F483588
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 467 | 848 | 64 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_11388883|Ga0307406_113888832 |
| Length | 77 |
| Sequence | VFLKGLQIDETTMPKLKTNRAAAKRFRPTAKGFKRTQSHRRHILTKKPSKRKRQLRAPSMVAKQDLVRMEQLLPNAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 3 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 4 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 5 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 6 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 7 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 8 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 125 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 199 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 200 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 209 | 3300029282 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 | Metatranscriptome | Rhizosphere |
| 210 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 211 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 212 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 235 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 249 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 250 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 251 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 252 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 253 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 254 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 255 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 256 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 264 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 265 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 268 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 271 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 286 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 287 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 290 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 291 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 295 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 296 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 297 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 298 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 299 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 300 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 301 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 302 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 303 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 304 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 305 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 306 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 307 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 308 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 309 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 310 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 311 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 312 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 313 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 314 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 315 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 316 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 317 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 318 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 319 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 320 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 321 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 322 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 323 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 324 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 325 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 326 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 327 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 328 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 329 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 330 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 331 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 332 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 333 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 334 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 335 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 368 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 369 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 372 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 373 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 374 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 375 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 376 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 377 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 378 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 379 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 380 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 388 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 389 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 390 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 391 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 416 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 417 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 418 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 419 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 422 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 425 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 426 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 441 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 443 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 444 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 445 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 447 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 449 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 451 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 453 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 454 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 455 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 456 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 457 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 459 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.01 |
| Metatranscriptomes | 14.29 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.69 |
| Nodule | 0.23 |
| Rhizoplane | 1.99 |
| Rhizosphere | 92.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1161348 | 2162886007 | Bacteria | 8226 |
| 2 | LJNas_1013031 | 3300000546 | Bacteria | 885 |
| 3 | JGI24743J22301_10141483 | 3300001991 | Bacteria | 535 |
| 4 | JGI24748J21848_1032926 | 3300002074 | Bacteria | 644 |
| 5 | Ga0006759J45824_1050395 | 3300003163 | Bacteria | 819 |
| 6 | rootL2_10091007 | 3300003322 | Bacteria | 3155 |
| 7 | Ga0058861_11497037 | 3300004800 | Bacteria | 524 |
| 8 | Ga0065717_1014737 | 3300005276 | Bacteria | 534 |
| 9 | Ga0065704_10000886 | 3300005289 | Bacteria | 14107 |
| 10 | Ga0065704_10484093 | 3300005289 | Bacteria | 675 |
| 11 | Ga0065712_10068636 | 3300005290 | Bacteria | 9559 |
| 12 | Ga0065715_10682560 | 3300005293 | Bacteria | 662 |
| 13 | Ga0065707_10008504 | 3300005295 | Bacteria | 2659 |
| 14 | Ga0065707_10082235 | 3300005295 | Bacteria | 18552 |
| 15 | Ga0065707_10082999 | 3300005295 | Bacteria | 10950 |
| 16 | Ga0070676_10136153 | 3300005328 | Bacteria | 1558 |
| 17 | Ga0070676_11097052 | 3300005328 | Unclassified | 601 |
| 18 | Ga0070683_100559146 | 3300005329 | Bacteria | 1094 |
| 19 | Ga0070690_100001299 | 3300005330 | Bacteria | 12982 |
| 20 | Ga0070690_100327377 | 3300005330 | Bacteria | 1106 |
| 21 | Ga0070670_100033908 | 3300005331 | Bacteria | 4395 |
| 22 | Ga0070670_100542502 | 3300005331 | Bacteria | 1037 |
| 23 | Ga0070670_100953885 | 3300005331 | Bacteria | 779 |
| 24 | Ga0070677_10122871 | 3300005333 | Bacteria | 1175 |
| 25 | Ga0068869_100206448 | 3300005334 | Bacteria | 1551 |
| 26 | Ga0068869_100402223 | 3300005334 | Bacteria | 1126 |
| 27 | Ga0068869_100661643 | 3300005334 | Bacteria | 887 |
| 28 | Ga0070666_11458937 | 3300005335 | Bacteria | 512 |
| 29 | Ga0070680_100368323 | 3300005336 | Bacteria | 1222 |
| 30 | Ga0070682_100180880 | 3300005337 | Bacteria | 1473 |
| 31 | Ga0070682_100876720 | 3300005337 | Unclassified | 735 |
| 32 | Ga0070682_101724068 | 3300005337 | Bacteria | 545 |
| 33 | Ga0068868_100252023 | 3300005338 | Bacteria | 1486 |
| 34 | Ga0070660_100331794 | 3300005339 | Bacteria | 1251 |
| 35 | Ga0070689_100027582 | 3300005340 | Bacteria | 4281 |
| 36 | Ga0070689_101657738 | 3300005340 | Bacteria | 581 |
| 37 | Ga0070691_10180959 | 3300005341 | Bacteria | 1097 |
| 38 | Ga0070687_101364706 | 3300005343 | Bacteria | 528 |
| 39 | Ga0070661_100086889 | 3300005344 | Bacteria | 2312 |
| 40 | Ga0070692_10143499 | 3300005345 | Bacteria | 1353 |
| 41 | Ga0070692_10967101 | 3300005345 | Bacteria | 593 |
| 42 | Ga0070668_100010219 | 3300005347 | Bacteria | 6962 |
| 43 | Ga0070668_100164431 | 3300005347 | Bacteria | 1802 |
| 44 | Ga0070669_100115369 | 3300005353 | Bacteria | 2043 |
| 45 | Ga0070669_100931022 | 3300005353 | Bacteria | 743 |
| 46 | Ga0070669_101679014 | 3300005353 | Bacteria | 553 |
| 47 | Ga0070675_100046169 | 3300005354 | Bacteria | 3566 |
| 48 | Ga0070675_101571674 | 3300005354 | Bacteria | 607 |
| 49 | Ga0070671_100507933 | 3300005355 | Bacteria | 1037 |
| 50 | Ga0070674_100602230 | 3300005356 | Bacteria | 929 |
| 51 | Ga0070673_100007087 | 3300005364 | Bacteria | 7361 |
| 52 | Ga0070673_100657062 | 3300005364 | Bacteria | 960 |
| 53 | Ga0070688_100001611 | 3300005365 | Bacteria | 11293 |
| 54 | Ga0070688_100380569 | 3300005365 | Unclassified | 1040 |
| 55 | Ga0070659_100990445 | 3300005366 | Bacteria | 737 |
| 56 | Ga0070667_100078669 | 3300005367 | Bacteria | 2818 |
| 57 | Ga0070703_10047148 | 3300005406 | Bacteria | 1364 |
| 58 | Ga0070703_10104043 | 3300005406 | Bacteria | 1005 |
| 59 | Ga0070714_100000908 | 3300005435 | Bacteria | 20948 |
| 60 | Ga0070701_10077327 | 3300005438 | Bacteria | 1793 |
| 61 | Ga0070701_10117777 | 3300005438 | Bacteria | 1492 |
| 62 | Ga0070701_10327901 | 3300005438 | Bacteria | 949 |
| 63 | Ga0070711_100049229 | 3300005439 | Bacteria | 2886 |
| 64 | Ga0070711_100118160 | 3300005439 | Bacteria | 1956 |
| 65 | Ga0070711_100461032 | 3300005439 | Bacteria | 1042 |
| 66 | Ga0070705_100025617 | 3300005440 | Bacteria | 3200 |
| 67 | Ga0070700_100035954 | 3300005441 | Bacteria | 3001 |
| 68 | Ga0070700_100213430 | 3300005441 | Bacteria | 1363 |
| 69 | Ga0070694_100096426 | 3300005444 | Bacteria | 2085 |
| 70 | Ga0070694_100137700 | 3300005444 | Bacteria | 1770 |
| 71 | Ga0070694_101389680 | 3300005444 | Bacteria | 592 |
| 72 | Ga0070694_101680138 | 3300005444 | Bacteria | 540 |
| 73 | Ga0070708_100081763 | 3300005445 | Bacteria | 2925 |
| 74 | Ga0070708_101603992 | 3300005445 | Bacteria | 605 |
| 75 | Ga0070663_100010247 | 3300005455 | Bacteria | 5838 |
| 76 | Ga0070663_100300954 | 3300005455 | Bacteria | 1284 |
| 77 | Ga0070678_101095528 | 3300005456 | Bacteria | 735 |
| 78 | Ga0070678_101633563 | 3300005456 | Bacteria | 605 |
| 79 | Ga0070662_100018270 | 3300005457 | Bacteria | 4741 |
| 80 | Ga0070662_100381733 | 3300005457 | Bacteria | 1160 |
| 81 | Ga0070662_100496455 | 3300005457 | Bacteria | 1018 |
| 82 | Ga0070681_10368622 | 3300005458 | Bacteria | 1346 |
| 83 | Ga0068867_100031965 | 3300005459 | Bacteria | 3803 |
| 84 | Ga0068867_100213365 | 3300005459 | Bacteria | 1551 |
| 85 | Ga0070685_10026085 | 3300005466 | Bacteria | 3219 |
| 86 | Ga0070685_10122749 | 3300005466 | Bacteria | 1615 |
| 87 | Ga0070706_100162761 | 3300005467 | Bacteria | 2084 |
| 88 | Ga0070706_100365613 | 3300005467 | Bacteria | 1344 |
| 89 | Ga0070706_100980465 | 3300005467 | Bacteria | 780 |
| 90 | Ga0070706_101401128 | 3300005467 | Bacteria | 640 |
| 91 | Ga0070707_100065637 | 3300005468 | Bacteria | 3487 |
| 92 | Ga0070707_101437548 | 3300005468 | Bacteria | 656 |
| 93 | Ga0070698_100024837 | 3300005471 | Bacteria | 6249 |
| 94 | Ga0070698_100272059 | 3300005471 | Bacteria | 1625 |
| 95 | Ga0070698_101481873 | 3300005471 | Bacteria | 630 |
| 96 | Ga0070698_101691699 | 3300005471 | Bacteria | 585 |
| 97 | Ga0070699_100000588 | 3300005518 | Bacteria | 34229 |
| 98 | Ga0070684_100073804 | 3300005535 | Bacteria | 3007 |
| 99 | Ga0068853_100325046 | 3300005539 | Bacteria | 1426 |
| 100 | Ga0070672_100085735 | 3300005543 | Bacteria | 2532 |
| 101 | Ga0070672_100733730 | 3300005543 | Bacteria | 866 |
| 102 | Ga0070672_101672652 | 3300005543 | Bacteria | 572 |
| 103 | Ga0070686_100008391 | 3300005544 | Bacteria | 5784 |
| 104 | Ga0070695_100192729 | 3300005545 | Bacteria | 1452 |
| 105 | Ga0070695_101614063 | 3300005545 | Bacteria | 542 |
| 106 | Ga0070696_100008240 | 3300005546 | Bacteria | 6976 |
| 107 | Ga0070696_100083454 | 3300005546 | Bacteria | 2266 |
| 108 | Ga0070696_100311031 | 3300005546 | Bacteria | 1209 |
| 109 | Ga0070693_100239448 | 3300005547 | Bacteria | 1198 |
| 110 | Ga0070693_100433965 | 3300005547 | Bacteria | 918 |
| 111 | Ga0070665_100091783 | 3300005548 | Bacteria | 3042 |
| 112 | Ga0070665_100125824 | 3300005548 | Bacteria | 2565 |
| 113 | Ga0070704_100012138 | 3300005549 | Bacteria | 5316 |
| 114 | Ga0070704_100554309 | 3300005549 | Bacteria | 1005 |
| 115 | Ga0070664_100024248 | 3300005564 | Bacteria | 5017 |
| 116 | Ga0068854_101510688 | 3300005578 | Bacteria | 610 |
| 117 | Ga0070702_100207188 | 3300005615 | Bacteria | 1302 |
| 118 | Ga0070702_100923388 | 3300005615 | Unclassified | 685 |
| 119 | Ga0070702_101806712 | 3300005615 | Bacteria | 511 |
| 120 | Ga0068852_100531697 | 3300005616 | Bacteria | 1174 |
| 121 | Ga0068852_101199238 | 3300005616 | Bacteria | 780 |
| 122 | Ga0068852_101713464 | 3300005616 | Bacteria | 651 |
| 123 | Ga0068859_100019428 | 3300005617 | Bacteria | 6824 |
| 124 | Ga0068859_100569848 | 3300005617 | Bacteria | 1226 |
| 125 | Ga0068859_101164247 | 3300005617 | Bacteria | 849 |
| 126 | Ga0068859_101331176 | 3300005617 | Bacteria | 792 |
| 127 | Ga0068864_100006308 | 3300005618 | Bacteria | 9727 |
| 128 | Ga0068864_100856216 | 3300005618 | Bacteria | 896 |
| 129 | Ga0068866_10096977 | 3300005718 | Bacteria | 1618 |
| 130 | Ga0068861_100002820 | 3300005719 | Bacteria | 11426 |
| 131 | Ga0068861_100009515 | 3300005719 | Bacteria | 6714 |
| 132 | Ga0068861_100012749 | 3300005719 | Bacteria | 5867 |
| 133 | Ga0068861_100887284 | 3300005719 | Bacteria | 843 |
| 134 | Ga0068861_100906035 | 3300005719 | Bacteria | 835 |
| 135 | Ga0068861_101229208 | 3300005719 | Unclassified | 726 |
| 136 | Ga0068861_102116737 | 3300005719 | Bacteria | 563 |
| 137 | Ga0068861_102499249 | 3300005719 | Unclassified | 520 |
| 138 | Ga0068870_10031824 | 3300005840 | Bacteria | 2675 |
| 139 | Ga0068870_10365646 | 3300005840 | Bacteria | 929 |
| 140 | Ga0068863_100008283 | 3300005841 | Bacteria | 10159 |
| 141 | Ga0068858_100169228 | 3300005842 | Bacteria | 2060 |
| 142 | Ga0068858_100311631 | 3300005842 | Bacteria | 1503 |
| 143 | Ga0068860_101064807 | 3300005843 | Bacteria | 827 |
| 144 | Ga0068862_100046867 | 3300005844 | Bacteria | 3687 |
| 145 | Ga0068862_100412668 | 3300005844 | Bacteria | 1265 |
| 146 | Ga0068862_102295416 | 3300005844 | Bacteria | 551 |
| 147 | Ga0081455_10119154 | 3300005937 | Bacteria | 2082 |
| 148 | Ga0081538_10095457 | 3300005981 | Bacteria | 1519 |
| 149 | Ga0081540_1045744 | 3300005983 | Bacteria | 2218 |
| 150 | Ga0070716_100149313 | 3300006173 | Bacteria | 1501 |
| 151 | Ga0070712_100443179 | 3300006175 | Bacteria | 1080 |
| 152 | Ga0075367_10606062 | 3300006178 | Bacteria | 696 |
| 153 | Ga0075427_10021717 | 3300006194 | Bacteria | 1022 |
| 154 | Ga0075366_10867641 | 3300006195 | Bacteria | 562 |
| 155 | Ga0075366_10933558 | 3300006195 | Unclassified | 541 |
| 156 | Ga0097621_100031265 | 3300006237 | Bacteria | 4224 |
| 157 | Ga0097621_100035941 | 3300006237 | Bacteria | 3960 |
| 158 | Ga0097621_100341495 | 3300006237 | Bacteria | 1330 |
| 159 | Ga0068871_100043621 | 3300006358 | Bacteria | 3603 |
| 160 | Ga0075428_100016674 | 3300006844 | Bacteria | 8112 |
| 161 | Ga0075428_100364315 | 3300006844 | Bacteria | 1550 |
| 162 | Ga0075428_100624900 | 3300006844 | Bacteria | 1150 |
| 163 | Ga0075430_100141774 | 3300006846 | Bacteria | 2001 |
| 164 | Ga0075430_100421302 | 3300006846 | Bacteria | 1102 |
| 165 | Ga0075430_100780193 | 3300006846 | Unclassified | 788 |
| 166 | Ga0075431_100006643 | 3300006847 | Bacteria | 11487 |
| 167 | Ga0075431_100283791 | 3300006847 | Bacteria | 1676 |
| 168 | Ga0075431_101635267 | 3300006847 | Bacteria | 601 |
| 169 | Ga0075433_10112354 | 3300006852 | Bacteria | 2417 |
| 170 | Ga0075433_10448430 | 3300006852 | Bacteria | 1137 |
| 171 | Ga0075433_11756764 | 3300006852 | Bacteria | 534 |
| 172 | Ga0075434_100017206 | 3300006871 | Bacteria | 6961 |
| 173 | Ga0075434_100567045 | 3300006871 | Bacteria | 1155 |
| 174 | Ga0075434_102274192 | 3300006871 | Unclassified | 545 |
| 175 | Ga0075429_100036699 | 3300006880 | Bacteria | 4264 |
| 176 | Ga0075429_100256397 | 3300006880 | Bacteria | 1531 |
| 177 | Ga0075429_101459212 | 3300006880 | Bacteria | 595 |
| 178 | Ga0068865_100133709 | 3300006881 | Bacteria | 1861 |
| 179 | Ga0068865_100476494 | 3300006881 | Bacteria | 1037 |
| 180 | Ga0068865_100881016 | 3300006881 | Bacteria | 777 |
| 181 | Ga0075436_100304509 | 3300006914 | Bacteria | 1143 |
| 182 | Ga0075436_100765378 | 3300006914 | Bacteria | 718 |
| 183 | Ga0097620_100019430 | 3300006931 | Bacteria | 6824 |
| 184 | Ga0097620_101164279 | 3300006931 | Bacteria | 849 |
| 185 | Ga0097620_101331124 | 3300006931 | Bacteria | 792 |
| 186 | Ga0099826_10086223 | 3300006948 | Bacteria | 1936 |
| 187 | Ga0075435_100187890 | 3300007076 | Bacteria | 1748 |
| 188 | Ga0075435_100605723 | 3300007076 | Bacteria | 950 |
| 189 | Ga0099794_10028606 | 3300007265 | Bacteria | 2593 |
| 190 | Ga0099795_10000903 | 3300007788 | Bacteria | 5981 |
| 191 | Ga0099795_10012130 | 3300007788 | Bacteria | 2602 |
| 192 | Ga0099795_10037778 | 3300007788 | Bacteria | 1701 |
| 193 | Ga0105244_10503751 | 3300009036 | Bacteria | 557 |
| 194 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 195 | Ga0105250_10124972 | 3300009092 | Bacteria | 1059 |
| 196 | Ga0105240_10327897 | 3300009093 | Bacteria | 1743 |
| 197 | Ga0105240_11968419 | 3300009093 | Bacteria | 607 |
| 198 | Ga0111539_10082033 | 3300009094 | Unclassified | 3793 |
| 199 | Ga0111539_10350561 | 3300009094 | Bacteria | 1718 |
| 200 | Ga0111539_10412106 | 3300009094 | Bacteria | 1574 |
| 201 | Ga0111539_10484305 | 3300009094 | Bacteria | 1441 |
| 202 | Ga0111539_11148744 | 3300009094 | Bacteria | 902 |
| 203 | Ga0111539_12714975 | 3300009094 | Unclassified | 574 |
| 204 | Ga0111539_13022686 | 3300009094 | Unclassified | 543 |
| 205 | Ga0105245_10224021 | 3300009098 | Bacteria | 1816 |
| 206 | Ga0105247_10021258 | 3300009101 | Bacteria | 3904 |
| 207 | Ga0105247_10051475 | 3300009101 | Bacteria | 2536 |
| 208 | Ga0114129_10092570 | 3300009147 | Bacteria | 4188 |
| 209 | Ga0114129_11784086 | 3300009147 | Bacteria | 749 |
| 210 | Ga0114129_13097839 | 3300009147 | Bacteria | 544 |
| 211 | Ga0105243_10091814 | 3300009148 | Bacteria | 2501 |
| 212 | Ga0105243_11094481 | 3300009148 | Unclassified | 805 |
| 213 | Ga0105243_11175929 | 3300009148 | Bacteria | 779 |
| 214 | Ga0105241_10248194 | 3300009174 | Bacteria | 1508 |
| 215 | Ga0105242_10085791 | 3300009176 | Bacteria | 2641 |
| 216 | Ga0105242_11770049 | 3300009176 | Bacteria | 656 |
| 217 | Ga0105248_10003777 | 3300009177 | Bacteria | 16771 |
| 218 | Ga0105248_12746339 | 3300009177 | Bacteria | 562 |
| 219 | Ga0105237_10838535 | 3300009545 | Bacteria | 926 |
| 220 | Ga0105238_10261134 | 3300009551 | Bacteria | 1711 |
| 221 | Ga0105249_10014854 | 3300009553 | Bacteria | 6886 |
| 222 | Ga0105249_10319390 | 3300009553 | Unclassified | 1564 |
| 223 | Ga0105249_10980898 | 3300009553 | Bacteria | 913 |
| 224 | Ga0105249_11173811 | 3300009553 | Bacteria | 838 |
| 225 | Ga0099796_10007558 | 3300010159 | Bacteria | 2847 |
| 226 | Ga0099796_10385249 | 3300010159 | Unclassified | 612 |
| 227 | Ga0105239_11278207 | 3300010375 | Bacteria | 846 |
| 228 | Ga0105246_11163208 | 3300011119 | Bacteria | 708 |
| 229 | Ga0105246_11628576 | 3300011119 | Unclassified | 611 |
| 230 | Ga0157341_1010192 | 3300012494 | Bacteria | 794 |
| 231 | Ga0157339_1007580 | 3300012505 | Bacteria | 914 |
| 232 | Ga0157373_11200257 | 3300013100 | Bacteria | 572 |
| 233 | Ga0157370_10612654 | 3300013104 | Bacteria | 996 |
| 234 | Ga0157370_10796679 | 3300013104 | Bacteria | 860 |
| 235 | Ga0157374_10615275 | 3300013296 | Bacteria | 1097 |
| 236 | Ga0157374_11195551 | 3300013296 | Bacteria | 781 |
| 237 | Ga0157378_10900088 | 3300013297 | Bacteria | 915 |
| 238 | Ga0163162_10352023 | 3300013306 | Bacteria | 1605 |
| 239 | Ga0163162_11436937 | 3300013306 | Bacteria | 785 |
| 240 | Ga0163162_11446080 | 3300013306 | Bacteria | 782 |
| 241 | Ga0163162_11954469 | 3300013306 | Bacteria | 672 |
| 242 | Ga0157375_10302115 | 3300013308 | Bacteria | 1764 |
| 243 | Ga0157375_10306320 | 3300013308 | Bacteria | 1752 |
| 244 | Ga0163163_10033935 | 3300014325 | Bacteria | 4940 |
| 245 | Ga0163163_10071291 | 3300014325 | Bacteria | 3462 |
| 246 | Ga0163163_12825685 | 3300014325 | Bacteria | 542 |
| 247 | Ga0157380_10000591 | 3300014326 | Bacteria | 22352 |
| 248 | Ga0157380_10473493 | 3300014326 | Bacteria | 1209 |
| 249 | Ga0157380_10864419 | 3300014326 | Bacteria | 927 |
| 250 | Ga0157380_11594196 | 3300014326 | Bacteria | 708 |
| 251 | Ga0157380_12172962 | 3300014326 | Bacteria | 619 |
| 252 | Ga0157380_13068487 | 3300014326 | Bacteria | 532 |
| 253 | Ga0157380_13164881 | 3300014326 | Bacteria | 525 |
| 254 | Ga0157380_13269189 | 3300014326 | Bacteria | 518 |
| 255 | Ga0157377_10382420 | 3300014745 | Bacteria | 953 |
| 256 | Ga0157377_10853619 | 3300014745 | Bacteria | 676 |
| 257 | Ga0157379_10005406 | 3300014968 | Bacteria | 10968 |
| 258 | Ga0157379_10183299 | 3300014968 | Bacteria | 1891 |
| 259 | Ga0157379_11461637 | 3300014968 | Bacteria | 664 |
| 260 | Ga0157376_10263095 | 3300014969 | Bacteria | 1617 |
| 261 | Ga0157376_10433111 | 3300014969 | Bacteria | 1279 |
| 262 | Ga0182007_10083740 | 3300015262 | Bacteria | 1047 |
| 263 | Ga0163161_10076747 | 3300017792 | Bacteria | 2453 |
| 264 | Ga0163161_11514113 | 3300017792 | Bacteria | 589 |
| 265 | Ga0163161_11800459 | 3300017792 | Bacteria | 544 |
| 266 | Ga0184594_106948 | 3300019181 | Bacteria | 624 |
| 267 | Ga0206352_10818112 | 3300020078 | Bacteria | 1134 |
| 268 | Ga0224570_102507 | 3300022730 | Bacteria | 1225 |
| 269 | Ga0224572_1026876 | 3300024225 | Bacteria | 1103 |
| 270 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 271 | Ga0207653_10024985 | 3300025885 | Bacteria | 1909 |
| 272 | Ga0207653_10030978 | 3300025885 | Bacteria | 1727 |
| 273 | Ga0207682_10032587 | 3300025893 | Bacteria | 2095 |
| 274 | Ga0207642_10048052 | 3300025899 | Bacteria | 1911 |
| 275 | Ga0207710_10042513 | 3300025900 | Bacteria | 2018 |
| 276 | Ga0207710_10042526 | 3300025900 | Bacteria | 2018 |
| 277 | Ga0207688_10213444 | 3300025901 | Bacteria | 1160 |
| 278 | Ga0207688_10563419 | 3300025901 | Bacteria | 716 |
| 279 | Ga0207688_10860820 | 3300025901 | Bacteria | 574 |
| 280 | Ga0207680_10099696 | 3300025903 | Bacteria | 1864 |
| 281 | Ga0207645_10100614 | 3300025907 | Bacteria | 1864 |
| 282 | Ga0207643_10011473 | 3300025908 | Bacteria | 4786 |
| 283 | Ga0207705_10968442 | 3300025909 | Bacteria | 658 |
| 284 | Ga0207684_10031695 | 3300025910 | Bacteria | 4497 |
| 285 | Ga0207684_10852587 | 3300025910 | Bacteria | 768 |
| 286 | Ga0207695_10090093 | 3300025913 | Bacteria | 3083 |
| 287 | Ga0207663_10012103 | 3300025916 | Bacteria | 4654 |
| 288 | Ga0207663_10016647 | 3300025916 | Bacteria | 4083 |
| 289 | Ga0207660_10416368 | 3300025917 | Bacteria | 1083 |
| 290 | Ga0207660_11243694 | 3300025917 | Bacteria | 605 |
| 291 | Ga0207657_10226209 | 3300025919 | Bacteria | 1497 |
| 292 | Ga0207652_10272702 | 3300025921 | Bacteria | 1526 |
| 293 | Ga0207652_10937564 | 3300025921 | Bacteria | 763 |
| 294 | Ga0207646_10122711 | 3300025922 | Bacteria | 2335 |
| 295 | Ga0207646_11226411 | 3300025922 | Bacteria | 657 |
| 296 | Ga0207681_10350050 | 3300025923 | Bacteria | 1182 |
| 297 | Ga0207681_11097059 | 3300025923 | Bacteria | 668 |
| 298 | Ga0207681_11106469 | 3300025923 | Bacteria | 665 |
| 299 | Ga0207681_11119731 | 3300025923 | Bacteria | 661 |
| 300 | Ga0207694_10675376 | 3300025924 | Bacteria | 871 |
| 301 | Ga0207650_10026889 | 3300025925 | Bacteria | 4111 |
| 302 | Ga0207659_10005865 | 3300025926 | Bacteria | 7493 |
| 303 | Ga0207659_11567761 | 3300025926 | Bacteria | 563 |
| 304 | Ga0207644_10154157 | 3300025931 | Bacteria | 1780 |
| 305 | Ga0207690_10576321 | 3300025932 | Bacteria | 917 |
| 306 | Ga0207690_10677806 | 3300025932 | Bacteria | 846 |
| 307 | Ga0207706_10030881 | 3300025933 | Bacteria | 4777 |
| 308 | Ga0207706_10361998 | 3300025933 | Bacteria | 1260 |
| 309 | Ga0207686_10364332 | 3300025934 | Bacteria | 1092 |
| 310 | Ga0207709_10028739 | 3300025935 | Bacteria | 3217 |
| 311 | Ga0207709_10701660 | 3300025935 | Unclassified | 810 |
| 312 | Ga0207670_10005712 | 3300025936 | Bacteria | 6858 |
| 313 | Ga0207670_10791987 | 3300025936 | Bacteria | 789 |
| 314 | Ga0207669_10418936 | 3300025937 | Bacteria | 1053 |
| 315 | Ga0207704_10973575 | 3300025938 | Bacteria | 716 |
| 316 | Ga0207691_10021978 | 3300025940 | Bacteria | 6020 |
| 317 | Ga0207691_10779170 | 3300025940 | Bacteria | 804 |
| 318 | Ga0207711_10011736 | 3300025941 | Bacteria | 7278 |
| 319 | Ga0207689_10884639 | 3300025942 | Bacteria | 754 |
| 320 | Ga0207689_10920223 | 3300025942 | Unclassified | 738 |
| 321 | Ga0207661_10558635 | 3300025944 | Bacteria | 1049 |
| 322 | Ga0207679_10003903 | 3300025945 | Bacteria | 9249 |
| 323 | Ga0207667_10787258 | 3300025949 | Bacteria | 949 |
| 324 | Ga0207651_10056556 | 3300025960 | Bacteria | 2700 |
| 325 | Ga0207712_10031923 | 3300025961 | Bacteria | 3551 |
| 326 | Ga0207712_10205623 | 3300025961 | Unclassified | 1564 |
| 327 | Ga0207712_10589783 | 3300025961 | Bacteria | 960 |
| 328 | Ga0207668_10278673 | 3300025972 | Bacteria | 1370 |
| 329 | Ga0207668_10358382 | 3300025972 | Bacteria | 1221 |
| 330 | Ga0207668_10728311 | 3300025972 | Bacteria | 873 |
| 331 | Ga0207640_11227261 | 3300025981 | Bacteria | 667 |
| 332 | Ga0207640_11747988 | 3300025981 | Bacteria | 562 |
| 333 | Ga0207677_10972160 | 3300026023 | Bacteria | 769 |
| 334 | Ga0207703_10039202 | 3300026035 | Bacteria | 3785 |
| 335 | Ga0207703_11159653 | 3300026035 | Bacteria | 743 |
| 336 | Ga0207639_10317723 | 3300026041 | Bacteria | 1382 |
| 337 | Ga0207678_10021083 | 3300026067 | Bacteria | 5712 |
| 338 | Ga0207678_10219863 | 3300026067 | Bacteria | 1626 |
| 339 | Ga0207708_10203672 | 3300026075 | Bacteria | 1579 |
| 340 | Ga0207708_10314330 | 3300026075 | Bacteria | 1277 |
| 341 | Ga0207708_11178939 | 3300026075 | Bacteria | 669 |
| 342 | Ga0207708_11262393 | 3300026075 | Bacteria | 647 |
| 343 | Ga0207641_10005068 | 3300026088 | Bacteria | 11294 |
| 344 | Ga0207648_10004948 | 3300026089 | Bacteria | 13559 |
| 345 | Ga0207648_10226426 | 3300026089 | Bacteria | 1663 |
| 346 | Ga0207676_10001855 | 3300026095 | Bacteria | 15472 |
| 347 | Ga0207676_11441570 | 3300026095 | Unclassified | 685 |
| 348 | Ga0207674_10298152 | 3300026116 | Bacteria | 1561 |
| 349 | Ga0207675_100000293 | 3300026118 | Bacteria | 48222 |
| 350 | Ga0207675_100005931 | 3300026118 | Bacteria | 11657 |
| 351 | Ga0207675_100426350 | 3300026118 | Bacteria | 1311 |
| 352 | Ga0207675_101006798 | 3300026118 | Bacteria | 852 |
| 353 | Ga0207675_101296640 | 3300026118 | Bacteria | 749 |
| 354 | Ga0207683_10200966 | 3300026121 | Bacteria | 1812 |
| 355 | Ga0207683_10643394 | 3300026121 | Bacteria | 982 |
| 356 | Ga0207683_12150018 | 3300026121 | Bacteria | 506 |
| 357 | Ga0207698_10895017 | 3300026142 | Bacteria | 894 |
| 358 | Ga0207698_10943478 | 3300026142 | Bacteria | 872 |
| 359 | Ga0209588_1060289 | 3300027671 | Bacteria | 1227 |
| 360 | Ga0209971_1134864 | 3300027682 | Bacteria | 608 |
| 361 | Ga0209974_10187899 | 3300027876 | Bacteria | 759 |
| 362 | Ga0209974_10205304 | 3300027876 | Bacteria | 729 |
| 363 | Ga0207428_10037102 | 3300027907 | Bacteria | 3967 |
| 364 | Ga0207428_10063831 | 3300027907 | Bacteria | 2908 |
| 365 | Ga0207428_10102462 | 3300027907 | Unclassified | 2210 |
| 366 | Ga0207428_10737374 | 3300027907 | Bacteria | 703 |
| 367 | Ga0265354_1001073 | 3300028016 | Bacteria | 4208 |
| 368 | Ga0265356_1001665 | 3300028017 | Bacteria | 3187 |
| 369 | Ga0265357_1019379 | 3300028023 | Bacteria | 738 |
| 370 | Ga0268266_10017545 | 3300028379 | Bacteria | 6107 |
| 371 | Ga0268266_10063090 | 3300028379 | Bacteria | 3199 |
| 372 | Ga0268265_10000379 | 3300028380 | Bacteria | 47868 |
| 373 | Ga0268265_10119374 | 3300028380 | Bacteria | 2169 |
| 374 | Ga0268265_10135473 | 3300028380 | Bacteria | 2054 |
| 375 | Ga0268264_10806996 | 3300028381 | Bacteria | 938 |
| 376 | Ga0268264_10890536 | 3300028381 | Bacteria | 893 |
| 377 | Ga0268264_10913789 | 3300028381 | Bacteria | 881 |
| 378 | Ga0265326_10148359 | 3300028558 | Bacteria | 670 |
| 379 | Ga0265334_10044628 | 3300028573 | Bacteria | 1720 |
| 380 | Ga0265318_10194422 | 3300028577 | Bacteria | 742 |
| 381 | Ga0265338_10003875 | 3300028800 | Bacteria | 20711 |
| 382 | Ga0265338_10556018 | 3300028800 | Bacteria | 803 |
| 383 | Ga0311000_100053 | 3300029272 | Bacteria | 994 |
| 384 | Ga0311003_158611 | 3300029282 | Bacteria | 611 |
| 385 | Ga0310981_1006486 | 3300029285 | Bacteria | 703 |
| 386 | Ga0310981_1032411 | 3300029285 | Bacteria | 856 |
| 387 | Ga0314311_1052161 | 3300030733 | Bacteria | 861 |
| 388 | Ga0265762_1074757 | 3300030760 | Bacteria | 717 |
| 389 | Ga0265762_1106305 | 3300030760 | Unclassified | 628 |
| 390 | Ga0265763_1002105 | 3300030763 | Bacteria | 1496 |
| 391 | Ga0265763_1004155 | 3300030763 | Bacteria | 1176 |
| 392 | Ga0265767_109884 | 3300030836 | Unclassified | 633 |
| 393 | Ga0265766_1006027 | 3300030863 | Bacteria | 785 |
| 394 | Ga0265766_1007397 | 3300030863 | Bacteria | 738 |
| 395 | Ga0265770_1000649 | 3300030878 | Bacteria | 4829 |
| 396 | Ga0265764_101027 | 3300030882 | Bacteria | 1172 |
| 397 | Ga0265764_113456 | 3300030882 | Unclassified | 546 |
| 398 | Ga0265772_100491 | 3300030886 | Bacteria | 1189 |
| 399 | Ga0265769_106574 | 3300030888 | Bacteria | 734 |
| 400 | Ga0265761_101200 | 3300030889 | Bacteria | 1108 |
| 401 | Ga0265768_100407 | 3300030963 | Bacteria | 1662 |
| 402 | Ga0265768_113614 | 3300030963 | Unclassified | 552 |
| 403 | Ga0265771_1001532 | 3300031010 | Bacteria | 1109 |
| 404 | Ga0265760_10001515 | 3300031090 | Bacteria | 6842 |
| 405 | Ga0265330_10505823 | 3300031235 | Bacteria | 514 |
| 406 | Ga0265328_10169427 | 3300031239 | Bacteria | 825 |
| 407 | Ga0265320_10202542 | 3300031240 | Bacteria | 886 |
| 408 | Ga0265325_10012046 | 3300031241 | Bacteria | 4955 |
| 409 | Ga0265329_10256559 | 3300031242 | Bacteria | 584 |
| 410 | Ga0265340_10225228 | 3300031247 | Bacteria | 839 |
| 411 | Ga0265340_10482640 | 3300031247 | Bacteria | 546 |
| 412 | Ga0265339_10179012 | 3300031249 | Bacteria | 1057 |
| 413 | Ga0265327_10030925 | 3300031251 | Bacteria | 3016 |
| 414 | Ga0265316_10118034 | 3300031344 | Bacteria | 2005 |
| 415 | Ga0265316_10462496 | 3300031344 | Bacteria | 909 |
| 416 | Ga0307408_100079115 | 3300031548 | Bacteria | 2452 |
| 417 | Ga0307408_100770166 | 3300031548 | Bacteria | 871 |
| 418 | Ga0307408_101151664 | 3300031548 | Bacteria | 721 |
| 419 | Ga0265313_10020146 | 3300031595 | Bacteria | 3687 |
| 420 | Ga0307508_10223421 | 3300031616 | Bacteria | 1483 |
| 421 | Ga0316575_10085728 | 3300031665 | Bacteria | 1272 |
| 422 | Ga0316575_10208181 | 3300031665 | Bacteria | 815 |
| 423 | Ga0316579_10171415 | 3300031691 | Bacteria | 1049 |
| 424 | Ga0316579_10461739 | 3300031691 | Bacteria | 614 |
| 425 | Ga0316579_10666670 | 3300031691 | Bacteria | 504 |
| 426 | Ga0316576_10048510 | 3300031727 | Bacteria | 3080 |
| 427 | Ga0316576_10071550 | 3300031727 | Bacteria | 2558 |
| 428 | Ga0316576_10178198 | 3300031727 | Bacteria | 1603 |
| 429 | Ga0316576_10407641 | 3300031727 | Bacteria | 1007 |
| 430 | Ga0316576_10758747 | 3300031727 | Bacteria | 700 |
| 431 | Ga0316578_10088829 | 3300031728 | Bacteria | 1844 |
| 432 | Ga0316578_10421713 | 3300031728 | Bacteria | 790 |
| 433 | Ga0316578_10448242 | 3300031728 | Bacteria | 763 |
| 434 | Ga0316578_10659171 | 3300031728 | Bacteria | 611 |
| 435 | Ga0307516_10000288 | 3300031730 | Bacteria | 65317 |
| 436 | Ga0307405_10300360 | 3300031731 | Bacteria | 1218 |
| 437 | Ga0307405_11372091 | 3300031731 | Bacteria | 617 |
| 438 | Ga0316577_10014813 | 3300031733 | Bacteria | 4286 |
| 439 | Ga0316577_10413893 | 3300031733 | Bacteria | 766 |
| 440 | Ga0307413_10545857 | 3300031824 | Bacteria | 939 |
| 441 | Ga0307413_10777758 | 3300031824 | Bacteria | 802 |
| 442 | Ga0307413_10829611 | 3300031824 | Bacteria | 779 |
| 443 | Ga0307413_10925690 | 3300031824 | Bacteria | 742 |
| 444 | Ga0307413_11780479 | 3300031824 | Bacteria | 551 |
| 445 | Ga0307413_11788986 | 3300031824 | Bacteria | 550 |
| 446 | Ga0307410_10188512 | 3300031852 | Bacteria | 1567 |
| 447 | Ga0307410_10598623 | 3300031852 | Bacteria | 919 |
| 448 | Ga0307410_10792063 | 3300031852 | Bacteria | 805 |
| 449 | Ga0307410_10916493 | 3300031852 | Bacteria | 751 |
| 450 | Ga0307410_11056549 | 3300031852 | Bacteria | 702 |
| 451 | Ga0307406_10000585 | 3300031901 | Bacteria | 20988 |
| 452 | Ga0307406_10227013 | 3300031901 | Bacteria | 1392 |
| 453 | Ga0307406_10322986 | 3300031901 | Bacteria | 1195 |
| 454 | Ga0307406_11388883 | 3300031901 | Bacteria | 615 |
| 455 | Ga0307407_10095855 | 3300031903 | Bacteria | 1830 |
| 456 | Ga0307407_10502983 | 3300031903 | Bacteria | 889 |
| 457 | Ga0307407_11386985 | 3300031903 | Bacteria | 553 |
| 458 | Ga0307412_10077525 | 3300031911 | Bacteria | 2286 |
| 459 | Ga0307412_10191175 | 3300031911 | Bacteria | 1548 |
| 460 | Ga0307412_11002366 | 3300031911 | Bacteria | 738 |
| 461 | Ga0307409_100350694 | 3300031995 | Bacteria | 1392 |
| 462 | Ga0307409_100386222 | 3300031995 | Bacteria | 1333 |
| 463 | Ga0307409_100691984 | 3300031995 | Bacteria | 1018 |
| 464 | Ga0307409_100720885 | 3300031995 | Bacteria | 998 |
| 465 | Ga0307409_102339594 | 3300031995 | Bacteria | 563 |
| 466 | Ga0307416_100233918 | 3300032002 | Bacteria | 1774 |
| 467 | Ga0307416_100958782 | 3300032002 | Bacteria | 957 |
| 468 | Ga0307416_101249653 | 3300032002 | Bacteria | 848 |
| 469 | Ga0307416_102575408 | 3300032002 | Bacteria | 607 |
| 470 | Ga0307414_10486183 | 3300032004 | Bacteria | 1090 |
| 471 | Ga0307414_10507500 | 3300032004 | Bacteria | 1068 |
| 472 | Ga0307414_11186277 | 3300032004 | Bacteria | 707 |
| 473 | Ga0307411_10083809 | 3300032005 | Bacteria | 2203 |
| 474 | Ga0307411_10803468 | 3300032005 | Bacteria | 828 |
| 475 | Ga0307415_100052178 | 3300032126 | Bacteria | 2779 |
| 476 | Ga0307415_100329800 | 3300032126 | Bacteria | 1276 |
| 477 | Ga0307415_100512539 | 3300032126 | Bacteria | 1051 |
| 478 | Ga0307415_100815195 | 3300032126 | Bacteria | 853 |
| 479 | Ga0307415_101744608 | 3300032126 | Bacteria | 601 |
| 480 | Ga0316583_10035511 | 3300032133 | Bacteria | 1769 |
| 481 | Ga0316583_10045147 | 3300032133 | Bacteria | 1556 |
| 482 | Ga0316585_10069217 | 3300032137 | Bacteria | 1144 |
| 483 | Ga0316580_10108568 | 3300032139 | Bacteria | 849 |
| 484 | Ga0316593_10000361 | 3300032168 | Bacteria | 8014 |
| 485 | Ga0316593_10000793 | 3300032168 | Bacteria | 6298 |
| 486 | Ga0316593_10000990 | 3300032168 | Bacteria | 5875 |
| 487 | Ga0316593_10003664 | 3300032168 | Bacteria | 3847 |
| 488 | Ga0316593_10007195 | 3300032168 | Bacteria | 3048 |
| 489 | Ga0316593_10011479 | 3300032168 | Bacteria | 2575 |
| 490 | Ga0316593_10028914 | 3300032168 | Bacteria | 1789 |
| 491 | Ga0316593_10048682 | 3300032168 | Bacteria | 1427 |
| 492 | Ga0316593_10050066 | 3300032168 | Bacteria | 1409 |
| 493 | Ga0316593_10052064 | 3300032168 | Bacteria | 1385 |
| 494 | Ga0316593_10054929 | 3300032168 | Bacteria | 1353 |
| 495 | Ga0316593_10103988 | 3300032168 | Bacteria | 1010 |
| 496 | Ga0316593_10108173 | 3300032168 | Bacteria | 991 |
| 497 | Ga0316593_10215658 | 3300032168 | Bacteria | 712 |
| 498 | Ga0316593_10219518 | 3300032168 | Bacteria | 706 |
| 499 | Ga0316593_10392002 | 3300032168 | Bacteria | 536 |
| 500 | Ga0307510_10153892 | 3300033180 | Bacteria | 1911 |
| 501 | Ga0316592_1002827 | 3300033524 | Bacteria | 3049 |
| 502 | Ga0316592_1003865 | 3300033524 | Bacteria | 2746 |
| 503 | Ga0316592_1015277 | 3300033524 | Bacteria | 1597 |
| 504 | Ga0316592_1017381 | 3300033524 | Bacteria | 1508 |
| 505 | Ga0316592_1018789 | 3300033524 | Bacteria | 1459 |
| 506 | Ga0316592_1034129 | 3300033524 | Bacteria | 1113 |
| 507 | Ga0316592_1108280 | 3300033524 | Bacteria | 642 |
| 508 | Ga0316592_1119679 | 3300033524 | Bacteria | 611 |
| 509 | Ga0316592_1130631 | 3300033524 | Bacteria | 586 |
| 510 | Ga0316586_1003514 | 3300033527 | Bacteria | 2064 |
| 511 | Ga0316586_1009966 | 3300033527 | Bacteria | 1432 |
| 512 | Ga0316586_1018484 | 3300033527 | Bacteria | 1131 |
| 513 | Ga0316586_1045064 | 3300033527 | Bacteria | 782 |
| 514 | Ga0316586_1048483 | 3300033527 | Bacteria | 757 |
| 515 | Ga0316588_1005180 | 3300033528 | Bacteria | 2521 |
| 516 | Ga0316588_1009326 | 3300033528 | Bacteria | 2045 |
| 517 | Ga0316588_1032648 | 3300033528 | Bacteria | 1226 |
| 518 | Ga0316588_1138966 | 3300033528 | Unclassified | 620 |
| 519 | Ga0316588_1154891 | 3300033528 | Bacteria | 589 |
| 520 | Ga0316587_1001502 | 3300033529 | Bacteria | 2892 |
| 521 | Ga0316587_1005823 | 3300033529 | Bacteria | 1863 |
| 522 | Ga0316587_1005922 | 3300033529 | Bacteria | 1851 |
| 523 | Ga0316587_1021404 | 3300033529 | Bacteria | 1103 |
| 524 | Ga0316587_1030091 | 3300033529 | Bacteria | 957 |
| 525 | Ga0316587_1052389 | 3300033529 | Bacteria | 749 |
| 526 | Ga0316587_1084307 | 3300033529 | Bacteria | 603 |
| 527 | Ga0316587_1093413 | 3300033529 | Bacteria | 575 |
| 528 | Ga0316587_1093949 | 3300033529 | Bacteria | 574 |
| 529 | Ga0316587_1106310 | 3300033529 | Bacteria | 543 |
| 530 | Ga0316596_1000248 | 3300033541 | Bacteria | 8264 |
| 531 | Ga0316596_1001002 | 3300033541 | Bacteria | 5438 |
| 532 | Ga0316596_1015151 | 3300033541 | Bacteria | 1919 |
| 533 | Ga0316596_1018273 | 3300033541 | Bacteria | 1771 |
| 534 | Ga0316596_1020028 | 3300033541 | Bacteria | 1700 |
| 535 | Ga0316596_1024641 | 3300033541 | Bacteria | 1545 |
| 536 | Ga0316596_1028569 | 3300033541 | Bacteria | 1442 |
| 537 | Ga0316596_1029864 | 3300033541 | Bacteria | 1412 |
| 538 | Ga0316596_1071966 | 3300033541 | Bacteria | 926 |
| 539 | Ga0316596_1081013 | 3300033541 | Bacteria | 873 |
| 540 | Ga0316596_1130800 | 3300033541 | Bacteria | 685 |
| 541 | Ga0316596_1156081 | 3300033541 | Bacteria | 628 |
| 542 | Ga0316596_1186083 | 3300033541 | Bacteria | 576 |
| 543 | Ga0316212_1020930 | 3300033547 | Bacteria | 918 |
| 544 | Ga0373958_0052411 | 3300034819 | Bacteria | 864 |
| 545 | Ga0373938_0016338 | 3300034957 | Bacteria | 1449 |
| 546 | Ga0373949_0043792 | 3300035090 | Bacteria | 1109 |
| 547 | Ga0373952_0198529 | 3300035092 | Bacteria | 587 |
| 548 | Ga0373923_0505593 | 3300035111 | Unclassified | 590 |
| 549 | Ga0373932_0143887 | 3300035112 | Bacteria | 813 |
| 550 | Ga0373939_0032708 | 3300035114 | Bacteria | 1514 |
| 551 | Ga0373945_0284957 | 3300035116 | Bacteria | 705 |
| 552 | Ga0373953_0104038 | 3300035117 | Bacteria | 1197 |
| 553 | Ga0373954_0138520 | 3300035118 | Bacteria | 1186 |
| 554 | Ga0373956_0112691 | 3300035119 | Bacteria | 1267 |
| 555 | Ga0373960_0275410 | 3300035121 | Bacteria | 619 |
| 556 | Ga0373955_0845580 | 3300035172 | Unclassified | 563 |
| 557 | Ga0373961_0174553 | 3300035241 | Bacteria | 745 |
| 558 | Ga0373962_0204318 | 3300035242 | Bacteria | 670 |
| 559 | Ga0316574_0027300 | 3300035398 | Bacteria | 3438 |
| 560 | Ga0316574_0037143 | 3300035398 | Bacteria | 2986 |
| 561 | Ga0316574_0040060 | 3300035398 | Bacteria | 2883 |
| 562 | Ga0316574_0133130 | 3300035398 | Bacteria | 1600 |
| 563 | Ga0316574_0161833 | 3300035398 | Bacteria | 1441 |
| 564 | Ga0316574_0226581 | 3300035398 | Bacteria | 1197 |
| 565 | Ga0316574_0525916 | 3300035398 | Bacteria | 736 |
| 566 | Ga0373924_0081700 | 3300035410 | Bacteria | 1375 |
| 567 | Ga0373931_0251053 | 3300035691 | Bacteria | 1076 |
| 568 | Ga0373935_0036278 | 3300035692 | Bacteria | 3082 |
| 569 | Ga0373933_0023866 | 3300035724 | Unclassified | 3498 |
| 570 | Ga0373933_0425718 | 3300035724 | Bacteria | 867 |
| 571 | Ga0373933_1007885 | 3300035724 | Bacteria | 548 |
| 572 | Ga0373937_0589547 | 3300036401 | Bacteria | 1055 |
| 573 | Ga0316582_0004388 | 3300036647 | Bacteria | 7116 |
| 574 | Ga0316582_0016790 | 3300036647 | Bacteria | 4219 |
| 575 | Ga0316582_0030603 | 3300036647 | Bacteria | 3280 |
| 576 | Ga0316582_0307190 | 3300036647 | Bacteria | 1090 |
| 577 | Ga0316582_0493189 | 3300036647 | Bacteria | 844 |
| 578 | Ga0316582_0828192 | 3300036647 | Bacteria | 634 |
| 579 | Ga0316584_0044625 | 3300036712 | Bacteria | 3306 |
| 580 | Ga0316584_0048003 | 3300036712 | Bacteria | 3190 |
| 581 | Ga0316584_0057675 | 3300036712 | Bacteria | 2907 |
| 582 | Ga0316584_0066017 | 3300036712 | Bacteria | 2711 |
| 583 | Ga0316584_0273821 | 3300036712 | Bacteria | 1228 |
| 584 | Ga0316584_0365296 | 3300036712 | Unclassified | 1034 |
| 585 | Ga0316584_0538179 | 3300036712 | Bacteria | 817 |
| 586 | Ga0316584_0605666 | 3300036712 | Bacteria | 759 |
| 587 | Ga0316584_0632277 | 3300036712 | Bacteria | 739 |
| 588 | Ga0316584_0908375 | 3300036712 | Bacteria | 592 |
| 589 | Ga0373925_0084490 | 3300037068 | Bacteria | 2419 |
| 590 | Ga0395900_1403174 | 3300037418 | Bacteria | 611 |
| 591 | Ga0316581_0001004 | 3300037588 | Bacteria | 6044 |
| 592 | Ga0400483_030749 | 3300039062 | Bacteria | 3322 |
| 593 | Ga0400487_62966 | 3300039110 | Bacteria | 10791 |
| 594 | Ga0436365_0511780 | 3300039437 | Bacteria | 582 |
| 595 | Ga0436365_1628411 | 3300039437 | Bacteria | 2342 |
| 596 | Ga0436360_0975443 | 3300039438 | Bacteria | 912 |
| 597 | Ga0439436_0116364 | 3300041404 | Bacteria | 747 |
| 598 | Ga0439461_0179896 | 3300041410 | Bacteria | 560 |
| 599 | Ga0439465_0028899 | 3300041413 | Bacteria | 1760 |
| 600 | Ga0451798_0569403 | 3300041458 | Bacteria | 2021 |
| 601 | Ga0451833_1011918 | 3300041491 | Bacteria | 1374 |
| 602 | Ga0451841_0702593 | 3300041498 | Bacteria | 655 |
| 603 | Ga0451849_0594637 | 3300041505 | Bacteria | 2121 |
| 604 | Ga0451850_27006 | 3300041506 | Bacteria | 1050 |
| 605 | Ga0451851_0741629 | 3300041507 | Bacteria | 604 |
| 606 | Ga0451843_0137409 | 3300041509 | Bacteria | 1187 |
| 607 | Ga0451843_0794405 | 3300041509 | Bacteria | 513 |
| 608 | Ga0451853_1477023 | 3300041512 | Bacteria | 1379 |
| 609 | Ga0451853_3285942 | 3300041512 | Bacteria | 2249 |
| 610 | Ga0452271_08140 | 3300041916 | Bacteria | 1261 |
| 611 | Ga0439431_0048983 | 3300041997 | Bacteria | 1092 |
| 612 | Ga0439431_0081767 | 3300041997 | Bacteria | 872 |
| 613 | Ga0439443_106347 | 3300042003 | Bacteria | 541 |
| 614 | Ga0439445_0004084 | 3300042004 | Bacteria | 3297 |
| 615 | Ga0439448_0271335 | 3300042005 | Bacteria | 600 |
| 616 | Ga0439449_0193637 | 3300042007 | Bacteria | 761 |
| 617 | Ga0439449_0240808 | 3300042007 | Bacteria | 679 |
| 618 | Ga0439450_116155 | 3300042008 | Bacteria | 687 |
| 619 | Ga0439455_0253122 | 3300042012 | Bacteria | 516 |
| 620 | Ga0439457_120880 | 3300042014 | Bacteria | 619 |
| 621 | Ga0439463_031763 | 3300042016 | Bacteria | 1334 |
| 622 | Ga0450911_032372 | 3300042115 | Bacteria | 679 |
| 623 | Ga0450914_013386 | 3300042118 | Bacteria | 835 |
| 624 | Ga0450917_014402 | 3300042120 | Bacteria | 660 |
| 625 | Ga0450923_139277 | 3300042125 | Bacteria | 582 |
| 626 | Ga0450888_027699 | 3300042126 | Bacteria | 748 |
| 627 | Ga0450895_031320 | 3300042132 | Bacteria | 520 |
| 628 | Ga0450899_027527 | 3300042135 | Bacteria | 683 |
| 629 | Ga0450902_047311 | 3300042137 | Bacteria | 736 |
| 630 | Ga0439458_0008446 | 3300042157 | Bacteria | 2293 |
| 631 | Ga0439458_0111164 | 3300042157 | Bacteria | 717 |
| 632 | Ga0439458_0114569 | 3300042157 | Bacteria | 707 |
| 633 | Ga0439458_0236303 | 3300042157 | Unclassified | 506 |
| 634 | Ga0439444_0105765 | 3300042437 | Bacteria | 643 |
| 635 | Ga0439459_0193661 | 3300042438 | Bacteria | 552 |
| 636 | Ga0439464_0309206 | 3300042439 | Bacteria | 517 |
| 637 | Ga0450918_074203 | 3300042531 | Unclassified | 642 |
| 638 | Ga0450901_016777 | 3300042533 | Bacteria | 773 |
| 639 | Ga0451577_0015944 | 3300042876 | Bacteria | 6971 |
| 640 | Ga0451577_0026574 | 3300042876 | Bacteria | 5242 |
| 641 | Ga0451577_0066178 | 3300042876 | Bacteria | 3223 |
| 642 | Ga0451577_0220962 | 3300042876 | Bacteria | 1712 |
| 643 | Ga0451577_0282635 | 3300042876 | Bacteria | 1503 |
| 644 | Ga0451577_0337134 | 3300042876 | Bacteria | 1368 |
| 645 | Ga0451577_0630340 | 3300042876 | Bacteria | 972 |
| 646 | Ga0451577_1124199 | 3300042876 | Unclassified | 702 |
| 647 | Ga0439440_0049720 | 3300042993 | Bacteria | 1045 |
| 648 | Ga0453683_0017806 | 3300044673 | Bacteria | 4569 |
| 649 | Ga0453683_0051102 | 3300044673 | Bacteria | 2590 |
| 650 | Ga0453683_0103919 | 3300044673 | Unclassified | 1784 |
| 651 | Ga0466965_0176315 | 3300044683 | Bacteria | 1126 |
| 652 | Ga0453684_0030164 | 3300044712 | Bacteria | 7668 |
| 653 | Ga0453684_0044583 | 3300044712 | Bacteria | 5931 |
| 654 | Ga0453684_0101520 | 3300044712 | Bacteria | 3519 |
| 655 | Ga0453684_0164305 | 3300044712 | Bacteria | 2622 |
| 656 | Ga0453684_0307384 | 3300044712 | Bacteria | 1800 |
| 657 | Ga0453684_0508560 | 3300044712 | Bacteria | 1333 |
| 658 | Ga0451576_0015038 | 3300045051 | Bacteria | 8595 |
| 659 | Ga0451576_0021827 | 3300045051 | Bacteria | 6951 |
| 660 | Ga0451576_0043051 | 3300045051 | Bacteria | 4765 |
| 661 | Ga0451576_0052745 | 3300045051 | Bacteria | 4261 |
| 662 | Ga0451576_0197175 | 3300045051 | Bacteria | 2103 |
| 663 | Ga0451576_0325504 | 3300045051 | Bacteria | 1609 |
| 664 | Ga0451576_2487741 | 3300045051 | Bacteria | 529 |
| 665 | Ga0495617_022717 | 3300046452 | Bacteria | 2121 |
| 666 | Ga0495638_0002014 | 3300046460 | Bacteria | 17345 |
| 667 | Ga0495638_0373287 | 3300046460 | Bacteria | 747 |
| 668 | Ga0495650_0057843 | 3300046471 | Bacteria | 1568 |
| 669 | Ga0495582_0181237 | 3300046473 | Bacteria | 1200 |
| 670 | Ga0495639_0114729 | 3300046475 | Bacteria | 1281 |
| 671 | Ga0495639_0211464 | 3300046475 | Bacteria | 952 |
| 672 | Ga0495616_0368857 | 3300046513 | Bacteria | 595 |
| 673 | Ga0495630_0594055 | 3300046517 | Bacteria | 849 |
| 674 | Ga0495632_0200095 | 3300046519 | Bacteria | 910 |
| 675 | Ga0495666_0544735 | 3300046526 | Unclassified | 518 |
| 676 | Ga0495642_0263515 | 3300046528 | Bacteria | 754 |
| 677 | Ga0495586_0854723 | 3300046535 | Bacteria | 524 |
| 678 | Ga0495645_0190173 | 3300046543 | Bacteria | 1400 |
| 679 | Ga0495622_0239562 | 3300046557 | Bacteria | 800 |
| 680 | Ga0495622_0443846 | 3300046557 | Bacteria | 557 |
| 681 | Ga0495656_0457634 | 3300046615 | Bacteria | 673 |
| 682 | Ga0495668_0255590 | 3300046616 | Bacteria | 959 |
| 683 | Ga0495668_0326817 | 3300046616 | Bacteria | 841 |
| 684 | Ga0495668_0629378 | 3300046616 | Bacteria | 593 |
| 685 | Ga0495625_0077402 | 3300046660 | Bacteria | 2324 |
| 686 | Ga0495625_0254561 | 3300046660 | Bacteria | 1139 |
| 687 | Ga0495635_0545007 | 3300046663 | Bacteria | 761 |
| 688 | Ga0495657_0459609 | 3300046675 | Bacteria | 745 |
| 689 | Ga0495599_0549382 | 3300046678 | Bacteria | 676 |
| 690 | Ga0495647_0044512 | 3300046681 | Bacteria | 1703 |
| 691 | Ga0495658_0470421 | 3300046683 | Bacteria | 803 |
| 692 | Ga0495658_0639444 | 3300046683 | Bacteria | 681 |
| 693 | Ga0495669_0144470 | 3300046684 | Bacteria | 1124 |
| 694 | Ga0495671_0387202 | 3300046692 | Bacteria | 670 |
| 695 | Ga0495600_0532529 | 3300046809 | Bacteria | 719 |
| 696 | Ga0495581_0393433 | 3300047315 | Bacteria | 809 |
| 697 | Ga0495674_0747074 | 3300047319 | Unclassified | 765 |
| 698 | Ga0495672_0091772 | 3300047320 | Bacteria | 1666 |
| 699 | Ga0495680_0817438 | 3300047322 | Bacteria | 607 |
| 700 | Ga0495673_0280740 | 3300047469 | Bacteria | 601 |
| 701 | Ga0495686_0091310 | 3300047472 | Bacteria | 1849 |
| 702 | Ga0495686_0124871 | 3300047472 | Bacteria | 1531 |
| 703 | Ga0496100_0089707 | 3300048903 | Bacteria | 2095 |
| 704 | Ga0496101_0148686 | 3300048904 | Bacteria | 1790 |
| 705 | Ga0496104_0005409 | 3300048907 | Bacteria | 11174 |
| 706 | Ga0496105_0024024 | 3300048908 | Bacteria | 4950 |
| 707 | Ga0496108_1065278 | 3300048911 | Bacteria | 688 |
| 708 | Ga0496109_0026265 | 3300048912 | Bacteria | 5193 |
| 709 | Ga0496110_0514324 | 3300048913 | Bacteria | 1089 |
| 710 | Ga0496110_0609047 | 3300048913 | Bacteria | 990 |
| 711 | Ga0496110_1262592 | 3300048913 | Bacteria | 648 |
| 712 | Ga0496111_0536819 | 3300048914 | Bacteria | 859 |
| 713 | Ga0496111_0594517 | 3300048914 | Bacteria | 810 |
| 714 | Ga0496112_1270309 | 3300048915 | Bacteria | 652 |
| 715 | Ga0496113_0651508 | 3300048916 | Bacteria | 842 |
| 716 | Ga0496114_0006729 | 3300048917 | Bacteria | 9057 |
| 717 | Ga0496114_0837757 | 3300048917 | Bacteria | 799 |
| 718 | Ga0496115_0001742 | 3300048918 | Bacteria | 15613 |
| 719 | Ga0496120_0510753 | 3300048923 | Bacteria | 515 |
| 720 | Ga0496122_0006191 | 3300048925 | Bacteria | 13887 |
| 721 | Ga0496126_0395015 | 3300048929 | Bacteria | 1123 |
| 722 | Ga0501306_013792 | 3300049127 | Bacteria | 1058 |
| 723 | Ga0501308_027100 | 3300049128 | Bacteria | 751 |
| 724 | Ga0501308_055036 | 3300049128 | Bacteria | 590 |
| 725 | Ga0501308_084651 | 3300049128 | Bacteria | 509 |
| 726 | Ga0501309_094163 | 3300049129 | Bacteria | 514 |
| 727 | Ga0501310_005433 | 3300049130 | Bacteria | 1308 |
| 728 | Ga0501310_056641 | 3300049130 | Bacteria | 577 |
| 729 | Ga0501310_074048 | 3300049130 | Bacteria | 526 |
| 730 | Ga0501304_021330 | 3300049160 | Bacteria | 644 |
| 731 | Ga0501305_009910 | 3300049161 | Bacteria | 1262 |
| 732 | Ga0501307_089751 | 3300049162 | Bacteria | 511 |
| 733 | Ga0501292_054169 | 3300049515 | Bacteria | 716 |
| 734 | Ga0501298_103019 | 3300049521 | Bacteria | 653 |
| 735 | Ga0501298_166767 | 3300049521 | Bacteria | 546 |
| 736 | Ga0501299_060164 | 3300049522 | Bacteria | 803 |
| 737 | Ga0501300_089470 | 3300049523 | Bacteria | 514 |
| 738 | Ga0501311_068149 | 3300049527 | Bacteria | 586 |
| 739 | Ga0501311_072748 | 3300049527 | Bacteria | 573 |
| 740 | Ga0501312_051953 | 3300049528 | Bacteria | 693 |
| 741 | Ga0501313_036901 | 3300049529 | Bacteria | 648 |
| 742 | Ga0501315_058363 | 3300049531 | Bacteria | 620 |
| 743 | Ga0501317_027251 | 3300049533 | Bacteria | 811 |
| 744 | Ga0501317_066603 | 3300049533 | Bacteria | 601 |
| 745 | Ga0501317_084837 | 3300049533 | Bacteria | 553 |
| 746 | Ga0501317_095027 | 3300049533 | Bacteria | 531 |
| 747 | Ga0501318_055240 | 3300049534 | Bacteria | 599 |
| 748 | Ga0501323_057119 | 3300049539 | Bacteria | 603 |
| 749 | Ga0501323_072410 | 3300049539 | Bacteria | 553 |
| 750 | Ga0501324_036115 | 3300049540 | Bacteria | 553 |
| 751 | Ga0501335_037677 | 3300049551 | Bacteria | 563 |
| 752 | Ga0501335_049680 | 3300049551 | Bacteria | 509 |
| 753 | Ga0501336_006653 | 3300049552 | Bacteria | 862 |
| 754 | Ga0501031_0256374 | 3300049568 | Bacteria | 1137 |
| 755 | Ga0501033_0752531 | 3300049570 | Bacteria | 661 |
| 756 | Ga0501034_0038314 | 3300049571 | Bacteria | 4855 |
| 757 | Ga0501034_0559978 | 3300049571 | Bacteria | 1052 |
| 758 | Ga0501037_0014295 | 3300049573 | Bacteria | 5849 |
| 759 | Ga0501037_0624549 | 3300049573 | Bacteria | 722 |
| 760 | Ga0501039_1165605 | 3300049575 | Bacteria | 596 |
| 761 | Ga0501042_0566941 | 3300049578 | Bacteria | 825 |
| 762 | Ga0501046_0580826 | 3300049580 | Bacteria | 797 |
| 763 | Ga0501047_0283885 | 3300049581 | Bacteria | 1500 |
| 764 | Ga0501048_0647321 | 3300049582 | Bacteria | 759 |
| 765 | Ga0501048_0738814 | 3300049582 | Bacteria | 707 |
| 766 | Ga0501071_1068754 | 3300049587 | Bacteria | 624 |
| 767 | Ga0501071_1498741 | 3300049587 | Bacteria | 521 |
| 768 | Ga0501072_0959813 | 3300049588 | Bacteria | 667 |
| 769 | Ga0501073_0281194 | 3300049589 | Bacteria | 1148 |
| 770 | Ga0501074_0000764 | 3300049590 | Bacteria | 20238 |
| 771 | Ga0501076_0069885 | 3300049592 | Bacteria | 2807 |
| 772 | Ga0501076_0862915 | 3300049592 | Bacteria | 746 |
| 773 | Ga0501076_1523838 | 3300049592 | Bacteria | 549 |
| 774 | Ga0501209_243249 | 3300049656 | Bacteria | 561 |
| 775 | Ga0501236_059410 | 3300049670 | Bacteria | 675 |
| 776 | Ga0501253_141660 | 3300049683 | Bacteria | 599 |
| 777 | Ga0501225_0302629 | 3300049705 | Bacteria | 541 |
| 778 | Ga0501079_1088669 | 3300049741 | Bacteria | 630 |
| 779 | Ga0501083_0330400 | 3300049744 | Bacteria | 991 |
| 780 | Ga0501268_136695 | 3300049765 | Bacteria | 556 |
| 781 | Ga0501035_0936759 | 3300049822 | Bacteria | 684 |
| 782 | Ga0501044_1290302 | 3300049823 | Bacteria | 597 |
| 783 | Ga0501226_036533 | 3300049853 | Bacteria | 564 |
| 784 | nmdc:mga0yw44_608903_c1 | 3300050492 | Bacteria | 742 |
| 785 | nmdc:mga06z11_990782_c1 | 3300050494 | Bacteria | 512 |
| 786 | nmdc:mga05p37_1955592_c1 | 3300050507 | Bacteria | 557 |
| 787 | nmdc:mga05p37_7541_c1 | 3300050507 | Bacteria | 12828 |
| 788 | nmdc:mga09592_30088_c1 | 3300050508 | Bacteria | 4518 |
| 789 | nmdc:mga09592_715329_c1 | 3300050508 | Bacteria | 852 |
| 790 | nmdc:mga0qj67_11501_c1 | 3300050509 | Bacteria | 6633 |
| 791 | nmdc:mga0qj67_1178103_c1 | 3300050509 | Bacteria | 597 |
| 792 | nmdc:mga0qj67_1275563_c1 | 3300050509 | Bacteria | 570 |
| 793 | nmdc:mga0qj67_18978_c1 | 3300050509 | Bacteria | 5247 |
| 794 | nmdc:mga0qj67_71290_c1 | 3300050509 | Bacteria | 2773 |
| 795 | nmdc:mga06r32_64343_c1 | 3300050510 | Bacteria | 3537 |
| 796 | nmdc:mga06r32_7136_c1 | 3300050510 | Bacteria | 10066 |
| 797 | nmdc:mga08y16_120245_c1 | 3300050511 | Bacteria | 2734 |
| 798 | nmdc:mga08y16_131524_c1 | 3300050511 | Bacteria | 2602 |
| 799 | nmdc:mga08y16_1555988_c1 | 3300050511 | Unclassified | 620 |
| 800 | nmdc:mga08y16_1648517_c1 | 3300050511 | Bacteria | 598 |
| 801 | nmdc:mga08y16_332_c1 | 3300050511 | Bacteria | 42807 |
| 802 | nmdc:mga08y16_35999_c1 | 3300050511 | Bacteria | 5198 |
| 803 | nmdc:mga08y16_443658_c1 | 3300050511 | Bacteria | 1324 |
| 804 | nmdc:mga08y16_447499_c1 | 3300050511 | Bacteria | 1318 |
| 805 | nmdc:mga0n895_1142101_c1 | 3300050512 | Bacteria | 755 |
| 806 | nmdc:mga0n895_19387_c1 | 3300050512 | Bacteria | 6322 |
| 807 | nmdc:mga0n895_268321_c1 | 3300050512 | Bacteria | 1731 |
| 808 | nmdc:mga0rr50_161783_c1 | 3300050513 | Bacteria | 1817 |
| 809 | nmdc:mga0rr50_405887_c1 | 3300050513 | Bacteria | 1151 |
| 810 | nmdc:mga08x19_69645_c1 | 3300050514 | Bacteria | 2291 |
| 811 | nmdc:mga0a205_28248_c1 | 3300050515 | Bacteria | 5363 |
| 812 | Ga0495601_0761715 | 3300053077 | Bacteria | 616 |
| 813 | Ga0495612_0109287 | 3300053078 | Bacteria | 1182 |
| 814 | Ga0495612_0143364 | 3300053078 | Bacteria | 1037 |
| 815 | Ga0495595_0504450 | 3300053084 | Bacteria | 617 |
| 816 | Ga0495619_0300455 | 3300053085 | Bacteria | 1112 |
| 817 | Ga0500643_226710 | 3300053087 | Bacteria | 502 |
| 818 | Ga0500644_0259261 | 3300053088 | Bacteria | 735 |
| 819 | Ga0500583_0187400 | 3300053092 | Bacteria | 1030 |
| 820 | Ga0500651_0751629 | 3300053093 | Bacteria | 518 |
| 821 | Ga0500650_0074968 | 3300053098 | Bacteria | 1582 |
| 822 | Ga0500594_0173353 | 3300053118 | Bacteria | 701 |
| 823 | Ga0500617_186493 | 3300053124 | Bacteria | 777 |
| 824 | Ga0500642_0071161 | 3300053130 | Bacteria | 1583 |
| 825 | Ga0500652_179799 | 3300053131 | Bacteria | 867 |
| 826 | Ga0500658_0022065 | 3300053134 | Bacteria | 2416 |
| 827 | Ga0500568_0035791 | 3300053139 | Bacteria | 2023 |
| 828 | Ga0500577_0408805 | 3300053142 | Bacteria | 594 |
| 829 | Ga0500588_0002971 | 3300053146 | Bacteria | 3529 |
| 830 | Ga0500604_0020082 | 3300053151 | Bacteria | 1877 |
| 831 | Ga0500616_0295885 | 3300053153 | Bacteria | 674 |
| 832 | Ga0500622_0000306 | 3300053156 | Bacteria | 50095 |
| 833 | Ga0500622_0000360 | 3300053156 | Bacteria | 44258 |
| 834 | Ga0500637_0545630 | 3300053178 | Unclassified | 563 |
| 835 | Ga0501084_1413990 | 3300054114 | Bacteria | 583 |
| 836 | Ga0501084_1740978 | 3300054114 | Bacteria | 521 |
| 837 | Ga0590071_038376 | 3300059421 | Bacteria | 1150 |
| 838 | Ga0590071_176899 | 3300059421 | Bacteria | 558 |
| 839 | Ga0587084_015642 | 3300059477 | Bacteria | 1074 |
| 840 | Ga0587066_082801 | 3300059490 | Bacteria | 698 |
| 841 | Ga0587077_019154 | 3300059493 | Bacteria | 1188 |
| 842 | Ga0587090_122076 | 3300059510 | Bacteria | 566 |
| 843 | Ga0587091_187714 | 3300059511 | Bacteria | 548 |
| 844 | Ga0587098_044564 | 3300059604 | Bacteria | 656 |
| 845 | Ga0587101_047005 | 3300059623 | Bacteria | 731 |
| 846 | Ga0587101_064635 | 3300059623 | Bacteria | 661 |
| 847 | Ga0587109_113435 | 3300059624 | Bacteria | 636 |
| 848 | Ga0587124_020546 | 3300059660 | Bacteria | 672 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2512564013 | 2512640941 | 60 |
| 2 | iso_pu_bacteria | 2857465823 | 2857466275 | 60 |
| 3 | iso_pu_bacteria | 2857591370 | 2857593648 | 60 |
| 4 | iso_pu_bacteria | 2915597211 | 2915600175 | 60 |
| 5 | iso_pu_bacteria | 2915606848 | 2915609758 | 60 |
| 6 | iso_pu_bacteria | 2929183550 | 2929185362 | 60 |
| 7 | 3300007265 | Ga0099794_10028606 | Ga0099794_100286064 | 61 |
| 8 | 3300009094 | Ga0111539_10082033 | Ga0111539_100820334 | 61 |
| 9 | 3300009094 | Ga0111539_13022686 | Ga0111539_130226861 | 61 |
| 10 | 3300010159 | Ga0099796_10385249 | Ga0099796_103852491 | 61 |
| 11 | 3300036712 | Ga0316584_0048003 | Ga0316584_0048003_771_959 | 61 |
| 12 | 3300046452 | Ga0495617_022717 | Ga0495617_022717_725_913 | 61 |
| 13 | 3300046526 | Ga0495666_0544735 | Ga0495666_0544735_309_497 | 61 |
| 14 | 3300046616 | Ga0495668_0326817 | Ga0495668_0326817_636_824 | 61 |
| 15 | 3300047469 | Ga0495673_0280740 | Ga0495673_0280740_50_238 | 61 |
| 16 | 3300048923 | Ga0496120_0510753 | Ga0496120_0510753_264_455 | 61 |
| 17 | 3300048925 | Ga0496122_0006191 | Ga0496122_0006191_12567_12758 | 61 |
| 18 | 3300048929 | Ga0496126_0395015 | Ga0496126_0395015_537_728 | 61 |
| 19 | 3300050511 | nmdc:mga08y16_35999_c1 | nmdc:mga08y16_35999_c1_2212_2400 | 61 |
| 20 | 3300050512 | nmdc:mga0n895_1142101_c1 | nmdc:mga0n895_1142101_c1_218_406 | 61 |
| 21 | 3300050513 | nmdc:mga0rr50_161783_c1 | nmdc:mga0rr50_161783_c1_454_642 | 61 |
| 22 | 3300053130 | Ga0500642_0071161 | Ga0500642_0071161_1104_1292 | 61 |
| 23 | 3300053131 | Ga0500652_179799 | Ga0500652_179799_375_563 | 61 |
| 24 | 3300005295 | Ga0065707_10008504 | Ga0065707_100085043 | 62 |
| 25 | 3300005345 | Ga0070692_10967101 | Ga0070692_109671012 | 62 |
| 26 | 3300005406 | Ga0070703_10047148 | Ga0070703_100471483 | 62 |
| 27 | 3300005406 | Ga0070703_10104043 | Ga0070703_101040432 | 62 |
| 28 | 3300005444 | Ga0070694_100137700 | Ga0070694_1001377003 | 62 |
| 29 | 3300005445 | Ga0070708_101603992 | Ga0070708_1016039921 | 62 |
| 30 | 3300005467 | Ga0070706_100162761 | Ga0070706_1001627612 | 62 |
| 31 | 3300005468 | Ga0070707_101437548 | Ga0070707_1014375482 | 62 |
| 32 | 3300005471 | Ga0070698_100024837 | Ga0070698_1000248373 | 62 |
| 33 | 3300005471 | Ga0070698_100272059 | Ga0070698_1002720592 | 62 |
| 34 | 3300005518 | Ga0070699_100000588 | Ga0070699_10000058841 | 62 |
| 35 | 3300005545 | Ga0070695_100192729 | Ga0070695_1001927293 | 62 |
| 36 | 3300005545 | Ga0070695_101614063 | Ga0070695_1016140631 | 62 |
| 37 | 3300005546 | Ga0070696_100008240 | Ga0070696_1000082405 | 62 |
| 38 | 3300005547 | Ga0070693_100433965 | Ga0070693_1004339651 | 62 |
| 39 | 3300005549 | Ga0070704_100012138 | Ga0070704_1000121384 | 62 |
| 40 | 3300005618 | Ga0068864_100856216 | Ga0068864_1008562162 | 62 |
| 41 | 3300006846 | Ga0075430_100780193 | Ga0075430_1007801932 | 62 |
| 42 | 3300006852 | Ga0075433_10112354 | Ga0075433_101123542 | 62 |
| 43 | 3300006871 | Ga0075434_100017206 | Ga0075434_1000172064 | 62 |
| 44 | 3300006880 | Ga0075429_100256397 | Ga0075429_1002563972 | 62 |
| 45 | 3300009147 | Ga0114129_11784086 | Ga0114129_117840862 | 62 |
| 46 | 3300025885 | Ga0207653_10024985 | Ga0207653_100249853 | 62 |
| 47 | 3300025910 | Ga0207684_10031695 | Ga0207684_100316953 | 62 |
| 48 | 3300025922 | Ga0207646_11226411 | Ga0207646_112264112 | 62 |
| 49 | 3300025942 | Ga0207689_10920223 | Ga0207689_109202232 | 62 |
| 50 | 3300026095 | Ga0207676_11441570 | Ga0207676_114415702 | 62 |
| 51 | 3300044673 | Ga0453683_0051102 | Ga0453683_0051102_312_503 | 62 |
| 52 | 3300050507 | nmdc:mga05p37_1955592_c1 | nmdc:mga05p37_1955592_c1_33_224 | 62 |
| 53 | 3300050508 | nmdc:mga09592_30088_c1 | nmdc:mga09592_30088_c1_2983_3174 | 62 |
| 54 | 3300050509 | nmdc:mga0qj67_18978_c1 | nmdc:mga0qj67_18978_c1_4661_4852 | 62 |
| 55 | 3300050512 | nmdc:mga0n895_19387_c1 | nmdc:mga0n895_19387_c1_3652_3843 | 62 |
| 56 | 3300050515 | nmdc:mga0a205_28248_c1 | nmdc:mga0a205_28248_c1_3942_4133 | 62 |
| 57 | 3300031691 | Ga0316579_10171415 | Ga0316579_101714152 | 63 |
| 58 | 3300031727 | Ga0316576_10178198 | Ga0316576_101781982 | 63 |
| 59 | 3300031728 | Ga0316578_10088829 | Ga0316578_100888293 | 63 |
| 60 | 3300031733 | Ga0316577_10014813 | Ga0316577_100148134 | 63 |
| 61 | 3300031733 | Ga0316577_10413893 | Ga0316577_104138932 | 63 |
| 62 | 3300032139 | Ga0316580_10108568 | Ga0316580_101085682 | 63 |
| 63 | 3300032168 | Ga0316593_10000793 | Ga0316593_100007934 | 63 |
| 64 | 3300032168 | Ga0316593_10011479 | Ga0316593_100114792 | 63 |
| 65 | 3300032168 | Ga0316593_10052064 | Ga0316593_100520643 | 63 |
| 66 | 3300033524 | Ga0316592_1017381 | Ga0316592_10173813 | 63 |
| 67 | 3300033524 | Ga0316592_1119679 | Ga0316592_11196791 | 63 |
| 68 | 3300033529 | Ga0316587_1084307 | Ga0316587_10843071 | 63 |
| 69 | 3300033529 | Ga0316587_1093949 | Ga0316587_10939492 | 63 |
| 70 | 3300033541 | Ga0316596_1015151 | Ga0316596_10151513 | 63 |
| 71 | 3300033541 | Ga0316596_1186083 | Ga0316596_11860832 | 63 |
| 72 | 3300035398 | Ga0316574_0525916 | Ga0316574_0525916_184_378 | 63 |
| 73 | 3300036647 | Ga0316582_0004388 | Ga0316582_0004388_2531_2725 | 63 |
| 74 | 3300036712 | Ga0316584_0057675 | Ga0316584_0057675_1657_1851 | 63 |
| 75 | 3300036712 | Ga0316584_0273821 | Ga0316584_0273821_754_948 | 63 |
| 76 | 3300037588 | Ga0316581_0001004 | Ga0316581_0001004_2821_3015 | 63 |
| 77 | 3300049592 | Ga0501076_0069885 | Ga0501076_0069885_424_618 | 63 |
| 78 | 2162886007 | SwRhRL2b_contig_1161348 | SwRhRL2b_0647.00006110 | 64 |
| 79 | 3300000546 | LJNas_1013031 | LJNas_10130312 | 64 |
| 80 | 3300001991 | JGI24743J22301_10141483 | JGI24743J22301_101414831 | 64 |
| 81 | 3300002074 | JGI24748J21848_1032926 | JGI24748J21848_10329262 | 64 |
| 82 | 3300003163 | Ga0006759J45824_1050395 | Ga0006759J45824_10503952 | 64 |
| 83 | 3300003322 | rootL2_10091007 | rootL2_100910073 | 64 |
| 84 | 3300004800 | Ga0058861_11497037 | Ga0058861_114970372 | 64 |
| 85 | 3300005276 | Ga0065717_1014737 | Ga0065717_10147371 | 64 |
| 86 | 3300005289 | Ga0065704_10000886 | Ga0065704_100008869 | 64 |
| 87 | 3300005289 | Ga0065704_10484093 | Ga0065704_104840931 | 64 |
| 88 | 3300005290 | Ga0065712_10068636 | Ga0065712_100686368 | 64 |
| 89 | 3300005293 | Ga0065715_10682560 | Ga0065715_106825602 | 64 |
| 90 | 3300005295 | Ga0065707_10082235 | Ga0065707_100822354 | 64 |
| 91 | 3300005295 | Ga0065707_10082999 | Ga0065707_1008299912 | 64 |
| 92 | 3300005328 | Ga0070676_10136153 | Ga0070676_101361533 | 64 |
| 93 | 3300005328 | Ga0070676_11097052 | Ga0070676_110970522 | 64 |
| 94 | 3300005329 | Ga0070683_100559146 | Ga0070683_1005591463 | 64 |
| 95 | 3300005330 | Ga0070690_100001299 | Ga0070690_1000012994 | 64 |
| 96 | 3300005330 | Ga0070690_100327377 | Ga0070690_1003273772 | 64 |
| 97 | 3300005331 | Ga0070670_100033908 | Ga0070670_1000339082 | 64 |
| 98 | 3300005331 | Ga0070670_100542502 | Ga0070670_1005425022 | 64 |
| 99 | 3300005331 | Ga0070670_100953885 | Ga0070670_1009538852 | 64 |
| 100 | 3300005333 | Ga0070677_10122871 | Ga0070677_101228712 | 64 |
| 101 | 3300005334 | Ga0068869_100206448 | Ga0068869_1002064483 | 64 |
| 102 | 3300005334 | Ga0068869_100402223 | Ga0068869_1004022233 | 64 |
| 103 | 3300005334 | Ga0068869_100661643 | Ga0068869_1006616431 | 64 |
| 104 | 3300005335 | Ga0070666_11458937 | Ga0070666_114589371 | 64 |
| 105 | 3300005336 | Ga0070680_100368323 | Ga0070680_1003683232 | 64 |
| 106 | 3300005337 | Ga0070682_100180880 | Ga0070682_1001808803 | 64 |
| 107 | 3300005337 | Ga0070682_100876720 | Ga0070682_1008767201 | 64 |
| 108 | 3300005337 | Ga0070682_101724068 | Ga0070682_1017240682 | 64 |
| 109 | 3300005338 | Ga0068868_100252023 | Ga0068868_1002520232 | 64 |
| 110 | 3300005339 | Ga0070660_100331794 | Ga0070660_1003317943 | 64 |
| 111 | 3300005340 | Ga0070689_100027582 | Ga0070689_1000275824 | 64 |
| 112 | 3300005340 | Ga0070689_101657738 | Ga0070689_1016577381 | 64 |
| 113 | 3300005341 | Ga0070691_10180959 | Ga0070691_101809591 | 64 |
| 114 | 3300005343 | Ga0070687_101364706 | Ga0070687_1013647062 | 64 |
| 115 | 3300005344 | Ga0070661_100086889 | Ga0070661_1000868893 | 64 |
| 116 | 3300005345 | Ga0070692_10143499 | Ga0070692_101434991 | 64 |
| 117 | 3300005347 | Ga0070668_100010219 | Ga0070668_1000102196 | 64 |
| 118 | 3300005347 | Ga0070668_100164431 | Ga0070668_1001644311 | 64 |
| 119 | 3300005353 | Ga0070669_100115369 | Ga0070669_1001153693 | 64 |
| 120 | 3300005353 | Ga0070669_100931022 | Ga0070669_1009310222 | 64 |
| 121 | 3300005353 | Ga0070669_101679014 | Ga0070669_1016790142 | 64 |
| 122 | 3300005354 | Ga0070675_100046169 | Ga0070675_1000461693 | 64 |
| 123 | 3300005354 | Ga0070675_101571674 | Ga0070675_1015716742 | 64 |
| 124 | 3300005355 | Ga0070671_100507933 | Ga0070671_1005079332 | 64 |
| 125 | 3300005356 | Ga0070674_100602230 | Ga0070674_1006022301 | 64 |
| 126 | 3300005364 | Ga0070673_100007087 | Ga0070673_1000070874 | 64 |
| 127 | 3300005364 | Ga0070673_100657062 | Ga0070673_1006570622 | 64 |
| 128 | 3300005365 | Ga0070688_100001611 | Ga0070688_1000016117 | 64 |
| 129 | 3300005365 | Ga0070688_100380569 | Ga0070688_1003805693 | 64 |
| 130 | 3300005366 | Ga0070659_100990445 | Ga0070659_1009904452 | 64 |
| 131 | 3300005367 | Ga0070667_100078669 | Ga0070667_1000786693 | 64 |
| 132 | 3300005435 | Ga0070714_100000908 | Ga0070714_10000090821 | 64 |
| 133 | 3300005438 | Ga0070701_10077327 | Ga0070701_100773272 | 64 |
| 134 | 3300005438 | Ga0070701_10117777 | Ga0070701_101177772 | 64 |
| 135 | 3300005438 | Ga0070701_10327901 | Ga0070701_103279011 | 64 |
| 136 | 3300005439 | Ga0070711_100049229 | Ga0070711_1000492292 | 64 |
| 137 | 3300005439 | Ga0070711_100118160 | Ga0070711_1001181602 | 64 |
| 138 | 3300005439 | Ga0070711_100461032 | Ga0070711_1004610321 | 64 |
| 139 | 3300005440 | Ga0070705_100025617 | Ga0070705_1000256174 | 64 |
| 140 | 3300005441 | Ga0070700_100035954 | Ga0070700_1000359543 | 64 |
| 141 | 3300005441 | Ga0070700_100213430 | Ga0070700_1002134301 | 64 |
| 142 | 3300005444 | Ga0070694_100096426 | Ga0070694_1000964264 | 64 |
| 143 | 3300005444 | Ga0070694_101389680 | Ga0070694_1013896802 | 64 |
| 144 | 3300005444 | Ga0070694_101680138 | Ga0070694_1016801381 | 64 |
| 145 | 3300005445 | Ga0070708_100081763 | Ga0070708_1000817632 | 64 |
| 146 | 3300005455 | Ga0070663_100010247 | Ga0070663_1000102472 | 64 |
| 147 | 3300005455 | Ga0070663_100300954 | Ga0070663_1003009543 | 64 |
| 148 | 3300005456 | Ga0070678_101095528 | Ga0070678_1010955282 | 64 |
| 149 | 3300005456 | Ga0070678_101633563 | Ga0070678_1016335631 | 64 |
| 150 | 3300005457 | Ga0070662_100018270 | Ga0070662_1000182706 | 64 |
| 151 | 3300005457 | Ga0070662_100381733 | Ga0070662_1003817333 | 64 |
| 152 | 3300005457 | Ga0070662_100496455 | Ga0070662_1004964552 | 64 |
| 153 | 3300005458 | Ga0070681_10368622 | Ga0070681_103686223 | 64 |
| 154 | 3300005459 | Ga0068867_100031965 | Ga0068867_1000319652 | 64 |
| 155 | 3300005459 | Ga0068867_100213365 | Ga0068867_1002133653 | 64 |
| 156 | 3300005466 | Ga0070685_10026085 | Ga0070685_100260853 | 64 |
| 157 | 3300005466 | Ga0070685_10122749 | Ga0070685_101227492 | 64 |
| 158 | 3300005467 | Ga0070706_100365613 | Ga0070706_1003656132 | 64 |
| 159 | 3300005467 | Ga0070706_100980465 | Ga0070706_1009804651 | 64 |
| 160 | 3300005467 | Ga0070706_101401128 | Ga0070706_1014011282 | 64 |
| 161 | 3300005468 | Ga0070707_100065637 | Ga0070707_1000656375 | 64 |
| 162 | 3300005471 | Ga0070698_101481873 | Ga0070698_1014818732 | 64 |
| 163 | 3300005471 | Ga0070698_101691699 | Ga0070698_1016916991 | 64 |
| 164 | 3300005535 | Ga0070684_100073804 | Ga0070684_1000738043 | 64 |
| 165 | 3300005539 | Ga0068853_100325046 | Ga0068853_1003250462 | 64 |
| 166 | 3300005543 | Ga0070672_100085735 | Ga0070672_1000857354 | 64 |
| 167 | 3300005543 | Ga0070672_100733730 | Ga0070672_1007337302 | 64 |
| 168 | 3300005543 | Ga0070672_101672652 | Ga0070672_1016726521 | 64 |
| 169 | 3300005544 | Ga0070686_100008391 | Ga0070686_1000083917 | 64 |
| 170 | 3300005546 | Ga0070696_100083454 | Ga0070696_1000834541 | 64 |
| 171 | 3300005546 | Ga0070696_100311031 | Ga0070696_1003110312 | 64 |
| 172 | 3300005547 | Ga0070693_100239448 | Ga0070693_1002394483 | 64 |
| 173 | 3300005548 | Ga0070665_100091783 | Ga0070665_1000917831 | 64 |
| 174 | 3300005548 | Ga0070665_100125824 | Ga0070665_1001258243 | 64 |
| 175 | 3300005549 | Ga0070704_100554309 | Ga0070704_1005543091 | 64 |
| 176 | 3300005564 | Ga0070664_100024248 | Ga0070664_1000242485 | 64 |
| 177 | 3300005578 | Ga0068854_101510688 | Ga0068854_1015106882 | 64 |
| 178 | 3300005615 | Ga0070702_100207188 | Ga0070702_1002071882 | 64 |
| 179 | 3300005615 | Ga0070702_100923388 | Ga0070702_1009233882 | 64 |
| 180 | 3300005615 | Ga0070702_101806712 | Ga0070702_1018067122 | 64 |
| 181 | 3300005616 | Ga0068852_100531697 | Ga0068852_1005316972 | 64 |
| 182 | 3300005616 | Ga0068852_101199238 | Ga0068852_1011992381 | 64 |
| 183 | 3300005616 | Ga0068852_101713464 | Ga0068852_1017134642 | 64 |
| 184 | 3300005617 | Ga0068859_100019428 | Ga0068859_1000194287 | 64 |
| 185 | 3300005617 | Ga0068859_100569848 | Ga0068859_1005698483 | 64 |
| 186 | 3300005617 | Ga0068859_101164247 | Ga0068859_1011642473 | 64 |
| 187 | 3300005617 | Ga0068859_101331176 | Ga0068859_1013311763 | 64 |
| 188 | 3300005618 | Ga0068864_100006308 | Ga0068864_1000063083 | 64 |
| 189 | 3300005718 | Ga0068866_10096977 | Ga0068866_100969773 | 64 |
| 190 | 3300005719 | Ga0068861_100002820 | Ga0068861_1000028205 | 64 |
| 191 | 3300005719 | Ga0068861_100009515 | Ga0068861_1000095153 | 64 |
| 192 | 3300005719 | Ga0068861_100012749 | Ga0068861_1000127493 | 64 |
| 193 | 3300005719 | Ga0068861_100887284 | Ga0068861_1008872842 | 64 |
| 194 | 3300005719 | Ga0068861_100906035 | Ga0068861_1009060352 | 64 |
| 195 | 3300005719 | Ga0068861_101229208 | Ga0068861_1012292081 | 64 |
| 196 | 3300005719 | Ga0068861_102116737 | Ga0068861_1021167373 | 64 |
| 197 | 3300005719 | Ga0068861_102499249 | Ga0068861_1024992491 | 64 |
| 198 | 3300005840 | Ga0068870_10031824 | Ga0068870_100318243 | 64 |
| 199 | 3300005840 | Ga0068870_10365646 | Ga0068870_103656463 | 64 |
| 200 | 3300005841 | Ga0068863_100008283 | Ga0068863_1000082832 | 64 |
| 201 | 3300005842 | Ga0068858_100169228 | Ga0068858_1001692283 | 64 |
| 202 | 3300005842 | Ga0068858_100311631 | Ga0068858_1003116312 | 64 |
| 203 | 3300005843 | Ga0068860_101064807 | Ga0068860_1010648072 | 64 |
| 204 | 3300005844 | Ga0068862_100046867 | Ga0068862_1000468672 | 64 |
| 205 | 3300005844 | Ga0068862_100412668 | Ga0068862_1004126683 | 64 |
| 206 | 3300005844 | Ga0068862_102295416 | Ga0068862_1022954161 | 64 |
| 207 | 3300005937 | Ga0081455_10119154 | Ga0081455_101191542 | 64 |
| 208 | 3300005981 | Ga0081538_10095457 | Ga0081538_100954572 | 64 |
| 209 | 3300005983 | Ga0081540_1045744 | Ga0081540_10457444 | 64 |
| 210 | 3300006173 | Ga0070716_100149313 | Ga0070716_1001493132 | 64 |
| 211 | 3300006175 | Ga0070712_100443179 | Ga0070712_1004431793 | 64 |
| 212 | 3300006178 | Ga0075367_10606062 | Ga0075367_106060621 | 64 |
| 213 | 3300006194 | Ga0075427_10021717 | Ga0075427_100217171 | 64 |
| 214 | 3300006195 | Ga0075366_10867641 | Ga0075366_108676411 | 64 |
| 215 | 3300006195 | Ga0075366_10933558 | Ga0075366_109335582 | 64 |
| 216 | 3300006237 | Ga0097621_100031265 | Ga0097621_1000312654 | 64 |
| 217 | 3300006237 | Ga0097621_100035941 | Ga0097621_1000359413 | 64 |
| 218 | 3300006237 | Ga0097621_100341495 | Ga0097621_1003414952 | 64 |
| 219 | 3300006358 | Ga0068871_100043621 | Ga0068871_1000436212 | 64 |
| 220 | 3300006844 | Ga0075428_100016674 | Ga0075428_1000166744 | 64 |
| 221 | 3300006844 | Ga0075428_100364315 | Ga0075428_1003643152 | 64 |
| 222 | 3300006844 | Ga0075428_100624900 | Ga0075428_1006249002 | 64 |
| 223 | 3300006846 | Ga0075430_100141774 | Ga0075430_1001417743 | 64 |
| 224 | 3300006846 | Ga0075430_100421302 | Ga0075430_1004213022 | 64 |
| 225 | 3300006847 | Ga0075431_100006643 | Ga0075431_1000066439 | 64 |
| 226 | 3300006847 | Ga0075431_100283791 | Ga0075431_1002837913 | 64 |
| 227 | 3300006847 | Ga0075431_101635267 | Ga0075431_1016352672 | 64 |
| 228 | 3300006852 | Ga0075433_10448430 | Ga0075433_104484303 | 64 |
| 229 | 3300006852 | Ga0075433_11756764 | Ga0075433_117567642 | 64 |
| 230 | 3300006871 | Ga0075434_100567045 | Ga0075434_1005670451 | 64 |
| 231 | 3300006871 | Ga0075434_102274192 | Ga0075434_1022741922 | 64 |
| 232 | 3300006880 | Ga0075429_100036699 | Ga0075429_1000366991 | 64 |
| 233 | 3300006880 | Ga0075429_101459212 | Ga0075429_1014592122 | 64 |
| 234 | 3300006881 | Ga0068865_100133709 | Ga0068865_1001337092 | 64 |
| 235 | 3300006881 | Ga0068865_100476494 | Ga0068865_1004764942 | 64 |
| 236 | 3300006881 | Ga0068865_100881016 | Ga0068865_1008810162 | 64 |
| 237 | 3300006914 | Ga0075436_100304509 | Ga0075436_1003045092 | 64 |
| 238 | 3300006914 | Ga0075436_100765378 | Ga0075436_1007653782 | 64 |
| 239 | 3300006931 | Ga0097620_100019430 | Ga0097620_1000194307 | 64 |
| 240 | 3300006931 | Ga0097620_101164279 | Ga0097620_1011642793 | 64 |
| 241 | 3300006931 | Ga0097620_101331124 | Ga0097620_1013311243 | 64 |
| 242 | 3300006948 | Ga0099826_10086223 | Ga0099826_100862233 | 64 |
| 243 | 3300007076 | Ga0075435_100187890 | Ga0075435_1001878903 | 64 |
| 244 | 3300007076 | Ga0075435_100605723 | Ga0075435_1006057232 | 64 |
| 245 | 3300007788 | Ga0099795_10000903 | Ga0099795_100009039 | 64 |
| 246 | 3300007788 | Ga0099795_10012130 | Ga0099795_100121302 | 64 |
| 247 | 3300007788 | Ga0099795_10037778 | Ga0099795_100377782 | 64 |
| 248 | 3300009036 | Ga0105244_10503751 | Ga0105244_105037511 | 64 |
| 249 | 3300009092 | Ga0105250_10000006 | Ga0105250_10000006227 | 64 |
| 250 | 3300009092 | Ga0105250_10124972 | Ga0105250_101249721 | 64 |
| 251 | 3300009093 | Ga0105240_10327897 | Ga0105240_103278973 | 64 |
| 252 | 3300009093 | Ga0105240_11968419 | Ga0105240_119684191 | 64 |
| 253 | 3300009094 | Ga0111539_10350561 | Ga0111539_103505614 | 64 |
| 254 | 3300009094 | Ga0111539_10412106 | Ga0111539_104121062 | 64 |
| 255 | 3300009094 | Ga0111539_10484305 | Ga0111539_104843052 | 64 |
| 256 | 3300009094 | Ga0111539_11148744 | Ga0111539_111487442 | 64 |
| 257 | 3300009094 | Ga0111539_12714975 | Ga0111539_127149752 | 64 |
| 258 | 3300009098 | Ga0105245_10224021 | Ga0105245_102240213 | 64 |
| 259 | 3300009101 | Ga0105247_10021258 | Ga0105247_100212585 | 64 |
| 260 | 3300009101 | Ga0105247_10051475 | Ga0105247_100514753 | 64 |
| 261 | 3300009147 | Ga0114129_10092570 | Ga0114129_100925703 | 64 |
| 262 | 3300009147 | Ga0114129_13097839 | Ga0114129_130978392 | 64 |
| 263 | 3300009148 | Ga0105243_10091814 | Ga0105243_100918143 | 64 |
| 264 | 3300009148 | Ga0105243_11094481 | Ga0105243_110944812 | 64 |
| 265 | 3300009148 | Ga0105243_11175929 | Ga0105243_111759292 | 64 |
| 266 | 3300009174 | Ga0105241_10248194 | Ga0105241_102481942 | 64 |
| 267 | 3300009176 | Ga0105242_10085791 | Ga0105242_100857913 | 64 |
| 268 | 3300009176 | Ga0105242_11770049 | Ga0105242_117700491 | 64 |
| 269 | 3300009177 | Ga0105248_10003777 | Ga0105248_100037778 | 64 |
| 270 | 3300009177 | Ga0105248_12746339 | Ga0105248_127463392 | 64 |
| 271 | 3300009545 | Ga0105237_10838535 | Ga0105237_108385351 | 64 |
| 272 | 3300009551 | Ga0105238_10261134 | Ga0105238_102611343 | 64 |
| 273 | 3300009553 | Ga0105249_10014854 | Ga0105249_100148546 | 64 |
| 274 | 3300009553 | Ga0105249_10319390 | Ga0105249_103193903 | 64 |
| 275 | 3300009553 | Ga0105249_10980898 | Ga0105249_109808981 | 64 |
| 276 | 3300009553 | Ga0105249_11173811 | Ga0105249_111738112 | 64 |
| 277 | 3300010159 | Ga0099796_10007558 | Ga0099796_100075582 | 64 |
| 278 | 3300010375 | Ga0105239_11278207 | Ga0105239_112782072 | 64 |
| 279 | 3300011119 | Ga0105246_11163208 | Ga0105246_111632081 | 64 |
| 280 | 3300011119 | Ga0105246_11628576 | Ga0105246_116285762 | 64 |
| 281 | 3300012494 | Ga0157341_1010192 | Ga0157341_10101922 | 64 |
| 282 | 3300012505 | Ga0157339_1007580 | Ga0157339_10075802 | 64 |
| 283 | 3300013100 | Ga0157373_11200257 | Ga0157373_112002571 | 64 |
| 284 | 3300013104 | Ga0157370_10612654 | Ga0157370_106126542 | 64 |
| 285 | 3300013104 | Ga0157370_10796679 | Ga0157370_107966792 | 64 |
| 286 | 3300013296 | Ga0157374_10615275 | Ga0157374_106152751 | 64 |
| 287 | 3300013296 | Ga0157374_11195551 | Ga0157374_111955512 | 64 |
| 288 | 3300013297 | Ga0157378_10900088 | Ga0157378_109000881 | 64 |
| 289 | 3300013306 | Ga0163162_10352023 | Ga0163162_103520233 | 64 |
| 290 | 3300013306 | Ga0163162_11436937 | Ga0163162_114369372 | 64 |
| 291 | 3300013306 | Ga0163162_11446080 | Ga0163162_114460802 | 64 |
| 292 | 3300013306 | Ga0163162_11954469 | Ga0163162_119544691 | 64 |
| 293 | 3300013308 | Ga0157375_10302115 | Ga0157375_103021152 | 64 |
| 294 | 3300013308 | Ga0157375_10306320 | Ga0157375_103063203 | 64 |
| 295 | 3300014325 | Ga0163163_10033935 | Ga0163163_100339354 | 64 |
| 296 | 3300014325 | Ga0163163_10071291 | Ga0163163_100712913 | 64 |
| 297 | 3300014325 | Ga0163163_12825685 | Ga0163163_128256852 | 64 |
| 298 | 3300014326 | Ga0157380_10000591 | Ga0157380_100005915 | 64 |
| 299 | 3300014326 | Ga0157380_10473493 | Ga0157380_104734933 | 64 |
| 300 | 3300014326 | Ga0157380_10864419 | Ga0157380_108644192 | 64 |
| 301 | 3300014326 | Ga0157380_11594196 | Ga0157380_115941961 | 64 |
| 302 | 3300014326 | Ga0157380_12172962 | Ga0157380_121729622 | 64 |
| 303 | 3300014326 | Ga0157380_13068487 | Ga0157380_130684872 | 64 |
| 304 | 3300014326 | Ga0157380_13164881 | Ga0157380_131648811 | 64 |
| 305 | 3300014326 | Ga0157380_13269189 | Ga0157380_132691891 | 64 |
| 306 | 3300014745 | Ga0157377_10382420 | Ga0157377_103824202 | 64 |
| 307 | 3300014745 | Ga0157377_10853619 | Ga0157377_108536192 | 64 |
| 308 | 3300014968 | Ga0157379_10005406 | Ga0157379_100054063 | 64 |
| 309 | 3300014968 | Ga0157379_10183299 | Ga0157379_101832992 | 64 |
| 310 | 3300014968 | Ga0157379_11461637 | Ga0157379_114616371 | 64 |
| 311 | 3300014969 | Ga0157376_10263095 | Ga0157376_102630953 | 64 |
| 312 | 3300014969 | Ga0157376_10433111 | Ga0157376_104331111 | 64 |
| 313 | 3300015262 | Ga0182007_10083740 | Ga0182007_100837402 | 64 |
| 314 | 3300017792 | Ga0163161_10076747 | Ga0163161_100767472 | 64 |
| 315 | 3300017792 | Ga0163161_11514113 | Ga0163161_115141132 | 64 |
| 316 | 3300017792 | Ga0163161_11800459 | Ga0163161_118004592 | 64 |
| 317 | 3300019181 | Ga0184594_106948 | Ga0184594_1069482 | 64 |
| 318 | 3300020078 | Ga0206352_10818112 | Ga0206352_108181122 | 64 |
| 319 | 3300022730 | Ga0224570_102507 | Ga0224570_1025072 | 64 |
| 320 | 3300024225 | Ga0224572_1026876 | Ga0224572_10268762 | 64 |
| 321 | 3300025711 | Ga0207696_1000069 | Ga0207696_1000069229 | 64 |
| 322 | 3300025885 | Ga0207653_10030978 | Ga0207653_100309784 | 64 |
| 323 | 3300025893 | Ga0207682_10032587 | Ga0207682_100325873 | 64 |
| 324 | 3300025899 | Ga0207642_10048052 | Ga0207642_100480521 | 64 |
| 325 | 3300025900 | Ga0207710_10042513 | Ga0207710_100425133 | 64 |
| 326 | 3300025900 | Ga0207710_10042526 | Ga0207710_100425263 | 64 |
| 327 | 3300025901 | Ga0207688_10213444 | Ga0207688_102134443 | 64 |
| 328 | 3300025901 | Ga0207688_10563419 | Ga0207688_105634192 | 64 |
| 329 | 3300025901 | Ga0207688_10860820 | Ga0207688_108608202 | 64 |
| 330 | 3300025903 | Ga0207680_10099696 | Ga0207680_100996964 | 64 |
| 331 | 3300025907 | Ga0207645_10100614 | Ga0207645_101006143 | 64 |
| 332 | 3300025908 | Ga0207643_10011473 | Ga0207643_100114733 | 64 |
| 333 | 3300025909 | Ga0207705_10968442 | Ga0207705_109684422 | 64 |
| 334 | 3300025910 | Ga0207684_10852587 | Ga0207684_108525872 | 64 |
| 335 | 3300025913 | Ga0207695_10090093 | Ga0207695_100900932 | 64 |
| 336 | 3300025916 | Ga0207663_10012103 | Ga0207663_100121033 | 64 |
| 337 | 3300025916 | Ga0207663_10016647 | Ga0207663_100166473 | 64 |
| 338 | 3300025917 | Ga0207660_10416368 | Ga0207660_104163682 | 64 |
| 339 | 3300025917 | Ga0207660_11243694 | Ga0207660_112436942 | 64 |
| 340 | 3300025919 | Ga0207657_10226209 | Ga0207657_102262093 | 64 |
| 341 | 3300025921 | Ga0207652_10272702 | Ga0207652_102727022 | 64 |
| 342 | 3300025921 | Ga0207652_10937564 | Ga0207652_109375642 | 64 |
| 343 | 3300025922 | Ga0207646_10122711 | Ga0207646_101227115 | 64 |
| 344 | 3300025923 | Ga0207681_10350050 | Ga0207681_103500503 | 64 |
| 345 | 3300025923 | Ga0207681_11097059 | Ga0207681_110970592 | 64 |
| 346 | 3300025923 | Ga0207681_11106469 | Ga0207681_111064692 | 64 |
| 347 | 3300025923 | Ga0207681_11119731 | Ga0207681_111197312 | 64 |
| 348 | 3300025924 | Ga0207694_10675376 | Ga0207694_106753762 | 64 |
| 349 | 3300025925 | Ga0207650_10026889 | Ga0207650_100268893 | 64 |
| 350 | 3300025926 | Ga0207659_10005865 | Ga0207659_100058653 | 64 |
| 351 | 3300025926 | Ga0207659_11567761 | Ga0207659_115677612 | 64 |
| 352 | 3300025931 | Ga0207644_10154157 | Ga0207644_101541573 | 64 |
| 353 | 3300025932 | Ga0207690_10576321 | Ga0207690_105763212 | 64 |
| 354 | 3300025932 | Ga0207690_10677806 | Ga0207690_106778062 | 64 |
| 355 | 3300025933 | Ga0207706_10030881 | Ga0207706_100308813 | 64 |
| 356 | 3300025933 | Ga0207706_10361998 | Ga0207706_103619983 | 64 |
| 357 | 3300025934 | Ga0207686_10364332 | Ga0207686_103643322 | 64 |
| 358 | 3300025935 | Ga0207709_10028739 | Ga0207709_100287392 | 64 |
| 359 | 3300025935 | Ga0207709_10701660 | Ga0207709_107016602 | 64 |
| 360 | 3300025936 | Ga0207670_10005712 | Ga0207670_100057123 | 64 |
| 361 | 3300025936 | Ga0207670_10791987 | Ga0207670_107919872 | 64 |
| 362 | 3300025937 | Ga0207669_10418936 | Ga0207669_104189361 | 64 |
| 363 | 3300025938 | Ga0207704_10973575 | Ga0207704_109735752 | 64 |
| 364 | 3300025940 | Ga0207691_10021978 | Ga0207691_100219783 | 64 |
| 365 | 3300025940 | Ga0207691_10779170 | Ga0207691_107791702 | 64 |
| 366 | 3300025941 | Ga0207711_10011736 | Ga0207711_100117365 | 64 |
| 367 | 3300025942 | Ga0207689_10884639 | Ga0207689_108846392 | 64 |
| 368 | 3300025944 | Ga0207661_10558635 | Ga0207661_105586353 | 64 |
| 369 | 3300025945 | Ga0207679_10003903 | Ga0207679_100039034 | 64 |
| 370 | 3300025949 | Ga0207667_10787258 | Ga0207667_107872582 | 64 |
| 371 | 3300025960 | Ga0207651_10056556 | Ga0207651_100565563 | 64 |
| 372 | 3300025961 | Ga0207712_10031923 | Ga0207712_100319233 | 64 |
| 373 | 3300025961 | Ga0207712_10205623 | Ga0207712_102056233 | 64 |
| 374 | 3300025961 | Ga0207712_10589783 | Ga0207712_105897832 | 64 |
| 375 | 3300025972 | Ga0207668_10278673 | Ga0207668_102786731 | 64 |
| 376 | 3300025972 | Ga0207668_10358382 | Ga0207668_103583823 | 64 |
| 377 | 3300025972 | Ga0207668_10728311 | Ga0207668_107283112 | 64 |
| 378 | 3300025981 | Ga0207640_11227261 | Ga0207640_112272612 | 64 |
| 379 | 3300025981 | Ga0207640_11747988 | Ga0207640_117479882 | 64 |
| 380 | 3300026023 | Ga0207677_10972160 | Ga0207677_109721602 | 64 |
| 381 | 3300026035 | Ga0207703_10039202 | Ga0207703_100392023 | 64 |
| 382 | 3300026035 | Ga0207703_11159653 | Ga0207703_111596532 | 64 |
| 383 | 3300026041 | Ga0207639_10317723 | Ga0207639_103177231 | 64 |
| 384 | 3300026067 | Ga0207678_10021083 | Ga0207678_100210832 | 64 |
| 385 | 3300026067 | Ga0207678_10219863 | Ga0207678_102198632 | 64 |
| 386 | 3300026075 | Ga0207708_10203672 | Ga0207708_102036722 | 64 |
| 387 | 3300026075 | Ga0207708_10314330 | Ga0207708_103143303 | 64 |
| 388 | 3300026075 | Ga0207708_11178939 | Ga0207708_111789392 | 64 |
| 389 | 3300026075 | Ga0207708_11262393 | Ga0207708_112623931 | 64 |
| 390 | 3300026088 | Ga0207641_10005068 | Ga0207641_100050684 | 64 |
| 391 | 3300026089 | Ga0207648_10004948 | Ga0207648_100049483 | 64 |
| 392 | 3300026089 | Ga0207648_10226426 | Ga0207648_102264262 | 64 |
| 393 | 3300026095 | Ga0207676_10001855 | Ga0207676_1000185511 | 64 |
| 394 | 3300026116 | Ga0207674_10298152 | Ga0207674_102981523 | 64 |
| 395 | 3300026118 | Ga0207675_100000293 | Ga0207675_10000029335 | 64 |
| 396 | 3300026118 | Ga0207675_100005931 | Ga0207675_1000059316 | 64 |
| 397 | 3300026118 | Ga0207675_100426350 | Ga0207675_1004263503 | 64 |
| 398 | 3300026118 | Ga0207675_101006798 | Ga0207675_1010067982 | 64 |
| 399 | 3300026118 | Ga0207675_101296640 | Ga0207675_1012966402 | 64 |
| 400 | 3300026121 | Ga0207683_10200966 | Ga0207683_102009662 | 64 |
| 401 | 3300026121 | Ga0207683_10643394 | Ga0207683_106433942 | 64 |
| 402 | 3300026121 | Ga0207683_12150018 | Ga0207683_121500182 | 64 |
| 403 | 3300026142 | Ga0207698_10895017 | Ga0207698_108950172 | 64 |
| 404 | 3300026142 | Ga0207698_10943478 | Ga0207698_109434782 | 64 |
| 405 | 3300027671 | Ga0209588_1060289 | Ga0209588_10602892 | 64 |
| 406 | 3300027682 | Ga0209971_1134864 | Ga0209971_11348642 | 64 |
| 407 | 3300027876 | Ga0209974_10187899 | Ga0209974_101878992 | 64 |
| 408 | 3300027876 | Ga0209974_10205304 | Ga0209974_102053042 | 64 |
| 409 | 3300027907 | Ga0207428_10037102 | Ga0207428_100371024 | 64 |
| 410 | 3300027907 | Ga0207428_10063831 | Ga0207428_100638312 | 64 |
| 411 | 3300027907 | Ga0207428_10102462 | Ga0207428_101024622 | 64 |
| 412 | 3300027907 | Ga0207428_10737374 | Ga0207428_107373742 | 64 |
| 413 | 3300028016 | Ga0265354_1001073 | Ga0265354_10010735 | 64 |
| 414 | 3300028017 | Ga0265356_1001665 | Ga0265356_10016653 | 64 |
| 415 | 3300028023 | Ga0265357_1019379 | Ga0265357_10193793 | 64 |
| 416 | 3300028379 | Ga0268266_10017545 | Ga0268266_100175453 | 64 |
| 417 | 3300028379 | Ga0268266_10063090 | Ga0268266_100630904 | 64 |
| 418 | 3300028380 | Ga0268265_10000379 | Ga0268265_1000037910 | 64 |
| 419 | 3300028380 | Ga0268265_10119374 | Ga0268265_101193742 | 64 |
| 420 | 3300028380 | Ga0268265_10135473 | Ga0268265_101354734 | 64 |
| 421 | 3300028381 | Ga0268264_10806996 | Ga0268264_108069962 | 64 |
| 422 | 3300028381 | Ga0268264_10890536 | Ga0268264_108905362 | 64 |
| 423 | 3300028381 | Ga0268264_10913789 | Ga0268264_109137892 | 64 |
| 424 | 3300028558 | Ga0265326_10148359 | Ga0265326_101483591 | 64 |
| 425 | 3300028573 | Ga0265334_10044628 | Ga0265334_100446282 | 64 |
| 426 | 3300028577 | Ga0265318_10194422 | Ga0265318_101944221 | 64 |
| 427 | 3300028800 | Ga0265338_10003875 | Ga0265338_1000387518 | 64 |
| 428 | 3300028800 | Ga0265338_10556018 | Ga0265338_105560182 | 64 |
| 429 | 3300029272 | Ga0311000_100053 | Ga0311000_1000531 | 64 |
| 430 | 3300029282 | Ga0311003_158611 | Ga0311003_1586112 | 64 |
| 431 | 3300029285 | Ga0310981_1006486 | Ga0310981_10064862 | 64 |
| 432 | 3300029285 | Ga0310981_1032411 | Ga0310981_10324112 | 64 |
| 433 | 3300030733 | Ga0314311_1052161 | Ga0314311_10521612 | 64 |
| 434 | 3300030760 | Ga0265762_1074757 | Ga0265762_10747572 | 64 |
| 435 | 3300030760 | Ga0265762_1106305 | Ga0265762_11063051 | 64 |
| 436 | 3300030763 | Ga0265763_1002105 | Ga0265763_10021052 | 64 |
| 437 | 3300030763 | Ga0265763_1004155 | Ga0265763_10041553 | 64 |
| 438 | 3300030836 | Ga0265767_109884 | Ga0265767_1098842 | 64 |
| 439 | 3300030863 | Ga0265766_1006027 | Ga0265766_10060272 | 64 |
| 440 | 3300030863 | Ga0265766_1007397 | Ga0265766_10073972 | 64 |
| 441 | 3300030878 | Ga0265770_1000649 | Ga0265770_10006496 | 64 |
| 442 | 3300030882 | Ga0265764_101027 | Ga0265764_1010273 | 64 |
| 443 | 3300030882 | Ga0265764_113456 | Ga0265764_1134562 | 64 |
| 444 | 3300030886 | Ga0265772_100491 | Ga0265772_1004913 | 64 |
| 445 | 3300030888 | Ga0265769_106574 | Ga0265769_1065742 | 64 |
| 446 | 3300030889 | Ga0265761_101200 | Ga0265761_1012003 | 64 |
| 447 | 3300030963 | Ga0265768_100407 | Ga0265768_1004073 | 64 |
| 448 | 3300030963 | Ga0265768_113614 | Ga0265768_1136142 | 64 |
| 449 | 3300031010 | Ga0265771_1001532 | Ga0265771_10015323 | 64 |
| 450 | 3300031090 | Ga0265760_10001515 | Ga0265760_100015159 | 64 |
| 451 | 3300031235 | Ga0265330_10505823 | Ga0265330_105058231 | 64 |
| 452 | 3300031239 | Ga0265328_10169427 | Ga0265328_101694271 | 64 |
| 453 | 3300031240 | Ga0265320_10202542 | Ga0265320_102025422 | 64 |
| 454 | 3300031241 | Ga0265325_10012046 | Ga0265325_100120465 | 64 |
| 455 | 3300031242 | Ga0265329_10256559 | Ga0265329_102565592 | 64 |
| 456 | 3300031247 | Ga0265340_10225228 | Ga0265340_102252283 | 64 |
| 457 | 3300031247 | Ga0265340_10482640 | Ga0265340_104826402 | 64 |
| 458 | 3300031249 | Ga0265339_10179012 | Ga0265339_101790121 | 64 |
| 459 | 3300031251 | Ga0265327_10030925 | Ga0265327_100309253 | 64 |
| 460 | 3300031344 | Ga0265316_10118034 | Ga0265316_101180343 | 64 |
| 461 | 3300031344 | Ga0265316_10462496 | Ga0265316_104624962 | 64 |
| 462 | 3300031548 | Ga0307408_100079115 | Ga0307408_1000791154 | 64 |
| 463 | 3300031548 | Ga0307408_100770166 | Ga0307408_1007701662 | 64 |
| 464 | 3300031548 | Ga0307408_101151664 | Ga0307408_1011516642 | 64 |
| 465 | 3300031595 | Ga0265313_10020146 | Ga0265313_100201462 | 64 |
| 466 | 3300031616 | Ga0307508_10223421 | Ga0307508_102234213 | 64 |
| 467 | 3300031665 | Ga0316575_10085728 | Ga0316575_100857282 | 64 |
| 468 | 3300031665 | Ga0316575_10208181 | Ga0316575_102081812 | 64 |
| 469 | 3300031691 | Ga0316579_10461739 | Ga0316579_104617392 | 64 |
| 470 | 3300031691 | Ga0316579_10666670 | Ga0316579_106666701 | 64 |
| 471 | 3300031727 | Ga0316576_10048510 | Ga0316576_100485103 | 64 |
| 472 | 3300031727 | Ga0316576_10071550 | Ga0316576_100715503 | 64 |
| 473 | 3300031727 | Ga0316576_10407641 | Ga0316576_104076412 | 64 |
| 474 | 3300031727 | Ga0316576_10758747 | Ga0316576_107587471 | 64 |
| 475 | 3300031728 | Ga0316578_10421713 | Ga0316578_104217131 | 64 |
| 476 | 3300031728 | Ga0316578_10448242 | Ga0316578_104482422 | 64 |
| 477 | 3300031728 | Ga0316578_10659171 | Ga0316578_106591712 | 64 |
| 478 | 3300031730 | Ga0307516_10000288 | Ga0307516_1000028821 | 64 |
| 479 | 3300031731 | Ga0307405_10300360 | Ga0307405_103003601 | 64 |
| 480 | 3300031731 | Ga0307405_11372091 | Ga0307405_113720911 | 64 |
| 481 | 3300031824 | Ga0307413_10545857 | Ga0307413_105458572 | 64 |
| 482 | 3300031824 | Ga0307413_10777758 | Ga0307413_107777582 | 64 |
| 483 | 3300031824 | Ga0307413_10829611 | Ga0307413_108296111 | 64 |
| 484 | 3300031824 | Ga0307413_10925690 | Ga0307413_109256901 | 64 |
| 485 | 3300031824 | Ga0307413_11780479 | Ga0307413_117804792 | 64 |
| 486 | 3300031824 | Ga0307413_11788986 | Ga0307413_117889861 | 64 |
| 487 | 3300031852 | Ga0307410_10188512 | Ga0307410_101885122 | 64 |
| 488 | 3300031852 | Ga0307410_10598623 | Ga0307410_105986233 | 64 |
| 489 | 3300031852 | Ga0307410_10792063 | Ga0307410_107920632 | 64 |
| 490 | 3300031852 | Ga0307410_10916493 | Ga0307410_109164932 | 64 |
| 491 | 3300031852 | Ga0307410_11056549 | Ga0307410_110565492 | 64 |
| 492 | 3300031901 | Ga0307406_10000585 | Ga0307406_1000058514 | 64 |
| 493 | 3300031901 | Ga0307406_10227013 | Ga0307406_102270133 | 64 |
| 494 | 3300031901 | Ga0307406_10322986 | Ga0307406_103229862 | 64 |
| 495 | 3300031901 | Ga0307406_11388883 | Ga0307406_113888832 | 64 |
| 496 | 3300031903 | Ga0307407_10095855 | Ga0307407_100958553 | 64 |
| 497 | 3300031903 | Ga0307407_10502983 | Ga0307407_105029832 | 64 |
| 498 | 3300031903 | Ga0307407_11386985 | Ga0307407_113869852 | 64 |
| 499 | 3300031911 | Ga0307412_10077525 | Ga0307412_100775253 | 64 |
| 500 | 3300031911 | Ga0307412_10191175 | Ga0307412_101911753 | 64 |
| 501 | 3300031911 | Ga0307412_11002366 | Ga0307412_110023662 | 64 |
| 502 | 3300031995 | Ga0307409_100350694 | Ga0307409_1003506941 | 64 |
| 503 | 3300031995 | Ga0307409_100386222 | Ga0307409_1003862223 | 64 |
| 504 | 3300031995 | Ga0307409_100691984 | Ga0307409_1006919842 | 64 |
| 505 | 3300031995 | Ga0307409_100720885 | Ga0307409_1007208852 | 64 |
| 506 | 3300031995 | Ga0307409_102339594 | Ga0307409_1023395942 | 64 |
| 507 | 3300032002 | Ga0307416_100233918 | Ga0307416_1002339182 | 64 |
| 508 | 3300032002 | Ga0307416_100958782 | Ga0307416_1009587823 | 64 |
| 509 | 3300032002 | Ga0307416_101249653 | Ga0307416_1012496532 | 64 |
| 510 | 3300032002 | Ga0307416_102575408 | Ga0307416_1025754082 | 64 |
| 511 | 3300032004 | Ga0307414_10486183 | Ga0307414_104861831 | 64 |
| 512 | 3300032004 | Ga0307414_10507500 | Ga0307414_105075001 | 64 |
| 513 | 3300032004 | Ga0307414_11186277 | Ga0307414_111862772 | 64 |
| 514 | 3300032005 | Ga0307411_10083809 | Ga0307411_100838093 | 64 |
| 515 | 3300032005 | Ga0307411_10803468 | Ga0307411_108034682 | 64 |
| 516 | 3300032126 | Ga0307415_100052178 | Ga0307415_1000521784 | 64 |
| 517 | 3300032126 | Ga0307415_100329800 | Ga0307415_1003298003 | 64 |
| 518 | 3300032126 | Ga0307415_100512539 | Ga0307415_1005125391 | 64 |
| 519 | 3300032126 | Ga0307415_100815195 | Ga0307415_1008151952 | 64 |
| 520 | 3300032126 | Ga0307415_101744608 | Ga0307415_1017446081 | 64 |
| 521 | 3300032133 | Ga0316583_10035511 | Ga0316583_100355113 | 64 |
| 522 | 3300032133 | Ga0316583_10045147 | Ga0316583_100451473 | 64 |
| 523 | 3300032137 | Ga0316585_10069217 | Ga0316585_100692172 | 64 |
| 524 | 3300032168 | Ga0316593_10000361 | Ga0316593_100003614 | 64 |
| 525 | 3300032168 | Ga0316593_10000990 | Ga0316593_100009905 | 64 |
| 526 | 3300032168 | Ga0316593_10003664 | Ga0316593_100036644 | 64 |
| 527 | 3300032168 | Ga0316593_10007195 | Ga0316593_100071953 | 64 |
| 528 | 3300032168 | Ga0316593_10028914 | Ga0316593_100289143 | 64 |
| 529 | 3300032168 | Ga0316593_10048682 | Ga0316593_100486822 | 64 |
| 530 | 3300032168 | Ga0316593_10050066 | Ga0316593_100500663 | 64 |
| 531 | 3300032168 | Ga0316593_10054929 | Ga0316593_100549291 | 64 |
| 532 | 3300032168 | Ga0316593_10103988 | Ga0316593_101039882 | 64 |
| 533 | 3300032168 | Ga0316593_10108173 | Ga0316593_101081732 | 64 |
| 534 | 3300032168 | Ga0316593_10215658 | Ga0316593_102156582 | 64 |
| 535 | 3300032168 | Ga0316593_10219518 | Ga0316593_102195182 | 64 |
| 536 | 3300032168 | Ga0316593_10392002 | Ga0316593_103920021 | 64 |
| 537 | 3300033180 | Ga0307510_10153892 | Ga0307510_101538921 | 64 |
| 538 | 3300033524 | Ga0316592_1002827 | Ga0316592_10028273 | 64 |
| 539 | 3300033524 | Ga0316592_1003865 | Ga0316592_10038653 | 64 |
| 540 | 3300033524 | Ga0316592_1015277 | Ga0316592_10152772 | 64 |
| 541 | 3300033524 | Ga0316592_1018789 | Ga0316592_10187892 | 64 |
| 542 | 3300033524 | Ga0316592_1034129 | Ga0316592_10341292 | 64 |
| 543 | 3300033524 | Ga0316592_1108280 | Ga0316592_11082802 | 64 |
| 544 | 3300033524 | Ga0316592_1130631 | Ga0316592_11306312 | 64 |
| 545 | 3300033527 | Ga0316586_1003514 | Ga0316586_10035143 | 64 |
| 546 | 3300033527 | Ga0316586_1009966 | Ga0316586_10099662 | 64 |
| 547 | 3300033527 | Ga0316586_1018484 | Ga0316586_10184843 | 64 |
| 548 | 3300033527 | Ga0316586_1045064 | Ga0316586_10450642 | 64 |
| 549 | 3300033527 | Ga0316586_1048483 | Ga0316586_10484832 | 64 |
| 550 | 3300033528 | Ga0316588_1005180 | Ga0316588_10051802 | 64 |
| 551 | 3300033528 | Ga0316588_1009326 | Ga0316588_10093263 | 64 |
| 552 | 3300033528 | Ga0316588_1032648 | Ga0316588_10326482 | 64 |
| 553 | 3300033528 | Ga0316588_1138966 | Ga0316588_11389662 | 64 |
| 554 | 3300033528 | Ga0316588_1154891 | Ga0316588_11548912 | 64 |
| 555 | 3300033529 | Ga0316587_1001502 | Ga0316587_10015023 | 64 |
| 556 | 3300033529 | Ga0316587_1005823 | Ga0316587_10058232 | 64 |
| 557 | 3300033529 | Ga0316587_1005922 | Ga0316587_10059222 | 64 |
| 558 | 3300033529 | Ga0316587_1021404 | Ga0316587_10214043 | 64 |
| 559 | 3300033529 | Ga0316587_1030091 | Ga0316587_10300912 | 64 |
| 560 | 3300033529 | Ga0316587_1052389 | Ga0316587_10523892 | 64 |
| 561 | 3300033529 | Ga0316587_1093413 | Ga0316587_10934131 | 64 |
| 562 | 3300033529 | Ga0316587_1106310 | Ga0316587_11063101 | 64 |
| 563 | 3300033541 | Ga0316596_1000248 | Ga0316596_10002488 | 64 |
| 564 | 3300033541 | Ga0316596_1001002 | Ga0316596_10010027 | 64 |
| 565 | 3300033541 | Ga0316596_1018273 | Ga0316596_10182732 | 64 |
| 566 | 3300033541 | Ga0316596_1020028 | Ga0316596_10200283 | 64 |
| 567 | 3300033541 | Ga0316596_1024641 | Ga0316596_10246412 | 64 |
| 568 | 3300033541 | Ga0316596_1028569 | Ga0316596_10285693 | 64 |
| 569 | 3300033541 | Ga0316596_1029864 | Ga0316596_10298643 | 64 |
| 570 | 3300033541 | Ga0316596_1071966 | Ga0316596_10719662 | 64 |
| 571 | 3300033541 | Ga0316596_1081013 | Ga0316596_10810132 | 64 |
| 572 | 3300033541 | Ga0316596_1130800 | Ga0316596_11308002 | 64 |
| 573 | 3300033541 | Ga0316596_1156081 | Ga0316596_11560812 | 64 |
| 574 | 3300033547 | Ga0316212_1020930 | Ga0316212_10209302 | 64 |
| 575 | 3300034819 | Ga0373958_0052411 | Ga0373958_0052411_437_631 | 64 |
| 576 | 3300034957 | Ga0373938_0016338 | Ga0373938_0016338_42_236 | 64 |
| 577 | 3300035090 | Ga0373949_0043792 | Ga0373949_0043792_534_728 | 64 |
| 578 | 3300035092 | Ga0373952_0198529 | Ga0373952_0198529_374_571 | 64 |
| 579 | 3300035111 | Ga0373923_0505593 | Ga0373923_0505593_342_536 | 64 |
| 580 | 3300035112 | Ga0373932_0143887 | Ga0373932_0143887_370_567 | 64 |
| 581 | 3300035114 | Ga0373939_0032708 | Ga0373939_0032708_318_515 | 64 |
| 582 | 3300035116 | Ga0373945_0284957 | Ga0373945_0284957_386_580 | 64 |
| 583 | 3300035117 | Ga0373953_0104038 | Ga0373953_0104038_487_681 | 64 |
| 584 | 3300035118 | Ga0373954_0138520 | Ga0373954_0138520_233_430 | 64 |
| 585 | 3300035119 | Ga0373956_0112691 | Ga0373956_0112691_247_441 | 64 |
| 586 | 3300035121 | Ga0373960_0275410 | Ga0373960_0275410_247_444 | 64 |
| 587 | 3300035172 | Ga0373955_0845580 | Ga0373955_0845580_336_530 | 64 |
| 588 | 3300035241 | Ga0373961_0174553 | Ga0373961_0174553_126_320 | 64 |
| 589 | 3300035242 | Ga0373962_0204318 | Ga0373962_0204318_441_638 | 64 |
| 590 | 3300035398 | Ga0316574_0027300 | Ga0316574_0027300_1306_1500 | 64 |
| 591 | 3300035398 | Ga0316574_0037143 | Ga0316574_0037143_1149_1346 | 64 |
| 592 | 3300035398 | Ga0316574_0040060 | Ga0316574_0040060_1350_1547 | 64 |
| 593 | 3300035398 | Ga0316574_0133130 | Ga0316574_0133130_894_1088 | 64 |
| 594 | 3300035398 | Ga0316574_0161833 | Ga0316574_0161833_427_624 | 64 |
| 595 | 3300035398 | Ga0316574_0226581 | Ga0316574_0226581_115_312 | 64 |
| 596 | 3300035410 | Ga0373924_0081700 | Ga0373924_0081700_1157_1351 | 64 |
| 597 | 3300035691 | Ga0373931_0251053 | Ga0373931_0251053_869_1063 | 64 |
| 598 | 3300035692 | Ga0373935_0036278 | Ga0373935_0036278_1646_1840 | 64 |
| 599 | 3300035724 | Ga0373933_0023866 | Ga0373933_0023866_2501_2698 | 64 |
| 600 | 3300035724 | Ga0373933_0425718 | Ga0373933_0425718_197_391 | 64 |
| 601 | 3300035724 | Ga0373933_1007885 | Ga0373933_1007885_322_519 | 64 |
| 602 | 3300036401 | Ga0373937_0589547 | Ga0373937_0589547_664_858 | 64 |
| 603 | 3300036647 | Ga0316582_0016790 | Ga0316582_0016790_803_1000 | 64 |
| 604 | 3300036647 | Ga0316582_0030603 | Ga0316582_0030603_1856_2053 | 64 |
| 605 | 3300036647 | Ga0316582_0307190 | Ga0316582_0307190_857_1054 | 64 |
| 606 | 3300036647 | Ga0316582_0493189 | Ga0316582_0493189_489_683 | 64 |
| 607 | 3300036647 | Ga0316582_0828192 | Ga0316582_0828192_42_239 | 64 |
| 608 | 3300036712 | Ga0316584_0044625 | Ga0316584_0044625_330_527 | 64 |
| 609 | 3300036712 | Ga0316584_0066017 | Ga0316584_0066017_1320_1514 | 64 |
| 610 | 3300036712 | Ga0316584_0365296 | Ga0316584_0365296_741_938 | 64 |
| 611 | 3300036712 | Ga0316584_0538179 | Ga0316584_0538179_400_597 | 64 |
| 612 | 3300036712 | Ga0316584_0605666 | Ga0316584_0605666_456_653 | 64 |
| 613 | 3300036712 | Ga0316584_0632277 | Ga0316584_0632277_448_645 | 64 |
| 614 | 3300036712 | Ga0316584_0908375 | Ga0316584_0908375_239_436 | 64 |
| 615 | 3300037068 | Ga0373925_0084490 | Ga0373925_0084490_1372_1566 | 64 |
| 616 | 3300037418 | Ga0395900_1403174 | Ga0395900_1403174_267_461 | 64 |
| 617 | 3300039062 | Ga0400483_030749 | Ga0400483_030749_1497_1694 | 64 |
| 618 | 3300039110 | Ga0400487_62966 | Ga0400487_62966_1045_1242 | 64 |
| 619 | 3300039437 | Ga0436365_0511780 | Ga0436365_0511780_81_278 | 64 |
| 620 | 3300039437 | Ga0436365_1628411 | Ga0436365_1628411_168_362 | 64 |
| 621 | 3300039438 | Ga0436360_0975443 | Ga0436360_0975443_609_806 | 64 |
| 622 | 3300041404 | Ga0439436_0116364 | Ga0439436_0116364_217_414 | 64 |
| 623 | 3300041410 | Ga0439461_0179896 | Ga0439461_0179896_71_268 | 64 |
| 624 | 3300041413 | Ga0439465_0028899 | Ga0439465_0028899_409_624 | 64 |
| 625 | 3300041458 | Ga0451798_0569403 | Ga0451798_0569403_902_1099 | 64 |
| 626 | 3300041491 | Ga0451833_1011918 | Ga0451833_1011918_1126_1320 | 64 |
| 627 | 3300041498 | Ga0451841_0702593 | Ga0451841_0702593_303_497 | 64 |
| 628 | 3300041505 | Ga0451849_0594637 | Ga0451849_0594637_907_1101 | 64 |
| 629 | 3300041506 | Ga0451850_27006 | Ga0451850_27006_315_509 | 64 |
| 630 | 3300041507 | Ga0451851_0741629 | Ga0451851_0741629_263_457 | 64 |
| 631 | 3300041509 | Ga0451843_0137409 | Ga0451843_0137409_426_620 | 64 |
| 632 | 3300041509 | Ga0451843_0794405 | Ga0451843_0794405_134_331 | 64 |
| 633 | 3300041512 | Ga0451853_1477023 | Ga0451853_1477023_353_553 | 64 |
| 634 | 3300041512 | Ga0451853_3285942 | Ga0451853_3285942_477_671 | 64 |
| 635 | 3300041916 | Ga0452271_08140 | Ga0452271_08140_685_879 | 64 |
| 636 | 3300041997 | Ga0439431_0048983 | Ga0439431_0048983_258_473 | 64 |
| 637 | 3300041997 | Ga0439431_0081767 | Ga0439431_0081767_256_453 | 64 |
| 638 | 3300042003 | Ga0439443_106347 | Ga0439443_106347_79_276 | 64 |
| 639 | 3300042004 | Ga0439445_0004084 | Ga0439445_0004084_3069_3284 | 64 |
| 640 | 3300042005 | Ga0439448_0271335 | Ga0439448_0271335_193_387 | 64 |
| 641 | 3300042007 | Ga0439449_0193637 | Ga0439449_0193637_76_273 | 64 |
| 642 | 3300042007 | Ga0439449_0240808 | Ga0439449_0240808_245_442 | 64 |
| 643 | 3300042008 | Ga0439450_116155 | Ga0439450_116155_389_583 | 64 |
| 644 | 3300042012 | Ga0439455_0253122 | Ga0439455_0253122_199_393 | 64 |
| 645 | 3300042014 | Ga0439457_120880 | Ga0439457_120880_322_519 | 64 |
| 646 | 3300042016 | Ga0439463_031763 | Ga0439463_031763_467_664 | 64 |
| 647 | 3300042115 | Ga0450911_032372 | Ga0450911_032372_62_259 | 64 |
| 648 | 3300042118 | Ga0450914_013386 | Ga0450914_013386_516_710 | 64 |
| 649 | 3300042120 | Ga0450917_014402 | Ga0450917_014402_415_609 | 64 |
| 650 | 3300042125 | Ga0450923_139277 | Ga0450923_139277_189_386 | 64 |
| 651 | 3300042126 | Ga0450888_027699 | Ga0450888_027699_332_529 | 64 |
| 652 | 3300042132 | Ga0450895_031320 | Ga0450895_031320_30_224 | 64 |
| 653 | 3300042135 | Ga0450899_027527 | Ga0450899_027527_395_592 | 64 |
| 654 | 3300042137 | Ga0450902_047311 | Ga0450902_047311_354_548 | 64 |
| 655 | 3300042157 | Ga0439458_0008446 | Ga0439458_0008446_549_746 | 64 |
| 656 | 3300042157 | Ga0439458_0111164 | Ga0439458_0111164_445_639 | 64 |
| 657 | 3300042157 | Ga0439458_0114569 | Ga0439458_0114569_303_500 | 64 |
| 658 | 3300042157 | Ga0439458_0236303 | Ga0439458_0236303_132_329 | 64 |
| 659 | 3300042437 | Ga0439444_0105765 | Ga0439444_0105765_246_443 | 64 |
| 660 | 3300042438 | Ga0439459_0193661 | Ga0439459_0193661_111_305 | 64 |
| 661 | 3300042439 | Ga0439464_0309206 | Ga0439464_0309206_283_477 | 64 |
| 662 | 3300042531 | Ga0450918_074203 | Ga0450918_074203_300_497 | 64 |
| 663 | 3300042533 | Ga0450901_016777 | Ga0450901_016777_543_737 | 64 |
| 664 | 3300042876 | Ga0451577_0015944 | Ga0451577_0015944_4296_4490 | 64 |
| 665 | 3300042876 | Ga0451577_0026574 | Ga0451577_0026574_670_870 | 64 |
| 666 | 3300042876 | Ga0451577_0066178 | Ga0451577_0066178_674_868 | 64 |
| 667 | 3300042876 | Ga0451577_0220962 | Ga0451577_0220962_281_475 | 64 |
| 668 | 3300042876 | Ga0451577_0282635 | Ga0451577_0282635_789_986 | 64 |
| 669 | 3300042876 | Ga0451577_0337134 | Ga0451577_0337134_997_1191 | 64 |
| 670 | 3300042876 | Ga0451577_0630340 | Ga0451577_0630340_429_623 | 64 |
| 671 | 3300042876 | Ga0451577_1124199 | Ga0451577_1124199_22_219 | 64 |
| 672 | 3300042993 | Ga0439440_0049720 | Ga0439440_0049720_232_429 | 64 |
| 673 | 3300044673 | Ga0453683_0017806 | Ga0453683_0017806_4151_4345 | 64 |
| 674 | 3300044673 | Ga0453683_0103919 | Ga0453683_0103919_97_297 | 64 |
| 675 | 3300044683 | Ga0466965_0176315 | Ga0466965_0176315_523_720 | 64 |
| 676 | 3300044712 | Ga0453684_0030164 | Ga0453684_0030164_4865_5059 | 64 |
| 677 | 3300044712 | Ga0453684_0044583 | Ga0453684_0044583_5259_5459 | 64 |
| 678 | 3300044712 | Ga0453684_0101520 | Ga0453684_0101520_3147_3341 | 64 |
| 679 | 3300044712 | Ga0453684_0164305 | Ga0453684_0164305_2108_2302 | 64 |
| 680 | 3300044712 | Ga0453684_0307384 | Ga0453684_0307384_1035_1229 | 64 |
| 681 | 3300044712 | Ga0453684_0508560 | Ga0453684_0508560_851_1045 | 64 |
| 682 | 3300045051 | Ga0451576_0015038 | Ga0451576_0015038_438_632 | 64 |
| 683 | 3300045051 | Ga0451576_0021827 | Ga0451576_0021827_5573_5767 | 64 |
| 684 | 3300045051 | Ga0451576_0043051 | Ga0451576_0043051_1952_2146 | 64 |
| 685 | 3300045051 | Ga0451576_0052745 | Ga0451576_0052745_3041_3241 | 64 |
| 686 | 3300045051 | Ga0451576_0197175 | Ga0451576_0197175_373_567 | 64 |
| 687 | 3300045051 | Ga0451576_0325504 | Ga0451576_0325504_1039_1233 | 64 |
| 688 | 3300045051 | Ga0451576_2487741 | Ga0451576_2487741_279_476 | 64 |
| 689 | 3300046460 | Ga0495638_0002014 | Ga0495638_0002014_12400_12597 | 64 |
| 690 | 3300046460 | Ga0495638_0373287 | Ga0495638_0373287_260_457 | 64 |
| 691 | 3300046471 | Ga0495650_0057843 | Ga0495650_0057843_231_425 | 64 |
| 692 | 3300046473 | Ga0495582_0181237 | Ga0495582_0181237_187_381 | 64 |
| 693 | 3300046475 | Ga0495639_0114729 | Ga0495639_0114729_1047_1241 | 64 |
| 694 | 3300046475 | Ga0495639_0211464 | Ga0495639_0211464_664_858 | 64 |
| 695 | 3300046513 | Ga0495616_0368857 | Ga0495616_0368857_103_300 | 64 |
| 696 | 3300046517 | Ga0495630_0594055 | Ga0495630_0594055_426_620 | 64 |
| 697 | 3300046519 | Ga0495632_0200095 | Ga0495632_0200095_639_836 | 64 |
| 698 | 3300046528 | Ga0495642_0263515 | Ga0495642_0263515_427_624 | 64 |
| 699 | 3300046535 | Ga0495586_0854723 | Ga0495586_0854723_215_409 | 64 |
| 700 | 3300046543 | Ga0495645_0190173 | Ga0495645_0190173_1117_1311 | 64 |
| 701 | 3300046557 | Ga0495622_0239562 | Ga0495622_0239562_539_733 | 64 |
| 702 | 3300046557 | Ga0495622_0443846 | Ga0495622_0443846_82_276 | 64 |
| 703 | 3300046615 | Ga0495656_0457634 | Ga0495656_0457634_203_397 | 64 |
| 704 | 3300046616 | Ga0495668_0255590 | Ga0495668_0255590_217_414 | 64 |
| 705 | 3300046616 | Ga0495668_0629378 | Ga0495668_0629378_151_348 | 64 |
| 706 | 3300046660 | Ga0495625_0077402 | Ga0495625_0077402_583_780 | 64 |
| 707 | 3300046660 | Ga0495625_0254561 | Ga0495625_0254561_603_797 | 64 |
| 708 | 3300046663 | Ga0495635_0545007 | Ga0495635_0545007_281_475 | 64 |
| 709 | 3300046675 | Ga0495657_0459609 | Ga0495657_0459609_85_279 | 64 |
| 710 | 3300046678 | Ga0495599_0549382 | Ga0495599_0549382_149_343 | 64 |
| 711 | 3300046681 | Ga0495647_0044512 | Ga0495647_0044512_617_811 | 64 |
| 712 | 3300046683 | Ga0495658_0470421 | Ga0495658_0470421_223_417 | 64 |
| 713 | 3300046683 | Ga0495658_0639444 | Ga0495658_0639444_338_532 | 64 |
| 714 | 3300046684 | Ga0495669_0144470 | Ga0495669_0144470_634_831 | 64 |
| 715 | 3300046692 | Ga0495671_0387202 | Ga0495671_0387202_177_374 | 64 |
| 716 | 3300046809 | Ga0495600_0532529 | Ga0495600_0532529_397_591 | 64 |
| 717 | 3300047315 | Ga0495581_0393433 | Ga0495581_0393433_301_495 | 64 |
| 718 | 3300047319 | Ga0495674_0747074 | Ga0495674_0747074_440_634 | 64 |
| 719 | 3300047320 | Ga0495672_0091772 | Ga0495672_0091772_807_1004 | 64 |
| 720 | 3300047322 | Ga0495680_0817438 | Ga0495680_0817438_260_454 | 64 |
| 721 | 3300047472 | Ga0495686_0091310 | Ga0495686_0091310_1360_1557 | 64 |
| 722 | 3300047472 | Ga0495686_0124871 | Ga0495686_0124871_550_747 | 64 |
| 723 | 3300048903 | Ga0496100_0089707 | Ga0496100_0089707_835_1029 | 64 |
| 724 | 3300048904 | Ga0496101_0148686 | Ga0496101_0148686_1314_1508 | 64 |
| 725 | 3300048907 | Ga0496104_0005409 | Ga0496104_0005409_7478_7672 | 64 |
| 726 | 3300048908 | Ga0496105_0024024 | Ga0496105_0024024_3209_3403 | 64 |
| 727 | 3300048911 | Ga0496108_1065278 | Ga0496108_1065278_222_416 | 64 |
| 728 | 3300048912 | Ga0496109_0026265 | Ga0496109_0026265_4581_4775 | 64 |
| 729 | 3300048913 | Ga0496110_0514324 | Ga0496110_0514324_503_700 | 64 |
| 730 | 3300048913 | Ga0496110_0609047 | Ga0496110_0609047_349_543 | 64 |
| 731 | 3300048913 | Ga0496110_1262592 | Ga0496110_1262592_231_425 | 64 |
| 732 | 3300048914 | Ga0496111_0536819 | Ga0496111_0536819_463_660 | 64 |
| 733 | 3300048914 | Ga0496111_0594517 | Ga0496111_0594517_571_768 | 64 |
| 734 | 3300048915 | Ga0496112_1270309 | Ga0496112_1270309_370_564 | 64 |
| 735 | 3300048916 | Ga0496113_0651508 | Ga0496113_0651508_177_371 | 64 |
| 736 | 3300048917 | Ga0496114_0006729 | Ga0496114_0006729_5757_5951 | 64 |
| 737 | 3300048917 | Ga0496114_0837757 | Ga0496114_0837757_379_576 | 64 |
| 738 | 3300048918 | Ga0496115_0001742 | Ga0496115_0001742_6501_6695 | 64 |
| 739 | 3300049127 | Ga0501306_013792 | Ga0501306_013792_202_399 | 64 |
| 740 | 3300049128 | Ga0501308_027100 | Ga0501308_027100_377_574 | 64 |
| 741 | 3300049128 | Ga0501308_055036 | Ga0501308_055036_218_415 | 64 |
| 742 | 3300049128 | Ga0501308_084651 | Ga0501308_084651_281_478 | 64 |
| 743 | 3300049129 | Ga0501309_094163 | Ga0501309_094163_262_459 | 64 |
| 744 | 3300049130 | Ga0501310_005433 | Ga0501310_005433_1028_1225 | 64 |
| 745 | 3300049130 | Ga0501310_056641 | Ga0501310_056641_348_545 | 64 |
| 746 | 3300049130 | Ga0501310_074048 | Ga0501310_074048_48_245 | 64 |
| 747 | 3300049160 | Ga0501304_021330 | Ga0501304_021330_276_470 | 64 |
| 748 | 3300049161 | Ga0501305_009910 | Ga0501305_009910_10_207 | 64 |
| 749 | 3300049162 | Ga0501307_089751 | Ga0501307_089751_296_493 | 64 |
| 750 | 3300049515 | Ga0501292_054169 | Ga0501292_054169_367_561 | 64 |
| 751 | 3300049521 | Ga0501298_103019 | Ga0501298_103019_220_414 | 64 |
| 752 | 3300049521 | Ga0501298_166767 | Ga0501298_166767_68_262 | 64 |
| 753 | 3300049522 | Ga0501299_060164 | Ga0501299_060164_281_475 | 64 |
| 754 | 3300049523 | Ga0501300_089470 | Ga0501300_089470_81_275 | 64 |
| 755 | 3300049527 | Ga0501311_068149 | Ga0501311_068149_320_517 | 64 |
| 756 | 3300049527 | Ga0501311_072748 | Ga0501311_072748_250_444 | 64 |
| 757 | 3300049528 | Ga0501312_051953 | Ga0501312_051953_420_617 | 64 |
| 758 | 3300049529 | Ga0501313_036901 | Ga0501313_036901_144_341 | 64 |
| 759 | 3300049531 | Ga0501315_058363 | Ga0501315_058363_78_275 | 64 |
| 760 | 3300049533 | Ga0501317_027251 | Ga0501317_027251_136_333 | 64 |
| 761 | 3300049533 | Ga0501317_066603 | Ga0501317_066603_318_512 | 64 |
| 762 | 3300049533 | Ga0501317_084837 | Ga0501317_084837_23_217 | 64 |
| 763 | 3300049533 | Ga0501317_095027 | Ga0501317_095027_92_289 | 64 |
| 764 | 3300049534 | Ga0501318_055240 | Ga0501318_055240_341_538 | 64 |
| 765 | 3300049539 | Ga0501323_057119 | Ga0501323_057119_391_585 | 64 |
| 766 | 3300049539 | Ga0501323_072410 | Ga0501323_072410_230_427 | 64 |
| 767 | 3300049540 | Ga0501324_036115 | Ga0501324_036115_75_272 | 64 |
| 768 | 3300049551 | Ga0501335_037677 | Ga0501335_037677_254_451 | 64 |
| 769 | 3300049551 | Ga0501335_049680 | Ga0501335_049680_191_388 | 64 |
| 770 | 3300049552 | Ga0501336_006653 | Ga0501336_006653_109_306 | 64 |
| 771 | 3300049568 | Ga0501031_0256374 | Ga0501031_0256374_195_392 | 64 |
| 772 | 3300049570 | Ga0501033_0752531 | Ga0501033_0752531_64_261 | 64 |
| 773 | 3300049571 | Ga0501034_0038314 | Ga0501034_0038314_3129_3326 | 64 |
| 774 | 3300049571 | Ga0501034_0559978 | Ga0501034_0559978_435_632 | 64 |
| 775 | 3300049573 | Ga0501037_0014295 | Ga0501037_0014295_992_1189 | 64 |
| 776 | 3300049573 | Ga0501037_0624549 | Ga0501037_0624549_250_444 | 64 |
| 777 | 3300049575 | Ga0501039_1165605 | Ga0501039_1165605_292_486 | 64 |
| 778 | 3300049578 | Ga0501042_0566941 | Ga0501042_0566941_169_366 | 64 |
| 779 | 3300049580 | Ga0501046_0580826 | Ga0501046_0580826_98_295 | 64 |
| 780 | 3300049581 | Ga0501047_0283885 | Ga0501047_0283885_877_1074 | 64 |
| 781 | 3300049582 | Ga0501048_0647321 | Ga0501048_0647321_152_346 | 64 |
| 782 | 3300049582 | Ga0501048_0738814 | Ga0501048_0738814_414_608 | 64 |
| 783 | 3300049587 | Ga0501071_1068754 | Ga0501071_1068754_141_338 | 64 |
| 784 | 3300049587 | Ga0501071_1498741 | Ga0501071_1498741_218_415 | 64 |
| 785 | 3300049588 | Ga0501072_0959813 | Ga0501072_0959813_174_368 | 64 |
| 786 | 3300049589 | Ga0501073_0281194 | Ga0501073_0281194_567_764 | 64 |
| 787 | 3300049590 | Ga0501074_0000764 | Ga0501074_0000764_4615_4812 | 64 |
| 788 | 3300049592 | Ga0501076_0862915 | Ga0501076_0862915_469_666 | 64 |
| 789 | 3300049592 | Ga0501076_1523838 | Ga0501076_1523838_204_401 | 64 |
| 790 | 3300049656 | Ga0501209_243249 | Ga0501209_243249_319_513 | 64 |
| 791 | 3300049670 | Ga0501236_059410 | Ga0501236_059410_297_491 | 64 |
| 792 | 3300049683 | Ga0501253_141660 | Ga0501253_141660_379_573 | 64 |
| 793 | 3300049705 | Ga0501225_0302629 | Ga0501225_0302629_155_349 | 64 |
| 794 | 3300049741 | Ga0501079_1088669 | Ga0501079_1088669_123_320 | 64 |
| 795 | 3300049744 | Ga0501083_0330400 | Ga0501083_0330400_499_696 | 64 |
| 796 | 3300049765 | Ga0501268_136695 | Ga0501268_136695_212_406 | 64 |
| 797 | 3300049822 | Ga0501035_0936759 | Ga0501035_0936759_195_392 | 64 |
| 798 | 3300049823 | Ga0501044_1290302 | Ga0501044_1290302_128_325 | 64 |
| 799 | 3300049853 | Ga0501226_036533 | Ga0501226_036533_249_443 | 64 |
| 800 | 3300050492 | nmdc:mga0yw44_608903_c1 | nmdc:mga0yw44_608903_c1_476_673 | 64 |
| 801 | 3300050494 | nmdc:mga06z11_990782_c1 | nmdc:mga06z11_990782_c1_105_302 | 64 |
| 802 | 3300050507 | nmdc:mga05p37_7541_c1 | nmdc:mga05p37_7541_c1_11714_11908 | 64 |
| 803 | 3300050508 | nmdc:mga09592_715329_c1 | nmdc:mga09592_715329_c1_47_241 | 64 |
| 804 | 3300050509 | nmdc:mga0qj67_11501_c1 | nmdc:mga0qj67_11501_c1_2916_3110 | 64 |
| 805 | 3300050509 | nmdc:mga0qj67_1178103_c1 | nmdc:mga0qj67_1178103_c1_25_219 | 64 |
| 806 | 3300050509 | nmdc:mga0qj67_1275563_c1 | nmdc:mga0qj67_1275563_c1_101_295 | 64 |
| 807 | 3300050509 | nmdc:mga0qj67_71290_c1 | nmdc:mga0qj67_71290_c1_646_843 | 64 |
| 808 | 3300050510 | nmdc:mga06r32_64343_c1 | nmdc:mga06r32_64343_c1_2234_2428 | 64 |
| 809 | 3300050510 | nmdc:mga06r32_7136_c1 | nmdc:mga06r32_7136_c1_6165_6359 | 64 |
| 810 | 3300050511 | nmdc:mga08y16_120245_c1 | nmdc:mga08y16_120245_c1_20_217 | 64 |
| 811 | 3300050511 | nmdc:mga08y16_131524_c1 | nmdc:mga08y16_131524_c1_1272_1469 | 64 |
| 812 | 3300050511 | nmdc:mga08y16_1555988_c1 | nmdc:mga08y16_1555988_c1_101_298 | 64 |
| 813 | 3300050511 | nmdc:mga08y16_1648517_c1 | nmdc:mga08y16_1648517_c1_323_520 | 64 |
| 814 | 3300050511 | nmdc:mga08y16_332_c1 | nmdc:mga08y16_332_c1_42573_42767 | 64 |
| 815 | 3300050511 | nmdc:mga08y16_443658_c1 | nmdc:mga08y16_443658_c1_128_328 | 64 |
| 816 | 3300050511 | nmdc:mga08y16_447499_c1 | nmdc:mga08y16_447499_c1_703_897 | 64 |
| 817 | 3300050512 | nmdc:mga0n895_268321_c1 | nmdc:mga0n895_268321_c1_1428_1622 | 64 |
| 818 | 3300050513 | nmdc:mga0rr50_405887_c1 | nmdc:mga0rr50_405887_c1_747_941 | 64 |
| 819 | 3300050514 | nmdc:mga08x19_69645_c1 | nmdc:mga08x19_69645_c1_1198_1392 | 64 |
| 820 | 3300053077 | Ga0495601_0761715 | Ga0495601_0761715_293_487 | 64 |
| 821 | 3300053078 | Ga0495612_0109287 | Ga0495612_0109287_430_624 | 64 |
| 822 | 3300053078 | Ga0495612_0143364 | Ga0495612_0143364_30_227 | 64 |
| 823 | 3300053084 | Ga0495595_0504450 | Ga0495595_0504450_368_562 | 64 |
| 824 | 3300053085 | Ga0495619_0300455 | Ga0495619_0300455_236_430 | 64 |
| 825 | 3300053087 | Ga0500643_226710 | Ga0500643_226710_207_404 | 64 |
| 826 | 3300053088 | Ga0500644_0259261 | Ga0500644_0259261_516_713 | 64 |
| 827 | 3300053092 | Ga0500583_0187400 | Ga0500583_0187400_232_429 | 64 |
| 828 | 3300053093 | Ga0500651_0751629 | Ga0500651_0751629_10_207 | 64 |
| 829 | 3300053098 | Ga0500650_0074968 | Ga0500650_0074968_974_1171 | 64 |
| 830 | 3300053118 | Ga0500594_0173353 | Ga0500594_0173353_385_582 | 64 |
| 831 | 3300053124 | Ga0500617_186493 | Ga0500617_186493_171_368 | 64 |
| 832 | 3300053134 | Ga0500658_0022065 | Ga0500658_0022065_2135_2332 | 64 |
| 833 | 3300053139 | Ga0500568_0035791 | Ga0500568_0035791_1248_1445 | 64 |
| 834 | 3300053142 | Ga0500577_0408805 | Ga0500577_0408805_137_334 | 64 |
| 835 | 3300053146 | Ga0500588_0002971 | Ga0500588_0002971_3246_3443 | 64 |
| 836 | 3300053151 | Ga0500604_0020082 | Ga0500604_0020082_1665_1862 | 64 |
| 837 | 3300053153 | Ga0500616_0295885 | Ga0500616_0295885_358_555 | 64 |
| 838 | 3300053156 | Ga0500622_0000306 | Ga0500622_0000306_17161_17358 | 64 |
| 839 | 3300053156 | Ga0500622_0000360 | Ga0500622_0000360_17306_17503 | 64 |
| 840 | 3300053178 | Ga0500637_0545630 | Ga0500637_0545630_78_275 | 64 |
| 841 | 3300054114 | Ga0501084_1413990 | Ga0501084_1413990_71_268 | 64 |
| 842 | 3300054114 | Ga0501084_1740978 | Ga0501084_1740978_233_430 | 64 |
| 843 | 3300059421 | Ga0590071_038376 | Ga0590071_038376_469_666 | 64 |
| 844 | 3300059421 | Ga0590071_176899 | Ga0590071_176899_145_342 | 64 |
| 845 | 3300059477 | Ga0587084_015642 | Ga0587084_015642_795_992 | 64 |
| 846 | 3300059490 | Ga0587066_082801 | Ga0587066_082801_422_619 | 64 |
| 847 | 3300059493 | Ga0587077_019154 | Ga0587077_019154_912_1109 | 64 |
| 848 | 3300059510 | Ga0587090_122076 | Ga0587090_122076_276_473 | 64 |
| 849 | 3300059511 | Ga0587091_187714 | Ga0587091_187714_270_467 | 64 |
| 850 | 3300059604 | Ga0587098_044564 | Ga0587098_044564_351_548 | 64 |
| 851 | 3300059623 | Ga0587101_047005 | Ga0587101_047005_449_646 | 64 |
| 852 | 3300059623 | Ga0587101_064635 | Ga0587101_064635_385_582 | 64 |
| 853 | 3300059624 | Ga0587109_113435 | Ga0587109_113435_80_277 | 64 |
| 854 | 3300059660 | Ga0587124_020546 | Ga0587124_020546_365_562 | 64 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mrc-assembly1.cif.gz_Z | structure of the yeast mitochondrial ribosome - class a | 0.7115 | 4 | 64 |
| 5mrc-assembly1.cif.gz_Z | structure of the yeast mitochondrial ribosome - class a | 0.6945 | 4 | 64 |
| 7m4z-assembly1.cif.gz_2 | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.6812 | 3 | 64 |
| 7uvy-assembly1.cif.gz_2 | a. baumannii ribosome-streptothricin-d complex: 70s with p-site trna | 0.678 | 3 | 64 |
| 7uvv-assembly1.cif.gz_2 | a. baumannii ribosome-streptothricin-f complex: 70s with p-site trna | 0.6776 | 3 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vw4Z00 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.7201 | 4 | 64 | 4.10.410.60 |
| 1vw4Z00 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.7027 | 4 | 64 | 4.10.410.60 |
| 3d5b800 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.6369 | 2 | 64 | 4.10.410.60 |
| 3d5b800 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.6299 | 2 | 64 | 4.10.410.60 |
| 1vvs800 | Few Secondary Structures;Irregular;Factor Xa Inhibitor; | 0.6282 | 2 | 63 | 4.10.410.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U6KQW4-F1-model_v4 | Ribosomal protein L35 | 0.7294 | 3 | 64 |
|
| AF-A0A521WMN9-F1-model_v4 | Large ribosomal subunit protein bL35 | 0.7225 | 1 | 64 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A4T0H0N4-F1-model_v4 | Uncharacterized protein | 0.717 | 4 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-U5HDW4-F1-model_v4 | 50S ribosomal protein L35 | 0.7154 | 3 | 64 |
GO:0003735
GO:0006412 GO:0015934 |
| AF-A0A521WMN9-F1-model_v4 | Large ribosomal subunit protein bL35 | 0.7137 | 1 | 64 |
GO:0003735
GO:0006412 GO:0015934 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar