F483588

General Info

Members Datasets Scaffolds Average Seq Length
854 467 848 64

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_11388883|Ga0307406_113888832
Length 77
Sequence VFLKGLQIDETTMPKLKTNRAAAKRFRPTAKGFKRTQSHRRHILTKKPSKRKRQLRAPSMVAKQDLVRMEQLLPNAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
4 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
5 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
6 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
7 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
8 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
125 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
199 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
200 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
209 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
210 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
211 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
212 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
229 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
230 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
231 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
232 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
254 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
255 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
256 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
264 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
265 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
266 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
267 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
268 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
270 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
271 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
275 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
276 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
286 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
287 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
290 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
291 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
295 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
296 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
297 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
298 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
299 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
300 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
301 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
302 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
303 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
306 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
307 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
308 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
311 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
312 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
313 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
314 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
315 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
316 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
317 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
318 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
319 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
320 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
321 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
322 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
323 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
324 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
325 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
326 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
327 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
328 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
331 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
332 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
333 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
336 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
337 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
344 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
345 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
355 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
356 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
370 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
371 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
372 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
373 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
374 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
375 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
376 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
377 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
378 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
379 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
380 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
388 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
389 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
390 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
391 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
411 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
412 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
413 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
416 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
417 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
418 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
419 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
420 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
421 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
425 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
428 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
429 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
430 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
431 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
432 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
433 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
434 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
435 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
436 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
437 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
438 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
439 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
440 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
441 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
442 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
445 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
446 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
447 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
448 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
449 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
450 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
451 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
452 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
453 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
456 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
457 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
458 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.01
Metatranscriptomes 14.29
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0.23
Rhizoplane 1.99
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1161348 2162886007 Bacteria 8226
2 LJNas_1013031 3300000546 Bacteria 885
3 JGI24743J22301_10141483 3300001991 Bacteria 535
4 JGI24748J21848_1032926 3300002074 Bacteria 644
5 Ga0006759J45824_1050395 3300003163 Bacteria 819
6 rootL2_10091007 3300003322 Bacteria 3155
7 Ga0058861_11497037 3300004800 Bacteria 524
8 Ga0065717_1014737 3300005276 Bacteria 534
9 Ga0065704_10000886 3300005289 Bacteria 14107
10 Ga0065704_10484093 3300005289 Bacteria 675
11 Ga0065712_10068636 3300005290 Bacteria 9559
12 Ga0065715_10682560 3300005293 Bacteria 662
13 Ga0065707_10008504 3300005295 Bacteria 2659
14 Ga0065707_10082235 3300005295 Bacteria 18552
15 Ga0065707_10082999 3300005295 Bacteria 10950
16 Ga0070676_10136153 3300005328 Bacteria 1558
17 Ga0070676_11097052 3300005328 Unclassified 601
18 Ga0070683_100559146 3300005329 Bacteria 1094
19 Ga0070690_100001299 3300005330 Bacteria 12982
20 Ga0070690_100327377 3300005330 Bacteria 1106
21 Ga0070670_100033908 3300005331 Bacteria 4395
22 Ga0070670_100542502 3300005331 Bacteria 1037
23 Ga0070670_100953885 3300005331 Bacteria 779
24 Ga0070677_10122871 3300005333 Bacteria 1175
25 Ga0068869_100206448 3300005334 Bacteria 1551
26 Ga0068869_100402223 3300005334 Bacteria 1126
27 Ga0068869_100661643 3300005334 Bacteria 887
28 Ga0070666_11458937 3300005335 Bacteria 512
29 Ga0070680_100368323 3300005336 Bacteria 1222
30 Ga0070682_100180880 3300005337 Bacteria 1473
31 Ga0070682_100876720 3300005337 Unclassified 735
32 Ga0070682_101724068 3300005337 Bacteria 545
33 Ga0068868_100252023 3300005338 Bacteria 1486
34 Ga0070660_100331794 3300005339 Bacteria 1251
35 Ga0070689_100027582 3300005340 Bacteria 4281
36 Ga0070689_101657738 3300005340 Bacteria 581
37 Ga0070691_10180959 3300005341 Bacteria 1097
38 Ga0070687_101364706 3300005343 Bacteria 528
39 Ga0070661_100086889 3300005344 Bacteria 2312
40 Ga0070692_10143499 3300005345 Bacteria 1353
41 Ga0070692_10967101 3300005345 Bacteria 593
42 Ga0070668_100010219 3300005347 Bacteria 6962
43 Ga0070668_100164431 3300005347 Bacteria 1802
44 Ga0070669_100115369 3300005353 Bacteria 2043
45 Ga0070669_100931022 3300005353 Bacteria 743
46 Ga0070669_101679014 3300005353 Bacteria 553
47 Ga0070675_100046169 3300005354 Bacteria 3566
48 Ga0070675_101571674 3300005354 Bacteria 607
49 Ga0070671_100507933 3300005355 Bacteria 1037
50 Ga0070674_100602230 3300005356 Bacteria 929
51 Ga0070673_100007087 3300005364 Bacteria 7361
52 Ga0070673_100657062 3300005364 Bacteria 960
53 Ga0070688_100001611 3300005365 Bacteria 11293
54 Ga0070688_100380569 3300005365 Unclassified 1040
55 Ga0070659_100990445 3300005366 Bacteria 737
56 Ga0070667_100078669 3300005367 Bacteria 2818
57 Ga0070703_10047148 3300005406 Bacteria 1364
58 Ga0070703_10104043 3300005406 Bacteria 1005
59 Ga0070714_100000908 3300005435 Bacteria 20948
60 Ga0070701_10077327 3300005438 Bacteria 1793
61 Ga0070701_10117777 3300005438 Bacteria 1492
62 Ga0070701_10327901 3300005438 Bacteria 949
63 Ga0070711_100049229 3300005439 Bacteria 2886
64 Ga0070711_100118160 3300005439 Bacteria 1956
65 Ga0070711_100461032 3300005439 Bacteria 1042
66 Ga0070705_100025617 3300005440 Bacteria 3200
67 Ga0070700_100035954 3300005441 Bacteria 3001
68 Ga0070700_100213430 3300005441 Bacteria 1363
69 Ga0070694_100096426 3300005444 Bacteria 2085
70 Ga0070694_100137700 3300005444 Bacteria 1770
71 Ga0070694_101389680 3300005444 Bacteria 592
72 Ga0070694_101680138 3300005444 Bacteria 540
73 Ga0070708_100081763 3300005445 Bacteria 2925
74 Ga0070708_101603992 3300005445 Bacteria 605
75 Ga0070663_100010247 3300005455 Bacteria 5838
76 Ga0070663_100300954 3300005455 Bacteria 1284
77 Ga0070678_101095528 3300005456 Bacteria 735
78 Ga0070678_101633563 3300005456 Bacteria 605
79 Ga0070662_100018270 3300005457 Bacteria 4741
80 Ga0070662_100381733 3300005457 Bacteria 1160
81 Ga0070662_100496455 3300005457 Bacteria 1018
82 Ga0070681_10368622 3300005458 Bacteria 1346
83 Ga0068867_100031965 3300005459 Bacteria 3803
84 Ga0068867_100213365 3300005459 Bacteria 1551
85 Ga0070685_10026085 3300005466 Bacteria 3219
86 Ga0070685_10122749 3300005466 Bacteria 1615
87 Ga0070706_100162761 3300005467 Bacteria 2084
88 Ga0070706_100365613 3300005467 Bacteria 1344
89 Ga0070706_100980465 3300005467 Bacteria 780
90 Ga0070706_101401128 3300005467 Bacteria 640
91 Ga0070707_100065637 3300005468 Bacteria 3487
92 Ga0070707_101437548 3300005468 Bacteria 656
93 Ga0070698_100024837 3300005471 Bacteria 6249
94 Ga0070698_100272059 3300005471 Bacteria 1625
95 Ga0070698_101481873 3300005471 Bacteria 630
96 Ga0070698_101691699 3300005471 Bacteria 585
97 Ga0070699_100000588 3300005518 Bacteria 34229
98 Ga0070684_100073804 3300005535 Bacteria 3007
99 Ga0068853_100325046 3300005539 Bacteria 1426
100 Ga0070672_100085735 3300005543 Bacteria 2532
101 Ga0070672_100733730 3300005543 Bacteria 866
102 Ga0070672_101672652 3300005543 Bacteria 572
103 Ga0070686_100008391 3300005544 Bacteria 5784
104 Ga0070695_100192729 3300005545 Bacteria 1452
105 Ga0070695_101614063 3300005545 Bacteria 542
106 Ga0070696_100008240 3300005546 Bacteria 6976
107 Ga0070696_100083454 3300005546 Bacteria 2266
108 Ga0070696_100311031 3300005546 Bacteria 1209
109 Ga0070693_100239448 3300005547 Bacteria 1198
110 Ga0070693_100433965 3300005547 Bacteria 918
111 Ga0070665_100091783 3300005548 Bacteria 3042
112 Ga0070665_100125824 3300005548 Bacteria 2565
113 Ga0070704_100012138 3300005549 Bacteria 5316
114 Ga0070704_100554309 3300005549 Bacteria 1005
115 Ga0070664_100024248 3300005564 Bacteria 5017
116 Ga0068854_101510688 3300005578 Bacteria 610
117 Ga0070702_100207188 3300005615 Bacteria 1302
118 Ga0070702_100923388 3300005615 Unclassified 685
119 Ga0070702_101806712 3300005615 Bacteria 511
120 Ga0068852_100531697 3300005616 Bacteria 1174
121 Ga0068852_101199238 3300005616 Bacteria 780
122 Ga0068852_101713464 3300005616 Bacteria 651
123 Ga0068859_100019428 3300005617 Bacteria 6824
124 Ga0068859_100569848 3300005617 Bacteria 1226
125 Ga0068859_101164247 3300005617 Bacteria 849
126 Ga0068859_101331176 3300005617 Bacteria 792
127 Ga0068864_100006308 3300005618 Bacteria 9727
128 Ga0068864_100856216 3300005618 Bacteria 896
129 Ga0068866_10096977 3300005718 Bacteria 1618
130 Ga0068861_100002820 3300005719 Bacteria 11426
131 Ga0068861_100009515 3300005719 Bacteria 6714
132 Ga0068861_100012749 3300005719 Bacteria 5867
133 Ga0068861_100887284 3300005719 Bacteria 843
134 Ga0068861_100906035 3300005719 Bacteria 835
135 Ga0068861_101229208 3300005719 Unclassified 726
136 Ga0068861_102116737 3300005719 Bacteria 563
137 Ga0068861_102499249 3300005719 Unclassified 520
138 Ga0068870_10031824 3300005840 Bacteria 2675
139 Ga0068870_10365646 3300005840 Bacteria 929
140 Ga0068863_100008283 3300005841 Bacteria 10159
141 Ga0068858_100169228 3300005842 Bacteria 2060
142 Ga0068858_100311631 3300005842 Bacteria 1503
143 Ga0068860_101064807 3300005843 Bacteria 827
144 Ga0068862_100046867 3300005844 Bacteria 3687
145 Ga0068862_100412668 3300005844 Bacteria 1265
146 Ga0068862_102295416 3300005844 Bacteria 551
147 Ga0081455_10119154 3300005937 Bacteria 2082
148 Ga0081538_10095457 3300005981 Bacteria 1519
149 Ga0081540_1045744 3300005983 Bacteria 2218
150 Ga0070716_100149313 3300006173 Bacteria 1501
151 Ga0070712_100443179 3300006175 Bacteria 1080
152 Ga0075367_10606062 3300006178 Bacteria 696
153 Ga0075427_10021717 3300006194 Bacteria 1022
154 Ga0075366_10867641 3300006195 Bacteria 562
155 Ga0075366_10933558 3300006195 Unclassified 541
156 Ga0097621_100031265 3300006237 Bacteria 4224
157 Ga0097621_100035941 3300006237 Bacteria 3960
158 Ga0097621_100341495 3300006237 Bacteria 1330
159 Ga0068871_100043621 3300006358 Bacteria 3603
160 Ga0075428_100016674 3300006844 Bacteria 8112
161 Ga0075428_100364315 3300006844 Bacteria 1550
162 Ga0075428_100624900 3300006844 Bacteria 1150
163 Ga0075430_100141774 3300006846 Bacteria 2001
164 Ga0075430_100421302 3300006846 Bacteria 1102
165 Ga0075430_100780193 3300006846 Unclassified 788
166 Ga0075431_100006643 3300006847 Bacteria 11487
167 Ga0075431_100283791 3300006847 Bacteria 1676
168 Ga0075431_101635267 3300006847 Bacteria 601
169 Ga0075433_10112354 3300006852 Bacteria 2417
170 Ga0075433_10448430 3300006852 Bacteria 1137
171 Ga0075433_11756764 3300006852 Bacteria 534
172 Ga0075434_100017206 3300006871 Bacteria 6961
173 Ga0075434_100567045 3300006871 Bacteria 1155
174 Ga0075434_102274192 3300006871 Unclassified 545
175 Ga0075429_100036699 3300006880 Bacteria 4264
176 Ga0075429_100256397 3300006880 Bacteria 1531
177 Ga0075429_101459212 3300006880 Bacteria 595
178 Ga0068865_100133709 3300006881 Bacteria 1861
179 Ga0068865_100476494 3300006881 Bacteria 1037
180 Ga0068865_100881016 3300006881 Bacteria 777
181 Ga0075436_100304509 3300006914 Bacteria 1143
182 Ga0075436_100765378 3300006914 Bacteria 718
183 Ga0097620_100019430 3300006931 Bacteria 6824
184 Ga0097620_101164279 3300006931 Bacteria 849
185 Ga0097620_101331124 3300006931 Bacteria 792
186 Ga0099826_10086223 3300006948 Bacteria 1936
187 Ga0075435_100187890 3300007076 Bacteria 1748
188 Ga0075435_100605723 3300007076 Bacteria 950
189 Ga0099794_10028606 3300007265 Bacteria 2593
190 Ga0099795_10000903 3300007788 Bacteria 5981
191 Ga0099795_10012130 3300007788 Bacteria 2602
192 Ga0099795_10037778 3300007788 Bacteria 1701
193 Ga0105244_10503751 3300009036 Bacteria 557
194 Ga0105250_10000006 3300009092 Bacteria 390071
195 Ga0105250_10124972 3300009092 Bacteria 1059
196 Ga0105240_10327897 3300009093 Bacteria 1743
197 Ga0105240_11968419 3300009093 Bacteria 607
198 Ga0111539_10082033 3300009094 Unclassified 3793
199 Ga0111539_10350561 3300009094 Bacteria 1718
200 Ga0111539_10412106 3300009094 Bacteria 1574
201 Ga0111539_10484305 3300009094 Bacteria 1441
202 Ga0111539_11148744 3300009094 Bacteria 902
203 Ga0111539_12714975 3300009094 Unclassified 574
204 Ga0111539_13022686 3300009094 Unclassified 543
205 Ga0105245_10224021 3300009098 Bacteria 1816
206 Ga0105247_10021258 3300009101 Bacteria 3904
207 Ga0105247_10051475 3300009101 Bacteria 2536
208 Ga0114129_10092570 3300009147 Bacteria 4188
209 Ga0114129_11784086 3300009147 Bacteria 749
210 Ga0114129_13097839 3300009147 Bacteria 544
211 Ga0105243_10091814 3300009148 Bacteria 2501
212 Ga0105243_11094481 3300009148 Unclassified 805
213 Ga0105243_11175929 3300009148 Bacteria 779
214 Ga0105241_10248194 3300009174 Bacteria 1508
215 Ga0105242_10085791 3300009176 Bacteria 2641
216 Ga0105242_11770049 3300009176 Bacteria 656
217 Ga0105248_10003777 3300009177 Bacteria 16771
218 Ga0105248_12746339 3300009177 Bacteria 562
219 Ga0105237_10838535 3300009545 Bacteria 926
220 Ga0105238_10261134 3300009551 Bacteria 1711
221 Ga0105249_10014854 3300009553 Bacteria 6886
222 Ga0105249_10319390 3300009553 Unclassified 1564
223 Ga0105249_10980898 3300009553 Bacteria 913
224 Ga0105249_11173811 3300009553 Bacteria 838
225 Ga0099796_10007558 3300010159 Bacteria 2847
226 Ga0099796_10385249 3300010159 Unclassified 612
227 Ga0105239_11278207 3300010375 Bacteria 846
228 Ga0105246_11163208 3300011119 Bacteria 708
229 Ga0105246_11628576 3300011119 Unclassified 611
230 Ga0157341_1010192 3300012494 Bacteria 794
231 Ga0157339_1007580 3300012505 Bacteria 914
232 Ga0157373_11200257 3300013100 Bacteria 572
233 Ga0157370_10612654 3300013104 Bacteria 996
234 Ga0157370_10796679 3300013104 Bacteria 860
235 Ga0157374_10615275 3300013296 Bacteria 1097
236 Ga0157374_11195551 3300013296 Bacteria 781
237 Ga0157378_10900088 3300013297 Bacteria 915
238 Ga0163162_10352023 3300013306 Bacteria 1605
239 Ga0163162_11436937 3300013306 Bacteria 785
240 Ga0163162_11446080 3300013306 Bacteria 782
241 Ga0163162_11954469 3300013306 Bacteria 672
242 Ga0157375_10302115 3300013308 Bacteria 1764
243 Ga0157375_10306320 3300013308 Bacteria 1752
244 Ga0163163_10033935 3300014325 Bacteria 4940
245 Ga0163163_10071291 3300014325 Bacteria 3462
246 Ga0163163_12825685 3300014325 Bacteria 542
247 Ga0157380_10000591 3300014326 Bacteria 22352
248 Ga0157380_10473493 3300014326 Bacteria 1209
249 Ga0157380_10864419 3300014326 Bacteria 927
250 Ga0157380_11594196 3300014326 Bacteria 708
251 Ga0157380_12172962 3300014326 Bacteria 619
252 Ga0157380_13068487 3300014326 Bacteria 532
253 Ga0157380_13164881 3300014326 Bacteria 525
254 Ga0157380_13269189 3300014326 Bacteria 518
255 Ga0157377_10382420 3300014745 Bacteria 953
256 Ga0157377_10853619 3300014745 Bacteria 676
257 Ga0157379_10005406 3300014968 Bacteria 10968
258 Ga0157379_10183299 3300014968 Bacteria 1891
259 Ga0157379_11461637 3300014968 Bacteria 664
260 Ga0157376_10263095 3300014969 Bacteria 1617
261 Ga0157376_10433111 3300014969 Bacteria 1279
262 Ga0182007_10083740 3300015262 Bacteria 1047
263 Ga0163161_10076747 3300017792 Bacteria 2453
264 Ga0163161_11514113 3300017792 Bacteria 589
265 Ga0163161_11800459 3300017792 Bacteria 544
266 Ga0184594_106948 3300019181 Bacteria 624
267 Ga0206352_10818112 3300020078 Bacteria 1134
268 Ga0224570_102507 3300022730 Bacteria 1225
269 Ga0224572_1026876 3300024225 Bacteria 1103
270 Ga0207696_1000069 3300025711 Bacteria 227744
271 Ga0207653_10024985 3300025885 Bacteria 1909
272 Ga0207653_10030978 3300025885 Bacteria 1727
273 Ga0207682_10032587 3300025893 Bacteria 2095
274 Ga0207642_10048052 3300025899 Bacteria 1911
275 Ga0207710_10042513 3300025900 Bacteria 2018
276 Ga0207710_10042526 3300025900 Bacteria 2018
277 Ga0207688_10213444 3300025901 Bacteria 1160
278 Ga0207688_10563419 3300025901 Bacteria 716
279 Ga0207688_10860820 3300025901 Bacteria 574
280 Ga0207680_10099696 3300025903 Bacteria 1864
281 Ga0207645_10100614 3300025907 Bacteria 1864
282 Ga0207643_10011473 3300025908 Bacteria 4786
283 Ga0207705_10968442 3300025909 Bacteria 658
284 Ga0207684_10031695 3300025910 Bacteria 4497
285 Ga0207684_10852587 3300025910 Bacteria 768
286 Ga0207695_10090093 3300025913 Bacteria 3083
287 Ga0207663_10012103 3300025916 Bacteria 4654
288 Ga0207663_10016647 3300025916 Bacteria 4083
289 Ga0207660_10416368 3300025917 Bacteria 1083
290 Ga0207660_11243694 3300025917 Bacteria 605
291 Ga0207657_10226209 3300025919 Bacteria 1497
292 Ga0207652_10272702 3300025921 Bacteria 1526
293 Ga0207652_10937564 3300025921 Bacteria 763
294 Ga0207646_10122711 3300025922 Bacteria 2335
295 Ga0207646_11226411 3300025922 Bacteria 657
296 Ga0207681_10350050 3300025923 Bacteria 1182
297 Ga0207681_11097059 3300025923 Bacteria 668
298 Ga0207681_11106469 3300025923 Bacteria 665
299 Ga0207681_11119731 3300025923 Bacteria 661
300 Ga0207694_10675376 3300025924 Bacteria 871
301 Ga0207650_10026889 3300025925 Bacteria 4111
302 Ga0207659_10005865 3300025926 Bacteria 7493
303 Ga0207659_11567761 3300025926 Bacteria 563
304 Ga0207644_10154157 3300025931 Bacteria 1780
305 Ga0207690_10576321 3300025932 Bacteria 917
306 Ga0207690_10677806 3300025932 Bacteria 846
307 Ga0207706_10030881 3300025933 Bacteria 4777
308 Ga0207706_10361998 3300025933 Bacteria 1260
309 Ga0207686_10364332 3300025934 Bacteria 1092
310 Ga0207709_10028739 3300025935 Bacteria 3217
311 Ga0207709_10701660 3300025935 Unclassified 810
312 Ga0207670_10005712 3300025936 Bacteria 6858
313 Ga0207670_10791987 3300025936 Bacteria 789
314 Ga0207669_10418936 3300025937 Bacteria 1053
315 Ga0207704_10973575 3300025938 Bacteria 716
316 Ga0207691_10021978 3300025940 Bacteria 6020
317 Ga0207691_10779170 3300025940 Bacteria 804
318 Ga0207711_10011736 3300025941 Bacteria 7278
319 Ga0207689_10884639 3300025942 Bacteria 754
320 Ga0207689_10920223 3300025942 Unclassified 738
321 Ga0207661_10558635 3300025944 Bacteria 1049
322 Ga0207679_10003903 3300025945 Bacteria 9249
323 Ga0207667_10787258 3300025949 Bacteria 949
324 Ga0207651_10056556 3300025960 Bacteria 2700
325 Ga0207712_10031923 3300025961 Bacteria 3551
326 Ga0207712_10205623 3300025961 Unclassified 1564
327 Ga0207712_10589783 3300025961 Bacteria 960
328 Ga0207668_10278673 3300025972 Bacteria 1370
329 Ga0207668_10358382 3300025972 Bacteria 1221
330 Ga0207668_10728311 3300025972 Bacteria 873
331 Ga0207640_11227261 3300025981 Bacteria 667
332 Ga0207640_11747988 3300025981 Bacteria 562
333 Ga0207677_10972160 3300026023 Bacteria 769
334 Ga0207703_10039202 3300026035 Bacteria 3785
335 Ga0207703_11159653 3300026035 Bacteria 743
336 Ga0207639_10317723 3300026041 Bacteria 1382
337 Ga0207678_10021083 3300026067 Bacteria 5712
338 Ga0207678_10219863 3300026067 Bacteria 1626
339 Ga0207708_10203672 3300026075 Bacteria 1579
340 Ga0207708_10314330 3300026075 Bacteria 1277
341 Ga0207708_11178939 3300026075 Bacteria 669
342 Ga0207708_11262393 3300026075 Bacteria 647
343 Ga0207641_10005068 3300026088 Bacteria 11294
344 Ga0207648_10004948 3300026089 Bacteria 13559
345 Ga0207648_10226426 3300026089 Bacteria 1663
346 Ga0207676_10001855 3300026095 Bacteria 15472
347 Ga0207676_11441570 3300026095 Unclassified 685
348 Ga0207674_10298152 3300026116 Bacteria 1561
349 Ga0207675_100000293 3300026118 Bacteria 48222
350 Ga0207675_100005931 3300026118 Bacteria 11657
351 Ga0207675_100426350 3300026118 Bacteria 1311
352 Ga0207675_101006798 3300026118 Bacteria 852
353 Ga0207675_101296640 3300026118 Bacteria 749
354 Ga0207683_10200966 3300026121 Bacteria 1812
355 Ga0207683_10643394 3300026121 Bacteria 982
356 Ga0207683_12150018 3300026121 Bacteria 506
357 Ga0207698_10895017 3300026142 Bacteria 894
358 Ga0207698_10943478 3300026142 Bacteria 872
359 Ga0209588_1060289 3300027671 Bacteria 1227
360 Ga0209971_1134864 3300027682 Bacteria 608
361 Ga0209974_10187899 3300027876 Bacteria 759
362 Ga0209974_10205304 3300027876 Bacteria 729
363 Ga0207428_10037102 3300027907 Bacteria 3967
364 Ga0207428_10063831 3300027907 Bacteria 2908
365 Ga0207428_10102462 3300027907 Unclassified 2210
366 Ga0207428_10737374 3300027907 Bacteria 703
367 Ga0265354_1001073 3300028016 Bacteria 4208
368 Ga0265356_1001665 3300028017 Bacteria 3187
369 Ga0265357_1019379 3300028023 Bacteria 738
370 Ga0268266_10017545 3300028379 Bacteria 6107
371 Ga0268266_10063090 3300028379 Bacteria 3199
372 Ga0268265_10000379 3300028380 Bacteria 47868
373 Ga0268265_10119374 3300028380 Bacteria 2169
374 Ga0268265_10135473 3300028380 Bacteria 2054
375 Ga0268264_10806996 3300028381 Bacteria 938
376 Ga0268264_10890536 3300028381 Bacteria 893
377 Ga0268264_10913789 3300028381 Bacteria 881
378 Ga0265326_10148359 3300028558 Bacteria 670
379 Ga0265334_10044628 3300028573 Bacteria 1720
380 Ga0265318_10194422 3300028577 Bacteria 742
381 Ga0265338_10003875 3300028800 Bacteria 20711
382 Ga0265338_10556018 3300028800 Bacteria 803
383 Ga0311000_100053 3300029272 Bacteria 994
384 Ga0311003_158611 3300029282 Bacteria 611
385 Ga0310981_1006486 3300029285 Bacteria 703
386 Ga0310981_1032411 3300029285 Bacteria 856
387 Ga0314311_1052161 3300030733 Bacteria 861
388 Ga0265762_1074757 3300030760 Bacteria 717
389 Ga0265762_1106305 3300030760 Unclassified 628
390 Ga0265763_1002105 3300030763 Bacteria 1496
391 Ga0265763_1004155 3300030763 Bacteria 1176
392 Ga0265767_109884 3300030836 Unclassified 633
393 Ga0265766_1006027 3300030863 Bacteria 785
394 Ga0265766_1007397 3300030863 Bacteria 738
395 Ga0265770_1000649 3300030878 Bacteria 4829
396 Ga0265764_101027 3300030882 Bacteria 1172
397 Ga0265764_113456 3300030882 Unclassified 546
398 Ga0265772_100491 3300030886 Bacteria 1189
399 Ga0265769_106574 3300030888 Bacteria 734
400 Ga0265761_101200 3300030889 Bacteria 1108
401 Ga0265768_100407 3300030963 Bacteria 1662
402 Ga0265768_113614 3300030963 Unclassified 552
403 Ga0265771_1001532 3300031010 Bacteria 1109
404 Ga0265760_10001515 3300031090 Bacteria 6842
405 Ga0265330_10505823 3300031235 Bacteria 514
406 Ga0265328_10169427 3300031239 Bacteria 825
407 Ga0265320_10202542 3300031240 Bacteria 886
408 Ga0265325_10012046 3300031241 Bacteria 4955
409 Ga0265329_10256559 3300031242 Bacteria 584
410 Ga0265340_10225228 3300031247 Bacteria 839
411 Ga0265340_10482640 3300031247 Bacteria 546
412 Ga0265339_10179012 3300031249 Bacteria 1057
413 Ga0265327_10030925 3300031251 Bacteria 3016
414 Ga0265316_10118034 3300031344 Bacteria 2005
415 Ga0265316_10462496 3300031344 Bacteria 909
416 Ga0307408_100079115 3300031548 Bacteria 2452
417 Ga0307408_100770166 3300031548 Bacteria 871
418 Ga0307408_101151664 3300031548 Bacteria 721
419 Ga0265313_10020146 3300031595 Bacteria 3687
420 Ga0307508_10223421 3300031616 Bacteria 1483
421 Ga0316575_10085728 3300031665 Bacteria 1272
422 Ga0316575_10208181 3300031665 Bacteria 815
423 Ga0316579_10171415 3300031691 Bacteria 1049
424 Ga0316579_10461739 3300031691 Bacteria 614
425 Ga0316579_10666670 3300031691 Bacteria 504
426 Ga0316576_10048510 3300031727 Bacteria 3080
427 Ga0316576_10071550 3300031727 Bacteria 2558
428 Ga0316576_10178198 3300031727 Bacteria 1603
429 Ga0316576_10407641 3300031727 Bacteria 1007
430 Ga0316576_10758747 3300031727 Bacteria 700
431 Ga0316578_10088829 3300031728 Bacteria 1844
432 Ga0316578_10421713 3300031728 Bacteria 790
433 Ga0316578_10448242 3300031728 Bacteria 763
434 Ga0316578_10659171 3300031728 Bacteria 611
435 Ga0307516_10000288 3300031730 Bacteria 65317
436 Ga0307405_10300360 3300031731 Bacteria 1218
437 Ga0307405_11372091 3300031731 Bacteria 617
438 Ga0316577_10014813 3300031733 Bacteria 4286
439 Ga0316577_10413893 3300031733 Bacteria 766
440 Ga0307413_10545857 3300031824 Bacteria 939
441 Ga0307413_10777758 3300031824 Bacteria 802
442 Ga0307413_10829611 3300031824 Bacteria 779
443 Ga0307413_10925690 3300031824 Bacteria 742
444 Ga0307413_11780479 3300031824 Bacteria 551
445 Ga0307413_11788986 3300031824 Bacteria 550
446 Ga0307410_10188512 3300031852 Bacteria 1567
447 Ga0307410_10598623 3300031852 Bacteria 919
448 Ga0307410_10792063 3300031852 Bacteria 805
449 Ga0307410_10916493 3300031852 Bacteria 751
450 Ga0307410_11056549 3300031852 Bacteria 702
451 Ga0307406_10000585 3300031901 Bacteria 20988
452 Ga0307406_10227013 3300031901 Bacteria 1392
453 Ga0307406_10322986 3300031901 Bacteria 1195
454 Ga0307406_11388883 3300031901 Bacteria 615
455 Ga0307407_10095855 3300031903 Bacteria 1830
456 Ga0307407_10502983 3300031903 Bacteria 889
457 Ga0307407_11386985 3300031903 Bacteria 553
458 Ga0307412_10077525 3300031911 Bacteria 2286
459 Ga0307412_10191175 3300031911 Bacteria 1548
460 Ga0307412_11002366 3300031911 Bacteria 738
461 Ga0307409_100350694 3300031995 Bacteria 1392
462 Ga0307409_100386222 3300031995 Bacteria 1333
463 Ga0307409_100691984 3300031995 Bacteria 1018
464 Ga0307409_100720885 3300031995 Bacteria 998
465 Ga0307409_102339594 3300031995 Bacteria 563
466 Ga0307416_100233918 3300032002 Bacteria 1774
467 Ga0307416_100958782 3300032002 Bacteria 957
468 Ga0307416_101249653 3300032002 Bacteria 848
469 Ga0307416_102575408 3300032002 Bacteria 607
470 Ga0307414_10486183 3300032004 Bacteria 1090
471 Ga0307414_10507500 3300032004 Bacteria 1068
472 Ga0307414_11186277 3300032004 Bacteria 707
473 Ga0307411_10083809 3300032005 Bacteria 2203
474 Ga0307411_10803468 3300032005 Bacteria 828
475 Ga0307415_100052178 3300032126 Bacteria 2779
476 Ga0307415_100329800 3300032126 Bacteria 1276
477 Ga0307415_100512539 3300032126 Bacteria 1051
478 Ga0307415_100815195 3300032126 Bacteria 853
479 Ga0307415_101744608 3300032126 Bacteria 601
480 Ga0316583_10035511 3300032133 Bacteria 1769
481 Ga0316583_10045147 3300032133 Bacteria 1556
482 Ga0316585_10069217 3300032137 Bacteria 1144
483 Ga0316580_10108568 3300032139 Bacteria 849
484 Ga0316593_10000361 3300032168 Bacteria 8014
485 Ga0316593_10000793 3300032168 Bacteria 6298
486 Ga0316593_10000990 3300032168 Bacteria 5875
487 Ga0316593_10003664 3300032168 Bacteria 3847
488 Ga0316593_10007195 3300032168 Bacteria 3048
489 Ga0316593_10011479 3300032168 Bacteria 2575
490 Ga0316593_10028914 3300032168 Bacteria 1789
491 Ga0316593_10048682 3300032168 Bacteria 1427
492 Ga0316593_10050066 3300032168 Bacteria 1409
493 Ga0316593_10052064 3300032168 Bacteria 1385
494 Ga0316593_10054929 3300032168 Bacteria 1353
495 Ga0316593_10103988 3300032168 Bacteria 1010
496 Ga0316593_10108173 3300032168 Bacteria 991
497 Ga0316593_10215658 3300032168 Bacteria 712
498 Ga0316593_10219518 3300032168 Bacteria 706
499 Ga0316593_10392002 3300032168 Bacteria 536
500 Ga0307510_10153892 3300033180 Bacteria 1911
501 Ga0316592_1002827 3300033524 Bacteria 3049
502 Ga0316592_1003865 3300033524 Bacteria 2746
503 Ga0316592_1015277 3300033524 Bacteria 1597
504 Ga0316592_1017381 3300033524 Bacteria 1508
505 Ga0316592_1018789 3300033524 Bacteria 1459
506 Ga0316592_1034129 3300033524 Bacteria 1113
507 Ga0316592_1108280 3300033524 Bacteria 642
508 Ga0316592_1119679 3300033524 Bacteria 611
509 Ga0316592_1130631 3300033524 Bacteria 586
510 Ga0316586_1003514 3300033527 Bacteria 2064
511 Ga0316586_1009966 3300033527 Bacteria 1432
512 Ga0316586_1018484 3300033527 Bacteria 1131
513 Ga0316586_1045064 3300033527 Bacteria 782
514 Ga0316586_1048483 3300033527 Bacteria 757
515 Ga0316588_1005180 3300033528 Bacteria 2521
516 Ga0316588_1009326 3300033528 Bacteria 2045
517 Ga0316588_1032648 3300033528 Bacteria 1226
518 Ga0316588_1138966 3300033528 Unclassified 620
519 Ga0316588_1154891 3300033528 Bacteria 589
520 Ga0316587_1001502 3300033529 Bacteria 2892
521 Ga0316587_1005823 3300033529 Bacteria 1863
522 Ga0316587_1005922 3300033529 Bacteria 1851
523 Ga0316587_1021404 3300033529 Bacteria 1103
524 Ga0316587_1030091 3300033529 Bacteria 957
525 Ga0316587_1052389 3300033529 Bacteria 749
526 Ga0316587_1084307 3300033529 Bacteria 603
527 Ga0316587_1093413 3300033529 Bacteria 575
528 Ga0316587_1093949 3300033529 Bacteria 574
529 Ga0316587_1106310 3300033529 Bacteria 543
530 Ga0316596_1000248 3300033541 Bacteria 8264
531 Ga0316596_1001002 3300033541 Bacteria 5438
532 Ga0316596_1015151 3300033541 Bacteria 1919
533 Ga0316596_1018273 3300033541 Bacteria 1771
534 Ga0316596_1020028 3300033541 Bacteria 1700
535 Ga0316596_1024641 3300033541 Bacteria 1545
536 Ga0316596_1028569 3300033541 Bacteria 1442
537 Ga0316596_1029864 3300033541 Bacteria 1412
538 Ga0316596_1071966 3300033541 Bacteria 926
539 Ga0316596_1081013 3300033541 Bacteria 873
540 Ga0316596_1130800 3300033541 Bacteria 685
541 Ga0316596_1156081 3300033541 Bacteria 628
542 Ga0316596_1186083 3300033541 Bacteria 576
543 Ga0316212_1020930 3300033547 Bacteria 918
544 Ga0373958_0052411 3300034819 Bacteria 864
545 Ga0373938_0016338 3300034957 Bacteria 1449
546 Ga0373949_0043792 3300035090 Bacteria 1109
547 Ga0373952_0198529 3300035092 Bacteria 587
548 Ga0373923_0505593 3300035111 Unclassified 590
549 Ga0373932_0143887 3300035112 Bacteria 813
550 Ga0373939_0032708 3300035114 Bacteria 1514
551 Ga0373945_0284957 3300035116 Bacteria 705
552 Ga0373953_0104038 3300035117 Bacteria 1197
553 Ga0373954_0138520 3300035118 Bacteria 1186
554 Ga0373956_0112691 3300035119 Bacteria 1267
555 Ga0373960_0275410 3300035121 Bacteria 619
556 Ga0373955_0845580 3300035172 Unclassified 563
557 Ga0373961_0174553 3300035241 Bacteria 745
558 Ga0373962_0204318 3300035242 Bacteria 670
559 Ga0316574_0027300 3300035398 Bacteria 3438
560 Ga0316574_0037143 3300035398 Bacteria 2986
561 Ga0316574_0040060 3300035398 Bacteria 2883
562 Ga0316574_0133130 3300035398 Bacteria 1600
563 Ga0316574_0161833 3300035398 Bacteria 1441
564 Ga0316574_0226581 3300035398 Bacteria 1197
565 Ga0316574_0525916 3300035398 Bacteria 736
566 Ga0373924_0081700 3300035410 Bacteria 1375
567 Ga0373931_0251053 3300035691 Bacteria 1076
568 Ga0373935_0036278 3300035692 Bacteria 3082
569 Ga0373933_0023866 3300035724 Unclassified 3498
570 Ga0373933_0425718 3300035724 Bacteria 867
571 Ga0373933_1007885 3300035724 Bacteria 548
572 Ga0373937_0589547 3300036401 Bacteria 1055
573 Ga0316582_0004388 3300036647 Bacteria 7116
574 Ga0316582_0016790 3300036647 Bacteria 4219
575 Ga0316582_0030603 3300036647 Bacteria 3280
576 Ga0316582_0307190 3300036647 Bacteria 1090
577 Ga0316582_0493189 3300036647 Bacteria 844
578 Ga0316582_0828192 3300036647 Bacteria 634
579 Ga0316584_0044625 3300036712 Bacteria 3306
580 Ga0316584_0048003 3300036712 Bacteria 3190
581 Ga0316584_0057675 3300036712 Bacteria 2907
582 Ga0316584_0066017 3300036712 Bacteria 2711
583 Ga0316584_0273821 3300036712 Bacteria 1228
584 Ga0316584_0365296 3300036712 Unclassified 1034
585 Ga0316584_0538179 3300036712 Bacteria 817
586 Ga0316584_0605666 3300036712 Bacteria 759
587 Ga0316584_0632277 3300036712 Bacteria 739
588 Ga0316584_0908375 3300036712 Bacteria 592
589 Ga0373925_0084490 3300037068 Bacteria 2419
590 Ga0395900_1403174 3300037418 Bacteria 611
591 Ga0316581_0001004 3300037588 Bacteria 6044
592 Ga0400483_030749 3300039062 Bacteria 3322
593 Ga0400487_62966 3300039110 Bacteria 10791
594 Ga0436365_0511780 3300039437 Bacteria 582
595 Ga0436365_1628411 3300039437 Bacteria 2342
596 Ga0436360_0975443 3300039438 Bacteria 912
597 Ga0439436_0116364 3300041404 Bacteria 747
598 Ga0439461_0179896 3300041410 Bacteria 560
599 Ga0439465_0028899 3300041413 Bacteria 1760
600 Ga0451798_0569403 3300041458 Bacteria 2021
601 Ga0451833_1011918 3300041491 Bacteria 1374
602 Ga0451841_0702593 3300041498 Bacteria 655
603 Ga0451849_0594637 3300041505 Bacteria 2121
604 Ga0451850_27006 3300041506 Bacteria 1050
605 Ga0451851_0741629 3300041507 Bacteria 604
606 Ga0451843_0137409 3300041509 Bacteria 1187
607 Ga0451843_0794405 3300041509 Bacteria 513
608 Ga0451853_1477023 3300041512 Bacteria 1379
609 Ga0451853_3285942 3300041512 Bacteria 2249
610 Ga0452271_08140 3300041916 Bacteria 1261
611 Ga0439431_0048983 3300041997 Bacteria 1092
612 Ga0439431_0081767 3300041997 Bacteria 872
613 Ga0439443_106347 3300042003 Bacteria 541
614 Ga0439445_0004084 3300042004 Bacteria 3297
615 Ga0439448_0271335 3300042005 Bacteria 600
616 Ga0439449_0193637 3300042007 Bacteria 761
617 Ga0439449_0240808 3300042007 Bacteria 679
618 Ga0439450_116155 3300042008 Bacteria 687
619 Ga0439455_0253122 3300042012 Bacteria 516
620 Ga0439457_120880 3300042014 Bacteria 619
621 Ga0439463_031763 3300042016 Bacteria 1334
622 Ga0450911_032372 3300042115 Bacteria 679
623 Ga0450914_013386 3300042118 Bacteria 835
624 Ga0450917_014402 3300042120 Bacteria 660
625 Ga0450923_139277 3300042125 Bacteria 582
626 Ga0450888_027699 3300042126 Bacteria 748
627 Ga0450895_031320 3300042132 Bacteria 520
628 Ga0450899_027527 3300042135 Bacteria 683
629 Ga0450902_047311 3300042137 Bacteria 736
630 Ga0439458_0008446 3300042157 Bacteria 2293
631 Ga0439458_0111164 3300042157 Bacteria 717
632 Ga0439458_0114569 3300042157 Bacteria 707
633 Ga0439458_0236303 3300042157 Unclassified 506
634 Ga0439444_0105765 3300042437 Bacteria 643
635 Ga0439459_0193661 3300042438 Bacteria 552
636 Ga0439464_0309206 3300042439 Bacteria 517
637 Ga0450918_074203 3300042531 Unclassified 642
638 Ga0450901_016777 3300042533 Bacteria 773
639 Ga0451577_0015944 3300042876 Bacteria 6971
640 Ga0451577_0026574 3300042876 Bacteria 5242
641 Ga0451577_0066178 3300042876 Bacteria 3223
642 Ga0451577_0220962 3300042876 Bacteria 1712
643 Ga0451577_0282635 3300042876 Bacteria 1503
644 Ga0451577_0337134 3300042876 Bacteria 1368
645 Ga0451577_0630340 3300042876 Bacteria 972
646 Ga0451577_1124199 3300042876 Unclassified 702
647 Ga0439440_0049720 3300042993 Bacteria 1045
648 Ga0453683_0017806 3300044673 Bacteria 4569
649 Ga0453683_0051102 3300044673 Bacteria 2590
650 Ga0453683_0103919 3300044673 Unclassified 1784
651 Ga0466965_0176315 3300044683 Bacteria 1126
652 Ga0453684_0030164 3300044712 Bacteria 7668
653 Ga0453684_0044583 3300044712 Bacteria 5931
654 Ga0453684_0101520 3300044712 Bacteria 3519
655 Ga0453684_0164305 3300044712 Bacteria 2622
656 Ga0453684_0307384 3300044712 Bacteria 1800
657 Ga0453684_0508560 3300044712 Bacteria 1333
658 Ga0451576_0015038 3300045051 Bacteria 8595
659 Ga0451576_0021827 3300045051 Bacteria 6951
660 Ga0451576_0043051 3300045051 Bacteria 4765
661 Ga0451576_0052745 3300045051 Bacteria 4261
662 Ga0451576_0197175 3300045051 Bacteria 2103
663 Ga0451576_0325504 3300045051 Bacteria 1609
664 Ga0451576_2487741 3300045051 Bacteria 529
665 Ga0495617_022717 3300046452 Bacteria 2121
666 Ga0495638_0002014 3300046460 Bacteria 17345
667 Ga0495638_0373287 3300046460 Bacteria 747
668 Ga0495650_0057843 3300046471 Bacteria 1568
669 Ga0495582_0181237 3300046473 Bacteria 1200
670 Ga0495639_0114729 3300046475 Bacteria 1281
671 Ga0495639_0211464 3300046475 Bacteria 952
672 Ga0495616_0368857 3300046513 Bacteria 595
673 Ga0495630_0594055 3300046517 Bacteria 849
674 Ga0495632_0200095 3300046519 Bacteria 910
675 Ga0495666_0544735 3300046526 Unclassified 518
676 Ga0495642_0263515 3300046528 Bacteria 754
677 Ga0495586_0854723 3300046535 Bacteria 524
678 Ga0495645_0190173 3300046543 Bacteria 1400
679 Ga0495622_0239562 3300046557 Bacteria 800
680 Ga0495622_0443846 3300046557 Bacteria 557
681 Ga0495656_0457634 3300046615 Bacteria 673
682 Ga0495668_0255590 3300046616 Bacteria 959
683 Ga0495668_0326817 3300046616 Bacteria 841
684 Ga0495668_0629378 3300046616 Bacteria 593
685 Ga0495625_0077402 3300046660 Bacteria 2324
686 Ga0495625_0254561 3300046660 Bacteria 1139
687 Ga0495635_0545007 3300046663 Bacteria 761
688 Ga0495657_0459609 3300046675 Bacteria 745
689 Ga0495599_0549382 3300046678 Bacteria 676
690 Ga0495647_0044512 3300046681 Bacteria 1703
691 Ga0495658_0470421 3300046683 Bacteria 803
692 Ga0495658_0639444 3300046683 Bacteria 681
693 Ga0495669_0144470 3300046684 Bacteria 1124
694 Ga0495671_0387202 3300046692 Bacteria 670
695 Ga0495600_0532529 3300046809 Bacteria 719
696 Ga0495581_0393433 3300047315 Bacteria 809
697 Ga0495674_0747074 3300047319 Unclassified 765
698 Ga0495672_0091772 3300047320 Bacteria 1666
699 Ga0495680_0817438 3300047322 Bacteria 607
700 Ga0495673_0280740 3300047469 Bacteria 601
701 Ga0495686_0091310 3300047472 Bacteria 1849
702 Ga0495686_0124871 3300047472 Bacteria 1531
703 Ga0496100_0089707 3300048903 Bacteria 2095
704 Ga0496101_0148686 3300048904 Bacteria 1790
705 Ga0496104_0005409 3300048907 Bacteria 11174
706 Ga0496105_0024024 3300048908 Bacteria 4950
707 Ga0496108_1065278 3300048911 Bacteria 688
708 Ga0496109_0026265 3300048912 Bacteria 5193
709 Ga0496110_0514324 3300048913 Bacteria 1089
710 Ga0496110_0609047 3300048913 Bacteria 990
711 Ga0496110_1262592 3300048913 Bacteria 648
712 Ga0496111_0536819 3300048914 Bacteria 859
713 Ga0496111_0594517 3300048914 Bacteria 810
714 Ga0496112_1270309 3300048915 Bacteria 652
715 Ga0496113_0651508 3300048916 Bacteria 842
716 Ga0496114_0006729 3300048917 Bacteria 9057
717 Ga0496114_0837757 3300048917 Bacteria 799
718 Ga0496115_0001742 3300048918 Bacteria 15613
719 Ga0496120_0510753 3300048923 Bacteria 515
720 Ga0496122_0006191 3300048925 Bacteria 13887
721 Ga0496126_0395015 3300048929 Bacteria 1123
722 Ga0501306_013792 3300049127 Bacteria 1058
723 Ga0501308_027100 3300049128 Bacteria 751
724 Ga0501308_055036 3300049128 Bacteria 590
725 Ga0501308_084651 3300049128 Bacteria 509
726 Ga0501309_094163 3300049129 Bacteria 514
727 Ga0501310_005433 3300049130 Bacteria 1308
728 Ga0501310_056641 3300049130 Bacteria 577
729 Ga0501310_074048 3300049130 Bacteria 526
730 Ga0501304_021330 3300049160 Bacteria 644
731 Ga0501305_009910 3300049161 Bacteria 1262
732 Ga0501307_089751 3300049162 Bacteria 511
733 Ga0501292_054169 3300049515 Bacteria 716
734 Ga0501298_103019 3300049521 Bacteria 653
735 Ga0501298_166767 3300049521 Bacteria 546
736 Ga0501299_060164 3300049522 Bacteria 803
737 Ga0501300_089470 3300049523 Bacteria 514
738 Ga0501311_068149 3300049527 Bacteria 586
739 Ga0501311_072748 3300049527 Bacteria 573
740 Ga0501312_051953 3300049528 Bacteria 693
741 Ga0501313_036901 3300049529 Bacteria 648
742 Ga0501315_058363 3300049531 Bacteria 620
743 Ga0501317_027251 3300049533 Bacteria 811
744 Ga0501317_066603 3300049533 Bacteria 601
745 Ga0501317_084837 3300049533 Bacteria 553
746 Ga0501317_095027 3300049533 Bacteria 531
747 Ga0501318_055240 3300049534 Bacteria 599
748 Ga0501323_057119 3300049539 Bacteria 603
749 Ga0501323_072410 3300049539 Bacteria 553
750 Ga0501324_036115 3300049540 Bacteria 553
751 Ga0501335_037677 3300049551 Bacteria 563
752 Ga0501335_049680 3300049551 Bacteria 509
753 Ga0501336_006653 3300049552 Bacteria 862
754 Ga0501031_0256374 3300049568 Bacteria 1137
755 Ga0501033_0752531 3300049570 Bacteria 661
756 Ga0501034_0038314 3300049571 Bacteria 4855
757 Ga0501034_0559978 3300049571 Bacteria 1052
758 Ga0501037_0014295 3300049573 Bacteria 5849
759 Ga0501037_0624549 3300049573 Bacteria 722
760 Ga0501039_1165605 3300049575 Bacteria 596
761 Ga0501042_0566941 3300049578 Bacteria 825
762 Ga0501046_0580826 3300049580 Bacteria 797
763 Ga0501047_0283885 3300049581 Bacteria 1500
764 Ga0501048_0647321 3300049582 Bacteria 759
765 Ga0501048_0738814 3300049582 Bacteria 707
766 Ga0501071_1068754 3300049587 Bacteria 624
767 Ga0501071_1498741 3300049587 Bacteria 521
768 Ga0501072_0959813 3300049588 Bacteria 667
769 Ga0501073_0281194 3300049589 Bacteria 1148
770 Ga0501074_0000764 3300049590 Bacteria 20238
771 Ga0501076_0069885 3300049592 Bacteria 2807
772 Ga0501076_0862915 3300049592 Bacteria 746
773 Ga0501076_1523838 3300049592 Bacteria 549
774 Ga0501209_243249 3300049656 Bacteria 561
775 Ga0501236_059410 3300049670 Bacteria 675
776 Ga0501253_141660 3300049683 Bacteria 599
777 Ga0501225_0302629 3300049705 Bacteria 541
778 Ga0501079_1088669 3300049741 Bacteria 630
779 Ga0501083_0330400 3300049744 Bacteria 991
780 Ga0501268_136695 3300049765 Bacteria 556
781 Ga0501035_0936759 3300049822 Bacteria 684
782 Ga0501044_1290302 3300049823 Bacteria 597
783 Ga0501226_036533 3300049853 Bacteria 564
784 nmdc:mga0yw44_608903_c1 3300050492 Bacteria 742
785 nmdc:mga06z11_990782_c1 3300050494 Bacteria 512
786 nmdc:mga05p37_1955592_c1 3300050507 Bacteria 557
787 nmdc:mga05p37_7541_c1 3300050507 Bacteria 12828
788 nmdc:mga09592_30088_c1 3300050508 Bacteria 4518
789 nmdc:mga09592_715329_c1 3300050508 Bacteria 852
790 nmdc:mga0qj67_11501_c1 3300050509 Bacteria 6633
791 nmdc:mga0qj67_1178103_c1 3300050509 Bacteria 597
792 nmdc:mga0qj67_1275563_c1 3300050509 Bacteria 570
793 nmdc:mga0qj67_18978_c1 3300050509 Bacteria 5247
794 nmdc:mga0qj67_71290_c1 3300050509 Bacteria 2773
795 nmdc:mga06r32_64343_c1 3300050510 Bacteria 3537
796 nmdc:mga06r32_7136_c1 3300050510 Bacteria 10066
797 nmdc:mga08y16_120245_c1 3300050511 Bacteria 2734
798 nmdc:mga08y16_131524_c1 3300050511 Bacteria 2602
799 nmdc:mga08y16_1555988_c1 3300050511 Unclassified 620
800 nmdc:mga08y16_1648517_c1 3300050511 Bacteria 598
801 nmdc:mga08y16_332_c1 3300050511 Bacteria 42807
802 nmdc:mga08y16_35999_c1 3300050511 Bacteria 5198
803 nmdc:mga08y16_443658_c1 3300050511 Bacteria 1324
804 nmdc:mga08y16_447499_c1 3300050511 Bacteria 1318
805 nmdc:mga0n895_1142101_c1 3300050512 Bacteria 755
806 nmdc:mga0n895_19387_c1 3300050512 Bacteria 6322
807 nmdc:mga0n895_268321_c1 3300050512 Bacteria 1731
808 nmdc:mga0rr50_161783_c1 3300050513 Bacteria 1817
809 nmdc:mga0rr50_405887_c1 3300050513 Bacteria 1151
810 nmdc:mga08x19_69645_c1 3300050514 Bacteria 2291
811 nmdc:mga0a205_28248_c1 3300050515 Bacteria 5363
812 Ga0495601_0761715 3300053077 Bacteria 616
813 Ga0495612_0109287 3300053078 Bacteria 1182
814 Ga0495612_0143364 3300053078 Bacteria 1037
815 Ga0495595_0504450 3300053084 Bacteria 617
816 Ga0495619_0300455 3300053085 Bacteria 1112
817 Ga0500643_226710 3300053087 Bacteria 502
818 Ga0500644_0259261 3300053088 Bacteria 735
819 Ga0500583_0187400 3300053092 Bacteria 1030
820 Ga0500651_0751629 3300053093 Bacteria 518
821 Ga0500650_0074968 3300053098 Bacteria 1582
822 Ga0500594_0173353 3300053118 Bacteria 701
823 Ga0500617_186493 3300053124 Bacteria 777
824 Ga0500642_0071161 3300053130 Bacteria 1583
825 Ga0500652_179799 3300053131 Bacteria 867
826 Ga0500658_0022065 3300053134 Bacteria 2416
827 Ga0500568_0035791 3300053139 Bacteria 2023
828 Ga0500577_0408805 3300053142 Bacteria 594
829 Ga0500588_0002971 3300053146 Bacteria 3529
830 Ga0500604_0020082 3300053151 Bacteria 1877
831 Ga0500616_0295885 3300053153 Bacteria 674
832 Ga0500622_0000306 3300053156 Bacteria 50095
833 Ga0500622_0000360 3300053156 Bacteria 44258
834 Ga0500637_0545630 3300053178 Unclassified 563
835 Ga0501084_1413990 3300054114 Bacteria 583
836 Ga0501084_1740978 3300054114 Bacteria 521
837 Ga0590071_038376 3300059421 Bacteria 1150
838 Ga0590071_176899 3300059421 Bacteria 558
839 Ga0587084_015642 3300059477 Bacteria 1074
840 Ga0587066_082801 3300059490 Bacteria 698
841 Ga0587077_019154 3300059493 Bacteria 1188
842 Ga0587090_122076 3300059510 Bacteria 566
843 Ga0587091_187714 3300059511 Bacteria 548
844 Ga0587098_044564 3300059604 Bacteria 656
845 Ga0587101_047005 3300059623 Bacteria 731
846 Ga0587101_064635 3300059623 Bacteria 661
847 Ga0587109_113435 3300059624 Bacteria 636
848 Ga0587124_020546 3300059660 Bacteria 672

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2512564013 2512640941 60
2 iso_pu_bacteria 2857465823 2857466275 60
3 iso_pu_bacteria 2857591370 2857593648 60
4 iso_pu_bacteria 2915597211 2915600175 60
5 iso_pu_bacteria 2915606848 2915609758 60
6 iso_pu_bacteria 2929183550 2929185362 60
7 3300007265 Ga0099794_10028606 Ga0099794_100286064 61
8 3300009094 Ga0111539_10082033 Ga0111539_100820334 61
9 3300009094 Ga0111539_13022686 Ga0111539_130226861 61
10 3300010159 Ga0099796_10385249 Ga0099796_103852491 61
11 3300036712 Ga0316584_0048003 Ga0316584_0048003_771_959 61
12 3300046452 Ga0495617_022717 Ga0495617_022717_725_913 61
13 3300046526 Ga0495666_0544735 Ga0495666_0544735_309_497 61
14 3300046616 Ga0495668_0326817 Ga0495668_0326817_636_824 61
15 3300047469 Ga0495673_0280740 Ga0495673_0280740_50_238 61
16 3300048923 Ga0496120_0510753 Ga0496120_0510753_264_455 61
17 3300048925 Ga0496122_0006191 Ga0496122_0006191_12567_12758 61
18 3300048929 Ga0496126_0395015 Ga0496126_0395015_537_728 61
19 3300050511 nmdc:mga08y16_35999_c1 nmdc:mga08y16_35999_c1_2212_2400 61
20 3300050512 nmdc:mga0n895_1142101_c1 nmdc:mga0n895_1142101_c1_218_406 61
21 3300050513 nmdc:mga0rr50_161783_c1 nmdc:mga0rr50_161783_c1_454_642 61
22 3300053130 Ga0500642_0071161 Ga0500642_0071161_1104_1292 61
23 3300053131 Ga0500652_179799 Ga0500652_179799_375_563 61
24 3300005295 Ga0065707_10008504 Ga0065707_100085043 62
25 3300005345 Ga0070692_10967101 Ga0070692_109671012 62
26 3300005406 Ga0070703_10047148 Ga0070703_100471483 62
27 3300005406 Ga0070703_10104043 Ga0070703_101040432 62
28 3300005444 Ga0070694_100137700 Ga0070694_1001377003 62
29 3300005445 Ga0070708_101603992 Ga0070708_1016039921 62
30 3300005467 Ga0070706_100162761 Ga0070706_1001627612 62
31 3300005468 Ga0070707_101437548 Ga0070707_1014375482 62
32 3300005471 Ga0070698_100024837 Ga0070698_1000248373 62
33 3300005471 Ga0070698_100272059 Ga0070698_1002720592 62
34 3300005518 Ga0070699_100000588 Ga0070699_10000058841 62
35 3300005545 Ga0070695_100192729 Ga0070695_1001927293 62
36 3300005545 Ga0070695_101614063 Ga0070695_1016140631 62
37 3300005546 Ga0070696_100008240 Ga0070696_1000082405 62
38 3300005547 Ga0070693_100433965 Ga0070693_1004339651 62
39 3300005549 Ga0070704_100012138 Ga0070704_1000121384 62
40 3300005618 Ga0068864_100856216 Ga0068864_1008562162 62
41 3300006846 Ga0075430_100780193 Ga0075430_1007801932 62
42 3300006852 Ga0075433_10112354 Ga0075433_101123542 62
43 3300006871 Ga0075434_100017206 Ga0075434_1000172064 62
44 3300006880 Ga0075429_100256397 Ga0075429_1002563972 62
45 3300009147 Ga0114129_11784086 Ga0114129_117840862 62
46 3300025885 Ga0207653_10024985 Ga0207653_100249853 62
47 3300025910 Ga0207684_10031695 Ga0207684_100316953 62
48 3300025922 Ga0207646_11226411 Ga0207646_112264112 62
49 3300025942 Ga0207689_10920223 Ga0207689_109202232 62
50 3300026095 Ga0207676_11441570 Ga0207676_114415702 62
51 3300044673 Ga0453683_0051102 Ga0453683_0051102_312_503 62
52 3300050507 nmdc:mga05p37_1955592_c1 nmdc:mga05p37_1955592_c1_33_224 62
53 3300050508 nmdc:mga09592_30088_c1 nmdc:mga09592_30088_c1_2983_3174 62
54 3300050509 nmdc:mga0qj67_18978_c1 nmdc:mga0qj67_18978_c1_4661_4852 62
55 3300050512 nmdc:mga0n895_19387_c1 nmdc:mga0n895_19387_c1_3652_3843 62
56 3300050515 nmdc:mga0a205_28248_c1 nmdc:mga0a205_28248_c1_3942_4133 62
57 3300031691 Ga0316579_10171415 Ga0316579_101714152 63
58 3300031727 Ga0316576_10178198 Ga0316576_101781982 63
59 3300031728 Ga0316578_10088829 Ga0316578_100888293 63
60 3300031733 Ga0316577_10014813 Ga0316577_100148134 63
61 3300031733 Ga0316577_10413893 Ga0316577_104138932 63
62 3300032139 Ga0316580_10108568 Ga0316580_101085682 63
63 3300032168 Ga0316593_10000793 Ga0316593_100007934 63
64 3300032168 Ga0316593_10011479 Ga0316593_100114792 63
65 3300032168 Ga0316593_10052064 Ga0316593_100520643 63
66 3300033524 Ga0316592_1017381 Ga0316592_10173813 63
67 3300033524 Ga0316592_1119679 Ga0316592_11196791 63
68 3300033529 Ga0316587_1084307 Ga0316587_10843071 63
69 3300033529 Ga0316587_1093949 Ga0316587_10939492 63
70 3300033541 Ga0316596_1015151 Ga0316596_10151513 63
71 3300033541 Ga0316596_1186083 Ga0316596_11860832 63
72 3300035398 Ga0316574_0525916 Ga0316574_0525916_184_378 63
73 3300036647 Ga0316582_0004388 Ga0316582_0004388_2531_2725 63
74 3300036712 Ga0316584_0057675 Ga0316584_0057675_1657_1851 63
75 3300036712 Ga0316584_0273821 Ga0316584_0273821_754_948 63
76 3300037588 Ga0316581_0001004 Ga0316581_0001004_2821_3015 63
77 3300049592 Ga0501076_0069885 Ga0501076_0069885_424_618 63
78 2162886007 SwRhRL2b_contig_1161348 SwRhRL2b_0647.00006110 64
79 3300000546 LJNas_1013031 LJNas_10130312 64
80 3300001991 JGI24743J22301_10141483 JGI24743J22301_101414831 64
81 3300002074 JGI24748J21848_1032926 JGI24748J21848_10329262 64
82 3300003163 Ga0006759J45824_1050395 Ga0006759J45824_10503952 64
83 3300003322 rootL2_10091007 rootL2_100910073 64
84 3300004800 Ga0058861_11497037 Ga0058861_114970372 64
85 3300005276 Ga0065717_1014737 Ga0065717_10147371 64
86 3300005289 Ga0065704_10000886 Ga0065704_100008869 64
87 3300005289 Ga0065704_10484093 Ga0065704_104840931 64
88 3300005290 Ga0065712_10068636 Ga0065712_100686368 64
89 3300005293 Ga0065715_10682560 Ga0065715_106825602 64
90 3300005295 Ga0065707_10082235 Ga0065707_100822354 64
91 3300005295 Ga0065707_10082999 Ga0065707_1008299912 64
92 3300005328 Ga0070676_10136153 Ga0070676_101361533 64
93 3300005328 Ga0070676_11097052 Ga0070676_110970522 64
94 3300005329 Ga0070683_100559146 Ga0070683_1005591463 64
95 3300005330 Ga0070690_100001299 Ga0070690_1000012994 64
96 3300005330 Ga0070690_100327377 Ga0070690_1003273772 64
97 3300005331 Ga0070670_100033908 Ga0070670_1000339082 64
98 3300005331 Ga0070670_100542502 Ga0070670_1005425022 64
99 3300005331 Ga0070670_100953885 Ga0070670_1009538852 64
100 3300005333 Ga0070677_10122871 Ga0070677_101228712 64
101 3300005334 Ga0068869_100206448 Ga0068869_1002064483 64
102 3300005334 Ga0068869_100402223 Ga0068869_1004022233 64
103 3300005334 Ga0068869_100661643 Ga0068869_1006616431 64
104 3300005335 Ga0070666_11458937 Ga0070666_114589371 64
105 3300005336 Ga0070680_100368323 Ga0070680_1003683232 64
106 3300005337 Ga0070682_100180880 Ga0070682_1001808803 64
107 3300005337 Ga0070682_100876720 Ga0070682_1008767201 64
108 3300005337 Ga0070682_101724068 Ga0070682_1017240682 64
109 3300005338 Ga0068868_100252023 Ga0068868_1002520232 64
110 3300005339 Ga0070660_100331794 Ga0070660_1003317943 64
111 3300005340 Ga0070689_100027582 Ga0070689_1000275824 64
112 3300005340 Ga0070689_101657738 Ga0070689_1016577381 64
113 3300005341 Ga0070691_10180959 Ga0070691_101809591 64
114 3300005343 Ga0070687_101364706 Ga0070687_1013647062 64
115 3300005344 Ga0070661_100086889 Ga0070661_1000868893 64
116 3300005345 Ga0070692_10143499 Ga0070692_101434991 64
117 3300005347 Ga0070668_100010219 Ga0070668_1000102196 64
118 3300005347 Ga0070668_100164431 Ga0070668_1001644311 64
119 3300005353 Ga0070669_100115369 Ga0070669_1001153693 64
120 3300005353 Ga0070669_100931022 Ga0070669_1009310222 64
121 3300005353 Ga0070669_101679014 Ga0070669_1016790142 64
122 3300005354 Ga0070675_100046169 Ga0070675_1000461693 64
123 3300005354 Ga0070675_101571674 Ga0070675_1015716742 64
124 3300005355 Ga0070671_100507933 Ga0070671_1005079332 64
125 3300005356 Ga0070674_100602230 Ga0070674_1006022301 64
126 3300005364 Ga0070673_100007087 Ga0070673_1000070874 64
127 3300005364 Ga0070673_100657062 Ga0070673_1006570622 64
128 3300005365 Ga0070688_100001611 Ga0070688_1000016117 64
129 3300005365 Ga0070688_100380569 Ga0070688_1003805693 64
130 3300005366 Ga0070659_100990445 Ga0070659_1009904452 64
131 3300005367 Ga0070667_100078669 Ga0070667_1000786693 64
132 3300005435 Ga0070714_100000908 Ga0070714_10000090821 64
133 3300005438 Ga0070701_10077327 Ga0070701_100773272 64
134 3300005438 Ga0070701_10117777 Ga0070701_101177772 64
135 3300005438 Ga0070701_10327901 Ga0070701_103279011 64
136 3300005439 Ga0070711_100049229 Ga0070711_1000492292 64
137 3300005439 Ga0070711_100118160 Ga0070711_1001181602 64
138 3300005439 Ga0070711_100461032 Ga0070711_1004610321 64
139 3300005440 Ga0070705_100025617 Ga0070705_1000256174 64
140 3300005441 Ga0070700_100035954 Ga0070700_1000359543 64
141 3300005441 Ga0070700_100213430 Ga0070700_1002134301 64
142 3300005444 Ga0070694_100096426 Ga0070694_1000964264 64
143 3300005444 Ga0070694_101389680 Ga0070694_1013896802 64
144 3300005444 Ga0070694_101680138 Ga0070694_1016801381 64
145 3300005445 Ga0070708_100081763 Ga0070708_1000817632 64
146 3300005455 Ga0070663_100010247 Ga0070663_1000102472 64
147 3300005455 Ga0070663_100300954 Ga0070663_1003009543 64
148 3300005456 Ga0070678_101095528 Ga0070678_1010955282 64
149 3300005456 Ga0070678_101633563 Ga0070678_1016335631 64
150 3300005457 Ga0070662_100018270 Ga0070662_1000182706 64
151 3300005457 Ga0070662_100381733 Ga0070662_1003817333 64
152 3300005457 Ga0070662_100496455 Ga0070662_1004964552 64
153 3300005458 Ga0070681_10368622 Ga0070681_103686223 64
154 3300005459 Ga0068867_100031965 Ga0068867_1000319652 64
155 3300005459 Ga0068867_100213365 Ga0068867_1002133653 64
156 3300005466 Ga0070685_10026085 Ga0070685_100260853 64
157 3300005466 Ga0070685_10122749 Ga0070685_101227492 64
158 3300005467 Ga0070706_100365613 Ga0070706_1003656132 64
159 3300005467 Ga0070706_100980465 Ga0070706_1009804651 64
160 3300005467 Ga0070706_101401128 Ga0070706_1014011282 64
161 3300005468 Ga0070707_100065637 Ga0070707_1000656375 64
162 3300005471 Ga0070698_101481873 Ga0070698_1014818732 64
163 3300005471 Ga0070698_101691699 Ga0070698_1016916991 64
164 3300005535 Ga0070684_100073804 Ga0070684_1000738043 64
165 3300005539 Ga0068853_100325046 Ga0068853_1003250462 64
166 3300005543 Ga0070672_100085735 Ga0070672_1000857354 64
167 3300005543 Ga0070672_100733730 Ga0070672_1007337302 64
168 3300005543 Ga0070672_101672652 Ga0070672_1016726521 64
169 3300005544 Ga0070686_100008391 Ga0070686_1000083917 64
170 3300005546 Ga0070696_100083454 Ga0070696_1000834541 64
171 3300005546 Ga0070696_100311031 Ga0070696_1003110312 64
172 3300005547 Ga0070693_100239448 Ga0070693_1002394483 64
173 3300005548 Ga0070665_100091783 Ga0070665_1000917831 64
174 3300005548 Ga0070665_100125824 Ga0070665_1001258243 64
175 3300005549 Ga0070704_100554309 Ga0070704_1005543091 64
176 3300005564 Ga0070664_100024248 Ga0070664_1000242485 64
177 3300005578 Ga0068854_101510688 Ga0068854_1015106882 64
178 3300005615 Ga0070702_100207188 Ga0070702_1002071882 64
179 3300005615 Ga0070702_100923388 Ga0070702_1009233882 64
180 3300005615 Ga0070702_101806712 Ga0070702_1018067122 64
181 3300005616 Ga0068852_100531697 Ga0068852_1005316972 64
182 3300005616 Ga0068852_101199238 Ga0068852_1011992381 64
183 3300005616 Ga0068852_101713464 Ga0068852_1017134642 64
184 3300005617 Ga0068859_100019428 Ga0068859_1000194287 64
185 3300005617 Ga0068859_100569848 Ga0068859_1005698483 64
186 3300005617 Ga0068859_101164247 Ga0068859_1011642473 64
187 3300005617 Ga0068859_101331176 Ga0068859_1013311763 64
188 3300005618 Ga0068864_100006308 Ga0068864_1000063083 64
189 3300005718 Ga0068866_10096977 Ga0068866_100969773 64
190 3300005719 Ga0068861_100002820 Ga0068861_1000028205 64
191 3300005719 Ga0068861_100009515 Ga0068861_1000095153 64
192 3300005719 Ga0068861_100012749 Ga0068861_1000127493 64
193 3300005719 Ga0068861_100887284 Ga0068861_1008872842 64
194 3300005719 Ga0068861_100906035 Ga0068861_1009060352 64
195 3300005719 Ga0068861_101229208 Ga0068861_1012292081 64
196 3300005719 Ga0068861_102116737 Ga0068861_1021167373 64
197 3300005719 Ga0068861_102499249 Ga0068861_1024992491 64
198 3300005840 Ga0068870_10031824 Ga0068870_100318243 64
199 3300005840 Ga0068870_10365646 Ga0068870_103656463 64
200 3300005841 Ga0068863_100008283 Ga0068863_1000082832 64
201 3300005842 Ga0068858_100169228 Ga0068858_1001692283 64
202 3300005842 Ga0068858_100311631 Ga0068858_1003116312 64
203 3300005843 Ga0068860_101064807 Ga0068860_1010648072 64
204 3300005844 Ga0068862_100046867 Ga0068862_1000468672 64
205 3300005844 Ga0068862_100412668 Ga0068862_1004126683 64
206 3300005844 Ga0068862_102295416 Ga0068862_1022954161 64
207 3300005937 Ga0081455_10119154 Ga0081455_101191542 64
208 3300005981 Ga0081538_10095457 Ga0081538_100954572 64
209 3300005983 Ga0081540_1045744 Ga0081540_10457444 64
210 3300006173 Ga0070716_100149313 Ga0070716_1001493132 64
211 3300006175 Ga0070712_100443179 Ga0070712_1004431793 64
212 3300006178 Ga0075367_10606062 Ga0075367_106060621 64
213 3300006194 Ga0075427_10021717 Ga0075427_100217171 64
214 3300006195 Ga0075366_10867641 Ga0075366_108676411 64
215 3300006195 Ga0075366_10933558 Ga0075366_109335582 64
216 3300006237 Ga0097621_100031265 Ga0097621_1000312654 64
217 3300006237 Ga0097621_100035941 Ga0097621_1000359413 64
218 3300006237 Ga0097621_100341495 Ga0097621_1003414952 64
219 3300006358 Ga0068871_100043621 Ga0068871_1000436212 64
220 3300006844 Ga0075428_100016674 Ga0075428_1000166744 64
221 3300006844 Ga0075428_100364315 Ga0075428_1003643152 64
222 3300006844 Ga0075428_100624900 Ga0075428_1006249002 64
223 3300006846 Ga0075430_100141774 Ga0075430_1001417743 64
224 3300006846 Ga0075430_100421302 Ga0075430_1004213022 64
225 3300006847 Ga0075431_100006643 Ga0075431_1000066439 64
226 3300006847 Ga0075431_100283791 Ga0075431_1002837913 64
227 3300006847 Ga0075431_101635267 Ga0075431_1016352672 64
228 3300006852 Ga0075433_10448430 Ga0075433_104484303 64
229 3300006852 Ga0075433_11756764 Ga0075433_117567642 64
230 3300006871 Ga0075434_100567045 Ga0075434_1005670451 64
231 3300006871 Ga0075434_102274192 Ga0075434_1022741922 64
232 3300006880 Ga0075429_100036699 Ga0075429_1000366991 64
233 3300006880 Ga0075429_101459212 Ga0075429_1014592122 64
234 3300006881 Ga0068865_100133709 Ga0068865_1001337092 64
235 3300006881 Ga0068865_100476494 Ga0068865_1004764942 64
236 3300006881 Ga0068865_100881016 Ga0068865_1008810162 64
237 3300006914 Ga0075436_100304509 Ga0075436_1003045092 64
238 3300006914 Ga0075436_100765378 Ga0075436_1007653782 64
239 3300006931 Ga0097620_100019430 Ga0097620_1000194307 64
240 3300006931 Ga0097620_101164279 Ga0097620_1011642793 64
241 3300006931 Ga0097620_101331124 Ga0097620_1013311243 64
242 3300006948 Ga0099826_10086223 Ga0099826_100862233 64
243 3300007076 Ga0075435_100187890 Ga0075435_1001878903 64
244 3300007076 Ga0075435_100605723 Ga0075435_1006057232 64
245 3300007788 Ga0099795_10000903 Ga0099795_100009039 64
246 3300007788 Ga0099795_10012130 Ga0099795_100121302 64
247 3300007788 Ga0099795_10037778 Ga0099795_100377782 64
248 3300009036 Ga0105244_10503751 Ga0105244_105037511 64
249 3300009092 Ga0105250_10000006 Ga0105250_10000006227 64
250 3300009092 Ga0105250_10124972 Ga0105250_101249721 64
251 3300009093 Ga0105240_10327897 Ga0105240_103278973 64
252 3300009093 Ga0105240_11968419 Ga0105240_119684191 64
253 3300009094 Ga0111539_10350561 Ga0111539_103505614 64
254 3300009094 Ga0111539_10412106 Ga0111539_104121062 64
255 3300009094 Ga0111539_10484305 Ga0111539_104843052 64
256 3300009094 Ga0111539_11148744 Ga0111539_111487442 64
257 3300009094 Ga0111539_12714975 Ga0111539_127149752 64
258 3300009098 Ga0105245_10224021 Ga0105245_102240213 64
259 3300009101 Ga0105247_10021258 Ga0105247_100212585 64
260 3300009101 Ga0105247_10051475 Ga0105247_100514753 64
261 3300009147 Ga0114129_10092570 Ga0114129_100925703 64
262 3300009147 Ga0114129_13097839 Ga0114129_130978392 64
263 3300009148 Ga0105243_10091814 Ga0105243_100918143 64
264 3300009148 Ga0105243_11094481 Ga0105243_110944812 64
265 3300009148 Ga0105243_11175929 Ga0105243_111759292 64
266 3300009174 Ga0105241_10248194 Ga0105241_102481942 64
267 3300009176 Ga0105242_10085791 Ga0105242_100857913 64
268 3300009176 Ga0105242_11770049 Ga0105242_117700491 64
269 3300009177 Ga0105248_10003777 Ga0105248_100037778 64
270 3300009177 Ga0105248_12746339 Ga0105248_127463392 64
271 3300009545 Ga0105237_10838535 Ga0105237_108385351 64
272 3300009551 Ga0105238_10261134 Ga0105238_102611343 64
273 3300009553 Ga0105249_10014854 Ga0105249_100148546 64
274 3300009553 Ga0105249_10319390 Ga0105249_103193903 64
275 3300009553 Ga0105249_10980898 Ga0105249_109808981 64
276 3300009553 Ga0105249_11173811 Ga0105249_111738112 64
277 3300010159 Ga0099796_10007558 Ga0099796_100075582 64
278 3300010375 Ga0105239_11278207 Ga0105239_112782072 64
279 3300011119 Ga0105246_11163208 Ga0105246_111632081 64
280 3300011119 Ga0105246_11628576 Ga0105246_116285762 64
281 3300012494 Ga0157341_1010192 Ga0157341_10101922 64
282 3300012505 Ga0157339_1007580 Ga0157339_10075802 64
283 3300013100 Ga0157373_11200257 Ga0157373_112002571 64
284 3300013104 Ga0157370_10612654 Ga0157370_106126542 64
285 3300013104 Ga0157370_10796679 Ga0157370_107966792 64
286 3300013296 Ga0157374_10615275 Ga0157374_106152751 64
287 3300013296 Ga0157374_11195551 Ga0157374_111955512 64
288 3300013297 Ga0157378_10900088 Ga0157378_109000881 64
289 3300013306 Ga0163162_10352023 Ga0163162_103520233 64
290 3300013306 Ga0163162_11436937 Ga0163162_114369372 64
291 3300013306 Ga0163162_11446080 Ga0163162_114460802 64
292 3300013306 Ga0163162_11954469 Ga0163162_119544691 64
293 3300013308 Ga0157375_10302115 Ga0157375_103021152 64
294 3300013308 Ga0157375_10306320 Ga0157375_103063203 64
295 3300014325 Ga0163163_10033935 Ga0163163_100339354 64
296 3300014325 Ga0163163_10071291 Ga0163163_100712913 64
297 3300014325 Ga0163163_12825685 Ga0163163_128256852 64
298 3300014326 Ga0157380_10000591 Ga0157380_100005915 64
299 3300014326 Ga0157380_10473493 Ga0157380_104734933 64
300 3300014326 Ga0157380_10864419 Ga0157380_108644192 64
301 3300014326 Ga0157380_11594196 Ga0157380_115941961 64
302 3300014326 Ga0157380_12172962 Ga0157380_121729622 64
303 3300014326 Ga0157380_13068487 Ga0157380_130684872 64
304 3300014326 Ga0157380_13164881 Ga0157380_131648811 64
305 3300014326 Ga0157380_13269189 Ga0157380_132691891 64
306 3300014745 Ga0157377_10382420 Ga0157377_103824202 64
307 3300014745 Ga0157377_10853619 Ga0157377_108536192 64
308 3300014968 Ga0157379_10005406 Ga0157379_100054063 64
309 3300014968 Ga0157379_10183299 Ga0157379_101832992 64
310 3300014968 Ga0157379_11461637 Ga0157379_114616371 64
311 3300014969 Ga0157376_10263095 Ga0157376_102630953 64
312 3300014969 Ga0157376_10433111 Ga0157376_104331111 64
313 3300015262 Ga0182007_10083740 Ga0182007_100837402 64
314 3300017792 Ga0163161_10076747 Ga0163161_100767472 64
315 3300017792 Ga0163161_11514113 Ga0163161_115141132 64
316 3300017792 Ga0163161_11800459 Ga0163161_118004592 64
317 3300019181 Ga0184594_106948 Ga0184594_1069482 64
318 3300020078 Ga0206352_10818112 Ga0206352_108181122 64
319 3300022730 Ga0224570_102507 Ga0224570_1025072 64
320 3300024225 Ga0224572_1026876 Ga0224572_10268762 64
321 3300025711 Ga0207696_1000069 Ga0207696_1000069229 64
322 3300025885 Ga0207653_10030978 Ga0207653_100309784 64
323 3300025893 Ga0207682_10032587 Ga0207682_100325873 64
324 3300025899 Ga0207642_10048052 Ga0207642_100480521 64
325 3300025900 Ga0207710_10042513 Ga0207710_100425133 64
326 3300025900 Ga0207710_10042526 Ga0207710_100425263 64
327 3300025901 Ga0207688_10213444 Ga0207688_102134443 64
328 3300025901 Ga0207688_10563419 Ga0207688_105634192 64
329 3300025901 Ga0207688_10860820 Ga0207688_108608202 64
330 3300025903 Ga0207680_10099696 Ga0207680_100996964 64
331 3300025907 Ga0207645_10100614 Ga0207645_101006143 64
332 3300025908 Ga0207643_10011473 Ga0207643_100114733 64
333 3300025909 Ga0207705_10968442 Ga0207705_109684422 64
334 3300025910 Ga0207684_10852587 Ga0207684_108525872 64
335 3300025913 Ga0207695_10090093 Ga0207695_100900932 64
336 3300025916 Ga0207663_10012103 Ga0207663_100121033 64
337 3300025916 Ga0207663_10016647 Ga0207663_100166473 64
338 3300025917 Ga0207660_10416368 Ga0207660_104163682 64
339 3300025917 Ga0207660_11243694 Ga0207660_112436942 64
340 3300025919 Ga0207657_10226209 Ga0207657_102262093 64
341 3300025921 Ga0207652_10272702 Ga0207652_102727022 64
342 3300025921 Ga0207652_10937564 Ga0207652_109375642 64
343 3300025922 Ga0207646_10122711 Ga0207646_101227115 64
344 3300025923 Ga0207681_10350050 Ga0207681_103500503 64
345 3300025923 Ga0207681_11097059 Ga0207681_110970592 64
346 3300025923 Ga0207681_11106469 Ga0207681_111064692 64
347 3300025923 Ga0207681_11119731 Ga0207681_111197312 64
348 3300025924 Ga0207694_10675376 Ga0207694_106753762 64
349 3300025925 Ga0207650_10026889 Ga0207650_100268893 64
350 3300025926 Ga0207659_10005865 Ga0207659_100058653 64
351 3300025926 Ga0207659_11567761 Ga0207659_115677612 64
352 3300025931 Ga0207644_10154157 Ga0207644_101541573 64
353 3300025932 Ga0207690_10576321 Ga0207690_105763212 64
354 3300025932 Ga0207690_10677806 Ga0207690_106778062 64
355 3300025933 Ga0207706_10030881 Ga0207706_100308813 64
356 3300025933 Ga0207706_10361998 Ga0207706_103619983 64
357 3300025934 Ga0207686_10364332 Ga0207686_103643322 64
358 3300025935 Ga0207709_10028739 Ga0207709_100287392 64
359 3300025935 Ga0207709_10701660 Ga0207709_107016602 64
360 3300025936 Ga0207670_10005712 Ga0207670_100057123 64
361 3300025936 Ga0207670_10791987 Ga0207670_107919872 64
362 3300025937 Ga0207669_10418936 Ga0207669_104189361 64
363 3300025938 Ga0207704_10973575 Ga0207704_109735752 64
364 3300025940 Ga0207691_10021978 Ga0207691_100219783 64
365 3300025940 Ga0207691_10779170 Ga0207691_107791702 64
366 3300025941 Ga0207711_10011736 Ga0207711_100117365 64
367 3300025942 Ga0207689_10884639 Ga0207689_108846392 64
368 3300025944 Ga0207661_10558635 Ga0207661_105586353 64
369 3300025945 Ga0207679_10003903 Ga0207679_100039034 64
370 3300025949 Ga0207667_10787258 Ga0207667_107872582 64
371 3300025960 Ga0207651_10056556 Ga0207651_100565563 64
372 3300025961 Ga0207712_10031923 Ga0207712_100319233 64
373 3300025961 Ga0207712_10205623 Ga0207712_102056233 64
374 3300025961 Ga0207712_10589783 Ga0207712_105897832 64
375 3300025972 Ga0207668_10278673 Ga0207668_102786731 64
376 3300025972 Ga0207668_10358382 Ga0207668_103583823 64
377 3300025972 Ga0207668_10728311 Ga0207668_107283112 64
378 3300025981 Ga0207640_11227261 Ga0207640_112272612 64
379 3300025981 Ga0207640_11747988 Ga0207640_117479882 64
380 3300026023 Ga0207677_10972160 Ga0207677_109721602 64
381 3300026035 Ga0207703_10039202 Ga0207703_100392023 64
382 3300026035 Ga0207703_11159653 Ga0207703_111596532 64
383 3300026041 Ga0207639_10317723 Ga0207639_103177231 64
384 3300026067 Ga0207678_10021083 Ga0207678_100210832 64
385 3300026067 Ga0207678_10219863 Ga0207678_102198632 64
386 3300026075 Ga0207708_10203672 Ga0207708_102036722 64
387 3300026075 Ga0207708_10314330 Ga0207708_103143303 64
388 3300026075 Ga0207708_11178939 Ga0207708_111789392 64
389 3300026075 Ga0207708_11262393 Ga0207708_112623931 64
390 3300026088 Ga0207641_10005068 Ga0207641_100050684 64
391 3300026089 Ga0207648_10004948 Ga0207648_100049483 64
392 3300026089 Ga0207648_10226426 Ga0207648_102264262 64
393 3300026095 Ga0207676_10001855 Ga0207676_1000185511 64
394 3300026116 Ga0207674_10298152 Ga0207674_102981523 64
395 3300026118 Ga0207675_100000293 Ga0207675_10000029335 64
396 3300026118 Ga0207675_100005931 Ga0207675_1000059316 64
397 3300026118 Ga0207675_100426350 Ga0207675_1004263503 64
398 3300026118 Ga0207675_101006798 Ga0207675_1010067982 64
399 3300026118 Ga0207675_101296640 Ga0207675_1012966402 64
400 3300026121 Ga0207683_10200966 Ga0207683_102009662 64
401 3300026121 Ga0207683_10643394 Ga0207683_106433942 64
402 3300026121 Ga0207683_12150018 Ga0207683_121500182 64
403 3300026142 Ga0207698_10895017 Ga0207698_108950172 64
404 3300026142 Ga0207698_10943478 Ga0207698_109434782 64
405 3300027671 Ga0209588_1060289 Ga0209588_10602892 64
406 3300027682 Ga0209971_1134864 Ga0209971_11348642 64
407 3300027876 Ga0209974_10187899 Ga0209974_101878992 64
408 3300027876 Ga0209974_10205304 Ga0209974_102053042 64
409 3300027907 Ga0207428_10037102 Ga0207428_100371024 64
410 3300027907 Ga0207428_10063831 Ga0207428_100638312 64
411 3300027907 Ga0207428_10102462 Ga0207428_101024622 64
412 3300027907 Ga0207428_10737374 Ga0207428_107373742 64
413 3300028016 Ga0265354_1001073 Ga0265354_10010735 64
414 3300028017 Ga0265356_1001665 Ga0265356_10016653 64
415 3300028023 Ga0265357_1019379 Ga0265357_10193793 64
416 3300028379 Ga0268266_10017545 Ga0268266_100175453 64
417 3300028379 Ga0268266_10063090 Ga0268266_100630904 64
418 3300028380 Ga0268265_10000379 Ga0268265_1000037910 64
419 3300028380 Ga0268265_10119374 Ga0268265_101193742 64
420 3300028380 Ga0268265_10135473 Ga0268265_101354734 64
421 3300028381 Ga0268264_10806996 Ga0268264_108069962 64
422 3300028381 Ga0268264_10890536 Ga0268264_108905362 64
423 3300028381 Ga0268264_10913789 Ga0268264_109137892 64
424 3300028558 Ga0265326_10148359 Ga0265326_101483591 64
425 3300028573 Ga0265334_10044628 Ga0265334_100446282 64
426 3300028577 Ga0265318_10194422 Ga0265318_101944221 64
427 3300028800 Ga0265338_10003875 Ga0265338_1000387518 64
428 3300028800 Ga0265338_10556018 Ga0265338_105560182 64
429 3300029272 Ga0311000_100053 Ga0311000_1000531 64
430 3300029282 Ga0311003_158611 Ga0311003_1586112 64
431 3300029285 Ga0310981_1006486 Ga0310981_10064862 64
432 3300029285 Ga0310981_1032411 Ga0310981_10324112 64
433 3300030733 Ga0314311_1052161 Ga0314311_10521612 64
434 3300030760 Ga0265762_1074757 Ga0265762_10747572 64
435 3300030760 Ga0265762_1106305 Ga0265762_11063051 64
436 3300030763 Ga0265763_1002105 Ga0265763_10021052 64
437 3300030763 Ga0265763_1004155 Ga0265763_10041553 64
438 3300030836 Ga0265767_109884 Ga0265767_1098842 64
439 3300030863 Ga0265766_1006027 Ga0265766_10060272 64
440 3300030863 Ga0265766_1007397 Ga0265766_10073972 64
441 3300030878 Ga0265770_1000649 Ga0265770_10006496 64
442 3300030882 Ga0265764_101027 Ga0265764_1010273 64
443 3300030882 Ga0265764_113456 Ga0265764_1134562 64
444 3300030886 Ga0265772_100491 Ga0265772_1004913 64
445 3300030888 Ga0265769_106574 Ga0265769_1065742 64
446 3300030889 Ga0265761_101200 Ga0265761_1012003 64
447 3300030963 Ga0265768_100407 Ga0265768_1004073 64
448 3300030963 Ga0265768_113614 Ga0265768_1136142 64
449 3300031010 Ga0265771_1001532 Ga0265771_10015323 64
450 3300031090 Ga0265760_10001515 Ga0265760_100015159 64
451 3300031235 Ga0265330_10505823 Ga0265330_105058231 64
452 3300031239 Ga0265328_10169427 Ga0265328_101694271 64
453 3300031240 Ga0265320_10202542 Ga0265320_102025422 64
454 3300031241 Ga0265325_10012046 Ga0265325_100120465 64
455 3300031242 Ga0265329_10256559 Ga0265329_102565592 64
456 3300031247 Ga0265340_10225228 Ga0265340_102252283 64
457 3300031247 Ga0265340_10482640 Ga0265340_104826402 64
458 3300031249 Ga0265339_10179012 Ga0265339_101790121 64
459 3300031251 Ga0265327_10030925 Ga0265327_100309253 64
460 3300031344 Ga0265316_10118034 Ga0265316_101180343 64
461 3300031344 Ga0265316_10462496 Ga0265316_104624962 64
462 3300031548 Ga0307408_100079115 Ga0307408_1000791154 64
463 3300031548 Ga0307408_100770166 Ga0307408_1007701662 64
464 3300031548 Ga0307408_101151664 Ga0307408_1011516642 64
465 3300031595 Ga0265313_10020146 Ga0265313_100201462 64
466 3300031616 Ga0307508_10223421 Ga0307508_102234213 64
467 3300031665 Ga0316575_10085728 Ga0316575_100857282 64
468 3300031665 Ga0316575_10208181 Ga0316575_102081812 64
469 3300031691 Ga0316579_10461739 Ga0316579_104617392 64
470 3300031691 Ga0316579_10666670 Ga0316579_106666701 64
471 3300031727 Ga0316576_10048510 Ga0316576_100485103 64
472 3300031727 Ga0316576_10071550 Ga0316576_100715503 64
473 3300031727 Ga0316576_10407641 Ga0316576_104076412 64
474 3300031727 Ga0316576_10758747 Ga0316576_107587471 64
475 3300031728 Ga0316578_10421713 Ga0316578_104217131 64
476 3300031728 Ga0316578_10448242 Ga0316578_104482422 64
477 3300031728 Ga0316578_10659171 Ga0316578_106591712 64
478 3300031730 Ga0307516_10000288 Ga0307516_1000028821 64
479 3300031731 Ga0307405_10300360 Ga0307405_103003601 64
480 3300031731 Ga0307405_11372091 Ga0307405_113720911 64
481 3300031824 Ga0307413_10545857 Ga0307413_105458572 64
482 3300031824 Ga0307413_10777758 Ga0307413_107777582 64
483 3300031824 Ga0307413_10829611 Ga0307413_108296111 64
484 3300031824 Ga0307413_10925690 Ga0307413_109256901 64
485 3300031824 Ga0307413_11780479 Ga0307413_117804792 64
486 3300031824 Ga0307413_11788986 Ga0307413_117889861 64
487 3300031852 Ga0307410_10188512 Ga0307410_101885122 64
488 3300031852 Ga0307410_10598623 Ga0307410_105986233 64
489 3300031852 Ga0307410_10792063 Ga0307410_107920632 64
490 3300031852 Ga0307410_10916493 Ga0307410_109164932 64
491 3300031852 Ga0307410_11056549 Ga0307410_110565492 64
492 3300031901 Ga0307406_10000585 Ga0307406_1000058514 64
493 3300031901 Ga0307406_10227013 Ga0307406_102270133 64
494 3300031901 Ga0307406_10322986 Ga0307406_103229862 64
495 3300031901 Ga0307406_11388883 Ga0307406_113888832 64
496 3300031903 Ga0307407_10095855 Ga0307407_100958553 64
497 3300031903 Ga0307407_10502983 Ga0307407_105029832 64
498 3300031903 Ga0307407_11386985 Ga0307407_113869852 64
499 3300031911 Ga0307412_10077525 Ga0307412_100775253 64
500 3300031911 Ga0307412_10191175 Ga0307412_101911753 64
501 3300031911 Ga0307412_11002366 Ga0307412_110023662 64
502 3300031995 Ga0307409_100350694 Ga0307409_1003506941 64
503 3300031995 Ga0307409_100386222 Ga0307409_1003862223 64
504 3300031995 Ga0307409_100691984 Ga0307409_1006919842 64
505 3300031995 Ga0307409_100720885 Ga0307409_1007208852 64
506 3300031995 Ga0307409_102339594 Ga0307409_1023395942 64
507 3300032002 Ga0307416_100233918 Ga0307416_1002339182 64
508 3300032002 Ga0307416_100958782 Ga0307416_1009587823 64
509 3300032002 Ga0307416_101249653 Ga0307416_1012496532 64
510 3300032002 Ga0307416_102575408 Ga0307416_1025754082 64
511 3300032004 Ga0307414_10486183 Ga0307414_104861831 64
512 3300032004 Ga0307414_10507500 Ga0307414_105075001 64
513 3300032004 Ga0307414_11186277 Ga0307414_111862772 64
514 3300032005 Ga0307411_10083809 Ga0307411_100838093 64
515 3300032005 Ga0307411_10803468 Ga0307411_108034682 64
516 3300032126 Ga0307415_100052178 Ga0307415_1000521784 64
517 3300032126 Ga0307415_100329800 Ga0307415_1003298003 64
518 3300032126 Ga0307415_100512539 Ga0307415_1005125391 64
519 3300032126 Ga0307415_100815195 Ga0307415_1008151952 64
520 3300032126 Ga0307415_101744608 Ga0307415_1017446081 64
521 3300032133 Ga0316583_10035511 Ga0316583_100355113 64
522 3300032133 Ga0316583_10045147 Ga0316583_100451473 64
523 3300032137 Ga0316585_10069217 Ga0316585_100692172 64
524 3300032168 Ga0316593_10000361 Ga0316593_100003614 64
525 3300032168 Ga0316593_10000990 Ga0316593_100009905 64
526 3300032168 Ga0316593_10003664 Ga0316593_100036644 64
527 3300032168 Ga0316593_10007195 Ga0316593_100071953 64
528 3300032168 Ga0316593_10028914 Ga0316593_100289143 64
529 3300032168 Ga0316593_10048682 Ga0316593_100486822 64
530 3300032168 Ga0316593_10050066 Ga0316593_100500663 64
531 3300032168 Ga0316593_10054929 Ga0316593_100549291 64
532 3300032168 Ga0316593_10103988 Ga0316593_101039882 64
533 3300032168 Ga0316593_10108173 Ga0316593_101081732 64
534 3300032168 Ga0316593_10215658 Ga0316593_102156582 64
535 3300032168 Ga0316593_10219518 Ga0316593_102195182 64
536 3300032168 Ga0316593_10392002 Ga0316593_103920021 64
537 3300033180 Ga0307510_10153892 Ga0307510_101538921 64
538 3300033524 Ga0316592_1002827 Ga0316592_10028273 64
539 3300033524 Ga0316592_1003865 Ga0316592_10038653 64
540 3300033524 Ga0316592_1015277 Ga0316592_10152772 64
541 3300033524 Ga0316592_1018789 Ga0316592_10187892 64
542 3300033524 Ga0316592_1034129 Ga0316592_10341292 64
543 3300033524 Ga0316592_1108280 Ga0316592_11082802 64
544 3300033524 Ga0316592_1130631 Ga0316592_11306312 64
545 3300033527 Ga0316586_1003514 Ga0316586_10035143 64
546 3300033527 Ga0316586_1009966 Ga0316586_10099662 64
547 3300033527 Ga0316586_1018484 Ga0316586_10184843 64
548 3300033527 Ga0316586_1045064 Ga0316586_10450642 64
549 3300033527 Ga0316586_1048483 Ga0316586_10484832 64
550 3300033528 Ga0316588_1005180 Ga0316588_10051802 64
551 3300033528 Ga0316588_1009326 Ga0316588_10093263 64
552 3300033528 Ga0316588_1032648 Ga0316588_10326482 64
553 3300033528 Ga0316588_1138966 Ga0316588_11389662 64
554 3300033528 Ga0316588_1154891 Ga0316588_11548912 64
555 3300033529 Ga0316587_1001502 Ga0316587_10015023 64
556 3300033529 Ga0316587_1005823 Ga0316587_10058232 64
557 3300033529 Ga0316587_1005922 Ga0316587_10059222 64
558 3300033529 Ga0316587_1021404 Ga0316587_10214043 64
559 3300033529 Ga0316587_1030091 Ga0316587_10300912 64
560 3300033529 Ga0316587_1052389 Ga0316587_10523892 64
561 3300033529 Ga0316587_1093413 Ga0316587_10934131 64
562 3300033529 Ga0316587_1106310 Ga0316587_11063101 64
563 3300033541 Ga0316596_1000248 Ga0316596_10002488 64
564 3300033541 Ga0316596_1001002 Ga0316596_10010027 64
565 3300033541 Ga0316596_1018273 Ga0316596_10182732 64
566 3300033541 Ga0316596_1020028 Ga0316596_10200283 64
567 3300033541 Ga0316596_1024641 Ga0316596_10246412 64
568 3300033541 Ga0316596_1028569 Ga0316596_10285693 64
569 3300033541 Ga0316596_1029864 Ga0316596_10298643 64
570 3300033541 Ga0316596_1071966 Ga0316596_10719662 64
571 3300033541 Ga0316596_1081013 Ga0316596_10810132 64
572 3300033541 Ga0316596_1130800 Ga0316596_11308002 64
573 3300033541 Ga0316596_1156081 Ga0316596_11560812 64
574 3300033547 Ga0316212_1020930 Ga0316212_10209302 64
575 3300034819 Ga0373958_0052411 Ga0373958_0052411_437_631 64
576 3300034957 Ga0373938_0016338 Ga0373938_0016338_42_236 64
577 3300035090 Ga0373949_0043792 Ga0373949_0043792_534_728 64
578 3300035092 Ga0373952_0198529 Ga0373952_0198529_374_571 64
579 3300035111 Ga0373923_0505593 Ga0373923_0505593_342_536 64
580 3300035112 Ga0373932_0143887 Ga0373932_0143887_370_567 64
581 3300035114 Ga0373939_0032708 Ga0373939_0032708_318_515 64
582 3300035116 Ga0373945_0284957 Ga0373945_0284957_386_580 64
583 3300035117 Ga0373953_0104038 Ga0373953_0104038_487_681 64
584 3300035118 Ga0373954_0138520 Ga0373954_0138520_233_430 64
585 3300035119 Ga0373956_0112691 Ga0373956_0112691_247_441 64
586 3300035121 Ga0373960_0275410 Ga0373960_0275410_247_444 64
587 3300035172 Ga0373955_0845580 Ga0373955_0845580_336_530 64
588 3300035241 Ga0373961_0174553 Ga0373961_0174553_126_320 64
589 3300035242 Ga0373962_0204318 Ga0373962_0204318_441_638 64
590 3300035398 Ga0316574_0027300 Ga0316574_0027300_1306_1500 64
591 3300035398 Ga0316574_0037143 Ga0316574_0037143_1149_1346 64
592 3300035398 Ga0316574_0040060 Ga0316574_0040060_1350_1547 64
593 3300035398 Ga0316574_0133130 Ga0316574_0133130_894_1088 64
594 3300035398 Ga0316574_0161833 Ga0316574_0161833_427_624 64
595 3300035398 Ga0316574_0226581 Ga0316574_0226581_115_312 64
596 3300035410 Ga0373924_0081700 Ga0373924_0081700_1157_1351 64
597 3300035691 Ga0373931_0251053 Ga0373931_0251053_869_1063 64
598 3300035692 Ga0373935_0036278 Ga0373935_0036278_1646_1840 64
599 3300035724 Ga0373933_0023866 Ga0373933_0023866_2501_2698 64
600 3300035724 Ga0373933_0425718 Ga0373933_0425718_197_391 64
601 3300035724 Ga0373933_1007885 Ga0373933_1007885_322_519 64
602 3300036401 Ga0373937_0589547 Ga0373937_0589547_664_858 64
603 3300036647 Ga0316582_0016790 Ga0316582_0016790_803_1000 64
604 3300036647 Ga0316582_0030603 Ga0316582_0030603_1856_2053 64
605 3300036647 Ga0316582_0307190 Ga0316582_0307190_857_1054 64
606 3300036647 Ga0316582_0493189 Ga0316582_0493189_489_683 64
607 3300036647 Ga0316582_0828192 Ga0316582_0828192_42_239 64
608 3300036712 Ga0316584_0044625 Ga0316584_0044625_330_527 64
609 3300036712 Ga0316584_0066017 Ga0316584_0066017_1320_1514 64
610 3300036712 Ga0316584_0365296 Ga0316584_0365296_741_938 64
611 3300036712 Ga0316584_0538179 Ga0316584_0538179_400_597 64
612 3300036712 Ga0316584_0605666 Ga0316584_0605666_456_653 64
613 3300036712 Ga0316584_0632277 Ga0316584_0632277_448_645 64
614 3300036712 Ga0316584_0908375 Ga0316584_0908375_239_436 64
615 3300037068 Ga0373925_0084490 Ga0373925_0084490_1372_1566 64
616 3300037418 Ga0395900_1403174 Ga0395900_1403174_267_461 64
617 3300039062 Ga0400483_030749 Ga0400483_030749_1497_1694 64
618 3300039110 Ga0400487_62966 Ga0400487_62966_1045_1242 64
619 3300039437 Ga0436365_0511780 Ga0436365_0511780_81_278 64
620 3300039437 Ga0436365_1628411 Ga0436365_1628411_168_362 64
621 3300039438 Ga0436360_0975443 Ga0436360_0975443_609_806 64
622 3300041404 Ga0439436_0116364 Ga0439436_0116364_217_414 64
623 3300041410 Ga0439461_0179896 Ga0439461_0179896_71_268 64
624 3300041413 Ga0439465_0028899 Ga0439465_0028899_409_624 64
625 3300041458 Ga0451798_0569403 Ga0451798_0569403_902_1099 64
626 3300041491 Ga0451833_1011918 Ga0451833_1011918_1126_1320 64
627 3300041498 Ga0451841_0702593 Ga0451841_0702593_303_497 64
628 3300041505 Ga0451849_0594637 Ga0451849_0594637_907_1101 64
629 3300041506 Ga0451850_27006 Ga0451850_27006_315_509 64
630 3300041507 Ga0451851_0741629 Ga0451851_0741629_263_457 64
631 3300041509 Ga0451843_0137409 Ga0451843_0137409_426_620 64
632 3300041509 Ga0451843_0794405 Ga0451843_0794405_134_331 64
633 3300041512 Ga0451853_1477023 Ga0451853_1477023_353_553 64
634 3300041512 Ga0451853_3285942 Ga0451853_3285942_477_671 64
635 3300041916 Ga0452271_08140 Ga0452271_08140_685_879 64
636 3300041997 Ga0439431_0048983 Ga0439431_0048983_258_473 64
637 3300041997 Ga0439431_0081767 Ga0439431_0081767_256_453 64
638 3300042003 Ga0439443_106347 Ga0439443_106347_79_276 64
639 3300042004 Ga0439445_0004084 Ga0439445_0004084_3069_3284 64
640 3300042005 Ga0439448_0271335 Ga0439448_0271335_193_387 64
641 3300042007 Ga0439449_0193637 Ga0439449_0193637_76_273 64
642 3300042007 Ga0439449_0240808 Ga0439449_0240808_245_442 64
643 3300042008 Ga0439450_116155 Ga0439450_116155_389_583 64
644 3300042012 Ga0439455_0253122 Ga0439455_0253122_199_393 64
645 3300042014 Ga0439457_120880 Ga0439457_120880_322_519 64
646 3300042016 Ga0439463_031763 Ga0439463_031763_467_664 64
647 3300042115 Ga0450911_032372 Ga0450911_032372_62_259 64
648 3300042118 Ga0450914_013386 Ga0450914_013386_516_710 64
649 3300042120 Ga0450917_014402 Ga0450917_014402_415_609 64
650 3300042125 Ga0450923_139277 Ga0450923_139277_189_386 64
651 3300042126 Ga0450888_027699 Ga0450888_027699_332_529 64
652 3300042132 Ga0450895_031320 Ga0450895_031320_30_224 64
653 3300042135 Ga0450899_027527 Ga0450899_027527_395_592 64
654 3300042137 Ga0450902_047311 Ga0450902_047311_354_548 64
655 3300042157 Ga0439458_0008446 Ga0439458_0008446_549_746 64
656 3300042157 Ga0439458_0111164 Ga0439458_0111164_445_639 64
657 3300042157 Ga0439458_0114569 Ga0439458_0114569_303_500 64
658 3300042157 Ga0439458_0236303 Ga0439458_0236303_132_329 64
659 3300042437 Ga0439444_0105765 Ga0439444_0105765_246_443 64
660 3300042438 Ga0439459_0193661 Ga0439459_0193661_111_305 64
661 3300042439 Ga0439464_0309206 Ga0439464_0309206_283_477 64
662 3300042531 Ga0450918_074203 Ga0450918_074203_300_497 64
663 3300042533 Ga0450901_016777 Ga0450901_016777_543_737 64
664 3300042876 Ga0451577_0015944 Ga0451577_0015944_4296_4490 64
665 3300042876 Ga0451577_0026574 Ga0451577_0026574_670_870 64
666 3300042876 Ga0451577_0066178 Ga0451577_0066178_674_868 64
667 3300042876 Ga0451577_0220962 Ga0451577_0220962_281_475 64
668 3300042876 Ga0451577_0282635 Ga0451577_0282635_789_986 64
669 3300042876 Ga0451577_0337134 Ga0451577_0337134_997_1191 64
670 3300042876 Ga0451577_0630340 Ga0451577_0630340_429_623 64
671 3300042876 Ga0451577_1124199 Ga0451577_1124199_22_219 64
672 3300042993 Ga0439440_0049720 Ga0439440_0049720_232_429 64
673 3300044673 Ga0453683_0017806 Ga0453683_0017806_4151_4345 64
674 3300044673 Ga0453683_0103919 Ga0453683_0103919_97_297 64
675 3300044683 Ga0466965_0176315 Ga0466965_0176315_523_720 64
676 3300044712 Ga0453684_0030164 Ga0453684_0030164_4865_5059 64
677 3300044712 Ga0453684_0044583 Ga0453684_0044583_5259_5459 64
678 3300044712 Ga0453684_0101520 Ga0453684_0101520_3147_3341 64
679 3300044712 Ga0453684_0164305 Ga0453684_0164305_2108_2302 64
680 3300044712 Ga0453684_0307384 Ga0453684_0307384_1035_1229 64
681 3300044712 Ga0453684_0508560 Ga0453684_0508560_851_1045 64
682 3300045051 Ga0451576_0015038 Ga0451576_0015038_438_632 64
683 3300045051 Ga0451576_0021827 Ga0451576_0021827_5573_5767 64
684 3300045051 Ga0451576_0043051 Ga0451576_0043051_1952_2146 64
685 3300045051 Ga0451576_0052745 Ga0451576_0052745_3041_3241 64
686 3300045051 Ga0451576_0197175 Ga0451576_0197175_373_567 64
687 3300045051 Ga0451576_0325504 Ga0451576_0325504_1039_1233 64
688 3300045051 Ga0451576_2487741 Ga0451576_2487741_279_476 64
689 3300046460 Ga0495638_0002014 Ga0495638_0002014_12400_12597 64
690 3300046460 Ga0495638_0373287 Ga0495638_0373287_260_457 64
691 3300046471 Ga0495650_0057843 Ga0495650_0057843_231_425 64
692 3300046473 Ga0495582_0181237 Ga0495582_0181237_187_381 64
693 3300046475 Ga0495639_0114729 Ga0495639_0114729_1047_1241 64
694 3300046475 Ga0495639_0211464 Ga0495639_0211464_664_858 64
695 3300046513 Ga0495616_0368857 Ga0495616_0368857_103_300 64
696 3300046517 Ga0495630_0594055 Ga0495630_0594055_426_620 64
697 3300046519 Ga0495632_0200095 Ga0495632_0200095_639_836 64
698 3300046528 Ga0495642_0263515 Ga0495642_0263515_427_624 64
699 3300046535 Ga0495586_0854723 Ga0495586_0854723_215_409 64
700 3300046543 Ga0495645_0190173 Ga0495645_0190173_1117_1311 64
701 3300046557 Ga0495622_0239562 Ga0495622_0239562_539_733 64
702 3300046557 Ga0495622_0443846 Ga0495622_0443846_82_276 64
703 3300046615 Ga0495656_0457634 Ga0495656_0457634_203_397 64
704 3300046616 Ga0495668_0255590 Ga0495668_0255590_217_414 64
705 3300046616 Ga0495668_0629378 Ga0495668_0629378_151_348 64
706 3300046660 Ga0495625_0077402 Ga0495625_0077402_583_780 64
707 3300046660 Ga0495625_0254561 Ga0495625_0254561_603_797 64
708 3300046663 Ga0495635_0545007 Ga0495635_0545007_281_475 64
709 3300046675 Ga0495657_0459609 Ga0495657_0459609_85_279 64
710 3300046678 Ga0495599_0549382 Ga0495599_0549382_149_343 64
711 3300046681 Ga0495647_0044512 Ga0495647_0044512_617_811 64
712 3300046683 Ga0495658_0470421 Ga0495658_0470421_223_417 64
713 3300046683 Ga0495658_0639444 Ga0495658_0639444_338_532 64
714 3300046684 Ga0495669_0144470 Ga0495669_0144470_634_831 64
715 3300046692 Ga0495671_0387202 Ga0495671_0387202_177_374 64
716 3300046809 Ga0495600_0532529 Ga0495600_0532529_397_591 64
717 3300047315 Ga0495581_0393433 Ga0495581_0393433_301_495 64
718 3300047319 Ga0495674_0747074 Ga0495674_0747074_440_634 64
719 3300047320 Ga0495672_0091772 Ga0495672_0091772_807_1004 64
720 3300047322 Ga0495680_0817438 Ga0495680_0817438_260_454 64
721 3300047472 Ga0495686_0091310 Ga0495686_0091310_1360_1557 64
722 3300047472 Ga0495686_0124871 Ga0495686_0124871_550_747 64
723 3300048903 Ga0496100_0089707 Ga0496100_0089707_835_1029 64
724 3300048904 Ga0496101_0148686 Ga0496101_0148686_1314_1508 64
725 3300048907 Ga0496104_0005409 Ga0496104_0005409_7478_7672 64
726 3300048908 Ga0496105_0024024 Ga0496105_0024024_3209_3403 64
727 3300048911 Ga0496108_1065278 Ga0496108_1065278_222_416 64
728 3300048912 Ga0496109_0026265 Ga0496109_0026265_4581_4775 64
729 3300048913 Ga0496110_0514324 Ga0496110_0514324_503_700 64
730 3300048913 Ga0496110_0609047 Ga0496110_0609047_349_543 64
731 3300048913 Ga0496110_1262592 Ga0496110_1262592_231_425 64
732 3300048914 Ga0496111_0536819 Ga0496111_0536819_463_660 64
733 3300048914 Ga0496111_0594517 Ga0496111_0594517_571_768 64
734 3300048915 Ga0496112_1270309 Ga0496112_1270309_370_564 64
735 3300048916 Ga0496113_0651508 Ga0496113_0651508_177_371 64
736 3300048917 Ga0496114_0006729 Ga0496114_0006729_5757_5951 64
737 3300048917 Ga0496114_0837757 Ga0496114_0837757_379_576 64
738 3300048918 Ga0496115_0001742 Ga0496115_0001742_6501_6695 64
739 3300049127 Ga0501306_013792 Ga0501306_013792_202_399 64
740 3300049128 Ga0501308_027100 Ga0501308_027100_377_574 64
741 3300049128 Ga0501308_055036 Ga0501308_055036_218_415 64
742 3300049128 Ga0501308_084651 Ga0501308_084651_281_478 64
743 3300049129 Ga0501309_094163 Ga0501309_094163_262_459 64
744 3300049130 Ga0501310_005433 Ga0501310_005433_1028_1225 64
745 3300049130 Ga0501310_056641 Ga0501310_056641_348_545 64
746 3300049130 Ga0501310_074048 Ga0501310_074048_48_245 64
747 3300049160 Ga0501304_021330 Ga0501304_021330_276_470 64
748 3300049161 Ga0501305_009910 Ga0501305_009910_10_207 64
749 3300049162 Ga0501307_089751 Ga0501307_089751_296_493 64
750 3300049515 Ga0501292_054169 Ga0501292_054169_367_561 64
751 3300049521 Ga0501298_103019 Ga0501298_103019_220_414 64
752 3300049521 Ga0501298_166767 Ga0501298_166767_68_262 64
753 3300049522 Ga0501299_060164 Ga0501299_060164_281_475 64
754 3300049523 Ga0501300_089470 Ga0501300_089470_81_275 64
755 3300049527 Ga0501311_068149 Ga0501311_068149_320_517 64
756 3300049527 Ga0501311_072748 Ga0501311_072748_250_444 64
757 3300049528 Ga0501312_051953 Ga0501312_051953_420_617 64
758 3300049529 Ga0501313_036901 Ga0501313_036901_144_341 64
759 3300049531 Ga0501315_058363 Ga0501315_058363_78_275 64
760 3300049533 Ga0501317_027251 Ga0501317_027251_136_333 64
761 3300049533 Ga0501317_066603 Ga0501317_066603_318_512 64
762 3300049533 Ga0501317_084837 Ga0501317_084837_23_217 64
763 3300049533 Ga0501317_095027 Ga0501317_095027_92_289 64
764 3300049534 Ga0501318_055240 Ga0501318_055240_341_538 64
765 3300049539 Ga0501323_057119 Ga0501323_057119_391_585 64
766 3300049539 Ga0501323_072410 Ga0501323_072410_230_427 64
767 3300049540 Ga0501324_036115 Ga0501324_036115_75_272 64
768 3300049551 Ga0501335_037677 Ga0501335_037677_254_451 64
769 3300049551 Ga0501335_049680 Ga0501335_049680_191_388 64
770 3300049552 Ga0501336_006653 Ga0501336_006653_109_306 64
771 3300049568 Ga0501031_0256374 Ga0501031_0256374_195_392 64
772 3300049570 Ga0501033_0752531 Ga0501033_0752531_64_261 64
773 3300049571 Ga0501034_0038314 Ga0501034_0038314_3129_3326 64
774 3300049571 Ga0501034_0559978 Ga0501034_0559978_435_632 64
775 3300049573 Ga0501037_0014295 Ga0501037_0014295_992_1189 64
776 3300049573 Ga0501037_0624549 Ga0501037_0624549_250_444 64
777 3300049575 Ga0501039_1165605 Ga0501039_1165605_292_486 64
778 3300049578 Ga0501042_0566941 Ga0501042_0566941_169_366 64
779 3300049580 Ga0501046_0580826 Ga0501046_0580826_98_295 64
780 3300049581 Ga0501047_0283885 Ga0501047_0283885_877_1074 64
781 3300049582 Ga0501048_0647321 Ga0501048_0647321_152_346 64
782 3300049582 Ga0501048_0738814 Ga0501048_0738814_414_608 64
783 3300049587 Ga0501071_1068754 Ga0501071_1068754_141_338 64
784 3300049587 Ga0501071_1498741 Ga0501071_1498741_218_415 64
785 3300049588 Ga0501072_0959813 Ga0501072_0959813_174_368 64
786 3300049589 Ga0501073_0281194 Ga0501073_0281194_567_764 64
787 3300049590 Ga0501074_0000764 Ga0501074_0000764_4615_4812 64
788 3300049592 Ga0501076_0862915 Ga0501076_0862915_469_666 64
789 3300049592 Ga0501076_1523838 Ga0501076_1523838_204_401 64
790 3300049656 Ga0501209_243249 Ga0501209_243249_319_513 64
791 3300049670 Ga0501236_059410 Ga0501236_059410_297_491 64
792 3300049683 Ga0501253_141660 Ga0501253_141660_379_573 64
793 3300049705 Ga0501225_0302629 Ga0501225_0302629_155_349 64
794 3300049741 Ga0501079_1088669 Ga0501079_1088669_123_320 64
795 3300049744 Ga0501083_0330400 Ga0501083_0330400_499_696 64
796 3300049765 Ga0501268_136695 Ga0501268_136695_212_406 64
797 3300049822 Ga0501035_0936759 Ga0501035_0936759_195_392 64
798 3300049823 Ga0501044_1290302 Ga0501044_1290302_128_325 64
799 3300049853 Ga0501226_036533 Ga0501226_036533_249_443 64
800 3300050492 nmdc:mga0yw44_608903_c1 nmdc:mga0yw44_608903_c1_476_673 64
801 3300050494 nmdc:mga06z11_990782_c1 nmdc:mga06z11_990782_c1_105_302 64
802 3300050507 nmdc:mga05p37_7541_c1 nmdc:mga05p37_7541_c1_11714_11908 64
803 3300050508 nmdc:mga09592_715329_c1 nmdc:mga09592_715329_c1_47_241 64
804 3300050509 nmdc:mga0qj67_11501_c1 nmdc:mga0qj67_11501_c1_2916_3110 64
805 3300050509 nmdc:mga0qj67_1178103_c1 nmdc:mga0qj67_1178103_c1_25_219 64
806 3300050509 nmdc:mga0qj67_1275563_c1 nmdc:mga0qj67_1275563_c1_101_295 64
807 3300050509 nmdc:mga0qj67_71290_c1 nmdc:mga0qj67_71290_c1_646_843 64
808 3300050510 nmdc:mga06r32_64343_c1 nmdc:mga06r32_64343_c1_2234_2428 64
809 3300050510 nmdc:mga06r32_7136_c1 nmdc:mga06r32_7136_c1_6165_6359 64
810 3300050511 nmdc:mga08y16_120245_c1 nmdc:mga08y16_120245_c1_20_217 64
811 3300050511 nmdc:mga08y16_131524_c1 nmdc:mga08y16_131524_c1_1272_1469 64
812 3300050511 nmdc:mga08y16_1555988_c1 nmdc:mga08y16_1555988_c1_101_298 64
813 3300050511 nmdc:mga08y16_1648517_c1 nmdc:mga08y16_1648517_c1_323_520 64
814 3300050511 nmdc:mga08y16_332_c1 nmdc:mga08y16_332_c1_42573_42767 64
815 3300050511 nmdc:mga08y16_443658_c1 nmdc:mga08y16_443658_c1_128_328 64
816 3300050511 nmdc:mga08y16_447499_c1 nmdc:mga08y16_447499_c1_703_897 64
817 3300050512 nmdc:mga0n895_268321_c1 nmdc:mga0n895_268321_c1_1428_1622 64
818 3300050513 nmdc:mga0rr50_405887_c1 nmdc:mga0rr50_405887_c1_747_941 64
819 3300050514 nmdc:mga08x19_69645_c1 nmdc:mga08x19_69645_c1_1198_1392 64
820 3300053077 Ga0495601_0761715 Ga0495601_0761715_293_487 64
821 3300053078 Ga0495612_0109287 Ga0495612_0109287_430_624 64
822 3300053078 Ga0495612_0143364 Ga0495612_0143364_30_227 64
823 3300053084 Ga0495595_0504450 Ga0495595_0504450_368_562 64
824 3300053085 Ga0495619_0300455 Ga0495619_0300455_236_430 64
825 3300053087 Ga0500643_226710 Ga0500643_226710_207_404 64
826 3300053088 Ga0500644_0259261 Ga0500644_0259261_516_713 64
827 3300053092 Ga0500583_0187400 Ga0500583_0187400_232_429 64
828 3300053093 Ga0500651_0751629 Ga0500651_0751629_10_207 64
829 3300053098 Ga0500650_0074968 Ga0500650_0074968_974_1171 64
830 3300053118 Ga0500594_0173353 Ga0500594_0173353_385_582 64
831 3300053124 Ga0500617_186493 Ga0500617_186493_171_368 64
832 3300053134 Ga0500658_0022065 Ga0500658_0022065_2135_2332 64
833 3300053139 Ga0500568_0035791 Ga0500568_0035791_1248_1445 64
834 3300053142 Ga0500577_0408805 Ga0500577_0408805_137_334 64
835 3300053146 Ga0500588_0002971 Ga0500588_0002971_3246_3443 64
836 3300053151 Ga0500604_0020082 Ga0500604_0020082_1665_1862 64
837 3300053153 Ga0500616_0295885 Ga0500616_0295885_358_555 64
838 3300053156 Ga0500622_0000306 Ga0500622_0000306_17161_17358 64
839 3300053156 Ga0500622_0000360 Ga0500622_0000360_17306_17503 64
840 3300053178 Ga0500637_0545630 Ga0500637_0545630_78_275 64
841 3300054114 Ga0501084_1413990 Ga0501084_1413990_71_268 64
842 3300054114 Ga0501084_1740978 Ga0501084_1740978_233_430 64
843 3300059421 Ga0590071_038376 Ga0590071_038376_469_666 64
844 3300059421 Ga0590071_176899 Ga0590071_176899_145_342 64
845 3300059477 Ga0587084_015642 Ga0587084_015642_795_992 64
846 3300059490 Ga0587066_082801 Ga0587066_082801_422_619 64
847 3300059493 Ga0587077_019154 Ga0587077_019154_912_1109 64
848 3300059510 Ga0587090_122076 Ga0587090_122076_276_473 64
849 3300059511 Ga0587091_187714 Ga0587091_187714_270_467 64
850 3300059604 Ga0587098_044564 Ga0587098_044564_351_548 64
851 3300059623 Ga0587101_047005 Ga0587101_047005_449_646 64
852 3300059623 Ga0587101_064635 Ga0587101_064635_385_582 64
853 3300059624 Ga0587109_113435 Ga0587109_113435_80_277 64
854 3300059660 Ga0587124_020546 Ga0587124_020546_365_562 64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01632

Ribosomal_L35p

Ribosomal protein L35

14

73

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mrc-assembly1.cif.gz_Z structure of the yeast mitochondrial ribosome - class a 0.7115 4 64
5mrc-assembly1.cif.gz_Z structure of the yeast mitochondrial ribosome - class a 0.6945 4 64
7m4z-assembly1.cif.gz_2 a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.6812 3 64
7uvy-assembly1.cif.gz_2 a. baumannii ribosome-streptothricin-d complex: 70s with p-site trna 0.678 3 64
7uvv-assembly1.cif.gz_2 a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna 0.6776 3 64
ID Description Score Start End Superfamily
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.7201 4 64 4.10.410.60
1vw4Z00 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.7027 4 64 4.10.410.60
3d5b800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6369 2 64 4.10.410.60
3d5b800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6299 2 64 4.10.410.60
1vvs800 Few Secondary Structures;Irregular;Factor Xa Inhibitor; 0.6282 2 63 4.10.410.60
ID Description Score Start End GO Terms
AF-U6KQW4-F1-model_v4 Ribosomal protein L35 0.7294 3 64
AF-A0A521WMN9-F1-model_v4 Large ribosomal subunit protein bL35 0.7225 1 64 GO:0003735
GO:0006412
GO:0015934
AF-A0A4T0H0N4-F1-model_v4 Uncharacterized protein 0.717 4 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-U5HDW4-F1-model_v4 50S ribosomal protein L35 0.7154 3 64 GO:0003735
GO:0006412
GO:0015934
AF-A0A521WMN9-F1-model_v4 Large ribosomal subunit protein bL35 0.7137 1 64 GO:0003735
GO:0006412
GO:0015934

Feature Viewer

pLDDT pTM Quality
82.99 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map