F483549

General Info

Members Datasets Scaffolds Average Seq Length
853 379 853 288

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0002449|Ga0373945_0002449_4700_5614
Length 296
Sequence MADGPLREPDLRRSVPIDVYLNVAVAGILTGLVYGLMALGLSVIFGVVRVVNFAHGEMMSIAMYLTVLLFSGLHLDPLVMLVPIAAILFVFGYALQAGLINPFISRPEHSQFLLLVALALIIVNTLLILFGPDARTVQTSYAFDSFQWGALIVDATKLYAGGLFVFFRFAPVGKAIRACADNYTGALVVGLDVKRLYALTFGIGAACVGAAGVMMTLIVDVTPMIGPAYTLLAFVIVITGGLGSMAGALLGGLLIGVTEALAGLLFTPSAKSMFAFAILVLVLLFRPQGILGKRSI

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
231 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
347 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
348 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
358 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
368 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
373 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.1
Nodule 0
Rhizoplane 7.03
Rhizosphere 85.58
Stem 0
Stem Tuber 0
Unclassified 1.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003964 3300003215 Bacteria 8103
2 rootH1_10101929 3300003316 Bacteria 1533
3 Ga0065712_10022039 3300005290 Bacteria 2146
4 Ga0065707_10201144 3300005295 Bacteria 1310
5 Ga0070658_10007812 3300005327 Bacteria 8619
6 Ga0070658_10163506 3300005327 Bacteria 1868
7 Ga0070690_100011486 3300005330 Bacteria 5181
8 Ga0068869_100032828 3300005334 Bacteria 3661
9 Ga0070666_10187404 3300005335 Bacteria 1453
10 Ga0070680_100004671 3300005336 Bacteria 10302
11 Ga0070680_100010183 3300005336 Bacteria 7250
12 Ga0070680_100081170 3300005336 Bacteria 2675
13 Ga0070682_100060440 3300005337 Bacteria 2396
14 Ga0068868_100327538 3300005338 Bacteria 1306
15 Ga0068868_100418451 3300005338 Bacteria 1160
16 Ga0070660_100025632 3300005339 Bacteria 4383
17 Ga0070660_100242405 3300005339 Unclassified 1469
18 Ga0070689_100003048 3300005340 Bacteria 11037
19 Ga0070689_100182890 3300005340 Bacteria 1703
20 Ga0070691_10002385 3300005341 Bacteria 8330
21 Ga0070687_100223455 3300005343 Bacteria 1155
22 Ga0070661_100129809 3300005344 Bacteria 1892
23 Ga0070692_10054837 3300005345 Bacteria 2082
24 Ga0070668_100175965 3300005347 Bacteria 1745
25 Ga0070675_100227172 3300005354 Bacteria 1627
26 Ga0070671_100001629 3300005355 Bacteria 16929
27 Ga0070671_100179031 3300005355 Bacteria 1795
28 Ga0070674_100005640 3300005356 Bacteria 7253
29 Ga0070674_100265233 3300005356 Unclassified 1355
30 Ga0070688_100010598 3300005365 Bacteria 5090
31 Ga0070688_100097895 3300005365 Bacteria 1929
32 Ga0070688_100103190 3300005365 Bacteria 1884
33 Ga0070659_100138178 3300005366 Bacteria 1983
34 Ga0070667_100194491 3300005367 Bacteria 1798
35 Ga0070667_100238863 3300005367 Bacteria 1622
36 Ga0070703_10000863 3300005406 Bacteria 9778
37 Ga0070709_10044315 3300005434 Bacteria 2754
38 Ga0070709_10089360 3300005434 Bacteria 2028
39 Ga0070714_100015537 3300005435 Bacteria 6123
40 Ga0070714_100034473 3300005435 Bacteria 4239
41 Ga0070713_100006445 3300005436 Bacteria 8140
42 Ga0070713_100066826 3300005436 Bacteria 3025
43 Ga0070713_100175961 3300005436 Bacteria 1920
44 Ga0070711_100031327 3300005439 Bacteria 3530
45 Ga0070711_100086139 3300005439 Bacteria 2252
46 Ga0070711_100130881 3300005439 Bacteria 1868
47 Ga0070711_100199513 3300005439 Bacteria 1543
48 Ga0070705_100002047 3300005440 Bacteria 10304
49 Ga0070700_100006099 3300005441 Bacteria 6420
50 Ga0070700_100307430 3300005441 Bacteria 1160
51 Ga0070694_100002834 3300005444 Bacteria 10301
52 Ga0070694_100194113 3300005444 Unclassified 1509
53 Ga0070678_100135240 3300005456 Bacteria 1965
54 Ga0070662_100088159 3300005457 Bacteria 2325
55 Ga0070662_100226547 3300005457 Bacteria 1494
56 Ga0070681_10039242 3300005458 Bacteria 4747
57 Ga0070681_10046550 3300005458 Bacteria 4336
58 Ga0068867_100379411 3300005459 Unclassified 1187
59 Ga0070685_10034379 3300005466 Bacteria 2854
60 Ga0070685_10068286 3300005466 Bacteria 2099
61 Ga0070685_10153428 3300005466 Bacteria 1462
62 Ga0070698_100107974 3300005471 Bacteria 2751
63 Ga0070698_100138364 3300005471 Bacteria 2388
64 Ga0070699_100000676 3300005518 Bacteria 31923
65 Ga0070699_100008160 3300005518 Bacteria 9087
66 Ga0070699_100037744 3300005518 Bacteria 4183
67 Ga0070679_100018216 3300005530 Bacteria 6810
68 Ga0070679_100031611 3300005530 Bacteria 5231
69 Ga0070679_100080118 3300005530 Bacteria 3254
70 Ga0070679_100543894 3300005530 Bacteria 1105
71 Ga0070684_100068425 3300005535 Bacteria 3121
72 Ga0070684_100175094 3300005535 Bacteria 1950
73 Ga0068853_100448012 3300005539 Bacteria 1214
74 Ga0070672_100086593 3300005543 Bacteria 2520
75 Ga0070672_100129074 3300005543 Bacteria 2076
76 Ga0070686_100053639 3300005544 Bacteria 2575
77 Ga0070686_100105802 3300005544 Bacteria 1908
78 Ga0070686_100148990 3300005544 Bacteria 1637
79 Ga0070695_100002706 3300005545 Bacteria 10271
80 Ga0070695_100088144 3300005545 Unclassified 2066
81 Ga0070696_100003618 3300005546 Bacteria 10294
82 Ga0070693_100258742 3300005547 Unclassified 1157
83 Ga0070665_100009831 3300005548 Bacteria 9669
84 Ga0070704_100002596 3300005549 Bacteria 10186
85 Ga0070704_100192950 3300005549 Bacteria 1639
86 Ga0068855_100019415 3300005563 Bacteria 8167
87 Ga0068855_100359197 3300005563 Bacteria 1603
88 Ga0068856_100056846 3300005614 Bacteria 3862
89 Ga0068856_100282343 3300005614 Bacteria 1677
90 Ga0068856_100444007 3300005614 Bacteria 1318
91 Ga0070702_100017320 3300005615 Bacteria 3714
92 Ga0068859_100053261 3300005617 Bacteria 4069
93 Ga0068859_100148530 3300005617 Bacteria 2419
94 Ga0068859_100157789 3300005617 Bacteria 2347
95 Ga0068861_100110705 3300005719 Bacteria 2200
96 Ga0068861_100334322 3300005719 Bacteria 1324
97 Ga0068870_10032553 3300005840 Bacteria 2652
98 Ga0068858_100396431 3300005842 Bacteria 1326
99 Ga0081455_10002266 3300005937 Bacteria 22935
100 Ga0081455_10014076 3300005937 Bacteria 7863
101 Ga0081455_10022274 3300005937 Bacteria 5925
102 Ga0081455_10071649 3300005937 Bacteria 2872
103 Ga0081538_10032375 3300005981 Bacteria 3505
104 Ga0081538_10035528 3300005981 Bacteria 3272
105 Ga0081538_10038133 3300005981 Bacteria 3106
106 Ga0081540_1000413 3300005983 Bacteria 42230
107 Ga0081540_1007933 3300005983 Bacteria 7492
108 Ga0081540_1037671 3300005983 Bacteria 2559
109 Ga0081540_1070642 3300005983 Bacteria 1616
110 Ga0081539_10009410 3300005985 Bacteria 8173
111 Ga0081539_10029464 3300005985 Bacteria 3428
112 Ga0081539_10040250 3300005985 Bacteria 2745
113 Ga0081539_10055264 3300005985 Bacteria 2210
114 Ga0070717_10001832 3300006028 Bacteria 14856
115 Ga0070717_10271317 3300006028 Bacteria 1503
116 Ga0070717_10291206 3300006028 Bacteria 1450
117 Ga0075365_10015329 3300006038 Bacteria 4634
118 Ga0075365_10031607 3300006038 Bacteria 3396
119 Ga0075365_10072168 3300006038 Bacteria 2325
120 Ga0075368_10051433 3300006042 Bacteria 1638
121 Ga0075364_10265500 3300006051 Bacteria 1167
122 Ga0070715_10000773 3300006163 Bacteria 8658
123 Ga0070716_100031558 3300006173 Bacteria 2882
124 Ga0070712_100001365 3300006175 Bacteria 14802
125 Ga0070712_100002949 3300006175 Bacteria 10539
126 Ga0075362_10025194 3300006177 Bacteria 2529
127 Ga0075362_10044880 3300006177 Bacteria 1962
128 Ga0075367_10010335 3300006178 Bacteria 4902
129 Ga0075367_10083360 3300006178 Bacteria 1937
130 Ga0075369_10003208 3300006186 Bacteria 5935
131 Ga0075369_10091376 3300006186 Bacteria 1359
132 Ga0075366_10003186 3300006195 Bacteria 8600
133 Ga0075366_10003908 3300006195 Bacteria 7945
134 Ga0097621_100034275 3300006237 Bacteria 4049
135 Ga0097621_100208396 3300006237 Bacteria 1699
136 Ga0068871_100024425 3300006358 Bacteria 4687
137 Ga0068871_100040552 3300006358 Bacteria 3729
138 Ga0075428_100033401 3300006844 Bacteria 5682
139 Ga0075428_100043702 3300006844 Bacteria 4926
140 Ga0075428_100072613 3300006844 Bacteria 3759
141 Ga0075428_100115363 3300006844 Bacteria 2926
142 Ga0075428_100138265 3300006844 Bacteria 2648
143 Ga0075428_100281631 3300006844 Bacteria 1789
144 Ga0075428_100429258 3300006844 Bacteria 1416
145 Ga0075430_100001038 3300006846 Bacteria 21949
146 Ga0075430_100008855 3300006846 Bacteria 8493
147 Ga0075430_100025536 3300006846 Bacteria 5026
148 Ga0075430_100035755 3300006846 Bacteria 4213
149 Ga0075430_100101673 3300006846 Bacteria 2400
150 Ga0075430_100121511 3300006846 Bacteria 2177
151 Ga0075430_100165915 3300006846 Bacteria 1838
152 Ga0075430_100229900 3300006846 Bacteria 1538
153 Ga0075431_100072882 3300006847 Bacteria 3543
154 Ga0075431_100169557 3300006847 Bacteria 2243
155 Ga0075431_100227964 3300006847 Bacteria 1899
156 Ga0075431_100255749 3300006847 Bacteria 1778
157 Ga0075433_10040253 3300006852 Bacteria 4045
158 Ga0075434_100006551 3300006871 Bacteria 10678
159 Ga0075434_100036000 3300006871 Bacteria 4895
160 Ga0075434_100226630 3300006871 Bacteria 1888
161 Ga0075434_100453329 3300006871 Bacteria 1304
162 Ga0075429_100118197 3300006880 Bacteria 2317
163 Ga0068865_100139009 3300006881 Bacteria 1829
164 Ga0075436_100054512 3300006914 Bacteria 2760
165 Ga0097620_100053263 3300006931 Bacteria 4069
166 Ga0097620_100148516 3300006931 Bacteria 2419
167 Ga0097620_100157776 3300006931 Bacteria 2347
168 Ga0075435_100061185 3300007076 Bacteria 3054
169 Ga0075435_100189322 3300007076 Bacteria 1741
170 Ga0105240_10018112 3300009093 Bacteria 9471
171 Ga0105240_10636057 3300009093 Bacteria 1171
172 Ga0111539_10039620 3300009094 Bacteria 5677
173 Ga0111539_10128038 3300009094 Bacteria 2974
174 Ga0111539_10137933 3300009094 Bacteria 2856
175 Ga0111539_10406481 3300009094 Bacteria 1586
176 Ga0111539_10439485 3300009094 Bacteria 1519
177 Ga0111539_10441686 3300009094 Bacteria 1515
178 Ga0111539_10521566 3300009094 Bacteria 1384
179 Ga0111539_10767389 3300009094 Bacteria 1122
180 Ga0105245_10007619 3300009098 Bacteria 9480
181 Ga0105245_10009970 3300009098 Bacteria 8275
182 Ga0105247_10159397 3300009101 Bacteria 1493
183 Ga0114129_10005876 3300009147 Bacteria 17380
184 Ga0114129_10031337 3300009147 Bacteria 7518
185 Ga0114129_10110595 3300009147 Bacteria 3792
186 Ga0114129_10111214 3300009147 Bacteria 3780
187 Ga0114129_10119370 3300009147 Bacteria 3632
188 Ga0114129_10210234 3300009147 Bacteria 2630
189 Ga0114129_10222381 3300009147 Bacteria 2546
190 Ga0114129_10257894 3300009147 Unclassified 2338
191 Ga0114129_10643814 3300009147 Bacteria 1369
192 Ga0105243_10057333 3300009148 Bacteria 3101
193 Ga0105243_10083844 3300009148 Bacteria 2608
194 Ga0105241_10456676 3300009174 Bacteria 1131
195 Ga0105242_10042703 3300009176 Bacteria 3663
196 Ga0105242_10425437 3300009176 Bacteria 1245
197 Ga0105248_10014889 3300009177 Bacteria 8566
198 Ga0105248_10087238 3300009177 Bacteria 3512
199 Ga0105248_10158891 3300009177 Bacteria 2550
200 Ga0105248_10179367 3300009177 Bacteria 2387
201 Ga0105237_10074588 3300009545 Bacteria 3385
202 Ga0105238_10083801 3300009551 Bacteria 3177
203 Ga0105238_10121564 3300009551 Unclassified 2590
204 Ga0105249_10012920 3300009553 Bacteria 7367
205 Ga0105249_10348651 3300009553 Bacteria 1499
206 Ga0105239_10090721 3300010375 Bacteria 3372
207 Ga0105239_10473938 3300010375 Bacteria 1422
208 Ga0105246_10435893 3300011119 Bacteria 1097
209 Ga0157373_10078964 3300013100 Bacteria 2321
210 Ga0157369_10436259 3300013105 Bacteria 1357
211 Ga0157374_10720323 3300013296 Bacteria 1011
212 Ga0157378_10113655 3300013297 Bacteria 2486
213 Ga0157378_10435382 3300013297 Bacteria 1298
214 Ga0163162_10085892 3300013306 Bacteria 3223
215 Ga0163162_10168685 3300013306 Bacteria 2313
216 Ga0163162_10304138 3300013306 Bacteria 1727
217 Ga0157375_10147328 3300013308 Bacteria 2486
218 Ga0157375_10363324 3300013308 Bacteria 1614
219 Ga0163163_10052576 3300014325 Bacteria 4019
220 Ga0163163_10235232 3300014325 Bacteria 1881
221 Ga0157380_10212780 3300014326 Bacteria 1724
222 Ga0157379_10019047 3300014968 Bacteria 6059
223 Ga0157379_10156673 3300014968 Bacteria 2055
224 Ga0157379_10217508 3300014968 Bacteria 1731
225 Ga0157376_10660073 3300014969 Bacteria 1047
226 Ga0163161_10319628 3300017792 Bacteria 1227
227 Ga0213872_10037343 3300021361 Bacteria 2218
228 Ga0213874_10099192 3300021377 Bacteria 966
229 Ga0213876_10027264 3300021384 Bacteria 3016
230 Ga0213876_10046534 3300021384 Bacteria 2294
231 Ga0209675_1002489 3300025291 Bacteria 9433
232 Ga0209758_1003526 3300025297 Bacteria 14107
233 Ga0207653_10011134 3300025885 Bacteria 2807
234 Ga0207682_10036882 3300025893 Bacteria 1979
235 Ga0207692_10008130 3300025898 Bacteria 4331
236 Ga0207688_10093977 3300025901 Bacteria 1725
237 Ga0207685_10001687 3300025905 Bacteria 4766
238 Ga0207699_10125925 3300025906 Bacteria 1663
239 Ga0207699_10182043 3300025906 Bacteria 1413
240 Ga0207645_10084627 3300025907 Bacteria 2035
241 Ga0207645_10190517 3300025907 Bacteria 1348
242 Ga0207643_10077870 3300025908 Bacteria 1917
243 Ga0207705_10006429 3300025909 Bacteria 8705
244 Ga0207654_10305260 3300025911 Bacteria 1083
245 Ga0207707_10134306 3300025912 Bacteria 2164
246 Ga0207671_10248297 3300025914 Bacteria 1399
247 Ga0207693_10001110 3300025915 Bacteria 24219
248 Ga0207693_10004385 3300025915 Bacteria 11930
249 Ga0207693_10005324 3300025915 Bacteria 10748
250 Ga0207693_10018460 3300025915 Bacteria 5556
251 Ga0207663_10073555 3300025916 Bacteria 2212
252 Ga0207663_10242323 3300025916 Bacteria 1323
253 Ga0207663_10253747 3300025916 Bacteria 1296
254 Ga0207660_10003455 3300025917 Bacteria 10306
255 Ga0207660_10052516 3300025917 Bacteria 2902
256 Ga0207662_10021594 3300025918 Bacteria 3683
257 Ga0207662_10059225 3300025918 Bacteria 2295
258 Ga0207657_10048882 3300025919 Bacteria 3690
259 Ga0207657_10064034 3300025919 Bacteria 3140
260 Ga0207649_10271451 3300025920 Bacteria 1229
261 Ga0207652_10013357 3300025921 Bacteria 6650
262 Ga0207652_10141511 3300025921 Bacteria 2151
263 Ga0207652_10195031 3300025921 Bacteria 1822
264 Ga0207652_10229440 3300025921 Unclassified 1673
265 Ga0207646_10143246 3300025922 Bacteria 2153
266 Ga0207694_10170549 3300025924 Bacteria 1762
267 Ga0207650_10003903 3300025925 Bacteria 10195
268 Ga0207659_10149531 3300025926 Bacteria 1822
269 Ga0207687_10067466 3300025927 Bacteria 2545
270 Ga0207687_10110692 3300025927 Bacteria 2037
271 Ga0207700_10007214 3300025928 Bacteria 6778
272 Ga0207700_10356154 3300025928 Bacteria 1275
273 Ga0207664_10106902 3300025929 Bacteria 2321
274 Ga0207644_10086654 3300025931 Bacteria 2326
275 Ga0207644_10094770 3300025931 Bacteria 2231
276 Ga0207644_10215155 3300025931 Bacteria 1521
277 Ga0207690_10324857 3300025932 Bacteria 1210
278 Ga0207690_10344223 3300025932 Bacteria 1177
279 Ga0207706_10003165 3300025933 Bacteria 15811
280 Ga0207706_10015943 3300025933 Bacteria 6791
281 Ga0207706_10028849 3300025933 Bacteria 4954
282 Ga0207706_10080732 3300025933 Bacteria 2859
283 Ga0207706_10206689 3300025933 Bacteria 1721
284 Ga0207706_10265618 3300025933 Bacteria 1498
285 Ga0207709_10039578 3300025935 Bacteria 2817
286 Ga0207709_10070805 3300025935 Bacteria 2212
287 Ga0207670_10005309 3300025936 Bacteria 7058
288 Ga0207670_10227793 3300025936 Bacteria 1430
289 Ga0207669_10008848 3300025937 Bacteria 4753
290 Ga0207669_10040865 3300025937 Bacteria 2694
291 Ga0207704_10070029 3300025938 Bacteria 2219
292 Ga0207665_10013442 3300025939 Bacteria 5382
293 Ga0207665_10085932 3300025939 Unclassified 2172
294 Ga0207691_10398930 3300025940 Bacteria 1173
295 Ga0207711_10066206 3300025941 Bacteria 3125
296 Ga0207711_10174196 3300025941 Bacteria 1954
297 Ga0207689_10050556 3300025942 Bacteria 3427
298 Ga0207689_10142109 3300025942 Bacteria 1977
299 Ga0207689_10160185 3300025942 Bacteria 1854
300 Ga0207661_10323570 3300025944 Bacteria 1387
301 Ga0207667_10019489 3300025949 Bacteria 7570
302 Ga0207651_10047465 3300025960 Bacteria 2896
303 Ga0207651_10071915 3300025960 Bacteria 2454
304 Ga0207712_10011425 3300025961 Bacteria 5657
305 Ga0207712_10342058 3300025961 Bacteria 1241
306 Ga0207658_10133627 3300025986 Bacteria 1997
307 Ga0207658_10148586 3300025986 Bacteria 1906
308 Ga0207703_10334189 3300026035 Bacteria 1391
309 Ga0207639_10126065 3300026041 Bacteria 2112
310 Ga0207639_10439269 3300026041 Bacteria 1183
311 Ga0207678_10046876 3300026067 Bacteria 3738
312 Ga0207708_10011998 3300026075 Bacteria 6457
313 Ga0207708_10322023 3300026075 Bacteria 1262
314 Ga0207702_10063784 3300026078 Bacteria 3151
315 Ga0207648_10013708 3300026089 Bacteria 7525
316 Ga0207648_10285261 3300026089 Bacteria 1477
317 Ga0207676_10108733 3300026095 Bacteria 2315
318 Ga0207675_100209894 3300026118 Bacteria 1872
319 Ga0207675_100247715 3300026118 Bacteria 1724
320 Ga0207675_100335293 3300026118 Bacteria 1479
321 Ga0207675_100347589 3300026118 Bacteria 1453
322 Ga0207683_10001401 3300026121 Bacteria 21763
323 Ga0207683_10019139 3300026121 Bacteria 5844
324 Ga0207683_10080537 3300026121 Bacteria 2889
325 Ga0209969_1000301 3300027360 Bacteria 6604
326 Ga0209967_1001239 3300027364 Bacteria 3266
327 Ga0209981_1005492 3300027378 Bacteria 1682
328 Ga0209996_1009934 3300027395 Bacteria 1258
329 Ga0210000_1001102 3300027462 Bacteria 3781
330 Ga0210000_1010799 3300027462 Bacteria 1351
331 Ga0209968_1001052 3300027526 Bacteria 4205
332 Ga0209999_1005741 3300027543 Bacteria 2234
333 Ga0209966_1037864 3300027695 Bacteria 997
334 Ga0209974_10005420 3300027876 Bacteria 4489
335 Ga0207428_10026718 3300027907 Bacteria 4813
336 Ga0207428_10109244 3300027907 Bacteria 2130
337 Ga0207428_10225018 3300027907 Bacteria 1405
338 Ga0268266_10004230 3300028379 Bacteria 13823
339 Ga0268265_10004057 3300028380 Bacteria 10293
340 Ga0268265_10192742 3300028380 Bacteria 1762
341 Ga0268264_10172702 3300028381 Bacteria 1956
342 Ga0265318_10010067 3300028577 Bacteria 4131
343 Ga0265338_10251082 3300028800 Bacteria 1305
344 Ga0265330_10082257 3300031235 Bacteria 1386
345 Ga0265320_10008692 3300031240 Bacteria 6187
346 Ga0265325_10008018 3300031241 Bacteria 6264
347 Ga0265329_10010598 3300031242 Bacteria 3375
348 Ga0265329_10011112 3300031242 Bacteria 3279
349 Ga0265340_10006108 3300031247 Bacteria 6641
350 Ga0265340_10014517 3300031247 Bacteria 4112
351 Ga0265340_10043374 3300031247 Bacteria 2205
352 Ga0265339_10009558 3300031249 Bacteria 6081
353 Ga0265339_10119720 3300031249 Bacteria 1354
354 Ga0265331_10028922 3300031250 Bacteria 2769
355 Ga0265327_10004354 3300031251 Bacteria 12598
356 Ga0265316_10099440 3300031344 Bacteria 2212
357 Ga0265316_10371318 3300031344 Bacteria 1033
358 Ga0265313_10000960 3300031595 Bacteria 28619
359 Ga0265314_10007016 3300031711 Bacteria 9843
360 Ga0265314_10117099 3300031711 Bacteria 1684
361 Ga0265342_10000026 3300031712 Bacteria 166610
362 Ga0265342_10050576 3300031712 Bacteria 2482
363 Ga0265342_10065218 3300031712 Bacteria 2135
364 Ga0307413_10079368 3300031824 Bacteria 2098
365 Ga0307413_10256068 3300031824 Bacteria 1302
366 Ga0307406_10402972 3300031901 Bacteria 1085
367 Ga0307412_10121879 3300031911 Bacteria 1879
368 Ga0307416_100140989 3300032002 Bacteria 2191
369 Ga0307416_100570071 3300032002 Bacteria 1208
370 Ga0373938_0020812 3300034957 Bacteria 1325
371 Ga0373926_0011875 3300035083 Bacteria 2938
372 Ga0373940_0039283 3300035088 Bacteria 1295
373 Ga0373949_0000762 3300035090 Bacteria 10376
374 Ga0373952_0005802 3300035092 Bacteria 2268
375 Ga0373939_0000939 3300035114 Bacteria 7257
376 Ga0373939_0112862 3300035114 Unclassified 949
377 Ga0373941_0026413 3300035115 Bacteria 1686
378 Ga0373945_0002449 3300035116 Bacteria 5826
379 Ga0373945_0038041 3300035116 Bacteria 1729
380 Ga0373953_0081431 3300035117 Bacteria 1346
381 Ga0373954_0001982 3300035118 Bacteria 8500
382 Ga0373956_0003825 3300035119 Bacteria 6056
383 Ga0373956_0052024 3300035119 Bacteria 1841
384 Ga0373957_0004410 3300035120 Bacteria 4282
385 Ga0373943_0000537 3300035170 Bacteria 16398
386 Ga0373946_0018731 3300035171 Bacteria 2660
387 Ga0373946_0088240 3300035171 Bacteria 1370
388 Ga0373955_0003925 3300035172 Bacteria 6555
389 Ga0373955_0057057 3300035172 Bacteria 2144
390 Ga0373942_0004147 3300035207 Bacteria 3375
391 Ga0373961_0033728 3300035241 Bacteria 1443
392 Ga0316574_0002290 3300035398 Bacteria 9537
393 Ga0373931_0000865 3300035691 Bacteria 12778
394 Ga0373927_0002460 3300035695 Bacteria 13513
395 Ga0373927_0019146 3300035695 Bacteria 4489
396 Ga0373933_0006622 3300035724 Bacteria 6314
397 Ga0373933_0011665 3300035724 Bacteria 4848
398 Ga0373947_0004973 3300035725 Bacteria 7780
399 Ga0373947_0050005 3300035725 Bacteria 2512
400 Ga0373937_0023654 3300036401 Bacteria 5536
401 Ga0373937_0036110 3300036401 Bacteria 4502
402 Ga0316584_0033825 3300036712 Bacteria 3787
403 Ga0373925_0002857 3300037068 Bacteria 13624
404 Ga0373925_0135890 3300037068 Bacteria 1921
405 Ga0373925_0369432 3300037068 Bacteria 1167
406 Ga0373925_0404112 3300037068 Bacteria 1114
407 Ga0395900_0244781 3300037418 Bacteria 1797
408 Ga0436364_0006078 3300037853 Bacteria 3309
409 Ga0436364_0295959 3300037853 Bacteria 1355
410 Ga0436364_0505381 3300037853 Bacteria 66783
411 Ga0395901_0387094 3300038443 Bacteria 1438
412 Ga0242420_025739 3300038996 Bacteria 1071
413 Ga0436365_0763020 3300039437 Bacteria 7635
414 Ga0436365_0936231 3300039437 Bacteria 1926
415 Ga0436360_0757620 3300039438 Bacteria 2411
416 Ga0436360_0871302 3300039438 Bacteria 1484
417 Ga0436361_0783087 3300039447 Bacteria 7661
418 Ga0436363_0343864 3300039450 Bacteria 1015
419 Ga0439434_0004801 3300042435 Bacteria 3956
420 Ga0439434_0082573 3300042435 Bacteria 1021
421 Ga0439435_0000044 3300042436 Bacteria 14055
422 Ga0439444_0003343 3300042437 Bacteria 2262
423 Ga0439460_0015586 3300042461 Bacteria 2014
424 Ga0466963_0128427 3300044694 Bacteria 1749
425 Ga0466957_0250912 3300044842 Bacteria 1177
426 Ga0451576_0516591 3300045051 Bacteria 1255
427 Ga0466958_0228396 3300045836 Bacteria 1188
428 Ga0495592_0043227 3300046454 Bacteria 3371
429 Ga0495592_0047711 3300046454 Bacteria 3189
430 Ga0495603_0107459 3300046455 Bacteria 1628
431 Ga0495629_0012832 3300046459 Bacteria 6062
432 Ga0495629_0085072 3300046459 Bacteria 2206
433 Ga0495638_0103390 3300046460 Bacteria 1700
434 Ga0495641_0064091 3300046461 Bacteria 1655
435 Ga0495651_0016719 3300046462 Bacteria 5681
436 Ga0495651_0028661 3300046462 Bacteria 4339
437 Ga0495653_0004022 3300046463 Bacteria 11871
438 Ga0495653_0013856 3300046463 Bacteria 6571
439 Ga0495653_0155596 3300046463 Bacteria 1592
440 Ga0495580_0068199 3300046472 Bacteria 2487
441 Ga0495580_0113981 3300046472 Bacteria 1878
442 Ga0495605_0127938 3300046474 Bacteria 1147
443 Ga0495639_0026038 3300046475 Bacteria 2583
444 Ga0495662_0001391 3300046476 Bacteria 11991
445 Ga0495662_0052257 3300046476 Bacteria 1973
446 Ga0495662_0065124 3300046476 Bacteria 1761
447 Ga0495664_0000854 3300046477 Bacteria 15638
448 Ga0495664_0014471 3300046477 Bacteria 4473
449 Ga0495664_0069690 3300046477 Bacteria 2099
450 Ga0495594_0075553 3300046499 Unclassified 1878
451 Ga0495608_0012022 3300046511 Bacteria 6017
452 Ga0495608_0044624 3300046511 Bacteria 2958
453 Ga0495608_0113266 3300046511 Bacteria 1743
454 Ga0495618_0002357 3300046514 Bacteria 12181
455 Ga0495618_0005360 3300046514 Bacteria 7824
456 Ga0495618_0015587 3300046514 Bacteria 4639
457 Ga0495618_0074986 3300046514 Bacteria 2155
458 Ga0495628_0029083 3300046516 Bacteria 4484
459 Ga0495628_0031255 3300046516 Bacteria 4307
460 Ga0495628_0478825 3300046516 Unclassified 901
461 Ga0495630_0006177 3300046517 Bacteria 8495
462 Ga0495630_0011171 3300046517 Bacteria 6499
463 Ga0495630_0181826 3300046517 Unclassified 1603
464 Ga0495630_0488519 3300046517 Bacteria 944
465 Ga0495666_0004437 3300046526 Bacteria 7092
466 Ga0495666_0032824 3300046526 Bacteria 2539
467 Ga0495642_0056930 3300046528 Bacteria 1616
468 Ga0495652_0002979 3300046529 Bacteria 17017
469 Ga0495652_0005448 3300046529 Bacteria 11986
470 Ga0495652_0154542 3300046529 Bacteria 1788
471 Ga0495652_0202927 3300046529 Bacteria 1503
472 Ga0495640_0005918 3300046533 Bacteria 9696
473 Ga0495640_0040849 3300046533 Bacteria 3245
474 Ga0495586_0006577 3300046535 Bacteria 6210
475 Ga0495586_0012914 3300046535 Bacteria 4430
476 Ga0495587_0018230 3300046536 Bacteria 4354
477 Ga0495598_0007747 3300046537 Bacteria 2477
478 Ga0495598_0051983 3300046537 Bacteria 1237
479 Ga0495621_0032725 3300046539 Bacteria 1789
480 Ga0495645_0001772 3300046543 Bacteria 14693
481 Ga0495645_0004794 3300046543 Bacteria 9241
482 Ga0495667_0002411 3300046559 Bacteria 12483
483 Ga0495667_0037832 3300046559 Bacteria 3214
484 Ga0495656_0039772 3300046615 Bacteria 1956
485 Ga0495634_0006350 3300046642 Bacteria 8987
486 Ga0495634_0086219 3300046642 Bacteria 2045
487 Ga0495634_0098788 3300046642 Bacteria 1888
488 Ga0495634_0105933 3300046642 Bacteria 1812
489 Ga0495634_0345751 3300046642 Bacteria 891
490 Ga0495635_0002197 3300046663 Bacteria 13268
491 Ga0495635_0007512 3300046663 Bacteria 7607
492 Ga0495635_0009754 3300046663 Bacteria 6710
493 Ga0495635_0157161 3300046663 Bacteria 1547
494 Ga0495659_0038466 3300046664 Unclassified 1699
495 Ga0495588_0136294 3300046674 Unclassified 1296
496 Ga0495657_0009163 3300046675 Bacteria 7518
497 Ga0495657_0075738 3300046675 Bacteria 2187
498 Ga0495599_0036152 3300046678 Bacteria 3100
499 Ga0495623_0002799 3300046679 Bacteria 11511
500 Ga0495646_0003366 3300046680 Bacteria 9942
501 Ga0495646_0019276 3300046680 Bacteria 4320
502 Ga0495646_0125466 3300046680 Bacteria 1449
503 Ga0495647_0046698 3300046681 Bacteria 1669
504 Ga0495658_0045835 3300046683 Bacteria 2455
505 Ga0495624_0029495 3300046690 Bacteria 3579
506 Ga0495624_0116267 3300046690 Bacteria 1644
507 Ga0495624_0246814 3300046690 Bacteria 1080
508 Ga0495600_0015386 3300046809 Bacteria 4836
509 Ga0495600_0024345 3300046809 Bacteria 3896
510 Ga0495581_0069497 3300047315 Bacteria 2036
511 Ga0495581_0258628 3300047315 Bacteria 1018
512 Ga0495604_0009356 3300047317 Bacteria 7754
513 Ga0495604_0021564 3300047317 Bacteria 5142
514 Ga0495636_0203334 3300047318 Bacteria 905
515 Ga0495674_0010284 3300047319 Bacteria 8857
516 Ga0495674_0022332 3300047319 Bacteria 5836
517 Ga0495672_0165851 3300047320 Bacteria 1131
518 Ga0495676_0118399 3300047321 Bacteria 1931
519 Ga0495676_0225737 3300047321 Bacteria 1289
520 Ga0495680_0006934 3300047322 Bacteria 10457
521 Ga0495680_0021194 3300047322 Bacteria 5445
522 Ga0495680_0108044 3300047322 Bacteria 2065
523 Ga0495675_0023103 3300047444 Bacteria 3962
524 Ga0495684_0042839 3300047471 Bacteria 3466
525 Ga0495684_0047235 3300047471 Bacteria 3293
526 Ga0495593_0006391 3300047673 Bacteria 6913
527 Ga0495593_0042302 3300047673 Bacteria 2445
528 Ga0495593_0060782 3300047673 Bacteria 1978
529 Ga0495602_0008235 3300048088 Bacteria 10888
530 Ga0495602_0083467 3300048088 Bacteria 2676
531 Ga0495614_0031776 3300048089 Bacteria 2273
532 Ga0495615_0003005 3300048090 Bacteria 2780
533 Ga0496101_0003115 3300048904 Bacteria 10261
534 Ga0496101_0044622 3300048904 Bacteria 3172
535 Ga0496101_0231387 3300048904 Bacteria 1437
536 Ga0496101_0295485 3300048904 Bacteria 1268
537 Ga0496102_0005771 3300048905 Bacteria 10526
538 Ga0496102_0006136 3300048905 Bacteria 10240
539 Ga0496102_0024027 3300048905 Bacteria 5418
540 Ga0496102_0055522 3300048905 Bacteria 3611
541 Ga0496102_0122032 3300048905 Bacteria 2434
542 Ga0496103_0063023 3300048906 Bacteria 2308
543 Ga0496103_0080284 3300048906 Bacteria 2051
544 Ga0496103_0236674 3300048906 Bacteria 1175
545 Ga0496104_0000618 3300048907 Bacteria 30466
546 Ga0496104_0005842 3300048907 Bacteria 10776
547 Ga0496104_0013745 3300048907 Bacteria 7301
548 Ga0496104_0018794 3300048907 Bacteria 6311
549 Ga0496104_0021537 3300048907 Bacteria 5920
550 Ga0496104_0273599 3300048907 Bacteria 1601
551 Ga0496105_0001514 3300048908 Bacteria 16426
552 Ga0496105_0037429 3300048908 Bacteria 3995
553 Ga0496105_0152872 3300048908 Bacteria 1896
554 Ga0496106_0005441 3300048909 Bacteria 9422
555 Ga0496106_0069698 3300048909 Bacteria 2685
556 Ga0496106_0076192 3300048909 Bacteria 2571
557 Ga0496106_0077587 3300048909 Bacteria 2547
558 Ga0496107_0003704 3300048910 Bacteria 10268
559 Ga0496107_0005110 3300048910 Bacteria 8949
560 Ga0496107_0162697 3300048910 Bacteria 1654
561 Ga0496107_0313672 3300048910 Bacteria 1167
562 Ga0496108_0000544 3300048911 Bacteria 29516
563 Ga0496108_0065717 3300048911 Bacteria 3058
564 Ga0496108_0346557 3300048911 Bacteria 1296
565 Ga0496108_0758615 3300048911 Bacteria 839
566 Ga0496109_0003416 3300048912 Bacteria 13286
567 Ga0496109_0030575 3300048912 Bacteria 4827
568 Ga0496109_0578427 3300048912 Bacteria 1059
569 Ga0496110_0001581 3300048913 Bacteria 16633
570 Ga0496110_0007612 3300048913 Bacteria 8658
571 Ga0496110_0009471 3300048913 Bacteria 7887
572 Ga0496110_0152444 3300048913 Bacteria 2093
573 Ga0496111_0002315 3300048914 Bacteria 11464
574 Ga0496111_0105187 3300048914 Bacteria 2077
575 Ga0496111_0107427 3300048914 Bacteria 2055
576 Ga0496111_0120556 3300048914 Bacteria 1937
577 Ga0496112_0001706 3300048915 Bacteria 17153
578 Ga0496112_0221587 3300048915 Bacteria 1848
579 Ga0496112_0269834 3300048915 Bacteria 1650
580 Ga0496112_0295482 3300048915 Bacteria 1566
581 Ga0496112_0364814 3300048915 Bacteria 1386
582 Ga0496113_0000577 3300048916 Bacteria 18288
583 Ga0496113_0035036 3300048916 Bacteria 3668
584 Ga0496114_0043891 3300048917 Bacteria 3707
585 Ga0496114_0249014 3300048917 Bacteria 1563
586 Ga0496114_0685759 3300048917 Bacteria 899
587 Ga0496115_0035876 3300048918 Bacteria 3925
588 Ga0496115_0082311 3300048918 Bacteria 2622
589 Ga0496115_0092249 3300048918 Bacteria 2476
590 Ga0496115_0188444 3300048918 Bacteria 1704
591 Ga0496115_0267086 3300048918 Bacteria 1406
592 Ga0496115_0334878 3300048918 Bacteria 1236
593 Ga0496126_0188476 3300048929 Bacteria 1748
594 Ga0501031_0015531 3300049568 Bacteria 4943
595 Ga0501032_0173066 3300049569 Bacteria 1415
596 Ga0501033_0004789 3300049570 Bacteria 10803
597 Ga0501033_0005891 3300049570 Bacteria 9629
598 Ga0501033_0031280 3300049570 Bacteria 4000
599 Ga0501033_0039910 3300049570 Bacteria 3506
600 Ga0501033_0201702 3300049570 Bacteria 1420
601 Ga0501034_0145164 3300049571 Bacteria 2350
602 Ga0501034_0236132 3300049571 Bacteria 1776
603 Ga0501034_0239469 3300049571 Bacteria 1761
604 Ga0501036_0010564 3300049572 Bacteria 7626
605 Ga0501036_0072802 3300049572 Bacteria 2905
606 Ga0501036_0410737 3300049572 Bacteria 1129
607 Ga0501036_0494959 3300049572 Bacteria 1017
608 Ga0501037_0000124 3300049573 Bacteria 71522
609 Ga0501037_0003538 3300049573 Bacteria 11340
610 Ga0501037_0308163 3300049573 Bacteria 1098
611 Ga0501038_0058663 3300049574 Bacteria 3299
612 Ga0501038_0061414 3300049574 Bacteria 3213
613 Ga0501038_0119788 3300049574 Bacteria 2172
614 Ga0501038_0145817 3300049574 Bacteria 1933
615 Ga0501038_0161500 3300049574 Bacteria 1821
616 Ga0501039_0158162 3300049575 Bacteria 1780
617 Ga0501039_0286338 3300049575 Bacteria 1295
618 Ga0501040_0011721 3300049576 Bacteria 5735
619 Ga0501040_0078815 3300049576 Bacteria 2280
620 Ga0501041_0039800 3300049577 Bacteria 2853
621 Ga0501041_0089201 3300049577 Bacteria 1904
622 Ga0501041_0106541 3300049577 Bacteria 1737
623 Ga0501041_0112116 3300049577 Bacteria 1692
624 Ga0501042_0001369 3300049578 Bacteria 14310
625 Ga0501042_0093140 3300049578 Bacteria 2164
626 Ga0501042_0237568 3300049578 Bacteria 1315
627 Ga0501042_0303388 3300049578 Bacteria 1154
628 Ga0501043_0000003 3300049579 Bacteria 318844
629 Ga0501043_0000013 3300049579 Bacteria 185639
630 Ga0501043_0122475 3300049579 Bacteria 2040
631 Ga0501043_0181663 3300049579 Bacteria 1639
632 Ga0501043_0201984 3300049579 Bacteria 1542
633 Ga0501046_0000099 3300049580 Bacteria 92986
634 Ga0501046_0170160 3300049580 Bacteria 1636
635 Ga0501047_0000040 3300049581 Bacteria 185677
636 Ga0501047_0022490 3300049581 Bacteria 6055
637 Ga0501047_0079948 3300049581 Bacteria 3143
638 Ga0501047_0087222 3300049581 Bacteria 2998
639 Ga0501047_0114871 3300049581 Bacteria 2574
640 Ga0501047_0120953 3300049581 Bacteria 2501
641 Ga0501047_0171066 3300049581 Bacteria 2041
642 Ga0501047_0226851 3300049581 Bacteria 1722
643 Ga0501047_0314551 3300049581 Bacteria 1406
644 Ga0501047_0375949 3300049581 Bacteria 1255
645 Ga0501048_0000932 3300049582 Bacteria 21587
646 Ga0501048_0009377 3300049582 Bacteria 7349
647 Ga0501048_0019726 3300049582 Bacteria 4944
648 Ga0501048_0056563 3300049582 Bacteria 2783
649 Ga0501067_0021984 3300049583 Bacteria 3529
650 Ga0501067_0156157 3300049583 Bacteria 1271
651 Ga0501068_0043899 3300049584 Bacteria 2690
652 Ga0501068_0156298 3300049584 Bacteria 1436
653 Ga0501069_0000003 3300049585 Bacteria 210301
654 Ga0501069_0003992 3300049585 Bacteria 7614
655 Ga0501069_0011946 3300049585 Bacteria 4608
656 Ga0501069_0049927 3300049585 Bacteria 2326
657 Ga0501070_0000321 3300049586 Bacteria 43662
658 Ga0501070_0000665 3300049586 Bacteria 31670
659 Ga0501070_0001482 3300049586 Bacteria 21004
660 Ga0501070_0168173 3300049586 Bacteria 1806
661 Ga0501071_0004774 3300049587 Bacteria 8628
662 Ga0501071_0014941 3300049587 Bacteria 5320
663 Ga0501071_0029463 3300049587 Bacteria 3874
664 Ga0501071_0397196 3300049587 Bacteria 1052
665 Ga0501072_0008121 3300049588 Bacteria 7965
666 Ga0501072_0109117 3300049588 Bacteria 2202
667 Ga0501072_0226408 3300049588 Bacteria 1490
668 Ga0501072_0228177 3300049588 Bacteria 1483
669 Ga0501072_0250925 3300049588 Bacteria 1409
670 Ga0501072_0263922 3300049588 Bacteria 1370
671 Ga0501073_0061619 3300049589 Bacteria 2617
672 Ga0501073_0066558 3300049589 Bacteria 2511
673 Ga0501073_0100359 3300049589 Bacteria 2010
674 Ga0501074_0000027 3300049590 Bacteria 67860
675 Ga0501074_0005145 3300049590 Bacteria 9400
676 Ga0501074_0005821 3300049590 Bacteria 8890
677 Ga0501074_0031335 3300049590 Bacteria 3853
678 Ga0501074_0031498 3300049590 Bacteria 3841
679 Ga0501074_0074422 3300049590 Bacteria 2439
680 Ga0501074_0130476 3300049590 Bacteria 1798
681 Ga0501075_0109380 3300049591 Bacteria 2101
682 Ga0501075_0253781 3300049591 Bacteria 1340
683 Ga0501076_0004334 3300049592 Bacteria 10068
684 Ga0501076_0053995 3300049592 Bacteria 3185
685 Ga0501076_0146955 3300049592 Bacteria 1917
686 Ga0501076_0410109 3300049592 Unclassified 1114
687 Ga0501077_0053073 3300049593 Bacteria 2574
688 Ga0501077_0192731 3300049593 Bacteria 1295
689 Ga0501077_0340474 3300049593 Bacteria 957
690 Ga0501079_0009079 3300049741 Bacteria 7530
691 Ga0501079_0023785 3300049741 Bacteria 4701
692 Ga0501079_0064766 3300049741 Bacteria 2819
693 Ga0501079_0074273 3300049741 Bacteria 2628
694 Ga0501080_0000139 3300049742 Bacteria 50565
695 Ga0501080_0005001 3300049742 Bacteria 11806
696 Ga0501080_0039043 3300049742 Bacteria 4430
697 Ga0501080_0079114 3300049742 Bacteria 3057
698 Ga0501080_0306870 3300049742 Bacteria 1439
699 Ga0501081_0003673 3300049743 Bacteria 9823
700 Ga0501081_0008074 3300049743 Bacteria 6832
701 Ga0501081_0015350 3300049743 Bacteria 5053
702 Ga0501081_0087087 3300049743 Bacteria 2193
703 Ga0501083_0000024 3300049744 Bacteria 123029
704 Ga0501083_0069649 3300049744 Bacteria 2341
705 Ga0501083_0105408 3300049744 Bacteria 1856
706 Ga0501083_0182952 3300049744 Bacteria 1368
707 Ga0501035_0001357 3300049822 Bacteria 25189
708 Ga0501035_0003123 3300049822 Bacteria 15899
709 Ga0501035_0007814 3300049822 Bacteria 9994
710 Ga0501035_0045837 3300049822 Bacteria 3933
711 Ga0501035_0051453 3300049822 Bacteria 3688
712 Ga0501035_0068824 3300049822 Bacteria 3138
713 Ga0501035_0096757 3300049822 Bacteria 2593
714 Ga0501035_0103582 3300049822 Bacteria 2496
715 Ga0501035_0122363 3300049822 Bacteria 2274
716 Ga0501035_0435005 3300049822 Bacteria 1087
717 Ga0501044_0000016 3300049823 Bacteria 231626
718 Ga0501044_0001046 3300049823 Bacteria 33251
719 Ga0501044_0014332 3300049823 Bacteria 8559
720 Ga0501044_0030367 3300049823 Bacteria 5696
721 Ga0501044_0037941 3300049823 Bacteria 5034
722 Ga0501044_0039887 3300049823 Bacteria 4895
723 Ga0501044_0109989 3300049823 Bacteria 2764
724 Ga0501044_0288048 3300049823 Bacteria 1574
725 Ga0501044_0292359 3300049823 Bacteria 1560
726 Ga0501045_0038056 3300049824 Bacteria 3498
727 Ga0501045_0080201 3300049824 Bacteria 2406
728 Ga0501045_0090153 3300049824 Bacteria 2265
729 Ga0501045_0133518 3300049824 Bacteria 1845
730 Ga0501045_0135655 3300049824 Bacteria 1830
731 Ga0501045_0136770 3300049824 Bacteria 1822
732 nmdc:mga03683_19246_c2 3300050489 Bacteria 1663
733 nmdc:mga00v17_101375_c1 3300050491 Bacteria 1818
734 nmdc:mga00v17_94680_c1 3300050491 Bacteria 1879
735 nmdc:mga0yw44_25714_c1 3300050492 Bacteria 3353
736 nmdc:mga0yw44_36773_c1 3300050492 Bacteria 2887
737 nmdc:mga0yw44_7206_c1 3300050492 Bacteria 5450
738 nmdc:mga0k408_2879_c1 3300050493 Bacteria 9123
739 nmdc:mga06z11_146544_c1 3300050494 Bacteria 1338
740 nmdc:mga06z11_55368_c1 3300050494 Bacteria 2048
741 nmdc:mga06z11_6143_c1 3300050494 Bacteria 4863
742 nmdc:mga04h51_13416_c1 3300050495 Bacteria 2319
743 nmdc:mga05p37_110528_c1 3300050507 Bacteria 3381
744 nmdc:mga05p37_13591_c2 3300050507 Bacteria 6115
745 nmdc:mga05p37_144139_c1 3300050507 Bacteria 2917
746 nmdc:mga05p37_23642_c1 3300050507 Bacteria 7460
747 nmdc:mga05p37_30735_c2 3300050507 Bacteria 3600
748 nmdc:mga05p37_351922_c1 3300050507 Bacteria 1734
749 nmdc:mga05p37_83131_c1 3300050507 Bacteria 3944
750 nmdc:mga09592_131804_c1 3300050508 Bacteria 2151
751 nmdc:mga09592_2967_c1 3300050508 Bacteria 13752
752 nmdc:mga09592_97108_c1 3300050508 Bacteria 2521
753 nmdc:mga0qj67_10255_c1 3300050509 Bacteria 6998
754 nmdc:mga0qj67_106085_c1 3300050509 Bacteria 2267
755 nmdc:mga0qj67_11822_c1 3300050509 Bacteria 6552
756 nmdc:mga0qj67_27803_c1 3300050509 Bacteria 4385
757 nmdc:mga0qj67_65631_c1 3300050509 Bacteria 2890
758 nmdc:mga0qj67_88087_c1 3300050509 Bacteria 2492
759 nmdc:mga0qj67_886_c1 3300050509 Bacteria 20528
760 nmdc:mga06r32_101016_c1 3300050510 Bacteria 2830
761 nmdc:mga06r32_108764_c1 3300050510 Bacteria 2726
762 nmdc:mga06r32_19380_c1 3300050510 Bacteria 6242
763 nmdc:mga06r32_271596_c1 3300050510 Bacteria 1683
764 nmdc:mga06r32_2722_c1 3300050510 Bacteria 15812
765 nmdc:mga06r32_326_c1 3300050510 Bacteria 39903
766 nmdc:mga06r32_51135_c1 3300050510 Bacteria 3954
767 nmdc:mga06r32_584639_c1 3300050510 Bacteria 1089
768 nmdc:mga06r32_671066_c1 3300050510 Bacteria 1004
769 nmdc:mga06r32_84675_c1 3300050510 Bacteria 3091
770 nmdc:mga08y16_100602_c1 3300050511 Bacteria 3010
771 nmdc:mga08y16_119201_c1 3300050511 Bacteria 2747
772 nmdc:mga08y16_160340_c1 3300050511 Bacteria 2337
773 nmdc:mga08y16_293895_c1 3300050511 Bacteria 1675
774 nmdc:mga08y16_52055_c1 3300050511 Bacteria 4284
775 nmdc:mga08y16_63461_c1 3300050511 Bacteria 3858
776 nmdc:mga08y16_73373_c1 3300050511 Bacteria 3566
777 nmdc:mga08y16_80106_c1 3300050511 Bacteria 3405
778 nmdc:mga0n895_20825_c1 3300050512 Bacteria 6125
779 nmdc:mga0n895_22291_c1 3300050512 Bacteria 5937
780 nmdc:mga0n895_343408_c1 3300050512 Bacteria 1512
781 nmdc:mga0n895_49235_c1 3300050512 Bacteria 4127
782 nmdc:mga0n895_526793_c1 3300050512 Bacteria 1189
783 nmdc:mga0n895_79479_c1 3300050512 Bacteria 3266
784 nmdc:mga0rr50_33097_c1 3300050513 Bacteria 3690
785 nmdc:mga0rr50_93733_c1 3300050513 Bacteria 2343
786 nmdc:mga08x19_162899_c1 3300050514 Bacteria 1515
787 nmdc:mga08x19_88759_c1 3300050514 Bacteria 2038
788 nmdc:mga0a205_132084_c1 3300050515 Bacteria 2397
789 nmdc:mga0a205_527981_c1 3300050515 Bacteria 1036
790 nmdc:mga0sz30_15352_c1 3300050516 Bacteria 3026
791 nmdc:mga0sz30_170760_c1 3300050516 Bacteria 964
792 Ga0495601_0001311 3300053077 Bacteria 13647
793 Ga0495601_0001595 3300053077 Bacteria 12519
794 Ga0495601_0012075 3300053077 Bacteria 5177
795 Ga0495601_0054380 3300053077 Bacteria 2532
796 Ga0495612_0000213 3300053078 Bacteria 24541
797 Ga0495612_0007271 3300053078 Bacteria 4530
798 Ga0495612_0013923 3300053078 Bacteria 3240
799 Ga0495612_0019969 3300053078 Bacteria 2684
800 Ga0495612_0039445 3300053078 Bacteria 1921
801 Ga0500610_0086801 3300053079 Bacteria 1628
802 Ga0495655_0009972 3300053083 Bacteria 1861
803 Ga0495595_0000240 3300053084 Bacteria 21669
804 Ga0495595_0034307 3300053084 Bacteria 2294
805 Ga0495619_0001165 3300053085 Bacteria 17262
806 Ga0495619_0002451 3300053085 Bacteria 12145
807 Ga0495619_0010589 3300053085 Bacteria 5801
808 Ga0495619_0017915 3300053085 Bacteria 4489
809 Ga0495619_0029930 3300053085 Bacteria 3521
810 Ga0495619_0059076 3300053085 Bacteria 2547
811 Ga0495619_0168834 3300053085 Bacteria 1513
812 Ga0495619_0342544 3300053085 Bacteria 1034
813 Ga0500646_0003719 3300053090 Bacteria 3908
814 Ga0500646_0041243 3300053090 Bacteria 1300
815 Ga0500566_0001471 3300053094 Bacteria 13782
816 Ga0500641_0013485 3300053096 Bacteria 3003
817 Ga0500593_012270 3300053117 Bacteria 3629
818 Ga0500594_0007213 3300053118 Bacteria 2514
819 Ga0500595_007580 3300053119 Bacteria 4494
820 Ga0500597_002499 3300053120 Bacteria 5128
821 Ga0500614_002487 3300053123 Bacteria 4100
822 Ga0500614_007050 3300053123 Bacteria 2365
823 Ga0500642_0011249 3300053130 Bacteria 3194
824 Ga0500642_0011917 3300053130 Bacteria 3133
825 Ga0500642_0051038 3300053130 Bacteria 1826
826 Ga0500642_0102596 3300053130 Bacteria 1332
827 Ga0500652_000003 3300053131 Bacteria 221528
828 Ga0500652_050255 3300053131 Bacteria 1701
829 Ga0500568_0037464 3300053139 Bacteria 1967
830 Ga0500603_001708 3300053150 Bacteria 4945
831 Ga0500604_0000255 3300053151 Bacteria 15224
832 Ga0500604_0029923 3300053151 Bacteria 1590
833 Ga0500616_0007706 3300053153 Bacteria 6796
834 Ga0500636_0018124 3300053177 Bacteria 4163
835 Ga0501084_0005808 3300054114 Bacteria 10158
836 Ga0501084_0031558 3300054114 Bacteria 4429
837 Ga0501084_0058828 3300054114 Bacteria 3216
838 Ga0501084_0069657 3300054114 Bacteria 2945
839 Ga0501084_0215005 3300054114 Bacteria 1622
840 Ga0501084_0228168 3300054114 Bacteria 1572
841 Ga0501084_0408553 3300054114 Bacteria 1147
842 Ga0501082_0008388 3300060353 Bacteria 8913
843 Ga0501082_0014628 3300060353 Bacteria 6759
844 Ga0501082_0031447 3300060353 Bacteria 4577
845 Ga0501082_0058534 3300060353 Bacteria 3320
846 Ga0501082_0196289 3300060353 Bacteria 1756
847 Ga0501082_0348010 3300060353 Unclassified 1292
848 Ga0501082_0408408 3300060353 Bacteria 1185
849 Ga0466962_0146378 3300061719 Bacteria 1145
850 Ga0530510_0086846 3300061734 Bacteria 2279
851 Ga0530510_0115336 3300061734 Bacteria 1969
852 Ga0530510_0197812 3300061734 Bacteria 1492
853 Ga0530510_0201128 3300061734 Bacteria 1480

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0039800 Ga0501041_0039800_1805_2692 258
2 3300049588 Ga0501072_0226408 Ga0501072_0226408_264_1151 258
3 3300049591 Ga0501075_0253781 Ga0501075_0253781_265_1152 258
4 3300049592 Ga0501076_0053995 Ga0501076_0053995_2164_3051 258
5 3300060353 Ga0501082_0058534 Ga0501082_0058534_953_1840 258
6 3300061734 Ga0530510_0086846 Ga0530510_0086846_1072_1959 258
7 3300013296 Ga0157374_10720323 Ga0157374_107203232 262
8 3300046516 Ga0495628_0478825 Ga0495628_0478825_13_801 262
9 3300046642 Ga0495634_0345751 Ga0495634_0345751_12_800 262
10 3300049574 Ga0501038_0161500 Ga0501038_0161500_443_1318 262
11 3300005614 Ga0068856_100444007 Ga0068856_1004440072 263
12 3300049574 Ga0501038_0145817 Ga0501038_0145817_95_892 265
13 3300049575 Ga0501039_0158162 Ga0501039_0158162_573_1370 265
14 3300049576 Ga0501040_0011721 Ga0501040_0011721_3665_4462 265
15 3300049824 Ga0501045_0080201 Ga0501045_0080201_848_1645 265
16 3300027695 Ga0209966_1037864 Ga0209966_10378641 266
17 3300003316 rootH1_10101929 rootH1_101019291 267
18 3300050516 nmdc:mga0sz30_170760_c1 nmdc:mga0sz30_170760_c1_150_953 267
19 3300006846 Ga0075430_100001038 Ga0075430_10000103818 268
20 3300006846 Ga0075430_100025536 Ga0075430_1000255364 268
21 3300013297 Ga0157378_10435382 Ga0157378_104353822 268
22 3300027360 Ga0209969_1000301 Ga0209969_10003015 268
23 3300027364 Ga0209967_1001239 Ga0209967_10012392 268
24 3300027378 Ga0209981_1005492 Ga0209981_10054922 268
25 3300027462 Ga0210000_1001102 Ga0210000_10011022 268
26 3300027526 Ga0209968_1001052 Ga0209968_10010523 268
27 3300048911 Ga0496108_0758615 Ga0496108_0758615_14_820 268
28 3300049743 Ga0501081_0015350 Ga0501081_0015350_617_1423 268
29 3300050509 nmdc:mga0qj67_27803_c1 nmdc:mga0qj67_27803_c1_839_1645 268
30 3300050509 nmdc:mga0qj67_886_c1 nmdc:mga0qj67_886_c1_16387_17193 268
31 3300050510 nmdc:mga06r32_51135_c1 nmdc:mga06r32_51135_c1_1946_2752 268
32 3300050510 nmdc:mga06r32_671066_c1 nmdc:mga06r32_671066_c1_14_820 268
33 3300006844 Ga0075428_100115363 Ga0075428_1001153632 269
34 3300049575 Ga0501039_0286338 Ga0501039_0286338_41_910 270
35 3300049824 Ga0501045_0136770 Ga0501045_0136770_781_1593 270
36 3300005614 Ga0068856_100056846 Ga0068856_1000568462 271
37 3300027907 Ga0207428_10225018 Ga0207428_102250182 271
38 3300049570 Ga0501033_0039910 Ga0501033_0039910_884_1756 271
39 3300049576 Ga0501040_0078815 Ga0501040_0078815_789_1661 271
40 3300049577 Ga0501041_0106541 Ga0501041_0106541_408_1280 271
41 3300049579 Ga0501043_0122475 Ga0501043_0122475_522_1394 271
42 3300049582 Ga0501048_0056563 Ga0501048_0056563_1396_2268 271
43 3300049588 Ga0501072_0109117 Ga0501072_0109117_367_1239 271
44 3300049590 Ga0501074_0130476 Ga0501074_0130476_707_1579 271
45 3300049741 Ga0501079_0074273 Ga0501079_0074273_968_1840 271
46 3300049743 Ga0501081_0087087 Ga0501081_0087087_696_1568 271
47 3300049824 Ga0501045_0090153 Ga0501045_0090153_930_1802 271
48 3300050510 nmdc:mga06r32_101016_c1 nmdc:mga06r32_101016_c1_786_1658 271
49 3300050510 nmdc:mga06r32_326_c1 nmdc:mga06r32_326_c1_38641_39513 271
50 3300050511 nmdc:mga08y16_73373_c1 nmdc:mga08y16_73373_c1_823_1698 271
51 3300060353 Ga0501082_0031447 Ga0501082_0031447_774_1646 271
52 3300061734 Ga0530510_0197812 Ga0530510_0197812_551_1423 271
53 3300006914 Ga0075436_100054512 Ga0075436_1000545122 275
54 3300031595 Ga0265313_10000960 Ga0265313_1000096014 275
55 3300006844 Ga0075428_100043702 Ga0075428_1000437023 276
56 3300006846 Ga0075430_100121511 Ga0075430_1001215112 276
57 3300006846 Ga0075430_100165915 Ga0075430_1001659152 276
58 3300006847 Ga0075431_100169557 Ga0075431_1001695572 276
59 3300009147 Ga0114129_10111214 Ga0114129_101112143 276
60 3300027395 Ga0209996_1009934 Ga0209996_10099342 276
61 3300027462 Ga0210000_1010799 Ga0210000_10107992 276
62 3300027543 Ga0209999_1005741 Ga0209999_10057413 276
63 3300027876 Ga0209974_10005420 Ga0209974_100054205 276
64 3300042435 Ga0439434_0004801 Ga0439434_0004801_1209_2039 276
65 3300042435 Ga0439434_0082573 Ga0439434_0082573_43_873 276
66 3300042436 Ga0439435_0000044 Ga0439435_0000044_2319_3149 276
67 3300042437 Ga0439444_0003343 Ga0439444_0003343_1050_1880 276
68 3300042461 Ga0439460_0015586 Ga0439460_0015586_582_1412 276
69 3300046511 Ga0495608_0113266 Ga0495608_0113266_544_1374 276
70 3300046526 Ga0495666_0004437 Ga0495666_0004437_14_844 276
71 3300046537 Ga0495598_0051983 Ga0495598_0051983_312_1214 276
72 3300048904 Ga0496101_0295485 Ga0496101_0295485_10_840 276
73 3300049579 Ga0501043_0000013 Ga0501043_0000013_9499_10368 276
74 3300049580 Ga0501046_0000099 Ga0501046_0000099_52706_53575 276
75 3300049581 Ga0501047_0000040 Ga0501047_0000040_9499_10368 276
76 3300049582 Ga0501048_0000932 Ga0501048_0000932_11240_12109 276
77 3300049590 Ga0501074_0074422 Ga0501074_0074422_867_1697 276
78 3300049824 Ga0501045_0038056 Ga0501045_0038056_852_1721 276
79 3300050507 nmdc:mga05p37_13591_c2 nmdc:mga05p37_13591_c2_3970_4800 276
80 3300050508 nmdc:mga09592_2967_c1 nmdc:mga09592_2967_c1_11696_12526 276
81 3300050509 nmdc:mga0qj67_106085_c1 nmdc:mga0qj67_106085_c1_367_1197 276
82 3300050510 nmdc:mga06r32_2722_c1 nmdc:mga06r32_2722_c1_14702_15532 276
83 3300050510 nmdc:mga06r32_584639_c1 nmdc:mga06r32_584639_c1_21_851 276
84 3300060353 Ga0501082_0196289 Ga0501082_0196289_430_1299 276
85 3300053118 Ga0500594_0007213 Ga0500594_0007213_755_1621 277
86 3300005345 Ga0070692_10054837 Ga0070692_100548372 278
87 3300025944 Ga0207661_10323570 Ga0207661_103235702 278
88 3300035090 Ga0373949_0000762 Ga0373949_0000762_778_1647 278
89 3300046690 Ga0495624_0116267 Ga0495624_0116267_182_1057 278
90 3300005535 Ga0070684_100068425 Ga0070684_1000684251 279
91 3300021384 Ga0213876_10027264 Ga0213876_100272642 279
92 3300026041 Ga0207639_10126065 Ga0207639_101260652 279
93 3300031251 Ga0265327_10004354 Ga0265327_100043545 279
94 3300039437 Ga0436365_0763020 Ga0436365_0763020_3532_4404 279
95 3300048907 Ga0496104_0018794 Ga0496104_0018794_4238_5110 279
96 3300048911 Ga0496108_0346557 Ga0496108_0346557_37_909 279
97 3300005365 Ga0070688_100097895 Ga0070688_1000978952 280
98 3300014968 Ga0157379_10156673 Ga0157379_101566732 280
99 3300025927 Ga0207687_10110692 Ga0207687_101106922 280
100 3300025931 Ga0207644_10215155 Ga0207644_102151552 280
101 3300046472 Ga0495580_0113981 Ga0495580_0113981_420_1295 280
102 3300048911 Ga0496108_0065717 Ga0496108_0065717_206_1081 280
103 3300048913 Ga0496110_0009471 Ga0496110_0009471_1457_2332 280
104 3300048915 Ga0496112_0364814 Ga0496112_0364814_174_1049 280
105 3300031824 Ga0307413_10079368 Ga0307413_100793682 281
106 3300031901 Ga0307406_10402972 Ga0307406_104029721 281
107 3300032002 Ga0307416_100140989 Ga0307416_1001409893 281
108 3300028800 Ga0265338_10251082 Ga0265338_102510822 282
109 3300031240 Ga0265320_10008692 Ga0265320_100086928 282
110 3300031711 Ga0265314_10007016 Ga0265314_100070168 282
111 3300035116 Ga0373945_0002449 Ga0373945_0002449_4700_5614 282
112 3300035170 Ga0373943_0000537 Ga0373943_0000537_7735_8649 282
113 3300035695 Ga0373927_0002460 Ga0373927_0002460_10980_11894 282
114 3300035725 Ga0373947_0004973 Ga0373947_0004973_5601_6473 282
115 3300037068 Ga0373925_0002857 Ga0373925_0002857_12542_13456 282
116 3300046517 Ga0495630_0011171 Ga0495630_0011171_4602_5516 282
117 3300046526 Ga0495666_0032824 Ga0495666_0032824_948_1820 282
118 3300046663 Ga0495635_0157161 Ga0495635_0157161_99_1013 282
119 3300047315 Ga0495581_0069497 Ga0495581_0069497_608_1480 282
120 3300047321 Ga0495676_0225737 Ga0495676_0225737_261_1175 282
121 3300047673 Ga0495593_0006391 Ga0495593_0006391_2370_3284 282
122 3300048089 Ga0495614_0031776 Ga0495614_0031776_1054_1968 282
123 3300044694 Ga0466963_0128427 Ga0466963_0128427_700_1572 283
124 3300044842 Ga0466957_0250912 Ga0466957_0250912_110_982 283
125 3300045836 Ga0466958_0228396 Ga0466958_0228396_156_1028 283
126 3300046528 Ga0495642_0056930 Ga0495642_0056930_710_1579 283
127 3300053123 Ga0500614_007050 Ga0500614_007050_1129_1998 283
128 3300061719 Ga0466962_0146378 Ga0466962_0146378_136_1008 283
129 3300005563 Ga0068855_100359197 Ga0068855_1003591972 284
130 3300005719 Ga0068861_100110705 Ga0068861_1001107053 284
131 3300009093 Ga0105240_10636057 Ga0105240_106360572 284
132 3300009094 Ga0111539_10128038 Ga0111539_101280382 284
133 3300009094 Ga0111539_10137933 Ga0111539_101379334 284
134 3300013306 Ga0163162_10085892 Ga0163162_100858922 284
135 3300031241 Ga0265325_10008018 Ga0265325_100080187 284
136 3300035088 Ga0373940_0039283 Ga0373940_0039283_401_1255 284
137 3300035092 Ga0373952_0005802 Ga0373952_0005802_1096_1950 284
138 3300035114 Ga0373939_0000939 Ga0373939_0000939_1445_2299 284
139 3300035115 Ga0373941_0026413 Ga0373941_0026413_764_1618 284
140 3300035207 Ga0373942_0004147 Ga0373942_0004147_2492_3346 284
141 3300035691 Ga0373931_0000865 Ga0373931_0000865_379_1233 284
142 3300047318 Ga0495636_0203334 Ga0495636_0203334_14_886 284
143 3300049573 Ga0501037_0308163 Ga0501037_0308163_35_907 284
144 3300049577 Ga0501041_0112116 Ga0501041_0112116_421_1293 284
145 3300049587 Ga0501071_0029463 Ga0501071_0029463_1198_2070 284
146 3300049588 Ga0501072_0228177 Ga0501072_0228177_174_1046 284
147 3300049742 Ga0501080_0039043 Ga0501080_0039043_2031_2903 284
148 3300050511 nmdc:mga08y16_80106_c1 nmdc:mga08y16_80106_c1_606_1460 284
149 3300050512 nmdc:mga0n895_20825_c1 nmdc:mga0n895_20825_c1_3796_4650 284
150 3300005985 Ga0081539_10040250 Ga0081539_100402502 285
151 3300021384 Ga0213876_10046534 Ga0213876_100465342 285
152 3300039437 Ga0436365_0936231 Ga0436365_0936231_595_1461 285
153 3300047471 Ga0495684_0047235 Ga0495684_0047235_680_1552 285
154 3300025986 Ga0207658_10148586 Ga0207658_101485862 287
155 3300049571 Ga0501034_0236132 Ga0501034_0236132_853_1725 287
156 3300049581 Ga0501047_0079948 Ga0501047_0079948_661_1533 287
157 3300005338 Ga0068868_100418451 Ga0068868_1004184512 288
158 3300005367 Ga0070667_100194491 Ga0070667_1001944911 288
159 3300009098 Ga0105245_10009970 Ga0105245_100099706 288
160 3300009148 Ga0105243_10083844 Ga0105243_100838442 288
161 3300009176 Ga0105242_10425437 Ga0105242_104254372 288
162 3300009177 Ga0105248_10014889 Ga0105248_100148896 288
163 3300025933 Ga0207706_10206689 Ga0207706_102066892 288
164 3300025935 Ga0207709_10039578 Ga0207709_100395783 288
165 3300025960 Ga0207651_10071915 Ga0207651_100719153 288
166 3300025986 Ga0207658_10133627 Ga0207658_101336271 288
167 3300053090 Ga0500646_0003719 Ga0500646_0003719_2388_3254 288
168 3300053139 Ga0500568_0037464 Ga0500568_0037464_279_1145 288
169 3300053151 Ga0500604_0000255 Ga0500604_0000255_8246_9112 288
170 3300005471 Ga0070698_100107974 Ga0070698_1001079742 289
171 3300005535 Ga0070684_100175094 Ga0070684_1001750942 289
172 3300005543 Ga0070672_100086593 Ga0070672_1000865932 289
173 3300005544 Ga0070686_100105802 Ga0070686_1001058022 289
174 3300005614 Ga0068856_100282343 Ga0068856_1002823431 289
175 3300005842 Ga0068858_100396431 Ga0068858_1003964312 289
176 3300005983 Ga0081540_1007933 Ga0081540_10079332 289
177 3300005983 Ga0081540_1070642 Ga0081540_10706422 289
178 3300006175 Ga0070712_100001365 Ga0070712_10000136510 289
179 3300006177 Ga0075362_10025194 Ga0075362_100251942 289
180 3300006195 Ga0075366_10003908 Ga0075366_100039087 289
181 3300006237 Ga0097621_100034275 Ga0097621_1000342754 289
182 3300006358 Ga0068871_100040552 Ga0068871_1000405522 289
183 3300009094 Ga0111539_10439485 Ga0111539_104394852 289
184 3300009101 Ga0105247_10159397 Ga0105247_101593972 289
185 3300009147 Ga0114129_10110595 Ga0114129_101105952 289
186 3300009147 Ga0114129_10257894 Ga0114129_102578942 289
187 3300009147 Ga0114129_10643814 Ga0114129_106438142 289
188 3300025291 Ga0209675_1002489 Ga0209675_10024898 289
189 3300025915 Ga0207693_10004385 Ga0207693_100043859 289
190 3300026035 Ga0207703_10334189 Ga0207703_103341892 289
191 3300031242 Ga0265329_10011112 Ga0265329_100111123 289
192 3300031247 Ga0265340_10006108 Ga0265340_100061083 289
193 3300031249 Ga0265339_10009558 Ga0265339_100095585 289
194 3300031250 Ga0265331_10028922 Ga0265331_100289222 289
195 3300031712 Ga0265342_10000026 Ga0265342_10000026120 289
196 3300031824 Ga0307413_10256068 Ga0307413_102560682 289
197 3300031911 Ga0307412_10121879 Ga0307412_101218792 289
198 3300035119 Ga0373956_0052024 Ga0373956_0052024_926_1795 289
199 3300035171 Ga0373946_0088240 Ga0373946_0088240_339_1208 289
200 3300035172 Ga0373955_0057057 Ga0373955_0057057_766_1635 289
201 3300035241 Ga0373961_0033728 Ga0373961_0033728_350_1219 289
202 3300035695 Ga0373927_0019146 Ga0373927_0019146_1116_1985 289
203 3300035724 Ga0373933_0011665 Ga0373933_0011665_1166_2035 289
204 3300036401 Ga0373937_0023654 Ga0373937_0023654_3200_4069 289
205 3300036712 Ga0316584_0033825 Ga0316584_0033825_1352_2221 289
206 3300037853 Ga0436364_0006078 Ga0436364_0006078_733_1602 289
207 3300037853 Ga0436364_0295959 Ga0436364_0295959_309_1181 289
208 3300037853 Ga0436364_0505381 Ga0436364_0505381_9436_10308 289
209 3300039438 Ga0436360_0757620 Ga0436360_0757620_529_1398 289
210 3300039447 Ga0436361_0783087 Ga0436361_0783087_4966_5835 289
211 3300046454 Ga0495592_0047711 Ga0495592_0047711_1551_2420 289
212 3300046462 Ga0495651_0016719 Ga0495651_0016719_3353_4222 289
213 3300046463 Ga0495653_0013856 Ga0495653_0013856_2388_3257 289
214 3300046511 Ga0495608_0044624 Ga0495608_0044624_1263_2132 289
215 3300046514 Ga0495618_0015587 Ga0495618_0015587_1382_2251 289
216 3300046516 Ga0495628_0031255 Ga0495628_0031255_3199_4068 289
217 3300046529 Ga0495652_0005448 Ga0495652_0005448_5703_6572 289
218 3300046533 Ga0495640_0005918 Ga0495640_0005918_4464_5333 289
219 3300046536 Ga0495587_0018230 Ga0495587_0018230_2920_3789 289
220 3300046537 Ga0495598_0007747 Ga0495598_0007747_1322_2191 289
221 3300046559 Ga0495667_0002411 Ga0495667_0002411_3889_4758 289
222 3300046615 Ga0495656_0039772 Ga0495656_0039772_533_1402 289
223 3300046642 Ga0495634_0098788 Ga0495634_0098788_440_1309 289
224 3300046663 Ga0495635_0007512 Ga0495635_0007512_3251_4120 289
225 3300046675 Ga0495657_0075738 Ga0495657_0075738_694_1563 289
226 3300046680 Ga0495646_0019276 Ga0495646_0019276_2447_3316 289
227 3300046681 Ga0495647_0046698 Ga0495647_0046698_144_1013 289
228 3300046809 Ga0495600_0024345 Ga0495600_0024345_273_1142 289
229 3300047317 Ga0495604_0009356 Ga0495604_0009356_5109_5978 289
230 3300047322 Ga0495680_0006934 Ga0495680_0006934_2217_3086 289
231 3300048088 Ga0495602_0008235 Ga0495602_0008235_1803_2672 289
232 3300048905 Ga0496102_0024027 Ga0496102_0024027_3104_3973 289
233 3300048907 Ga0496104_0021537 Ga0496104_0021537_4187_5056 289
234 3300048908 Ga0496105_0037429 Ga0496105_0037429_618_1487 289
235 3300049572 Ga0501036_0072802 Ga0501036_0072802_647_1516 289
236 3300049578 Ga0501042_0001369 Ga0501042_0001369_2972_3841 289
237 3300049582 Ga0501048_0009377 Ga0501048_0009377_2361_3230 289
238 3300049583 Ga0501067_0021984 Ga0501067_0021984_1593_2534 289
239 3300049584 Ga0501068_0156298 Ga0501068_0156298_291_1160 289
240 3300049587 Ga0501071_0014941 Ga0501071_0014941_1023_1892 289
241 3300049588 Ga0501072_0250925 Ga0501072_0250925_191_1063 289
242 3300049589 Ga0501073_0061619 Ga0501073_0061619_240_1112 289
243 3300049589 Ga0501073_0100359 Ga0501073_0100359_866_1735 289
244 3300049590 Ga0501074_0031498 Ga0501074_0031498_705_1577 289
245 3300049592 Ga0501076_0004334 Ga0501076_0004334_2492_3361 289
246 3300049742 Ga0501080_0079114 Ga0501080_0079114_738_1628 289
247 3300049743 Ga0501081_0003673 Ga0501081_0003673_8174_9043 289
248 3300050507 nmdc:mga05p37_351922_c1 nmdc:mga05p37_351922_c1_821_1690 289
249 3300050507 nmdc:mga05p37_83131_c1 nmdc:mga05p37_83131_c1_2386_3261 289
250 3300050515 nmdc:mga0a205_132084_c1 nmdc:mga0a205_132084_c1_531_1406 289
251 3300050515 nmdc:mga0a205_527981_c1 nmdc:mga0a205_527981_c1_143_1012 289
252 3300053077 Ga0495601_0001595 Ga0495601_0001595_8203_9072 289
253 3300053078 Ga0495612_0019969 Ga0495612_0019969_1505_2374 289
254 3300053078 Ga0495612_0039445 Ga0495612_0039445_371_1240 289
255 3300053084 Ga0495595_0034307 Ga0495595_0034307_550_1419 289
256 3300053085 Ga0495619_0002451 Ga0495619_0002451_10069_10938 289
257 3300053085 Ga0495619_0059076 Ga0495619_0059076_942_1811 289
258 3300053085 Ga0495619_0342544 Ga0495619_0342544_98_967 289
259 3300053094 Ga0500566_0001471 Ga0500566_0001471_2199_3068 289
260 3300053120 Ga0500597_002499 Ga0500597_002499_3260_4129 289
261 3300053123 Ga0500614_002487 Ga0500614_002487_1123_1992 289
262 3300053130 Ga0500642_0011249 Ga0500642_0011249_2272_3141 289
263 3300053130 Ga0500642_0011917 Ga0500642_0011917_2183_3052 289
264 3300053150 Ga0500603_001708 Ga0500603_001708_2351_3220 289
265 3300053177 Ga0500636_0018124 Ga0500636_0018124_2244_3113 289
266 3300054114 Ga0501084_0058828 Ga0501084_0058828_1516_2385 289
267 3300003215 JGI25153J46596_10003964 JGI25153J46596_100039646 290
268 3300005290 Ga0065712_10022039 Ga0065712_100220392 290
269 3300005295 Ga0065707_10201144 Ga0065707_102011441 290
270 3300005327 Ga0070658_10007812 Ga0070658_100078125 290
271 3300005327 Ga0070658_10163506 Ga0070658_101635062 290
272 3300005330 Ga0070690_100011486 Ga0070690_1000114865 290
273 3300005334 Ga0068869_100032828 Ga0068869_1000328284 290
274 3300005335 Ga0070666_10187404 Ga0070666_101874042 290
275 3300005336 Ga0070680_100004671 Ga0070680_1000046719 290
276 3300005336 Ga0070680_100010183 Ga0070680_1000101834 290
277 3300005336 Ga0070680_100081170 Ga0070680_1000811702 290
278 3300005337 Ga0070682_100060440 Ga0070682_1000604402 290
279 3300005338 Ga0068868_100327538 Ga0068868_1003275382 290
280 3300005339 Ga0070660_100025632 Ga0070660_1000256322 290
281 3300005339 Ga0070660_100242405 Ga0070660_1002424052 290
282 3300005340 Ga0070689_100003048 Ga0070689_10000304811 290
283 3300005340 Ga0070689_100182890 Ga0070689_1001828902 290
284 3300005341 Ga0070691_10002385 Ga0070691_100023852 290
285 3300005343 Ga0070687_100223455 Ga0070687_1002234551 290
286 3300005344 Ga0070661_100129809 Ga0070661_1001298092 290
287 3300005347 Ga0070668_100175965 Ga0070668_1001759652 290
288 3300005354 Ga0070675_100227172 Ga0070675_1002271722 290
289 3300005355 Ga0070671_100001629 Ga0070671_10000162919 290
290 3300005355 Ga0070671_100179031 Ga0070671_1001790312 290
291 3300005356 Ga0070674_100005640 Ga0070674_1000056407 290
292 3300005356 Ga0070674_100265233 Ga0070674_1002652332 290
293 3300005365 Ga0070688_100010598 Ga0070688_1000105983 290
294 3300005365 Ga0070688_100103190 Ga0070688_1001031902 290
295 3300005366 Ga0070659_100138178 Ga0070659_1001381782 290
296 3300005367 Ga0070667_100238863 Ga0070667_1002388632 290
297 3300005406 Ga0070703_10000863 Ga0070703_100008639 290
298 3300005434 Ga0070709_10044315 Ga0070709_100443153 290
299 3300005434 Ga0070709_10089360 Ga0070709_100893602 290
300 3300005435 Ga0070714_100015537 Ga0070714_1000155374 290
301 3300005435 Ga0070714_100034473 Ga0070714_1000344736 290
302 3300005436 Ga0070713_100006445 Ga0070713_1000064456 290
303 3300005436 Ga0070713_100066826 Ga0070713_1000668262 290
304 3300005436 Ga0070713_100175961 Ga0070713_1001759612 290
305 3300005439 Ga0070711_100031327 Ga0070711_1000313273 290
306 3300005439 Ga0070711_100086139 Ga0070711_1000861392 290
307 3300005439 Ga0070711_100130881 Ga0070711_1001308812 290
308 3300005439 Ga0070711_100199513 Ga0070711_1001995132 290
309 3300005440 Ga0070705_100002047 Ga0070705_1000020479 290
310 3300005441 Ga0070700_100006099 Ga0070700_1000060995 290
311 3300005441 Ga0070700_100307430 Ga0070700_1003074301 290
312 3300005444 Ga0070694_100002834 Ga0070694_1000028349 290
313 3300005444 Ga0070694_100194113 Ga0070694_1001941132 290
314 3300005456 Ga0070678_100135240 Ga0070678_1001352402 290
315 3300005457 Ga0070662_100088159 Ga0070662_1000881592 290
316 3300005457 Ga0070662_100226547 Ga0070662_1002265472 290
317 3300005458 Ga0070681_10039242 Ga0070681_100392422 290
318 3300005458 Ga0070681_10046550 Ga0070681_100465503 290
319 3300005459 Ga0068867_100379411 Ga0068867_1003794111 290
320 3300005466 Ga0070685_10034379 Ga0070685_100343792 290
321 3300005466 Ga0070685_10068286 Ga0070685_100682862 290
322 3300005466 Ga0070685_10153428 Ga0070685_101534282 290
323 3300005471 Ga0070698_100138364 Ga0070698_1001383642 290
324 3300005518 Ga0070699_100000676 Ga0070699_1000006766 290
325 3300005518 Ga0070699_100008160 Ga0070699_1000081609 290
326 3300005518 Ga0070699_100037744 Ga0070699_1000377443 290
327 3300005530 Ga0070679_100018216 Ga0070679_1000182168 290
328 3300005530 Ga0070679_100031611 Ga0070679_1000316114 290
329 3300005530 Ga0070679_100080118 Ga0070679_1000801182 290
330 3300005530 Ga0070679_100543894 Ga0070679_1005438942 290
331 3300005539 Ga0068853_100448012 Ga0068853_1004480121 290
332 3300005543 Ga0070672_100129074 Ga0070672_1001290742 290
333 3300005544 Ga0070686_100053639 Ga0070686_1000536392 290
334 3300005544 Ga0070686_100148990 Ga0070686_1001489901 290
335 3300005545 Ga0070695_100002706 Ga0070695_1000027069 290
336 3300005545 Ga0070695_100088144 Ga0070695_1000881442 290
337 3300005546 Ga0070696_100003618 Ga0070696_1000036189 290
338 3300005547 Ga0070693_100258742 Ga0070693_1002587421 290
339 3300005548 Ga0070665_100009831 Ga0070665_1000098314 290
340 3300005549 Ga0070704_100002596 Ga0070704_1000025969 290
341 3300005549 Ga0070704_100192950 Ga0070704_1001929502 290
342 3300005563 Ga0068855_100019415 Ga0068855_1000194155 290
343 3300005615 Ga0070702_100017320 Ga0070702_1000173203 290
344 3300005617 Ga0068859_100053261 Ga0068859_1000532615 290
345 3300005617 Ga0068859_100148530 Ga0068859_1001485302 290
346 3300005617 Ga0068859_100157789 Ga0068859_1001577892 290
347 3300005719 Ga0068861_100334322 Ga0068861_1003343222 290
348 3300005840 Ga0068870_10032553 Ga0068870_100325532 290
349 3300005937 Ga0081455_10002266 Ga0081455_100022665 290
350 3300005937 Ga0081455_10014076 Ga0081455_100140766 290
351 3300005937 Ga0081455_10022274 Ga0081455_100222745 290
352 3300005937 Ga0081455_10071649 Ga0081455_100716492 290
353 3300005981 Ga0081538_10032375 Ga0081538_100323753 290
354 3300005981 Ga0081538_10035528 Ga0081538_100355284 290
355 3300005981 Ga0081538_10038133 Ga0081538_100381332 290
356 3300005983 Ga0081540_1000413 Ga0081540_100041337 290
357 3300005983 Ga0081540_1037671 Ga0081540_10376712 290
358 3300005985 Ga0081539_10009410 Ga0081539_100094107 290
359 3300005985 Ga0081539_10029464 Ga0081539_100294642 290
360 3300005985 Ga0081539_10055264 Ga0081539_100552642 290
361 3300006028 Ga0070717_10001832 Ga0070717_1000183212 290
362 3300006028 Ga0070717_10271317 Ga0070717_102713172 290
363 3300006028 Ga0070717_10291206 Ga0070717_102912062 290
364 3300006038 Ga0075365_10015329 Ga0075365_100153292 290
365 3300006038 Ga0075365_10031607 Ga0075365_100316073 290
366 3300006038 Ga0075365_10072168 Ga0075365_100721682 290
367 3300006042 Ga0075368_10051433 Ga0075368_100514332 290
368 3300006051 Ga0075364_10265500 Ga0075364_102655002 290
369 3300006163 Ga0070715_10000773 Ga0070715_100007732 290
370 3300006173 Ga0070716_100031558 Ga0070716_1000315583 290
371 3300006175 Ga0070712_100002949 Ga0070712_1000029492 290
372 3300006177 Ga0075362_10044880 Ga0075362_100448802 290
373 3300006178 Ga0075367_10010335 Ga0075367_100103354 290
374 3300006178 Ga0075367_10083360 Ga0075367_100833602 290
375 3300006186 Ga0075369_10003208 Ga0075369_100032083 290
376 3300006186 Ga0075369_10091376 Ga0075369_100913762 290
377 3300006195 Ga0075366_10003186 Ga0075366_100031865 290
378 3300006237 Ga0097621_100208396 Ga0097621_1002083962 290
379 3300006358 Ga0068871_100024425 Ga0068871_1000244254 290
380 3300006844 Ga0075428_100033401 Ga0075428_1000334013 290
381 3300006844 Ga0075428_100072613 Ga0075428_1000726132 290
382 3300006844 Ga0075428_100138265 Ga0075428_1001382652 290
383 3300006844 Ga0075428_100281631 Ga0075428_1002816312 290
384 3300006844 Ga0075428_100429258 Ga0075428_1004292582 290
385 3300006846 Ga0075430_100008855 Ga0075430_1000088555 290
386 3300006846 Ga0075430_100035755 Ga0075430_1000357554 290
387 3300006846 Ga0075430_100101673 Ga0075430_1001016732 290
388 3300006846 Ga0075430_100229900 Ga0075430_1002299002 290
389 3300006847 Ga0075431_100072882 Ga0075431_1000728824 290
390 3300006847 Ga0075431_100227964 Ga0075431_1002279642 290
391 3300006847 Ga0075431_100255749 Ga0075431_1002557492 290
392 3300006852 Ga0075433_10040253 Ga0075433_100402535 290
393 3300006871 Ga0075434_100006551 Ga0075434_1000065515 290
394 3300006871 Ga0075434_100036000 Ga0075434_1000360003 290
395 3300006871 Ga0075434_100226630 Ga0075434_1002266302 290
396 3300006871 Ga0075434_100453329 Ga0075434_1004533292 290
397 3300006880 Ga0075429_100118197 Ga0075429_1001181972 290
398 3300006881 Ga0068865_100139009 Ga0068865_1001390092 290
399 3300006931 Ga0097620_100053263 Ga0097620_1000532635 290
400 3300006931 Ga0097620_100148516 Ga0097620_1001485162 290
401 3300006931 Ga0097620_100157776 Ga0097620_1001577762 290
402 3300007076 Ga0075435_100061185 Ga0075435_1000611852 290
403 3300007076 Ga0075435_100189322 Ga0075435_1001893222 290
404 3300009093 Ga0105240_10018112 Ga0105240_100181122 290
405 3300009094 Ga0111539_10039620 Ga0111539_100396204 290
406 3300009094 Ga0111539_10406481 Ga0111539_104064812 290
407 3300009094 Ga0111539_10441686 Ga0111539_104416862 290
408 3300009094 Ga0111539_10521566 Ga0111539_105215662 290
409 3300009094 Ga0111539_10767389 Ga0111539_107673892 290
410 3300009098 Ga0105245_10007619 Ga0105245_100076193 290
411 3300009147 Ga0114129_10005876 Ga0114129_100058765 290
412 3300009147 Ga0114129_10031337 Ga0114129_100313375 290
413 3300009147 Ga0114129_10119370 Ga0114129_101193703 290
414 3300009147 Ga0114129_10210234 Ga0114129_102102342 290
415 3300009147 Ga0114129_10222381 Ga0114129_102223812 290
416 3300009148 Ga0105243_10057333 Ga0105243_100573332 290
417 3300009174 Ga0105241_10456676 Ga0105241_104566761 290
418 3300009176 Ga0105242_10042703 Ga0105242_100427033 290
419 3300009177 Ga0105248_10087238 Ga0105248_100872382 290
420 3300009177 Ga0105248_10158891 Ga0105248_101588912 290
421 3300009177 Ga0105248_10179367 Ga0105248_101793672 290
422 3300009545 Ga0105237_10074588 Ga0105237_100745882 290
423 3300009551 Ga0105238_10083801 Ga0105238_100838012 290
424 3300009551 Ga0105238_10121564 Ga0105238_101215643 290
425 3300009553 Ga0105249_10012920 Ga0105249_100129205 290
426 3300009553 Ga0105249_10348651 Ga0105249_103486512 290
427 3300010375 Ga0105239_10090721 Ga0105239_100907212 290
428 3300010375 Ga0105239_10473938 Ga0105239_104739382 290
429 3300011119 Ga0105246_10435893 Ga0105246_104358932 290
430 3300013100 Ga0157373_10078964 Ga0157373_100789643 290
431 3300013105 Ga0157369_10436259 Ga0157369_104362592 290
432 3300013297 Ga0157378_10113655 Ga0157378_101136552 290
433 3300013306 Ga0163162_10168685 Ga0163162_101686852 290
434 3300013306 Ga0163162_10304138 Ga0163162_103041382 290
435 3300013308 Ga0157375_10147328 Ga0157375_101473282 290
436 3300013308 Ga0157375_10363324 Ga0157375_103633241 290
437 3300014325 Ga0163163_10052576 Ga0163163_100525764 290
438 3300014325 Ga0163163_10235232 Ga0163163_102352322 290
439 3300014326 Ga0157380_10212780 Ga0157380_102127802 290
440 3300014968 Ga0157379_10019047 Ga0157379_100190476 290
441 3300014968 Ga0157379_10217508 Ga0157379_102175082 290
442 3300014969 Ga0157376_10660073 Ga0157376_106600731 290
443 3300017792 Ga0163161_10319628 Ga0163161_103196282 290
444 3300021361 Ga0213872_10037343 Ga0213872_100373432 290
445 3300021377 Ga0213874_10099192 Ga0213874_100991921 290
446 3300025297 Ga0209758_1003526 Ga0209758_100352610 290
447 3300025885 Ga0207653_10011134 Ga0207653_100111342 290
448 3300025893 Ga0207682_10036882 Ga0207682_100368822 290
449 3300025898 Ga0207692_10008130 Ga0207692_100081302 290
450 3300025901 Ga0207688_10093977 Ga0207688_100939772 290
451 3300025905 Ga0207685_10001687 Ga0207685_100016873 290
452 3300025906 Ga0207699_10125925 Ga0207699_101259252 290
453 3300025906 Ga0207699_10182043 Ga0207699_101820431 290
454 3300025907 Ga0207645_10084627 Ga0207645_100846272 290
455 3300025907 Ga0207645_10190517 Ga0207645_101905171 290
456 3300025908 Ga0207643_10077870 Ga0207643_100778702 290
457 3300025909 Ga0207705_10006429 Ga0207705_100064297 290
458 3300025911 Ga0207654_10305260 Ga0207654_103052601 290
459 3300025912 Ga0207707_10134306 Ga0207707_101343062 290
460 3300025914 Ga0207671_10248297 Ga0207671_102482972 290
461 3300025915 Ga0207693_10001110 Ga0207693_1000111023 290
462 3300025915 Ga0207693_10005324 Ga0207693_100053249 290
463 3300025915 Ga0207693_10018460 Ga0207693_100184603 290
464 3300025916 Ga0207663_10073555 Ga0207663_100735552 290
465 3300025916 Ga0207663_10242323 Ga0207663_102423232 290
466 3300025916 Ga0207663_10253747 Ga0207663_102537472 290
467 3300025917 Ga0207660_10003455 Ga0207660_100034555 290
468 3300025917 Ga0207660_10052516 Ga0207660_100525162 290
469 3300025918 Ga0207662_10021594 Ga0207662_100215943 290
470 3300025918 Ga0207662_10059225 Ga0207662_100592252 290
471 3300025919 Ga0207657_10048882 Ga0207657_100488823 290
472 3300025919 Ga0207657_10064034 Ga0207657_100640342 290
473 3300025920 Ga0207649_10271451 Ga0207649_102714512 290
474 3300025921 Ga0207652_10013357 Ga0207652_100133576 290
475 3300025921 Ga0207652_10141511 Ga0207652_101415112 290
476 3300025921 Ga0207652_10195031 Ga0207652_101950312 290
477 3300025921 Ga0207652_10229440 Ga0207652_102294402 290
478 3300025922 Ga0207646_10143246 Ga0207646_101432462 290
479 3300025924 Ga0207694_10170549 Ga0207694_101705492 290
480 3300025925 Ga0207650_10003903 Ga0207650_100039039 290
481 3300025926 Ga0207659_10149531 Ga0207659_101495312 290
482 3300025927 Ga0207687_10067466 Ga0207687_100674661 290
483 3300025928 Ga0207700_10007214 Ga0207700_100072143 290
484 3300025928 Ga0207700_10356154 Ga0207700_103561542 290
485 3300025929 Ga0207664_10106902 Ga0207664_101069022 290
486 3300025931 Ga0207644_10086654 Ga0207644_100866542 290
487 3300025931 Ga0207644_10094770 Ga0207644_100947702 290
488 3300025932 Ga0207690_10324857 Ga0207690_103248571 290
489 3300025932 Ga0207690_10344223 Ga0207690_103442232 290
490 3300025933 Ga0207706_10003165 Ga0207706_1000316511 290
491 3300025933 Ga0207706_10015943 Ga0207706_100159433 290
492 3300025933 Ga0207706_10028849 Ga0207706_100288492 290
493 3300025933 Ga0207706_10080732 Ga0207706_100807321 290
494 3300025933 Ga0207706_10265618 Ga0207706_102656182 290
495 3300025935 Ga0207709_10070805 Ga0207709_100708052 290
496 3300025936 Ga0207670_10005309 Ga0207670_100053093 290
497 3300025936 Ga0207670_10227793 Ga0207670_102277932 290
498 3300025937 Ga0207669_10008848 Ga0207669_100088483 290
499 3300025937 Ga0207669_10040865 Ga0207669_100408652 290
500 3300025938 Ga0207704_10070029 Ga0207704_100700292 290
501 3300025939 Ga0207665_10013442 Ga0207665_100134421 290
502 3300025939 Ga0207665_10085932 Ga0207665_100859322 290
503 3300025940 Ga0207691_10398930 Ga0207691_103989302 290
504 3300025941 Ga0207711_10066206 Ga0207711_100662064 290
505 3300025941 Ga0207711_10174196 Ga0207711_101741961 290
506 3300025942 Ga0207689_10050556 Ga0207689_100505562 290
507 3300025942 Ga0207689_10142109 Ga0207689_101421092 290
508 3300025942 Ga0207689_10160185 Ga0207689_101601851 290
509 3300025949 Ga0207667_10019489 Ga0207667_100194896 290
510 3300025960 Ga0207651_10047465 Ga0207651_100474652 290
511 3300025961 Ga0207712_10011425 Ga0207712_100114255 290
512 3300025961 Ga0207712_10342058 Ga0207712_103420582 290
513 3300026041 Ga0207639_10439269 Ga0207639_104392692 290
514 3300026067 Ga0207678_10046876 Ga0207678_100468762 290
515 3300026075 Ga0207708_10011998 Ga0207708_100119983 290
516 3300026075 Ga0207708_10322023 Ga0207708_103220231 290
517 3300026078 Ga0207702_10063784 Ga0207702_100637842 290
518 3300026089 Ga0207648_10013708 Ga0207648_100137083 290
519 3300026089 Ga0207648_10285261 Ga0207648_102852611 290
520 3300026095 Ga0207676_10108733 Ga0207676_101087333 290
521 3300026118 Ga0207675_100209894 Ga0207675_1002098941 290
522 3300026118 Ga0207675_100247715 Ga0207675_1002477152 290
523 3300026118 Ga0207675_100335293 Ga0207675_1003352932 290
524 3300026118 Ga0207675_100347589 Ga0207675_1003475892 290
525 3300026121 Ga0207683_10001401 Ga0207683_100014017 290
526 3300026121 Ga0207683_10019139 Ga0207683_100191393 290
527 3300026121 Ga0207683_10080537 Ga0207683_100805372 290
528 3300027907 Ga0207428_10026718 Ga0207428_100267184 290
529 3300027907 Ga0207428_10109244 Ga0207428_101092442 290
530 3300028379 Ga0268266_10004230 Ga0268266_100042309 290
531 3300028380 Ga0268265_10004057 Ga0268265_1000405710 290
532 3300028380 Ga0268265_10192742 Ga0268265_101927422 290
533 3300028381 Ga0268264_10172702 Ga0268264_101727022 290
534 3300028577 Ga0265318_10010067 Ga0265318_100100676 290
535 3300031235 Ga0265330_10082257 Ga0265330_100822572 290
536 3300031242 Ga0265329_10010598 Ga0265329_100105983 290
537 3300031247 Ga0265340_10014517 Ga0265340_100145172 290
538 3300031247 Ga0265340_10043374 Ga0265340_100433742 290
539 3300031249 Ga0265339_10119720 Ga0265339_101197202 290
540 3300031344 Ga0265316_10099440 Ga0265316_100994402 290
541 3300031344 Ga0265316_10371318 Ga0265316_103713182 290
542 3300031711 Ga0265314_10117099 Ga0265314_101170992 290
543 3300031712 Ga0265342_10050576 Ga0265342_100505761 290
544 3300031712 Ga0265342_10065218 Ga0265342_100652182 290
545 3300032002 Ga0307416_100570071 Ga0307416_1005700711 290
546 3300034957 Ga0373938_0020812 Ga0373938_0020812_25_897 290
547 3300035083 Ga0373926_0011875 Ga0373926_0011875_181_1053 290
548 3300035114 Ga0373939_0112862 Ga0373939_0112862_57_929 290
549 3300035116 Ga0373945_0038041 Ga0373945_0038041_229_1101 290
550 3300035117 Ga0373953_0081431 Ga0373953_0081431_355_1227 290
551 3300035118 Ga0373954_0001982 Ga0373954_0001982_998_1870 290
552 3300035119 Ga0373956_0003825 Ga0373956_0003825_3131_4003 290
553 3300035120 Ga0373957_0004410 Ga0373957_0004410_2225_3097 290
554 3300035171 Ga0373946_0018731 Ga0373946_0018731_1242_2114 290
555 3300035172 Ga0373955_0003925 Ga0373955_0003925_483_1355 290
556 3300035398 Ga0316574_0002290 Ga0316574_0002290_8327_9199 290
557 3300035724 Ga0373933_0006622 Ga0373933_0006622_3230_4102 290
558 3300035725 Ga0373947_0050005 Ga0373947_0050005_907_1779 290
559 3300036401 Ga0373937_0036110 Ga0373937_0036110_2865_3737 290
560 3300037068 Ga0373925_0135890 Ga0373925_0135890_252_1124 290
561 3300037068 Ga0373925_0369432 Ga0373925_0369432_56_931 290
562 3300037068 Ga0373925_0404112 Ga0373925_0404112_23_895 290
563 3300037418 Ga0395900_0244781 Ga0395900_0244781_263_1144 290
564 3300038443 Ga0395901_0387094 Ga0395901_0387094_277_1158 290
565 3300038996 Ga0242420_025739 Ga0242420_025739_147_1019 290
566 3300039438 Ga0436360_0871302 Ga0436360_0871302_121_993 290
567 3300039450 Ga0436363_0343864 Ga0436363_0343864_78_950 290
568 3300045051 Ga0451576_0516591 Ga0451576_0516591_115_987 290
569 3300046454 Ga0495592_0043227 Ga0495592_0043227_1946_2818 290
570 3300046455 Ga0495603_0107459 Ga0495603_0107459_523_1395 290
571 3300046459 Ga0495629_0012832 Ga0495629_0012832_3192_4064 290
572 3300046459 Ga0495629_0085072 Ga0495629_0085072_710_1582 290
573 3300046460 Ga0495638_0103390 Ga0495638_0103390_60_932 290
574 3300046461 Ga0495641_0064091 Ga0495641_0064091_253_1125 290
575 3300046462 Ga0495651_0028661 Ga0495651_0028661_886_1758 290
576 3300046463 Ga0495653_0004022 Ga0495653_0004022_6347_7219 290
577 3300046463 Ga0495653_0155596 Ga0495653_0155596_139_1011 290
578 3300046472 Ga0495580_0068199 Ga0495580_0068199_546_1418 290
579 3300046474 Ga0495605_0127938 Ga0495605_0127938_36_908 290
580 3300046475 Ga0495639_0026038 Ga0495639_0026038_296_1168 290
581 3300046476 Ga0495662_0001391 Ga0495662_0001391_7244_8116 290
582 3300046476 Ga0495662_0052257 Ga0495662_0052257_885_1760 290
583 3300046476 Ga0495662_0065124 Ga0495662_0065124_595_1467 290
584 3300046477 Ga0495664_0000854 Ga0495664_0000854_2669_3541 290
585 3300046477 Ga0495664_0014471 Ga0495664_0014471_2996_3868 290
586 3300046477 Ga0495664_0069690 Ga0495664_0069690_885_1757 290
587 3300046499 Ga0495594_0075553 Ga0495594_0075553_35_907 290
588 3300046511 Ga0495608_0012022 Ga0495608_0012022_1803_2675 290
589 3300046514 Ga0495618_0002357 Ga0495618_0002357_7207_8079 290
590 3300046514 Ga0495618_0005360 Ga0495618_0005360_682_1554 290
591 3300046514 Ga0495618_0074986 Ga0495618_0074986_165_1040 290
592 3300046516 Ga0495628_0029083 Ga0495628_0029083_3059_3931 290
593 3300046517 Ga0495630_0006177 Ga0495630_0006177_3776_4648 290
594 3300046517 Ga0495630_0181826 Ga0495630_0181826_716_1588 290
595 3300046517 Ga0495630_0488519 Ga0495630_0488519_39_914 290
596 3300046529 Ga0495652_0002979 Ga0495652_0002979_5157_6029 290
597 3300046529 Ga0495652_0154542 Ga0495652_0154542_625_1497 290
598 3300046529 Ga0495652_0202927 Ga0495652_0202927_550_1422 290
599 3300046533 Ga0495640_0040849 Ga0495640_0040849_1803_2675 290
600 3300046535 Ga0495586_0006577 Ga0495586_0006577_1678_2550 290
601 3300046535 Ga0495586_0012914 Ga0495586_0012914_2778_3650 290
602 3300046539 Ga0495621_0032725 Ga0495621_0032725_578_1495 290
603 3300046543 Ga0495645_0001772 Ga0495645_0001772_12777_13649 290
604 3300046543 Ga0495645_0004794 Ga0495645_0004794_2622_3494 290
605 3300046559 Ga0495667_0037832 Ga0495667_0037832_1750_2622 290
606 3300046642 Ga0495634_0006350 Ga0495634_0006350_1583_2455 290
607 3300046642 Ga0495634_0086219 Ga0495634_0086219_422_1294 290
608 3300046642 Ga0495634_0105933 Ga0495634_0105933_655_1527 290
609 3300046663 Ga0495635_0002197 Ga0495635_0002197_4200_5072 290
610 3300046663 Ga0495635_0009754 Ga0495635_0009754_2824_3696 290
611 3300046664 Ga0495659_0038466 Ga0495659_0038466_781_1653 290
612 3300046674 Ga0495588_0136294 Ga0495588_0136294_319_1191 290
613 3300046675 Ga0495657_0009163 Ga0495657_0009163_4185_5057 290
614 3300046678 Ga0495599_0036152 Ga0495599_0036152_1675_2547 290
615 3300046679 Ga0495623_0002799 Ga0495623_0002799_7298_8170 290
616 3300046680 Ga0495646_0003366 Ga0495646_0003366_3578_4450 290
617 3300046680 Ga0495646_0125466 Ga0495646_0125466_407_1279 290
618 3300046683 Ga0495658_0045835 Ga0495658_0045835_1333_2205 290
619 3300046690 Ga0495624_0029495 Ga0495624_0029495_1456_2328 290
620 3300046690 Ga0495624_0246814 Ga0495624_0246814_72_944 290
621 3300046809 Ga0495600_0015386 Ga0495600_0015386_648_1520 290
622 3300047315 Ga0495581_0258628 Ga0495581_0258628_79_954 290
623 3300047317 Ga0495604_0021564 Ga0495604_0021564_4259_5131 290
624 3300047319 Ga0495674_0010284 Ga0495674_0010284_4599_5471 290
625 3300047319 Ga0495674_0022332 Ga0495674_0022332_130_1002 290
626 3300047320 Ga0495672_0165851 Ga0495672_0165851_96_968 290
627 3300047321 Ga0495676_0118399 Ga0495676_0118399_706_1578 290
628 3300047322 Ga0495680_0021194 Ga0495680_0021194_2659_3531 290
629 3300047322 Ga0495680_0108044 Ga0495680_0108044_209_1081 290
630 3300047444 Ga0495675_0023103 Ga0495675_0023103_2256_3128 290
631 3300047471 Ga0495684_0042839 Ga0495684_0042839_2582_3454 290
632 3300047673 Ga0495593_0042302 Ga0495593_0042302_567_1439 290
633 3300047673 Ga0495593_0060782 Ga0495593_0060782_1044_1916 290
634 3300048088 Ga0495602_0083467 Ga0495602_0083467_1675_2547 290
635 3300048090 Ga0495615_0003005 Ga0495615_0003005_1573_2490 290
636 3300048904 Ga0496101_0003115 Ga0496101_0003115_1494_2366 290
637 3300048904 Ga0496101_0044622 Ga0496101_0044622_1529_2404 290
638 3300048904 Ga0496101_0231387 Ga0496101_0231387_344_1216 290
639 3300048905 Ga0496102_0005771 Ga0496102_0005771_5105_5980 290
640 3300048905 Ga0496102_0006136 Ga0496102_0006136_3125_4033 290
641 3300048905 Ga0496102_0055522 Ga0496102_0055522_1087_1959 290
642 3300048905 Ga0496102_0122032 Ga0496102_0122032_1087_1959 290
643 3300048906 Ga0496103_0063023 Ga0496103_0063023_516_1391 290
644 3300048906 Ga0496103_0080284 Ga0496103_0080284_83_991 290
645 3300048906 Ga0496103_0236674 Ga0496103_0236674_214_1086 290
646 3300048907 Ga0496104_0000618 Ga0496104_0000618_29059_29931 290
647 3300048907 Ga0496104_0005842 Ga0496104_0005842_5895_6770 290
648 3300048907 Ga0496104_0013745 Ga0496104_0013745_1491_2363 290
649 3300048907 Ga0496104_0273599 Ga0496104_0273599_681_1589 290
650 3300048908 Ga0496105_0001514 Ga0496105_0001514_7263_8138 290
651 3300048908 Ga0496105_0152872 Ga0496105_0152872_500_1372 290
652 3300048909 Ga0496106_0005441 Ga0496106_0005441_2385_3293 290
653 3300048909 Ga0496106_0069698 Ga0496106_0069698_821_1693 290
654 3300048909 Ga0496106_0076192 Ga0496106_0076192_829_1701 290
655 3300048909 Ga0496106_0077587 Ga0496106_0077587_453_1328 290
656 3300048910 Ga0496107_0003704 Ga0496107_0003704_6180_7088 290
657 3300048910 Ga0496107_0005110 Ga0496107_0005110_1802_2674 290
658 3300048910 Ga0496107_0162697 Ga0496107_0162697_341_1216 290
659 3300048910 Ga0496107_0313672 Ga0496107_0313672_19_891 290
660 3300048911 Ga0496108_0000544 Ga0496108_0000544_7289_8164 290
661 3300048912 Ga0496109_0003416 Ga0496109_0003416_7313_8188 290
662 3300048912 Ga0496109_0030575 Ga0496109_0030575_1107_1979 290
663 3300048912 Ga0496109_0578427 Ga0496109_0578427_74_946 290
664 3300048913 Ga0496110_0001581 Ga0496110_0001581_6996_7871 290
665 3300048913 Ga0496110_0007612 Ga0496110_0007612_6545_7417 290
666 3300048913 Ga0496110_0152444 Ga0496110_0152444_514_1386 290
667 3300048914 Ga0496111_0002315 Ga0496111_0002315_7345_8220 290
668 3300048914 Ga0496111_0105187 Ga0496111_0105187_456_1331 290
669 3300048914 Ga0496111_0107427 Ga0496111_0107427_576_1448 290
670 3300048914 Ga0496111_0120556 Ga0496111_0120556_118_990 290
671 3300048915 Ga0496112_0001706 Ga0496112_0001706_8300_9175 290
672 3300048915 Ga0496112_0221587 Ga0496112_0221587_255_1127 290
673 3300048915 Ga0496112_0269834 Ga0496112_0269834_52_924 290
674 3300048915 Ga0496112_0295482 Ga0496112_0295482_424_1296 290
675 3300048916 Ga0496113_0000577 Ga0496113_0000577_10113_10988 290
676 3300048916 Ga0496113_0035036 Ga0496113_0035036_1889_2761 290
677 3300048917 Ga0496114_0043891 Ga0496114_0043891_466_1338 290
678 3300048917 Ga0496114_0249014 Ga0496114_0249014_153_1028 290
679 3300048917 Ga0496114_0685759 Ga0496114_0685759_13_885 290
680 3300048918 Ga0496115_0035876 Ga0496115_0035876_1362_2234 290
681 3300048918 Ga0496115_0082311 Ga0496115_0082311_356_1228 290
682 3300048918 Ga0496115_0092249 Ga0496115_0092249_1203_2093 290
683 3300048918 Ga0496115_0188444 Ga0496115_0188444_290_1162 290
684 3300048918 Ga0496115_0267086 Ga0496115_0267086_514_1389 290
685 3300048918 Ga0496115_0334878 Ga0496115_0334878_216_1088 290
686 3300048929 Ga0496126_0188476 Ga0496126_0188476_471_1343 290
687 3300049568 Ga0501031_0015531 Ga0501031_0015531_2531_3403 290
688 3300049569 Ga0501032_0173066 Ga0501032_0173066_358_1230 290
689 3300049570 Ga0501033_0004789 Ga0501033_0004789_2518_3390 290
690 3300049570 Ga0501033_0005891 Ga0501033_0005891_3075_3947 290
691 3300049570 Ga0501033_0031280 Ga0501033_0031280_2917_3789 290
692 3300049570 Ga0501033_0201702 Ga0501033_0201702_299_1171 290
693 3300049571 Ga0501034_0145164 Ga0501034_0145164_565_1437 290
694 3300049571 Ga0501034_0239469 Ga0501034_0239469_575_1447 290
695 3300049572 Ga0501036_0010564 Ga0501036_0010564_5988_6860 290
696 3300049572 Ga0501036_0410737 Ga0501036_0410737_213_1085 290
697 3300049572 Ga0501036_0494959 Ga0501036_0494959_58_948 290
698 3300049573 Ga0501037_0000124 Ga0501037_0000124_57815_58687 290
699 3300049573 Ga0501037_0003538 Ga0501037_0003538_8953_9825 290
700 3300049574 Ga0501038_0058663 Ga0501038_0058663_974_1846 290
701 3300049574 Ga0501038_0061414 Ga0501038_0061414_1742_2614 290
702 3300049574 Ga0501038_0119788 Ga0501038_0119788_245_1117 290
703 3300049577 Ga0501041_0089201 Ga0501041_0089201_306_1178 290
704 3300049578 Ga0501042_0093140 Ga0501042_0093140_534_1409 290
705 3300049578 Ga0501042_0237568 Ga0501042_0237568_353_1225 290
706 3300049578 Ga0501042_0303388 Ga0501042_0303388_95_967 290
707 3300049579 Ga0501043_0000003 Ga0501043_0000003_110138_111010 290
708 3300049579 Ga0501043_0181663 Ga0501043_0181663_170_1042 290
709 3300049579 Ga0501043_0201984 Ga0501043_0201984_252_1124 290
710 3300049580 Ga0501046_0170160 Ga0501046_0170160_632_1504 290
711 3300049581 Ga0501047_0022490 Ga0501047_0022490_3148_4020 290
712 3300049581 Ga0501047_0087222 Ga0501047_0087222_935_1807 290
713 3300049581 Ga0501047_0114871 Ga0501047_0114871_174_1046 290
714 3300049581 Ga0501047_0120953 Ga0501047_0120953_795_1667 290
715 3300049581 Ga0501047_0171066 Ga0501047_0171066_89_961 290
716 3300049581 Ga0501047_0226851 Ga0501047_0226851_670_1542 290
717 3300049581 Ga0501047_0314551 Ga0501047_0314551_495_1367 290
718 3300049581 Ga0501047_0375949 Ga0501047_0375949_203_1075 290
719 3300049582 Ga0501048_0019726 Ga0501048_0019726_2832_3704 290
720 3300049583 Ga0501067_0156157 Ga0501067_0156157_13_885 290
721 3300049584 Ga0501068_0043899 Ga0501068_0043899_1545_2417 290
722 3300049585 Ga0501069_0000003 Ga0501069_0000003_125713_126585 290
723 3300049585 Ga0501069_0003992 Ga0501069_0003992_5878_6750 290
724 3300049585 Ga0501069_0011946 Ga0501069_0011946_3200_4072 290
725 3300049585 Ga0501069_0049927 Ga0501069_0049927_408_1280 290
726 3300049586 Ga0501070_0000321 Ga0501070_0000321_19262_20134 290
727 3300049586 Ga0501070_0000665 Ga0501070_0000665_1099_1971 290
728 3300049586 Ga0501070_0001482 Ga0501070_0001482_8572_9444 290
729 3300049586 Ga0501070_0168173 Ga0501070_0168173_92_964 290
730 3300049587 Ga0501071_0004774 Ga0501071_0004774_6242_7114 290
731 3300049587 Ga0501071_0397196 Ga0501071_0397196_105_977 290
732 3300049588 Ga0501072_0008121 Ga0501072_0008121_3289_4161 290
733 3300049588 Ga0501072_0263922 Ga0501072_0263922_195_1067 290
734 3300049589 Ga0501073_0066558 Ga0501073_0066558_788_1660 290
735 3300049590 Ga0501074_0000027 Ga0501074_0000027_1833_2705 290
736 3300049590 Ga0501074_0005145 Ga0501074_0005145_4902_5774 290
737 3300049590 Ga0501074_0005821 Ga0501074_0005821_5988_6860 290
738 3300049590 Ga0501074_0031335 Ga0501074_0031335_1312_2184 290
739 3300049591 Ga0501075_0109380 Ga0501075_0109380_823_1713 290
740 3300049592 Ga0501076_0146955 Ga0501076_0146955_791_1666 290
741 3300049592 Ga0501076_0410109 Ga0501076_0410109_181_1053 290
742 3300049593 Ga0501077_0053073 Ga0501077_0053073_45_917 290
743 3300049593 Ga0501077_0192731 Ga0501077_0192731_209_1084 290
744 3300049593 Ga0501077_0340474 Ga0501077_0340474_20_910 290
745 3300049741 Ga0501079_0009079 Ga0501079_0009079_6513_7385 290
746 3300049741 Ga0501079_0023785 Ga0501079_0023785_598_1470 290
747 3300049741 Ga0501079_0064766 Ga0501079_0064766_822_1694 290
748 3300049742 Ga0501080_0000139 Ga0501080_0000139_48408_49280 290
749 3300049742 Ga0501080_0005001 Ga0501080_0005001_5391_6263 290
750 3300049742 Ga0501080_0306870 Ga0501080_0306870_142_1017 290
751 3300049743 Ga0501081_0008074 Ga0501081_0008074_4388_5260 290
752 3300049744 Ga0501083_0000024 Ga0501083_0000024_73669_74541 290
753 3300049744 Ga0501083_0069649 Ga0501083_0069649_374_1246 290
754 3300049744 Ga0501083_0105408 Ga0501083_0105408_831_1703 290
755 3300049744 Ga0501083_0182952 Ga0501083_0182952_336_1208 290
756 3300049822 Ga0501035_0001357 Ga0501035_0001357_9446_10318 290
757 3300049822 Ga0501035_0003123 Ga0501035_0003123_8832_9704 290
758 3300049822 Ga0501035_0007814 Ga0501035_0007814_5695_6567 290
759 3300049822 Ga0501035_0045837 Ga0501035_0045837_2032_2904 290
760 3300049822 Ga0501035_0051453 Ga0501035_0051453_2504_3376 290
761 3300049822 Ga0501035_0068824 Ga0501035_0068824_1851_2723 290
762 3300049822 Ga0501035_0096757 Ga0501035_0096757_537_1409 290
763 3300049822 Ga0501035_0103582 Ga0501035_0103582_989_1861 290
764 3300049822 Ga0501035_0122363 Ga0501035_0122363_495_1385 290
765 3300049822 Ga0501035_0435005 Ga0501035_0435005_203_1075 290
766 3300049823 Ga0501044_0000016 Ga0501044_0000016_125705_126577 290
767 3300049823 Ga0501044_0001046 Ga0501044_0001046_31486_32358 290
768 3300049823 Ga0501044_0014332 Ga0501044_0014332_3190_4062 290
769 3300049823 Ga0501044_0030367 Ga0501044_0030367_905_1777 290
770 3300049823 Ga0501044_0037941 Ga0501044_0037941_3236_4108 290
771 3300049823 Ga0501044_0039887 Ga0501044_0039887_3496_4368 290
772 3300049823 Ga0501044_0109989 Ga0501044_0109989_954_1826 290
773 3300049823 Ga0501044_0288048 Ga0501044_0288048_528_1400 290
774 3300049823 Ga0501044_0292359 Ga0501044_0292359_532_1404 290
775 3300049824 Ga0501045_0133518 Ga0501045_0133518_74_946 290
776 3300049824 Ga0501045_0135655 Ga0501045_0135655_159_1031 290
777 3300050489 nmdc:mga03683_19246_c2 nmdc:mga03683_19246_c2_222_1097 290
778 3300050491 nmdc:mga00v17_101375_c1 nmdc:mga00v17_101375_c1_677_1549 290
779 3300050491 nmdc:mga00v17_94680_c1 nmdc:mga00v17_94680_c1_236_1108 290
780 3300050492 nmdc:mga0yw44_25714_c1 nmdc:mga0yw44_25714_c1_331_1203 290
781 3300050492 nmdc:mga0yw44_36773_c1 nmdc:mga0yw44_36773_c1_1510_2385 290
782 3300050492 nmdc:mga0yw44_7206_c1 nmdc:mga0yw44_7206_c1_3238_4113 290
783 3300050493 nmdc:mga0k408_2879_c1 nmdc:mga0k408_2879_c1_5354_6226 290
784 3300050494 nmdc:mga06z11_146544_c1 nmdc:mga06z11_146544_c1_202_1074 290
785 3300050494 nmdc:mga06z11_55368_c1 nmdc:mga06z11_55368_c1_496_1368 290
786 3300050494 nmdc:mga06z11_6143_c1 nmdc:mga06z11_6143_c1_1147_2019 290
787 3300050495 nmdc:mga04h51_13416_c1 nmdc:mga04h51_13416_c1_485_1357 290
788 3300050507 nmdc:mga05p37_110528_c1 nmdc:mga05p37_110528_c1_1095_1967 290
789 3300050507 nmdc:mga05p37_144139_c1 nmdc:mga05p37_144139_c1_590_1462 290
790 3300050507 nmdc:mga05p37_23642_c1 nmdc:mga05p37_23642_c1_1413_2288 290
791 3300050507 nmdc:mga05p37_30735_c2 nmdc:mga05p37_30735_c2_1939_2814 290
792 3300050508 nmdc:mga09592_131804_c1 nmdc:mga09592_131804_c1_176_1051 290
793 3300050508 nmdc:mga09592_97108_c1 nmdc:mga09592_97108_c1_84_956 290
794 3300050509 nmdc:mga0qj67_10255_c1 nmdc:mga0qj67_10255_c1_2109_2981 290
795 3300050509 nmdc:mga0qj67_11822_c1 nmdc:mga0qj67_11822_c1_5332_6204 290
796 3300050509 nmdc:mga0qj67_65631_c1 nmdc:mga0qj67_65631_c1_284_1156 290
797 3300050509 nmdc:mga0qj67_88087_c1 nmdc:mga0qj67_88087_c1_850_1722 290
798 3300050510 nmdc:mga06r32_108764_c1 nmdc:mga06r32_108764_c1_1806_2678 290
799 3300050510 nmdc:mga06r32_19380_c1 nmdc:mga06r32_19380_c1_5117_5989 290
800 3300050510 nmdc:mga06r32_271596_c1 nmdc:mga06r32_271596_c1_720_1592 290
801 3300050510 nmdc:mga06r32_84675_c1 nmdc:mga06r32_84675_c1_750_1622 290
802 3300050511 nmdc:mga08y16_100602_c1 nmdc:mga08y16_100602_c1_1836_2711 290
803 3300050511 nmdc:mga08y16_119201_c1 nmdc:mga08y16_119201_c1_701_1573 290
804 3300050511 nmdc:mga08y16_160340_c1 nmdc:mga08y16_160340_c1_334_1206 290
805 3300050511 nmdc:mga08y16_293895_c1 nmdc:mga08y16_293895_c1_41_928 290
806 3300050511 nmdc:mga08y16_52055_c1 nmdc:mga08y16_52055_c1_3239_4114 290
807 3300050511 nmdc:mga08y16_63461_c1 nmdc:mga08y16_63461_c1_2097_3068 290
808 3300050512 nmdc:mga0n895_22291_c1 nmdc:mga0n895_22291_c1_2684_3559 290
809 3300050512 nmdc:mga0n895_343408_c1 nmdc:mga0n895_343408_c1_315_1187 290
810 3300050512 nmdc:mga0n895_49235_c1 nmdc:mga0n895_49235_c1_1703_2614 290
811 3300050512 nmdc:mga0n895_526793_c1 nmdc:mga0n895_526793_c1_33_905 290
812 3300050512 nmdc:mga0n895_79479_c1 nmdc:mga0n895_79479_c1_1668_2558 290
813 3300050513 nmdc:mga0rr50_33097_c1 nmdc:mga0rr50_33097_c1_1521_2396 290
814 3300050513 nmdc:mga0rr50_93733_c1 nmdc:mga0rr50_93733_c1_72_944 290
815 3300050514 nmdc:mga08x19_162899_c1 nmdc:mga08x19_162899_c1_473_1345 290
816 3300050514 nmdc:mga08x19_88759_c1 nmdc:mga08x19_88759_c1_288_1163 290
817 3300050516 nmdc:mga0sz30_15352_c1 nmdc:mga0sz30_15352_c1_41_913 290
818 3300053077 Ga0495601_0001311 Ga0495601_0001311_567_1439 290
819 3300053077 Ga0495601_0012075 Ga0495601_0012075_2755_3627 290
820 3300053077 Ga0495601_0054380 Ga0495601_0054380_735_1607 290
821 3300053078 Ga0495612_0000213 Ga0495612_0000213_3545_4417 290
822 3300053078 Ga0495612_0007271 Ga0495612_0007271_1946_2818 290
823 3300053078 Ga0495612_0013923 Ga0495612_0013923_151_1023 290
824 3300053079 Ga0500610_0086801 Ga0500610_0086801_114_986 290
825 3300053083 Ga0495655_0009972 Ga0495655_0009972_949_1821 290
826 3300053084 Ga0495595_0000240 Ga0495595_0000240_10257_11129 290
827 3300053085 Ga0495619_0001165 Ga0495619_0001165_10072_10944 290
828 3300053085 Ga0495619_0010589 Ga0495619_0010589_321_1193 290
829 3300053085 Ga0495619_0017915 Ga0495619_0017915_1675_2547 290
830 3300053085 Ga0495619_0029930 Ga0495619_0029930_1441_2316 290
831 3300053085 Ga0495619_0168834 Ga0495619_0168834_451_1323 290
832 3300053090 Ga0500646_0041243 Ga0500646_0041243_409_1281 290
833 3300053096 Ga0500641_0013485 Ga0500641_0013485_1676_2548 290
834 3300053117 Ga0500593_012270 Ga0500593_012270_1672_2544 290
835 3300053119 Ga0500595_007580 Ga0500595_007580_1455_2327 290
836 3300053130 Ga0500642_0051038 Ga0500642_0051038_455_1330 290
837 3300053130 Ga0500642_0102596 Ga0500642_0102596_321_1193 290
838 3300053131 Ga0500652_000003 Ga0500652_000003_159180_160052 290
839 3300053131 Ga0500652_050255 Ga0500652_050255_791_1666 290
840 3300053151 Ga0500604_0029923 Ga0500604_0029923_201_1073 290
841 3300053153 Ga0500616_0007706 Ga0500616_0007706_1748_2623 290
842 3300054114 Ga0501084_0005808 Ga0501084_0005808_5657_6529 290
843 3300054114 Ga0501084_0031558 Ga0501084_0031558_2856_3728 290
844 3300054114 Ga0501084_0069657 Ga0501084_0069657_1655_2527 290
845 3300054114 Ga0501084_0215005 Ga0501084_0215005_408_1280 290
846 3300054114 Ga0501084_0228168 Ga0501084_0228168_14_889 290
847 3300054114 Ga0501084_0408553 Ga0501084_0408553_24_896 290
848 3300060353 Ga0501082_0008388 Ga0501082_0008388_595_1467 290
849 3300060353 Ga0501082_0014628 Ga0501082_0014628_3248_4120 290
850 3300060353 Ga0501082_0348010 Ga0501082_0348010_300_1172 290
851 3300060353 Ga0501082_0408408 Ga0501082_0408408_41_931 290
852 3300061734 Ga0530510_0115336 Ga0530510_0115336_767_1642 290
853 3300061734 Ga0530510_0201128 Ga0530510_0201128_190_1101 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

23

283

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5297 7 279
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5172 8 282
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5146 7 279
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5007 6 282
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.4958 7 279
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9175 10 275 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8649 10 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.864 12 278 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.818 12 278 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7854 12 275 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1W6CKT9-F1-model_v4 Branched-chain amino acid ABC transporter 0.9868 6 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A231HHQ6-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9826 4 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A433SED4-F1-model_v4 High-affinity branched-chain amino acid transport system permease protein LivH 0.9804 4 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A4Q7DK43-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9788 5 288 GO:0005886
GO:0006865
GO:0022857
AF-A0A399I3A9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9787 4 290 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.59 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map