | |||
| 1580 | Ga0501032_0000456 | |||
| 1581 | Ga0501032_0021619 | |||
| 1582 | Ga0501032_0035881 | |||
| 1583 | Ga0501033_0008105 | |||
| 1584 | Ga0501033_0032436 | |||
| 1585 | Ga0501034_0003873 | |||
| 1586 | Ga0501034_0009091 | |||
| 1587 | Ga0501034_0014329 | |||
| 1588 | Ga0501034_0015090 | |||
| 1589 | Ga0501034_0081815 | |||
| 1590 | Ga0501034_0610647 | |||
| 1591 | Ga0501034_0674412 | |||
| 1592 | Ga0501036_0002791 | |||
| 1593 | Ga0501036_0044485 | |||
| 1594 | Ga0501036_0098518 | |||
| 1595 | Ga0501037_0000343 | |||
| 1596 | Ga0501037_0002896 | |||
| 1597 | Ga0501037_0009568 | |||
| 1598 | Ga0501037_0142050 | |||
| 1599 | Ga0501037_0281334 | |||
| 1600 | Ga0501038_0008496 | |||
| 1601 | Ga0501038_0011895 | |||
| 1602 | Ga0501038_0028160 | |||
| 1603 | Ga0501039_0002968 | |||
| 1604 | Ga0501039_0028739 | |||
| 1605 | Ga0501039_0084025 | |||
| 1606 | Ga0501039_0253016 | |||
| 1607 | Ga0501039_0599930 | |||
| 1608 | Ga0501040_0040603 | |||
| 1609 | Ga0501041_0122539 | |||
| 1610 | Ga0501043_0000764 | |||
| 1611 | Ga0501043_0017731 | |||
| 1612 | Ga0501043_0029801 | |||
| 1613 | Ga0501043_0091633 | |||
| 1614 | Ga0501046_0000677 | |||
| 1615 | Ga0501046_0012855 | |||
| 1616 | Ga0501046_0124122 | |||
| 1617 | Ga0501046_0147180 | |||
| 1618 | Ga0501046_0208460 | |||
| 1619 | Ga0501046_0209370 | |||
| 1620 | Ga0501047_0005336 | |||
| 1621 | Ga0501047_0007824 | |||
| 1622 | Ga0501047_0026451 | |||
| 1623 | Ga0501047_0119847 | |||
| 1624 | Ga0501047_0358057 | |||
| 1625 | Ga0501048_0010659 | |||
| 1626 | Ga0501067_0081217 | |||
| 1627 | Ga0501069_0000436 | |||
| 1628 | Ga0501070_0000684 | |||
| 1629 | Ga0501070_0004266 | |||
| 1630 | Ga0501070_0656602 | |||
| 1631 | Ga0501071_0279205 | |||
| 1632 | Ga0501071_0361793 | |||
| 1633 | Ga0501072_0182435 | |||
| 1634 | Ga0501072_0292701 | |||
| 1635 | Ga0501073_0050198 | |||
| 1636 | Ga0501073_0050937 | |||
| 1637 | Ga0501074_0006737 | |||
| 1638 | Ga0501074_0067027 | |||
| 1639 | Ga0501075_0102758 | |||
| 1640 | Ga0501075_0120709 | |||
| 1641 | Ga0501075_0153200 | |||
| 1642 | Ga0501075_0336452 | |||
| 1643 | Ga0501076_0431936 | |||
| 1644 | Ga0501077_0012932 | |||
| 1645 | Ga0501079_0019576 | |||
| 1646 | Ga0501079_0027791 | |||
| 1647 | Ga0501079_0229249 | |||
| 1648 | Ga0501080_0000676 | |||
| 1649 | Ga0501080_0055007 | |||
| 1650 | Ga0501080_0560839 | |||
| 1651 | Ga0501081_0003747 | |||
| 1652 | Ga0501081_0020321 | |||
| 1653 | Ga0501081_0446346 | |||
| 1654 | Ga0501083_0052215 | |||
| 1655 | Ga0501269_000381 | |||
| 1656 | Ga0501035_0006623 | |||
| 1657 | Ga0501035_0009852 | |||
| 1658 | Ga0501035_0025455 | |||
| 1659 | Ga0501044_0003064 | |||
| 1660 | Ga0501044_0007585 | |||
| 1661 | Ga0501044_0024840 | |||
| 1662 | Ga0501044_0047754 | |||
| 1663 | Ga0501044_0122104 | |||
| 1664 | Ga0501044_0162376 | |||
| 1665 | Ga0501044_0248406 | |||
| 1666 | Ga0501044_0252819 | |||
| 1667 | Ga0501045_0151188 | |||
| 1668 | Ga0501045_0167510 | |||
| 1669 | nmdc:mga0k408_15196_c1 | |||
| 1670 | nmdc:mga0k408_18452_c1 | |||
| 1671 | nmdc:mga05p37_207663_c1 | |||
| 1672 | nmdc:mga05p37_216407_c1 | |||
| 1673 | nmdc:mga05p37_435508_c1 | |||
| 1674 | nmdc:mga05p37_488230_c1 | |||
| 1675 | nmdc:mga05p37_739280_c1 | |||
| 1676 | nmdc:mga05p37_989227_c1 | |||
| 1677 | nmdc:mga09592_126461_c1 | |||
| 1678 | nmdc:mga0qj67_64889_c1 | |||
| 1679 | nmdc:mga06r32_229289_c1 | |||
| 1680 | nmdc:mga06r32_407227_c1 | |||
| 1681 | nmdc:mga06r32_423349_c1 | |||
| 1682 | nmdc:mga06r32_427557_c1 | |||
| 1683 | nmdc:mga06r32_433871_c1 | |||
| 1684 | nmdc:mga06r32_479493_c1 | |||
| 1685 | nmdc:mga06r32_49787_c1 | |||
| 1686 | nmdc:mga06r32_9161_c1 | |||
| 1687 | nmdc:mga08y16_161046_c1 | |||
| 1688 | nmdc:mga08y16_162128_c1 | |||
| 1689 | nmdc:mga08y16_73156_c1 | |||
| 1690 | nmdc:mga0n895_281261_c1 | |||
| 1691 | nmdc:mga0n895_443705_c1 | |||
| 1692 | nmdc:mga0n895_538945_c1 | |||
| 1693 | nmdc:mga0n895_8224_c1 | |||
| 1694 | nmdc:mga0a205_13478_c1 | |||
| 1695 | nmdc:mga0a205_744965_c1 | |||
| 1696 | Ga0495601_0012825 | |||
| 1697 | Ga0495612_0010520 | |||
| 1698 | Ga0495595_0072118 | |||
| 1699 | Ga0500646_0001454 | |||
| 1700 | Ga0500646_0027597 | |||
| 1701 | Ga0500583_0044381 | |||
| 1702 | Ga0500556_0035822 | |||
| 1703 | Ga0500594_0054022 | |||
| 1704 | Ga0500616_0002320 | |||
| 1705 | Ga0500622_0049763 | |||
| 1706 | Ga0501084_0005256 | |||
| 1707 | Ga0501082_0169310 | |||
| 1708 | Ga0501082_0287563 | |||
| 1709 | Ga0501082_0646907 | |||
| 1710 | Ga0530510_0006543 | |||
| 1711 | Ga0530510_0353246 | |||
| 1712 | 2740004033 | |||
| 1713 | 2740008850 | |||
| 1714 | 2841917994 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3knu-assembly1.cif.gz_B | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.9116 | 1 | 211 |
| 3knu-assembly2.cif.gz_C | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.9041 | 1 | 211 |
| 4yq1-assembly1.cif.gz_A | crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds | 0.903 | 1 | 211 |
| 3knu-assembly1.cif.gz_A | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.9028 | 1 | 211 |
| 3knu-assembly2.cif.gz_D | crystal structure of trna (guanine-n1)-methyltransferase from anaplasma phagocytophilum | 0.902 | 1 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ky7A01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9284 | 1 | 155 | 3.40.1280.10 |
| 5wyrA01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9255 | 1 | 160 | 3.40.1280.10 |
| 3iefB01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9197 | 1 | 155 | 3.40.1280.10 |
| 1oy5C01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9176 | 1 | 160 | 3.40.1280.10 |
| 3ky7A01 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.917 | 1 | 155 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A368B863-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9674 | 1 | 155 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A2H0VR85-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) | 0.966 | 1 | 169 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A0G1ZQZ9-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) | 0.9659 | 1 | 166 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A7W1JH08-F1-model_v4 | tRNA (Guanosine(37)-N1)-methyltransferase TrmD | 0.9647 | 1 | 152 |
GO:0002939
GO:0005829 GO:0052906 |
| AF-A0A524PE26-F1-model_v4 | tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) | 0.9636 | 1 | 155 |
GO:0002939
GO:0005829 GO:0052906 |