F483549
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 853 | 379 | 853 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300035116|Ga0373945_0002449|Ga0373945_0002449_4700_5614 |
| Length | 296 |
| Sequence | MADGPLREPDLRRSVPIDVYLNVAVAGILTGLVYGLMALGLSVIFGVVRVVNFAHGEMMSIAMYLTVLLFSGLHLDPLVMLVPIAAILFVFGYALQAGLINPFISRPEHSQFLLLVALALIIVNTLLILFGPDARTVQTSYAFDSFQWGALIVDATKLYAGGLFVFFRFAPVGKAIRACADNYTGALVVGLDVKRLYALTFGIGAACVGAAGVMMTLIVDVTPMIGPAYTLLAFVIVITGGLGSMAGALLGGLLIGVTEALAGLLFTPSAKSMFAFAILVLVLLFRPQGILGKRSI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 198 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 230 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 231 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 232 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 362 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 369 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 370 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 371 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 379 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.1 |
| Nodule | 0 |
| Rhizoplane | 7.03 |
| Rhizosphere | 85.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10003964 | 3300003215 | Bacteria | 8103 |
| 2 | rootH1_10101929 | 3300003316 | Bacteria | 1533 |
| 3 | Ga0065712_10022039 | 3300005290 | Bacteria | 2146 |
| 4 | Ga0065707_10201144 | 3300005295 | Bacteria | 1310 |
| 5 | Ga0070658_10007812 | 3300005327 | Bacteria | 8619 |
| 6 | Ga0070658_10163506 | 3300005327 | Bacteria | 1868 |
| 7 | Ga0070690_100011486 | 3300005330 | Bacteria | 5181 |
| 8 | Ga0068869_100032828 | 3300005334 | Bacteria | 3661 |
| 9 | Ga0070666_10187404 | 3300005335 | Bacteria | 1453 |
| 10 | Ga0070680_100004671 | 3300005336 | Bacteria | 10302 |
| 11 | Ga0070680_100010183 | 3300005336 | Bacteria | 7250 |
| 12 | Ga0070680_100081170 | 3300005336 | Bacteria | 2675 |
| 13 | Ga0070682_100060440 | 3300005337 | Bacteria | 2396 |
| 14 | Ga0068868_100327538 | 3300005338 | Bacteria | 1306 |
| 15 | Ga0068868_100418451 | 3300005338 | Bacteria | 1160 |
| 16 | Ga0070660_100025632 | 3300005339 | Bacteria | 4383 |
| 17 | Ga0070660_100242405 | 3300005339 | Unclassified | 1469 |
| 18 | Ga0070689_100003048 | 3300005340 | Bacteria | 11037 |
| 19 | Ga0070689_100182890 | 3300005340 | Bacteria | 1703 |
| 20 | Ga0070691_10002385 | 3300005341 | Bacteria | 8330 |
| 21 | Ga0070687_100223455 | 3300005343 | Bacteria | 1155 |
| 22 | Ga0070661_100129809 | 3300005344 | Bacteria | 1892 |
| 23 | Ga0070692_10054837 | 3300005345 | Bacteria | 2082 |
| 24 | Ga0070668_100175965 | 3300005347 | Bacteria | 1745 |
| 25 | Ga0070675_100227172 | 3300005354 | Bacteria | 1627 |
| 26 | Ga0070671_100001629 | 3300005355 | Bacteria | 16929 |
| 27 | Ga0070671_100179031 | 3300005355 | Bacteria | 1795 |
| 28 | Ga0070674_100005640 | 3300005356 | Bacteria | 7253 |
| 29 | Ga0070674_100265233 | 3300005356 | Unclassified | 1355 |
| 30 | Ga0070688_100010598 | 3300005365 | Bacteria | 5090 |
| 31 | Ga0070688_100097895 | 3300005365 | Bacteria | 1929 |
| 32 | Ga0070688_100103190 | 3300005365 | Bacteria | 1884 |
| 33 | Ga0070659_100138178 | 3300005366 | Bacteria | 1983 |
| 34 | Ga0070667_100194491 | 3300005367 | Bacteria | 1798 |
| 35 | Ga0070667_100238863 | 3300005367 | Bacteria | 1622 |
| 36 | Ga0070703_10000863 | 3300005406 | Bacteria | 9778 |
| 37 | Ga0070709_10044315 | 3300005434 | Bacteria | 2754 |
| 38 | Ga0070709_10089360 | 3300005434 | Bacteria | 2028 |
| 39 | Ga0070714_100015537 | 3300005435 | Bacteria | 6123 |
| 40 | Ga0070714_100034473 | 3300005435 | Bacteria | 4239 |
| 41 | Ga0070713_100006445 | 3300005436 | Bacteria | 8140 |
| 42 | Ga0070713_100066826 | 3300005436 | Bacteria | 3025 |
| 43 | Ga0070713_100175961 | 3300005436 | Bacteria | 1920 |
| 44 | Ga0070711_100031327 | 3300005439 | Bacteria | 3530 |
| 45 | Ga0070711_100086139 | 3300005439 | Bacteria | 2252 |
| 46 | Ga0070711_100130881 | 3300005439 | Bacteria | 1868 |
| 47 | Ga0070711_100199513 | 3300005439 | Bacteria | 1543 |
| 48 | Ga0070705_100002047 | 3300005440 | Bacteria | 10304 |
| 49 | Ga0070700_100006099 | 3300005441 | Bacteria | 6420 |
| 50 | Ga0070700_100307430 | 3300005441 | Bacteria | 1160 |
| 51 | Ga0070694_100002834 | 3300005444 | Bacteria | 10301 |
| 52 | Ga0070694_100194113 | 3300005444 | Unclassified | 1509 |
| 53 | Ga0070678_100135240 | 3300005456 | Bacteria | 1965 |
| 54 | Ga0070662_100088159 | 3300005457 | Bacteria | 2325 |
| 55 | Ga0070662_100226547 | 3300005457 | Bacteria | 1494 |
| 56 | Ga0070681_10039242 | 3300005458 | Bacteria | 4747 |
| 57 | Ga0070681_10046550 | 3300005458 | Bacteria | 4336 |
| 58 | Ga0068867_100379411 | 3300005459 | Unclassified | 1187 |
| 59 | Ga0070685_10034379 | 3300005466 | Bacteria | 2854 |
| 60 | Ga0070685_10068286 | 3300005466 | Bacteria | 2099 |
| 61 | Ga0070685_10153428 | 3300005466 | Bacteria | 1462 |
| 62 | Ga0070698_100107974 | 3300005471 | Bacteria | 2751 |
| 63 | Ga0070698_100138364 | 3300005471 | Bacteria | 2388 |
| 64 | Ga0070699_100000676 | 3300005518 | Bacteria | 31923 |
| 65 | Ga0070699_100008160 | 3300005518 | Bacteria | 9087 |
| 66 | Ga0070699_100037744 | 3300005518 | Bacteria | 4183 |
| 67 | Ga0070679_100018216 | 3300005530 | Bacteria | 6810 |
| 68 | Ga0070679_100031611 | 3300005530 | Bacteria | 5231 |
| 69 | Ga0070679_100080118 | 3300005530 | Bacteria | 3254 |
| 70 | Ga0070679_100543894 | 3300005530 | Bacteria | 1105 |
| 71 | Ga0070684_100068425 | 3300005535 | Bacteria | 3121 |
| 72 | Ga0070684_100175094 | 3300005535 | Bacteria | 1950 |
| 73 | Ga0068853_100448012 | 3300005539 | Bacteria | 1214 |
| 74 | Ga0070672_100086593 | 3300005543 | Bacteria | 2520 |
| 75 | Ga0070672_100129074 | 3300005543 | Bacteria | 2076 |
| 76 | Ga0070686_100053639 | 3300005544 | Bacteria | 2575 |
| 77 | Ga0070686_100105802 | 3300005544 | Bacteria | 1908 |
| 78 | Ga0070686_100148990 | 3300005544 | Bacteria | 1637 |
| 79 | Ga0070695_100002706 | 3300005545 | Bacteria | 10271 |
| 80 | Ga0070695_100088144 | 3300005545 | Unclassified | 2066 |
| 81 | Ga0070696_100003618 | 3300005546 | Bacteria | 10294 |
| 82 | Ga0070693_100258742 | 3300005547 | Unclassified | 1157 |
| 83 | Ga0070665_100009831 | 3300005548 | Bacteria | 9669 |
| 84 | Ga0070704_100002596 | 3300005549 | Bacteria | 10186 |
| 85 | Ga0070704_100192950 | 3300005549 | Bacteria | 1639 |
| 86 | Ga0068855_100019415 | 3300005563 | Bacteria | 8167 |
| 87 | Ga0068855_100359197 | 3300005563 | Bacteria | 1603 |
| 88 | Ga0068856_100056846 | 3300005614 | Bacteria | 3862 |
| 89 | Ga0068856_100282343 | 3300005614 | Bacteria | 1677 |
| 90 | Ga0068856_100444007 | 3300005614 | Bacteria | 1318 |
| 91 | Ga0070702_100017320 | 3300005615 | Bacteria | 3714 |
| 92 | Ga0068859_100053261 | 3300005617 | Bacteria | 4069 |
| 93 | Ga0068859_100148530 | 3300005617 | Bacteria | 2419 |
| 94 | Ga0068859_100157789 | 3300005617 | Bacteria | 2347 |
| 95 | Ga0068861_100110705 | 3300005719 | Bacteria | 2200 |
| 96 | Ga0068861_100334322 | 3300005719 | Bacteria | 1324 |
| 97 | Ga0068870_10032553 | 3300005840 | Bacteria | 2652 |
| 98 | Ga0068858_100396431 | 3300005842 | Bacteria | 1326 |
| 99 | Ga0081455_10002266 | 3300005937 | Bacteria | 22935 |
| 100 | Ga0081455_10014076 | 3300005937 | Bacteria | 7863 |
| 101 | Ga0081455_10022274 | 3300005937 | Bacteria | 5925 |
| 102 | Ga0081455_10071649 | 3300005937 | Bacteria | 2872 |
| 103 | Ga0081538_10032375 | 3300005981 | Bacteria | 3505 |
| 104 | Ga0081538_10035528 | 3300005981 | Bacteria | 3272 |
| 105 | Ga0081538_10038133 | 3300005981 | Bacteria | 3106 |
| 106 | Ga0081540_1000413 | 3300005983 | Bacteria | 42230 |
| 107 | Ga0081540_1007933 | 3300005983 | Bacteria | 7492 |
| 108 | Ga0081540_1037671 | 3300005983 | Bacteria | 2559 |
| 109 | Ga0081540_1070642 | 3300005983 | Bacteria | 1616 |
| 110 | Ga0081539_10009410 | 3300005985 | Bacteria | 8173 |
| 111 | Ga0081539_10029464 | 3300005985 | Bacteria | 3428 |
| 112 | Ga0081539_10040250 | 3300005985 | Bacteria | 2745 |
| 113 | Ga0081539_10055264 | 3300005985 | Bacteria | 2210 |
| 114 | Ga0070717_10001832 | 3300006028 | Bacteria | 14856 |
| 115 | Ga0070717_10271317 | 3300006028 | Bacteria | 1503 |
| 116 | Ga0070717_10291206 | 3300006028 | Bacteria | 1450 |
| 117 | Ga0075365_10015329 | 3300006038 | Bacteria | 4634 |
| 118 | Ga0075365_10031607 | 3300006038 | Bacteria | 3396 |
| 119 | Ga0075365_10072168 | 3300006038 | Bacteria | 2325 |
| 120 | Ga0075368_10051433 | 3300006042 | Bacteria | 1638 |
| 121 | Ga0075364_10265500 | 3300006051 | Bacteria | 1167 |
| 122 | Ga0070715_10000773 | 3300006163 | Bacteria | 8658 |
| 123 | Ga0070716_100031558 | 3300006173 | Bacteria | 2882 |
| 124 | Ga0070712_100001365 | 3300006175 | Bacteria | 14802 |
| 125 | Ga0070712_100002949 | 3300006175 | Bacteria | 10539 |
| 126 | Ga0075362_10025194 | 3300006177 | Bacteria | 2529 |
| 127 | Ga0075362_10044880 | 3300006177 | Bacteria | 1962 |
| 128 | Ga0075367_10010335 | 3300006178 | Bacteria | 4902 |
| 129 | Ga0075367_10083360 | 3300006178 | Bacteria | 1937 |
| 130 | Ga0075369_10003208 | 3300006186 | Bacteria | 5935 |
| 131 | Ga0075369_10091376 | 3300006186 | Bacteria | 1359 |
| 132 | Ga0075366_10003186 | 3300006195 | Bacteria | 8600 |
| 133 | Ga0075366_10003908 | 3300006195 | Bacteria | 7945 |
| 134 | Ga0097621_100034275 | 3300006237 | Bacteria | 4049 |
| 135 | Ga0097621_100208396 | 3300006237 | Bacteria | 1699 |
| 136 | Ga0068871_100024425 | 3300006358 | Bacteria | 4687 |
| 137 | Ga0068871_100040552 | 3300006358 | Bacteria | 3729 |
| 138 | Ga0075428_100033401 | 3300006844 | Bacteria | 5682 |
| 139 | Ga0075428_100043702 | 3300006844 | Bacteria | 4926 |
| 140 | Ga0075428_100072613 | 3300006844 | Bacteria | 3759 |
| 141 | Ga0075428_100115363 | 3300006844 | Bacteria | 2926 |
| 142 | Ga0075428_100138265 | 3300006844 | Bacteria | 2648 |
| 143 | Ga0075428_100281631 | 3300006844 | Bacteria | 1789 |
| 144 | Ga0075428_100429258 | 3300006844 | Bacteria | 1416 |
| 145 | Ga0075430_100001038 | 3300006846 | Bacteria | 21949 |
| 146 | Ga0075430_100008855 | 3300006846 | Bacteria | 8493 |
| 147 | Ga0075430_100025536 | 3300006846 | Bacteria | 5026 |
| 148 | Ga0075430_100035755 | 3300006846 | Bacteria | 4213 |
| 149 | Ga0075430_100101673 | 3300006846 | Bacteria | 2400 |
| 150 | Ga0075430_100121511 | 3300006846 | Bacteria | 2177 |
| 151 | Ga0075430_100165915 | 3300006846 | Bacteria | 1838 |
| 152 | Ga0075430_100229900 | 3300006846 | Bacteria | 1538 |
| 153 | Ga0075431_100072882 | 3300006847 | Bacteria | 3543 |
| 154 | Ga0075431_100169557 | 3300006847 | Bacteria | 2243 |
| 155 | Ga0075431_100227964 | 3300006847 | Bacteria | 1899 |
| 156 | Ga0075431_100255749 | 3300006847 | Bacteria | 1778 |
| 157 | Ga0075433_10040253 | 3300006852 | Bacteria | 4045 |
| 158 | Ga0075434_100006551 | 3300006871 | Bacteria | 10678 |
| 159 | Ga0075434_100036000 | 3300006871 | Bacteria | 4895 |
| 160 | Ga0075434_100226630 | 3300006871 | Bacteria | 1888 |
| 161 | Ga0075434_100453329 | 3300006871 | Bacteria | 1304 |
| 162 | Ga0075429_100118197 | 3300006880 | Bacteria | 2317 |
| 163 | Ga0068865_100139009 | 3300006881 | Bacteria | 1829 |
| 164 | Ga0075436_100054512 | 3300006914 | Bacteria | 2760 |
| 165 | Ga0097620_100053263 | 3300006931 | Bacteria | 4069 |
| 166 | Ga0097620_100148516 | 3300006931 | Bacteria | 2419 |
| 167 | Ga0097620_100157776 | 3300006931 | Bacteria | 2347 |
| 168 | Ga0075435_100061185 | 3300007076 | Bacteria | 3054 |
| 169 | Ga0075435_100189322 | 3300007076 | Bacteria | 1741 |
| 170 | Ga0105240_10018112 | 3300009093 | Bacteria | 9471 |
| 171 | Ga0105240_10636057 | 3300009093 | Bacteria | 1171 |
| 172 | Ga0111539_10039620 | 3300009094 | Bacteria | 5677 |
| 173 | Ga0111539_10128038 | 3300009094 | Bacteria | 2974 |
| 174 | Ga0111539_10137933 | 3300009094 | Bacteria | 2856 |
| 175 | Ga0111539_10406481 | 3300009094 | Bacteria | 1586 |
| 176 | Ga0111539_10439485 | 3300009094 | Bacteria | 1519 |
| 177 | Ga0111539_10441686 | 3300009094 | Bacteria | 1515 |
| 178 | Ga0111539_10521566 | 3300009094 | Bacteria | 1384 |
| 179 | Ga0111539_10767389 | 3300009094 | Bacteria | 1122 |
| 180 | Ga0105245_10007619 | 3300009098 | Bacteria | 9480 |
| 181 | Ga0105245_10009970 | 3300009098 | Bacteria | 8275 |
| 182 | Ga0105247_10159397 | 3300009101 | Bacteria | 1493 |
| 183 | Ga0114129_10005876 | 3300009147 | Bacteria | 17380 |
| 184 | Ga0114129_10031337 | 3300009147 | Bacteria | 7518 |
| 185 | Ga0114129_10110595 | 3300009147 | Bacteria | 3792 |
| 186 | Ga0114129_10111214 | 3300009147 | Bacteria | 3780 |
| 187 | Ga0114129_10119370 | 3300009147 | Bacteria | 3632 |
| 188 | Ga0114129_10210234 | 3300009147 | Bacteria | 2630 |
| 189 | Ga0114129_10222381 | 3300009147 | Bacteria | 2546 |
| 190 | Ga0114129_10257894 | 3300009147 | Unclassified | 2338 |
| 191 | Ga0114129_10643814 | 3300009147 | Bacteria | 1369 |
| 192 | Ga0105243_10057333 | 3300009148 | Bacteria | 3101 |
| 193 | Ga0105243_10083844 | 3300009148 | Bacteria | 2608 |
| 194 | Ga0105241_10456676 | 3300009174 | Bacteria | 1131 |
| 195 | Ga0105242_10042703 | 3300009176 | Bacteria | 3663 |
| 196 | Ga0105242_10425437 | 3300009176 | Bacteria | 1245 |
| 197 | Ga0105248_10014889 | 3300009177 | Bacteria | 8566 |
| 198 | Ga0105248_10087238 | 3300009177 | Bacteria | 3512 |
| 199 | Ga0105248_10158891 | 3300009177 | Bacteria | 2550 |
| 200 | Ga0105248_10179367 | 3300009177 | Bacteria | 2387 |
| 201 | Ga0105237_10074588 | 3300009545 | Bacteria | 3385 |
| 202 | Ga0105238_10083801 | 3300009551 | Bacteria | 3177 |
| 203 | Ga0105238_10121564 | 3300009551 | Unclassified | 2590 |
| 204 | Ga0105249_10012920 | 3300009553 | Bacteria | 7367 |
| 205 | Ga0105249_10348651 | 3300009553 | Bacteria | 1499 |
| 206 | Ga0105239_10090721 | 3300010375 | Bacteria | 3372 |
| 207 | Ga0105239_10473938 | 3300010375 | Bacteria | 1422 |
| 208 | Ga0105246_10435893 | 3300011119 | Bacteria | 1097 |
| 209 | Ga0157373_10078964 | 3300013100 | Bacteria | 2321 |
| 210 | Ga0157369_10436259 | 3300013105 | Bacteria | 1357 |
| 211 | Ga0157374_10720323 | 3300013296 | Bacteria | 1011 |
| 212 | Ga0157378_10113655 | 3300013297 | Bacteria | 2486 |
| 213 | Ga0157378_10435382 | 3300013297 | Bacteria | 1298 |
| 214 | Ga0163162_10085892 | 3300013306 | Bacteria | 3223 |
| 215 | Ga0163162_10168685 | 3300013306 | Bacteria | 2313 |
| 216 | Ga0163162_10304138 | 3300013306 | Bacteria | 1727 |
| 217 | Ga0157375_10147328 | 3300013308 | Bacteria | 2486 |
| 218 | Ga0157375_10363324 | 3300013308 | Bacteria | 1614 |
| 219 | Ga0163163_10052576 | 3300014325 | Bacteria | 4019 |
| 220 | Ga0163163_10235232 | 3300014325 | Bacteria | 1881 |
| 221 | Ga0157380_10212780 | 3300014326 | Bacteria | 1724 |
| 222 | Ga0157379_10019047 | 3300014968 | Bacteria | 6059 |
| 223 | Ga0157379_10156673 | 3300014968 | Bacteria | 2055 |
| 224 | Ga0157379_10217508 | 3300014968 | Bacteria | 1731 |
| 225 | Ga0157376_10660073 | 3300014969 | Bacteria | 1047 |
| 226 | Ga0163161_10319628 | 3300017792 | Bacteria | 1227 |
| 227 | Ga0213872_10037343 | 3300021361 | Bacteria | 2218 |
| 228 | Ga0213874_10099192 | 3300021377 | Bacteria | 966 |
| 229 | Ga0213876_10027264 | 3300021384 | Bacteria | 3016 |
| 230 | Ga0213876_10046534 | 3300021384 | Bacteria | 2294 |
| 231 | Ga0209675_1002489 | 3300025291 | Bacteria | 9433 |
| 232 | Ga0209758_1003526 | 3300025297 | Bacteria | 14107 |
| 233 | Ga0207653_10011134 | 3300025885 | Bacteria | 2807 |
| 234 | Ga0207682_10036882 | 3300025893 | Bacteria | 1979 |
| 235 | Ga0207692_10008130 | 3300025898 | Bacteria | 4331 |
| 236 | Ga0207688_10093977 | 3300025901 | Bacteria | 1725 |
| 237 | Ga0207685_10001687 | 3300025905 | Bacteria | 4766 |
| 238 | Ga0207699_10125925 | 3300025906 | Bacteria | 1663 |
| 239 | Ga0207699_10182043 | 3300025906 | Bacteria | 1413 |
| 240 | Ga0207645_10084627 | 3300025907 | Bacteria | 2035 |
| 241 | Ga0207645_10190517 | 3300025907 | Bacteria | 1348 |
| 242 | Ga0207643_10077870 | 3300025908 | Bacteria | 1917 |
| 243 | Ga0207705_10006429 | 3300025909 | Bacteria | 8705 |
| 244 | Ga0207654_10305260 | 3300025911 | Bacteria | 1083 |
| 245 | Ga0207707_10134306 | 3300025912 | Bacteria | 2164 |
| 246 | Ga0207671_10248297 | 3300025914 | Bacteria | 1399 |
| 247 | Ga0207693_10001110 | 3300025915 | Bacteria | 24219 |
| 248 | Ga0207693_10004385 | 3300025915 | Bacteria | 11930 |
| 249 | Ga0207693_10005324 | 3300025915 | Bacteria | 10748 |
| 250 | Ga0207693_10018460 | 3300025915 | Bacteria | 5556 |
| 251 | Ga0207663_10073555 | 3300025916 | Bacteria | 2212 |
| 252 | Ga0207663_10242323 | 3300025916 | Bacteria | 1323 |
| 253 | Ga0207663_10253747 | 3300025916 | Bacteria | 1296 |
| 254 | Ga0207660_10003455 | 3300025917 | Bacteria | 10306 |
| 255 | Ga0207660_10052516 | 3300025917 | Bacteria | 2902 |
| 256 | Ga0207662_10021594 | 3300025918 | Bacteria | 3683 |
| 257 | Ga0207662_10059225 | 3300025918 | Bacteria | 2295 |
| 258 | Ga0207657_10048882 | 3300025919 | Bacteria | 3690 |
| 259 | Ga0207657_10064034 | 3300025919 | Bacteria | 3140 |
| 260 | Ga0207649_10271451 | 3300025920 | Bacteria | 1229 |
| 261 | Ga0207652_10013357 | 3300025921 | Bacteria | 6650 |
| 262 | Ga0207652_10141511 | 3300025921 | Bacteria | 2151 |
| 263 | Ga0207652_10195031 | 3300025921 | Bacteria | 1822 |
| 264 | Ga0207652_10229440 | 3300025921 | Unclassified | 1673 |
| 265 | Ga0207646_10143246 | 3300025922 | Bacteria | 2153 |
| 266 | Ga0207694_10170549 | 3300025924 | Bacteria | 1762 |
| 267 | Ga0207650_10003903 | 3300025925 | Bacteria | 10195 |
| 268 | Ga0207659_10149531 | 3300025926 | Bacteria | 1822 |
| 269 | Ga0207687_10067466 | 3300025927 | Bacteria | 2545 |
| 270 | Ga0207687_10110692 | 3300025927 | Bacteria | 2037 |
| 271 | Ga0207700_10007214 | 3300025928 | Bacteria | 6778 |
| 272 | Ga0207700_10356154 | 3300025928 | Bacteria | 1275 |
| 273 | Ga0207664_10106902 | 3300025929 | Bacteria | 2321 |
| 274 | Ga0207644_10086654 | 3300025931 | Bacteria | 2326 |
| 275 | Ga0207644_10094770 | 3300025931 | Bacteria | 2231 |
| 276 | Ga0207644_10215155 | 3300025931 | Bacteria | 1521 |
| 277 | Ga0207690_10324857 | 3300025932 | Bacteria | 1210 |
| 278 | Ga0207690_10344223 | 3300025932 | Bacteria | 1177 |
| 279 | Ga0207706_10003165 | 3300025933 | Bacteria | 15811 |
| 280 | Ga0207706_10015943 | 3300025933 | Bacteria | 6791 |
| 281 | Ga0207706_10028849 | 3300025933 | Bacteria | 4954 |
| 282 | Ga0207706_10080732 | 3300025933 | Bacteria | 2859 |
| 283 | Ga0207706_10206689 | 3300025933 | Bacteria | 1721 |
| 284 | Ga0207706_10265618 | 3300025933 | Bacteria | 1498 |
| 285 | Ga0207709_10039578 | 3300025935 | Bacteria | 2817 |
| 286 | Ga0207709_10070805 | 3300025935 | Bacteria | 2212 |
| 287 | Ga0207670_10005309 | 3300025936 | Bacteria | 7058 |
| 288 | Ga0207670_10227793 | 3300025936 | Bacteria | 1430 |
| 289 | Ga0207669_10008848 | 3300025937 | Bacteria | 4753 |
| 290 | Ga0207669_10040865 | 3300025937 | Bacteria | 2694 |
| 291 | Ga0207704_10070029 | 3300025938 | Bacteria | 2219 |
| 292 | Ga0207665_10013442 | 3300025939 | Bacteria | 5382 |
| 293 | Ga0207665_10085932 | 3300025939 | Unclassified | 2172 |
| 294 | Ga0207691_10398930 | 3300025940 | Bacteria | 1173 |
| 295 | Ga0207711_10066206 | 3300025941 | Bacteria | 3125 |
| 296 | Ga0207711_10174196 | 3300025941 | Bacteria | 1954 |
| 297 | Ga0207689_10050556 | 3300025942 | Bacteria | 3427 |
| 298 | Ga0207689_10142109 | 3300025942 | Bacteria | 1977 |
| 299 | Ga0207689_10160185 | 3300025942 | Bacteria | 1854 |
| 300 | Ga0207661_10323570 | 3300025944 | Bacteria | 1387 |
| 301 | Ga0207667_10019489 | 3300025949 | Bacteria | 7570 |
| 302 | Ga0207651_10047465 | 3300025960 | Bacteria | 2896 |
| 303 | Ga0207651_10071915 | 3300025960 | Bacteria | 2454 |
| 304 | Ga0207712_10011425 | 3300025961 | Bacteria | 5657 |
| 305 | Ga0207712_10342058 | 3300025961 | Bacteria | 1241 |
| 306 | Ga0207658_10133627 | 3300025986 | Bacteria | 1997 |
| 307 | Ga0207658_10148586 | 3300025986 | Bacteria | 1906 |
| 308 | Ga0207703_10334189 | 3300026035 | Bacteria | 1391 |
| 309 | Ga0207639_10126065 | 3300026041 | Bacteria | 2112 |
| 310 | Ga0207639_10439269 | 3300026041 | Bacteria | 1183 |
| 311 | Ga0207678_10046876 | 3300026067 | Bacteria | 3738 |
| 312 | Ga0207708_10011998 | 3300026075 | Bacteria | 6457 |
| 313 | Ga0207708_10322023 | 3300026075 | Bacteria | 1262 |
| 314 | Ga0207702_10063784 | 3300026078 | Bacteria | 3151 |
| 315 | Ga0207648_10013708 | 3300026089 | Bacteria | 7525 |
| 316 | Ga0207648_10285261 | 3300026089 | Bacteria | 1477 |
| 317 | Ga0207676_10108733 | 3300026095 | Bacteria | 2315 |
| 318 | Ga0207675_100209894 | 3300026118 | Bacteria | 1872 |
| 319 | Ga0207675_100247715 | 3300026118 | Bacteria | 1724 |
| 320 | Ga0207675_100335293 | 3300026118 | Bacteria | 1479 |
| 321 | Ga0207675_100347589 | 3300026118 | Bacteria | 1453 |
| 322 | Ga0207683_10001401 | 3300026121 | Bacteria | 21763 |
| 323 | Ga0207683_10019139 | 3300026121 | Bacteria | 5844 |
| 324 | Ga0207683_10080537 | 3300026121 | Bacteria | 2889 |
| 325 | Ga0209969_1000301 | 3300027360 | Bacteria | 6604 |
| 326 | Ga0209967_1001239 | 3300027364 | Bacteria | 3266 |
| 327 | Ga0209981_1005492 | 3300027378 | Bacteria | 1682 |
| 328 | Ga0209996_1009934 | 3300027395 | Bacteria | 1258 |
| 329 | Ga0210000_1001102 | 3300027462 | Bacteria | 3781 |
| 330 | Ga0210000_1010799 | 3300027462 | Bacteria | 1351 |
| 331 | Ga0209968_1001052 | 3300027526 | Bacteria | 4205 |
| 332 | Ga0209999_1005741 | 3300027543 | Bacteria | 2234 |
| 333 | Ga0209966_1037864 | 3300027695 | Bacteria | 997 |
| 334 | Ga0209974_10005420 | 3300027876 | Bacteria | 4489 |
| 335 | Ga0207428_10026718 | 3300027907 | Bacteria | 4813 |
| 336 | Ga0207428_10109244 | 3300027907 | Bacteria | 2130 |
| 337 | Ga0207428_10225018 | 3300027907 | Bacteria | 1405 |
| 338 | Ga0268266_10004230 | 3300028379 | Bacteria | 13823 |
| 339 | Ga0268265_10004057 | 3300028380 | Bacteria | 10293 |
| 340 | Ga0268265_10192742 | 3300028380 | Bacteria | 1762 |
| 341 | Ga0268264_10172702 | 3300028381 | Bacteria | 1956 |
| 342 | Ga0265318_10010067 | 3300028577 | Bacteria | 4131 |
| 343 | Ga0265338_10251082 | 3300028800 | Bacteria | 1305 |
| 344 | Ga0265330_10082257 | 3300031235 | Bacteria | 1386 |
| 345 | Ga0265320_10008692 | 3300031240 | Bacteria | 6187 |
| 346 | Ga0265325_10008018 | 3300031241 | Bacteria | 6264 |
| 347 | Ga0265329_10010598 | 3300031242 | Bacteria | 3375 |
| 348 | Ga0265329_10011112 | 3300031242 | Bacteria | 3279 |
| 349 | Ga0265340_10006108 | 3300031247 | Bacteria | 6641 |
| 350 | Ga0265340_10014517 | 3300031247 | Bacteria | 4112 |
| 351 | Ga0265340_10043374 | 3300031247 | Bacteria | 2205 |
| 352 | Ga0265339_10009558 | 3300031249 | Bacteria | 6081 |
| 353 | Ga0265339_10119720 | 3300031249 | Bacteria | 1354 |
| 354 | Ga0265331_10028922 | 3300031250 | Bacteria | 2769 |
| 355 | Ga0265327_10004354 | 3300031251 | Bacteria | 12598 |
| 356 | Ga0265316_10099440 | 3300031344 | Bacteria | 2212 |
| 357 | Ga0265316_10371318 | 3300031344 | Bacteria | 1033 |
| 358 | Ga0265313_10000960 | 3300031595 | Bacteria | 28619 |
| 359 | Ga0265314_10007016 | 3300031711 | Bacteria | 9843 |
| 360 | Ga0265314_10117099 | 3300031711 | Bacteria | 1684 |
| 361 | Ga0265342_10000026 | 3300031712 | Bacteria | 166610 |
| 362 | Ga0265342_10050576 | 3300031712 | Bacteria | 2482 |
| 363 | Ga0265342_10065218 | 3300031712 | Bacteria | 2135 |
| 364 | Ga0307413_10079368 | 3300031824 | Bacteria | 2098 |
| 365 | Ga0307413_10256068 | 3300031824 | Bacteria | 1302 |
| 366 | Ga0307406_10402972 | 3300031901 | Bacteria | 1085 |
| 367 | Ga0307412_10121879 | 3300031911 | Bacteria | 1879 |
| 368 | Ga0307416_100140989 | 3300032002 | Bacteria | 2191 |
| 369 | Ga0307416_100570071 | 3300032002 | Bacteria | 1208 |
| 370 | Ga0373938_0020812 | 3300034957 | Bacteria | 1325 |
| 371 | Ga0373926_0011875 | 3300035083 | Bacteria | 2938 |
| 372 | Ga0373940_0039283 | 3300035088 | Bacteria | 1295 |
| 373 | Ga0373949_0000762 | 3300035090 | Bacteria | 10376 |
| 374 | Ga0373952_0005802 | 3300035092 | Bacteria | 2268 |
| 375 | Ga0373939_0000939 | 3300035114 | Bacteria | 7257 |
| 376 | Ga0373939_0112862 | 3300035114 | Unclassified | 949 |
| 377 | Ga0373941_0026413 | 3300035115 | Bacteria | 1686 |
| 378 | Ga0373945_0002449 | 3300035116 | Bacteria | 5826 |
| 379 | Ga0373945_0038041 | 3300035116 | Bacteria | 1729 |
| 380 | Ga0373953_0081431 | 3300035117 | Bacteria | 1346 |
| 381 | Ga0373954_0001982 | 3300035118 | Bacteria | 8500 |
| 382 | Ga0373956_0003825 | 3300035119 | Bacteria | 6056 |
| 383 | Ga0373956_0052024 | 3300035119 | Bacteria | 1841 |
| 384 | Ga0373957_0004410 | 3300035120 | Bacteria | 4282 |
| 385 | Ga0373943_0000537 | 3300035170 | Bacteria | 16398 |
| 386 | Ga0373946_0018731 | 3300035171 | Bacteria | 2660 |
| 387 | Ga0373946_0088240 | 3300035171 | Bacteria | 1370 |
| 388 | Ga0373955_0003925 | 3300035172 | Bacteria | 6555 |
| 389 | Ga0373955_0057057 | 3300035172 | Bacteria | 2144 |
| 390 | Ga0373942_0004147 | 3300035207 | Bacteria | 3375 |
| 391 | Ga0373961_0033728 | 3300035241 | Bacteria | 1443 |
| 392 | Ga0316574_0002290 | 3300035398 | Bacteria | 9537 |
| 393 | Ga0373931_0000865 | 3300035691 | Bacteria | 12778 |
| 394 | Ga0373927_0002460 | 3300035695 | Bacteria | 13513 |
| 395 | Ga0373927_0019146 | 3300035695 | Bacteria | 4489 |
| 396 | Ga0373933_0006622 | 3300035724 | Bacteria | 6314 |
| 397 | Ga0373933_0011665 | 3300035724 | Bacteria | 4848 |
| 398 | Ga0373947_0004973 | 3300035725 | Bacteria | 7780 |
| 399 | Ga0373947_0050005 | 3300035725 | Bacteria | 2512 |
| 400 | Ga0373937_0023654 | 3300036401 | Bacteria | 5536 |
| 401 | Ga0373937_0036110 | 3300036401 | Bacteria | 4502 |
| 402 | Ga0316584_0033825 | 3300036712 | Bacteria | 3787 |
| 403 | Ga0373925_0002857 | 3300037068 | Bacteria | 13624 |
| 404 | Ga0373925_0135890 | 3300037068 | Bacteria | 1921 |
| 405 | Ga0373925_0369432 | 3300037068 | Bacteria | 1167 |
| 406 | Ga0373925_0404112 | 3300037068 | Bacteria | 1114 |
| 407 | Ga0395900_0244781 | 3300037418 | Bacteria | 1797 |
| 408 | Ga0436364_0006078 | 3300037853 | Bacteria | 3309 |
| 409 | Ga0436364_0295959 | 3300037853 | Bacteria | 1355 |
| 410 | Ga0436364_0505381 | 3300037853 | Bacteria | 66783 |
| 411 | Ga0395901_0387094 | 3300038443 | Bacteria | 1438 |
| 412 | Ga0242420_025739 | 3300038996 | Bacteria | 1071 |
| 413 | Ga0436365_0763020 | 3300039437 | Bacteria | 7635 |
| 414 | Ga0436365_0936231 | 3300039437 | Bacteria | 1926 |
| 415 | Ga0436360_0757620 | 3300039438 | Bacteria | 2411 |
| 416 | Ga0436360_0871302 | 3300039438 | Bacteria | 1484 |
| 417 | Ga0436361_0783087 | 3300039447 | Bacteria | 7661 |
| 418 | Ga0436363_0343864 | 3300039450 | Bacteria | 1015 |
| 419 | Ga0439434_0004801 | 3300042435 | Bacteria | 3956 |
| 420 | Ga0439434_0082573 | 3300042435 | Bacteria | 1021 |
| 421 | Ga0439435_0000044 | 3300042436 | Bacteria | 14055 |
| 422 | Ga0439444_0003343 | 3300042437 | Bacteria | 2262 |
| 423 | Ga0439460_0015586 | 3300042461 | Bacteria | 2014 |
| 424 | Ga0466963_0128427 | 3300044694 | Bacteria | 1749 |
| 425 | Ga0466957_0250912 | 3300044842 | Bacteria | 1177 |
| 426 | Ga0451576_0516591 | 3300045051 | Bacteria | 1255 |
| 427 | Ga0466958_0228396 | 3300045836 | Bacteria | 1188 |
| 428 | Ga0495592_0043227 | 3300046454 | Bacteria | 3371 |
| 429 | Ga0495592_0047711 | 3300046454 | Bacteria | 3189 |
| 430 | Ga0495603_0107459 | 3300046455 | Bacteria | 1628 |
| 431 | Ga0495629_0012832 | 3300046459 | Bacteria | 6062 |
| 432 | Ga0495629_0085072 | 3300046459 | Bacteria | 2206 |
| 433 | Ga0495638_0103390 | 3300046460 | Bacteria | 1700 |
| 434 | Ga0495641_0064091 | 3300046461 | Bacteria | 1655 |
| 435 | Ga0495651_0016719 | 3300046462 | Bacteria | 5681 |
| 436 | Ga0495651_0028661 | 3300046462 | Bacteria | 4339 |
| 437 | Ga0495653_0004022 | 3300046463 | Bacteria | 11871 |
| 438 | Ga0495653_0013856 | 3300046463 | Bacteria | 6571 |
| 439 | Ga0495653_0155596 | 3300046463 | Bacteria | 1592 |
| 440 | Ga0495580_0068199 | 3300046472 | Bacteria | 2487 |
| 441 | Ga0495580_0113981 | 3300046472 | Bacteria | 1878 |
| 442 | Ga0495605_0127938 | 3300046474 | Bacteria | 1147 |
| 443 | Ga0495639_0026038 | 3300046475 | Bacteria | 2583 |
| 444 | Ga0495662_0001391 | 3300046476 | Bacteria | 11991 |
| 445 | Ga0495662_0052257 | 3300046476 | Bacteria | 1973 |
| 446 | Ga0495662_0065124 | 3300046476 | Bacteria | 1761 |
| 447 | Ga0495664_0000854 | 3300046477 | Bacteria | 15638 |
| 448 | Ga0495664_0014471 | 3300046477 | Bacteria | 4473 |
| 449 | Ga0495664_0069690 | 3300046477 | Bacteria | 2099 |
| 450 | Ga0495594_0075553 | 3300046499 | Unclassified | 1878 |
| 451 | Ga0495608_0012022 | 3300046511 | Bacteria | 6017 |
| 452 | Ga0495608_0044624 | 3300046511 | Bacteria | 2958 |
| 453 | Ga0495608_0113266 | 3300046511 | Bacteria | 1743 |
| 454 | Ga0495618_0002357 | 3300046514 | Bacteria | 12181 |
| 455 | Ga0495618_0005360 | 3300046514 | Bacteria | 7824 |
| 456 | Ga0495618_0015587 | 3300046514 | Bacteria | 4639 |
| 457 | Ga0495618_0074986 | 3300046514 | Bacteria | 2155 |
| 458 | Ga0495628_0029083 | 3300046516 | Bacteria | 4484 |
| 459 | Ga0495628_0031255 | 3300046516 | Bacteria | 4307 |
| 460 | Ga0495628_0478825 | 3300046516 | Unclassified | 901 |
| 461 | Ga0495630_0006177 | 3300046517 | Bacteria | 8495 |
| 462 | Ga0495630_0011171 | 3300046517 | Bacteria | 6499 |
| 463 | Ga0495630_0181826 | 3300046517 | Unclassified | 1603 |
| 464 | Ga0495630_0488519 | 3300046517 | Bacteria | 944 |
| 465 | Ga0495666_0004437 | 3300046526 | Bacteria | 7092 |
| 466 | Ga0495666_0032824 | 3300046526 | Bacteria | 2539 |
| 467 | Ga0495642_0056930 | 3300046528 | Bacteria | 1616 |
| 468 | Ga0495652_0002979 | 3300046529 | Bacteria | 17017 |
| 469 | Ga0495652_0005448 | 3300046529 | Bacteria | 11986 |
| 470 | Ga0495652_0154542 | 3300046529 | Bacteria | 1788 |
| 471 | Ga0495652_0202927 | 3300046529 | Bacteria | 1503 |
| 472 | Ga0495640_0005918 | 3300046533 | Bacteria | 9696 |
| 473 | Ga0495640_0040849 | 3300046533 | Bacteria | 3245 |
| 474 | Ga0495586_0006577 | 3300046535 | Bacteria | 6210 |
| 475 | Ga0495586_0012914 | 3300046535 | Bacteria | 4430 |
| 476 | Ga0495587_0018230 | 3300046536 | Bacteria | 4354 |
| 477 | Ga0495598_0007747 | 3300046537 | Bacteria | 2477 |
| 478 | Ga0495598_0051983 | 3300046537 | Bacteria | 1237 |
| 479 | Ga0495621_0032725 | 3300046539 | Bacteria | 1789 |
| 480 | Ga0495645_0001772 | 3300046543 | Bacteria | 14693 |
| 481 | Ga0495645_0004794 | 3300046543 | Bacteria | 9241 |
| 482 | Ga0495667_0002411 | 3300046559 | Bacteria | 12483 |
| 483 | Ga0495667_0037832 | 3300046559 | Bacteria | 3214 |
| 484 | Ga0495656_0039772 | 3300046615 | Bacteria | 1956 |
| 485 | Ga0495634_0006350 | 3300046642 | Bacteria | 8987 |
| 486 | Ga0495634_0086219 | 3300046642 | Bacteria | 2045 |
| 487 | Ga0495634_0098788 | 3300046642 | Bacteria | 1888 |
| 488 | Ga0495634_0105933 | 3300046642 | Bacteria | 1812 |
| 489 | Ga0495634_0345751 | 3300046642 | Bacteria | 891 |
| 490 | Ga0495635_0002197 | 3300046663 | Bacteria | 13268 |
| 491 | Ga0495635_0007512 | 3300046663 | Bacteria | 7607 |
| 492 | Ga0495635_0009754 | 3300046663 | Bacteria | 6710 |
| 493 | Ga0495635_0157161 | 3300046663 | Bacteria | 1547 |
| 494 | Ga0495659_0038466 | 3300046664 | Unclassified | 1699 |
| 495 | Ga0495588_0136294 | 3300046674 | Unclassified | 1296 |
| 496 | Ga0495657_0009163 | 3300046675 | Bacteria | 7518 |
| 497 | Ga0495657_0075738 | 3300046675 | Bacteria | 2187 |
| 498 | Ga0495599_0036152 | 3300046678 | Bacteria | 3100 |
| 499 | Ga0495623_0002799 | 3300046679 | Bacteria | 11511 |
| 500 | Ga0495646_0003366 | 3300046680 | Bacteria | 9942 |
| 501 | Ga0495646_0019276 | 3300046680 | Bacteria | 4320 |
| 502 | Ga0495646_0125466 | 3300046680 | Bacteria | 1449 |
| 503 | Ga0495647_0046698 | 3300046681 | Bacteria | 1669 |
| 504 | Ga0495658_0045835 | 3300046683 | Bacteria | 2455 |
| 505 | Ga0495624_0029495 | 3300046690 | Bacteria | 3579 |
| 506 | Ga0495624_0116267 | 3300046690 | Bacteria | 1644 |
| 507 | Ga0495624_0246814 | 3300046690 | Bacteria | 1080 |
| 508 | Ga0495600_0015386 | 3300046809 | Bacteria | 4836 |
| 509 | Ga0495600_0024345 | 3300046809 | Bacteria | 3896 |
| 510 | Ga0495581_0069497 | 3300047315 | Bacteria | 2036 |
| 511 | Ga0495581_0258628 | 3300047315 | Bacteria | 1018 |
| 512 | Ga0495604_0009356 | 3300047317 | Bacteria | 7754 |
| 513 | Ga0495604_0021564 | 3300047317 | Bacteria | 5142 |
| 514 | Ga0495636_0203334 | 3300047318 | Bacteria | 905 |
| 515 | Ga0495674_0010284 | 3300047319 | Bacteria | 8857 |
| 516 | Ga0495674_0022332 | 3300047319 | Bacteria | 5836 |
| 517 | Ga0495672_0165851 | 3300047320 | Bacteria | 1131 |
| 518 | Ga0495676_0118399 | 3300047321 | Bacteria | 1931 |
| 519 | Ga0495676_0225737 | 3300047321 | Bacteria | 1289 |
| 520 | Ga0495680_0006934 | 3300047322 | Bacteria | 10457 |
| 521 | Ga0495680_0021194 | 3300047322 | Bacteria | 5445 |
| 522 | Ga0495680_0108044 | 3300047322 | Bacteria | 2065 |
| 523 | Ga0495675_0023103 | 3300047444 | Bacteria | 3962 |
| 524 | Ga0495684_0042839 | 3300047471 | Bacteria | 3466 |
| 525 | Ga0495684_0047235 | 3300047471 | Bacteria | 3293 |
| 526 | Ga0495593_0006391 | 3300047673 | Bacteria | 6913 |
| 527 | Ga0495593_0042302 | 3300047673 | Bacteria | 2445 |
| 528 | Ga0495593_0060782 | 3300047673 | Bacteria | 1978 |
| 529 | Ga0495602_0008235 | 3300048088 | Bacteria | 10888 |
| 530 | Ga0495602_0083467 | 3300048088 | Bacteria | 2676 |
| 531 | Ga0495614_0031776 | 3300048089 | Bacteria | 2273 |
| 532 | Ga0495615_0003005 | 3300048090 | Bacteria | 2780 |
| 533 | Ga0496101_0003115 | 3300048904 | Bacteria | 10261 |
| 534 | Ga0496101_0044622 | 3300048904 | Bacteria | 3172 |
| 535 | Ga0496101_0231387 | 3300048904 | Bacteria | 1437 |
| 536 | Ga0496101_0295485 | 3300048904 | Bacteria | 1268 |
| 537 | Ga0496102_0005771 | 3300048905 | Bacteria | 10526 |
| 538 | Ga0496102_0006136 | 3300048905 | Bacteria | 10240 |
| 539 | Ga0496102_0024027 | 3300048905 | Bacteria | 5418 |
| 540 | Ga0496102_0055522 | 3300048905 | Bacteria | 3611 |
| 541 | Ga0496102_0122032 | 3300048905 | Bacteria | 2434 |
| 542 | Ga0496103_0063023 | 3300048906 | Bacteria | 2308 |
| 543 | Ga0496103_0080284 | 3300048906 | Bacteria | 2051 |
| 544 | Ga0496103_0236674 | 3300048906 | Bacteria | 1175 |
| 545 | Ga0496104_0000618 | 3300048907 | Bacteria | 30466 |
| 546 | Ga0496104_0005842 | 3300048907 | Bacteria | 10776 |
| 547 | Ga0496104_0013745 | 3300048907 | Bacteria | 7301 |
| 548 | Ga0496104_0018794 | 3300048907 | Bacteria | 6311 |
| 549 | Ga0496104_0021537 | 3300048907 | Bacteria | 5920 |
| 550 | Ga0496104_0273599 | 3300048907 | Bacteria | 1601 |
| 551 | Ga0496105_0001514 | 3300048908 | Bacteria | 16426 |
| 552 | Ga0496105_0037429 | 3300048908 | Bacteria | 3995 |
| 553 | Ga0496105_0152872 | 3300048908 | Bacteria | 1896 |
| 554 | Ga0496106_0005441 | 3300048909 | Bacteria | 9422 |
| 555 | Ga0496106_0069698 | 3300048909 | Bacteria | 2685 |
| 556 | Ga0496106_0076192 | 3300048909 | Bacteria | 2571 |
| 557 | Ga0496106_0077587 | 3300048909 | Bacteria | 2547 |
| 558 | Ga0496107_0003704 | 3300048910 | Bacteria | 10268 |
| 559 | Ga0496107_0005110 | 3300048910 | Bacteria | 8949 |
| 560 | Ga0496107_0162697 | 3300048910 | Bacteria | 1654 |
| 561 | Ga0496107_0313672 | 3300048910 | Bacteria | 1167 |
| 562 | Ga0496108_0000544 | 3300048911 | Bacteria | 29516 |
| 563 | Ga0496108_0065717 | 3300048911 | Bacteria | 3058 |
| 564 | Ga0496108_0346557 | 3300048911 | Bacteria | 1296 |
| 565 | Ga0496108_0758615 | 3300048911 | Bacteria | 839 |
| 566 | Ga0496109_0003416 | 3300048912 | Bacteria | 13286 |
| 567 | Ga0496109_0030575 | 3300048912 | Bacteria | 4827 |
| 568 | Ga0496109_0578427 | 3300048912 | Bacteria | 1059 |
| 569 | Ga0496110_0001581 | 3300048913 | Bacteria | 16633 |
| 570 | Ga0496110_0007612 | 3300048913 | Bacteria | 8658 |
| 571 | Ga0496110_0009471 | 3300048913 | Bacteria | 7887 |
| 572 | Ga0496110_0152444 | 3300048913 | Bacteria | 2093 |
| 573 | Ga0496111_0002315 | 3300048914 | Bacteria | 11464 |
| 574 | Ga0496111_0105187 | 3300048914 | Bacteria | 2077 |
| 575 | Ga0496111_0107427 | 3300048914 | Bacteria | 2055 |
| 576 | Ga0496111_0120556 | 3300048914 | Bacteria | 1937 |
| 577 | Ga0496112_0001706 | 3300048915 | Bacteria | 17153 |
| 578 | Ga0496112_0221587 | 3300048915 | Bacteria | 1848 |
| 579 | Ga0496112_0269834 | 3300048915 | Bacteria | 1650 |
| 580 | Ga0496112_0295482 | 3300048915 | Bacteria | 1566 |
| 581 | Ga0496112_0364814 | 3300048915 | Bacteria | 1386 |
| 582 | Ga0496113_0000577 | 3300048916 | Bacteria | 18288 |
| 583 | Ga0496113_0035036 | 3300048916 | Bacteria | 3668 |
| 584 | Ga0496114_0043891 | 3300048917 | Bacteria | 3707 |
| 585 | Ga0496114_0249014 | 3300048917 | Bacteria | 1563 |
| 586 | Ga0496114_0685759 | 3300048917 | Bacteria | 899 |
| 587 | Ga0496115_0035876 | 3300048918 | Bacteria | 3925 |
| 588 | Ga0496115_0082311 | 3300048918 | Bacteria | 2622 |
| 589 | Ga0496115_0092249 | 3300048918 | Bacteria | 2476 |
| 590 | Ga0496115_0188444 | 3300048918 | Bacteria | 1704 |
| 591 | Ga0496115_0267086 | 3300048918 | Bacteria | 1406 |
| 592 | Ga0496115_0334878 | 3300048918 | Bacteria | 1236 |
| 593 | Ga0496126_0188476 | 3300048929 | Bacteria | 1748 |
| 594 | Ga0501031_0015531 | 3300049568 | Bacteria | 4943 |
| 595 | Ga0501032_0173066 | 3300049569 | Bacteria | 1415 |
| 596 | Ga0501033_0004789 | 3300049570 | Bacteria | 10803 |
| 597 | Ga0501033_0005891 | 3300049570 | Bacteria | 9629 |
| 598 | Ga0501033_0031280 | 3300049570 | Bacteria | 4000 |
| 599 | Ga0501033_0039910 | 3300049570 | Bacteria | 3506 |
| 600 | Ga0501033_0201702 | 3300049570 | Bacteria | 1420 |
| 601 | Ga0501034_0145164 | 3300049571 | Bacteria | 2350 |
| 602 | Ga0501034_0236132 | 3300049571 | Bacteria | 1776 |
| 603 | Ga0501034_0239469 | 3300049571 | Bacteria | 1761 |
| 604 | Ga0501036_0010564 | 3300049572 | Bacteria | 7626 |
| 605 | Ga0501036_0072802 | 3300049572 | Bacteria | 2905 |
| 606 | Ga0501036_0410737 | 3300049572 | Bacteria | 1129 |
| 607 | Ga0501036_0494959 | 3300049572 | Bacteria | 1017 |
| 608 | Ga0501037_0000124 | 3300049573 | Bacteria | 71522 |
| 609 | Ga0501037_0003538 | 3300049573 | Bacteria | 11340 |
| 610 | Ga0501037_0308163 | 3300049573 | Bacteria | 1098 |
| 611 | Ga0501038_0058663 | 3300049574 | Bacteria | 3299 |
| 612 | Ga0501038_0061414 | 3300049574 | Bacteria | 3213 |
| 613 | Ga0501038_0119788 | 3300049574 | Bacteria | 2172 |
| 614 | Ga0501038_0145817 | 3300049574 | Bacteria | 1933 |
| 615 | Ga0501038_0161500 | 3300049574 | Bacteria | 1821 |
| 616 | Ga0501039_0158162 | 3300049575 | Bacteria | 1780 |
| 617 | Ga0501039_0286338 | 3300049575 | Bacteria | 1295 |
| 618 | Ga0501040_0011721 | 3300049576 | Bacteria | 5735 |
| 619 | Ga0501040_0078815 | 3300049576 | Bacteria | 2280 |
| 620 | Ga0501041_0039800 | 3300049577 | Bacteria | 2853 |
| 621 | Ga0501041_0089201 | 3300049577 | Bacteria | 1904 |
| 622 | Ga0501041_0106541 | 3300049577 | Bacteria | 1737 |
| 623 | Ga0501041_0112116 | 3300049577 | Bacteria | 1692 |
| 624 | Ga0501042_0001369 | 3300049578 | Bacteria | 14310 |
| 625 | Ga0501042_0093140 | 3300049578 | Bacteria | 2164 |
| 626 | Ga0501042_0237568 | 3300049578 | Bacteria | 1315 |
| 627 | Ga0501042_0303388 | 3300049578 | Bacteria | 1154 |
| 628 | Ga0501043_0000003 | 3300049579 | Bacteria | 318844 |
| 629 | Ga0501043_0000013 | 3300049579 | Bacteria | 185639 |
| 630 | Ga0501043_0122475 | 3300049579 | Bacteria | 2040 |
| 631 | Ga0501043_0181663 | 3300049579 | Bacteria | 1639 |
| 632 | Ga0501043_0201984 | 3300049579 | Bacteria | 1542 |
| 633 | Ga0501046_0000099 | 3300049580 | Bacteria | 92986 |
| 634 | Ga0501046_0170160 | 3300049580 | Bacteria | 1636 |
| 635 | Ga0501047_0000040 | 3300049581 | Bacteria | 185677 |
| 636 | Ga0501047_0022490 | 3300049581 | Bacteria | 6055 |
| 637 | Ga0501047_0079948 | 3300049581 | Bacteria | 3143 |
| 638 | Ga0501047_0087222 | 3300049581 | Bacteria | 2998 |
| 639 | Ga0501047_0114871 | 3300049581 | Bacteria | 2574 |
| 640 | Ga0501047_0120953 | 3300049581 | Bacteria | 2501 |
| 641 | Ga0501047_0171066 | 3300049581 | Bacteria | 2041 |
| 642 | Ga0501047_0226851 | 3300049581 | Bacteria | 1722 |
| 643 | Ga0501047_0314551 | 3300049581 | Bacteria | 1406 |
| 644 | Ga0501047_0375949 | 3300049581 | Bacteria | 1255 |
| 645 | Ga0501048_0000932 | 3300049582 | Bacteria | 21587 |
| 646 | Ga0501048_0009377 | 3300049582 | Bacteria | 7349 |
| 647 | Ga0501048_0019726 | 3300049582 | Bacteria | 4944 |
| 648 | Ga0501048_0056563 | 3300049582 | Bacteria | 2783 |
| 649 | Ga0501067_0021984 | 3300049583 | Bacteria | 3529 |
| 650 | Ga0501067_0156157 | 3300049583 | Bacteria | 1271 |
| 651 | Ga0501068_0043899 | 3300049584 | Bacteria | 2690 |
| 652 | Ga0501068_0156298 | 3300049584 | Bacteria | 1436 |
| 653 | Ga0501069_0000003 | 3300049585 | Bacteria | 210301 |
| 654 | Ga0501069_0003992 | 3300049585 | Bacteria | 7614 |
| 655 | Ga0501069_0011946 | 3300049585 | Bacteria | 4608 |
| 656 | Ga0501069_0049927 | 3300049585 | Bacteria | 2326 |
| 657 | Ga0501070_0000321 | 3300049586 | Bacteria | 43662 |
| 658 | Ga0501070_0000665 | 3300049586 | Bacteria | 31670 |
| 659 | Ga0501070_0001482 | 3300049586 | Bacteria | 21004 |
| 660 | Ga0501070_0168173 | 3300049586 | Bacteria | 1806 |
| 661 | Ga0501071_0004774 | 3300049587 | Bacteria | 8628 |
| 662 | Ga0501071_0014941 | 3300049587 | Bacteria | 5320 |
| 663 | Ga0501071_0029463 | 3300049587 | Bacteria | 3874 |
| 664 | Ga0501071_0397196 | 3300049587 | Bacteria | 1052 |
| 665 | Ga0501072_0008121 | 3300049588 | Bacteria | 7965 |
| 666 | Ga0501072_0109117 | 3300049588 | Bacteria | 2202 |
| 667 | Ga0501072_0226408 | 3300049588 | Bacteria | 1490 |
| 668 | Ga0501072_0228177 | 3300049588 | Bacteria | 1483 |
| 669 | Ga0501072_0250925 | 3300049588 | Bacteria | 1409 |
| 670 | Ga0501072_0263922 | 3300049588 | Bacteria | 1370 |
| 671 | Ga0501073_0061619 | 3300049589 | Bacteria | 2617 |
| 672 | Ga0501073_0066558 | 3300049589 | Bacteria | 2511 |
| 673 | Ga0501073_0100359 | 3300049589 | Bacteria | 2010 |
| 674 | Ga0501074_0000027 | 3300049590 | Bacteria | 67860 |
| 675 | Ga0501074_0005145 | 3300049590 | Bacteria | 9400 |
| 676 | Ga0501074_0005821 | 3300049590 | Bacteria | 8890 |
| 677 | Ga0501074_0031335 | 3300049590 | Bacteria | 3853 |
| 678 | Ga0501074_0031498 | 3300049590 | Bacteria | 3841 |
| 679 | Ga0501074_0074422 | 3300049590 | Bacteria | 2439 |
| 680 | Ga0501074_0130476 | 3300049590 | Bacteria | 1798 |
| 681 | Ga0501075_0109380 | 3300049591 | Bacteria | 2101 |
| 682 | Ga0501075_0253781 | 3300049591 | Bacteria | 1340 |
| 683 | Ga0501076_0004334 | 3300049592 | Bacteria | 10068 |
| 684 | Ga0501076_0053995 | 3300049592 | Bacteria | 3185 |
| 685 | Ga0501076_0146955 | 3300049592 | Bacteria | 1917 |
| 686 | Ga0501076_0410109 | 3300049592 | Unclassified | 1114 |
| 687 | Ga0501077_0053073 | 3300049593 | Bacteria | 2574 |
| 688 | Ga0501077_0192731 | 3300049593 | Bacteria | 1295 |
| 689 | Ga0501077_0340474 | 3300049593 | Bacteria | 957 |
| 690 | Ga0501079_0009079 | 3300049741 | Bacteria | 7530 |
| 691 | Ga0501079_0023785 | 3300049741 | Bacteria | 4701 |
| 692 | Ga0501079_0064766 | 3300049741 | Bacteria | 2819 |
| 693 | Ga0501079_0074273 | 3300049741 | Bacteria | 2628 |
| 694 | Ga0501080_0000139 | 3300049742 | Bacteria | 50565 |
| 695 | Ga0501080_0005001 | 3300049742 | Bacteria | 11806 |
| 696 | Ga0501080_0039043 | 3300049742 | Bacteria | 4430 |
| 697 | Ga0501080_0079114 | 3300049742 | Bacteria | 3057 |
| 698 | Ga0501080_0306870 | 3300049742 | Bacteria | 1439 |
| 699 | Ga0501081_0003673 | 3300049743 | Bacteria | 9823 |
| 700 | Ga0501081_0008074 | 3300049743 | Bacteria | 6832 |
| 701 | Ga0501081_0015350 | 3300049743 | Bacteria | 5053 |
| 702 | Ga0501081_0087087 | 3300049743 | Bacteria | 2193 |
| 703 | Ga0501083_0000024 | 3300049744 | Bacteria | 123029 |
| 704 | Ga0501083_0069649 | 3300049744 | Bacteria | 2341 |
| 705 | Ga0501083_0105408 | 3300049744 | Bacteria | 1856 |
| 706 | Ga0501083_0182952 | 3300049744 | Bacteria | 1368 |
| 707 | Ga0501035_0001357 | 3300049822 | Bacteria | 25189 |
| 708 | Ga0501035_0003123 | 3300049822 | Bacteria | 15899 |
| 709 | Ga0501035_0007814 | 3300049822 | Bacteria | 9994 |
| 710 | Ga0501035_0045837 | 3300049822 | Bacteria | 3933 |
| 711 | Ga0501035_0051453 | 3300049822 | Bacteria | 3688 |
| 712 | Ga0501035_0068824 | 3300049822 | Bacteria | 3138 |
| 713 | Ga0501035_0096757 | 3300049822 | Bacteria | 2593 |
| 714 | Ga0501035_0103582 | 3300049822 | Bacteria | 2496 |
| 715 | Ga0501035_0122363 | 3300049822 | Bacteria | 2274 |
| 716 | Ga0501035_0435005 | 3300049822 | Bacteria | 1087 |
| 717 | Ga0501044_0000016 | 3300049823 | Bacteria | 231626 |
| 718 | Ga0501044_0001046 | 3300049823 | Bacteria | 33251 |
| 719 | Ga0501044_0014332 | 3300049823 | Bacteria | 8559 |
| 720 | Ga0501044_0030367 | 3300049823 | Bacteria | 5696 |
| 721 | Ga0501044_0037941 | 3300049823 | Bacteria | 5034 |
| 722 | Ga0501044_0039887 | 3300049823 | Bacteria | 4895 |
| 723 | Ga0501044_0109989 | 3300049823 | Bacteria | 2764 |
| 724 | Ga0501044_0288048 | 3300049823 | Bacteria | 1574 |
| 725 | Ga0501044_0292359 | 3300049823 | Bacteria | 1560 |
| 726 | Ga0501045_0038056 | 3300049824 | Bacteria | 3498 |
| 727 | Ga0501045_0080201 | 3300049824 | Bacteria | 2406 |
| 728 | Ga0501045_0090153 | 3300049824 | Bacteria | 2265 |
| 729 | Ga0501045_0133518 | 3300049824 | Bacteria | 1845 |
| 730 | Ga0501045_0135655 | 3300049824 | Bacteria | 1830 |
| 731 | Ga0501045_0136770 | 3300049824 | Bacteria | 1822 |
| 732 | nmdc:mga03683_19246_c2 | 3300050489 | Bacteria | 1663 |
| 733 | nmdc:mga00v17_101375_c1 | 3300050491 | Bacteria | 1818 |
| 734 | nmdc:mga00v17_94680_c1 | 3300050491 | Bacteria | 1879 |
| 735 | nmdc:mga0yw44_25714_c1 | 3300050492 | Bacteria | 3353 |
| 736 | nmdc:mga0yw44_36773_c1 | 3300050492 | Bacteria | 2887 |
| 737 | nmdc:mga0yw44_7206_c1 | 3300050492 | Bacteria | 5450 |
| 738 | nmdc:mga0k408_2879_c1 | 3300050493 | Bacteria | 9123 |
| 739 | nmdc:mga06z11_146544_c1 | 3300050494 | Bacteria | 1338 |
| 740 | nmdc:mga06z11_55368_c1 | 3300050494 | Bacteria | 2048 |
| 741 | nmdc:mga06z11_6143_c1 | 3300050494 | Bacteria | 4863 |
| 742 | nmdc:mga04h51_13416_c1 | 3300050495 | Bacteria | 2319 |
| 743 | nmdc:mga05p37_110528_c1 | 3300050507 | Bacteria | 3381 |
| 744 | nmdc:mga05p37_13591_c2 | 3300050507 | Bacteria | 6115 |
| 745 | nmdc:mga05p37_144139_c1 | 3300050507 | Bacteria | 2917 |
| 746 | nmdc:mga05p37_23642_c1 | 3300050507 | Bacteria | 7460 |
| 747 | nmdc:mga05p37_30735_c2 | 3300050507 | Bacteria | 3600 |
| 748 | nmdc:mga05p37_351922_c1 | 3300050507 | Bacteria | 1734 |
| 749 | nmdc:mga05p37_83131_c1 | 3300050507 | Bacteria | 3944 |
| 750 | nmdc:mga09592_131804_c1 | 3300050508 | Bacteria | 2151 |
| 751 | nmdc:mga09592_2967_c1 | 3300050508 | Bacteria | 13752 |
| 752 | nmdc:mga09592_97108_c1 | 3300050508 | Bacteria | 2521 |
| 753 | nmdc:mga0qj67_10255_c1 | 3300050509 | Bacteria | 6998 |
| 754 | nmdc:mga0qj67_106085_c1 | 3300050509 | Bacteria | 2267 |
| 755 | nmdc:mga0qj67_11822_c1 | 3300050509 | Bacteria | 6552 |
| 756 | nmdc:mga0qj67_27803_c1 | 3300050509 | Bacteria | 4385 |
| 757 | nmdc:mga0qj67_65631_c1 | 3300050509 | Bacteria | 2890 |
| 758 | nmdc:mga0qj67_88087_c1 | 3300050509 | Bacteria | 2492 |
| 759 | nmdc:mga0qj67_886_c1 | 3300050509 | Bacteria | 20528 |
| 760 | nmdc:mga06r32_101016_c1 | 3300050510 | Bacteria | 2830 |
| 761 | nmdc:mga06r32_108764_c1 | 3300050510 | Bacteria | 2726 |
| 762 | nmdc:mga06r32_19380_c1 | 3300050510 | Bacteria | 6242 |
| 763 | nmdc:mga06r32_271596_c1 | 3300050510 | Bacteria | 1683 |
| 764 | nmdc:mga06r32_2722_c1 | 3300050510 | Bacteria | 15812 |
| 765 | nmdc:mga06r32_326_c1 | 3300050510 | Bacteria | 39903 |
| 766 | nmdc:mga06r32_51135_c1 | 3300050510 | Bacteria | 3954 |
| 767 | nmdc:mga06r32_584639_c1 | 3300050510 | Bacteria | 1089 |
| 768 | nmdc:mga06r32_671066_c1 | 3300050510 | Bacteria | 1004 |
| 769 | nmdc:mga06r32_84675_c1 | 3300050510 | Bacteria | 3091 |
| 770 | nmdc:mga08y16_100602_c1 | 3300050511 | Bacteria | 3010 |
| 771 | nmdc:mga08y16_119201_c1 | 3300050511 | Bacteria | 2747 |
| 772 | nmdc:mga08y16_160340_c1 | 3300050511 | Bacteria | 2337 |
| 773 | nmdc:mga08y16_293895_c1 | 3300050511 | Bacteria | 1675 |
| 774 | nmdc:mga08y16_52055_c1 | 3300050511 | Bacteria | 4284 |
| 775 | nmdc:mga08y16_63461_c1 | 3300050511 | Bacteria | 3858 |
| 776 | nmdc:mga08y16_73373_c1 | 3300050511 | Bacteria | 3566 |
| 777 | nmdc:mga08y16_80106_c1 | 3300050511 | Bacteria | 3405 |
| 778 | nmdc:mga0n895_20825_c1 | 3300050512 | Bacteria | 6125 |
| 779 | nmdc:mga0n895_22291_c1 | 3300050512 | Bacteria | 5937 |
| 780 | nmdc:mga0n895_343408_c1 | 3300050512 | Bacteria | 1512 |
| 781 | nmdc:mga0n895_49235_c1 | 3300050512 | Bacteria | 4127 |
| 782 | nmdc:mga0n895_526793_c1 | 3300050512 | Bacteria | 1189 |
| 783 | nmdc:mga0n895_79479_c1 | 3300050512 | Bacteria | 3266 |
| 784 | nmdc:mga0rr50_33097_c1 | 3300050513 | Bacteria | 3690 |
| 785 | nmdc:mga0rr50_93733_c1 | 3300050513 | Bacteria | 2343 |
| 786 | nmdc:mga08x19_162899_c1 | 3300050514 | Bacteria | 1515 |
| 787 | nmdc:mga08x19_88759_c1 | 3300050514 | Bacteria | 2038 |
| 788 | nmdc:mga0a205_132084_c1 | 3300050515 | Bacteria | 2397 |
| 789 | nmdc:mga0a205_527981_c1 | 3300050515 | Bacteria | 1036 |
| 790 | nmdc:mga0sz30_15352_c1 | 3300050516 | Bacteria | 3026 |
| 791 | nmdc:mga0sz30_170760_c1 | 3300050516 | Bacteria | 964 |
| 792 | Ga0495601_0001311 | 3300053077 | Bacteria | 13647 |
| 793 | Ga0495601_0001595 | 3300053077 | Bacteria | 12519 |
| 794 | Ga0495601_0012075 | 3300053077 | Bacteria | 5177 |
| 795 | Ga0495601_0054380 | 3300053077 | Bacteria | 2532 |
| 796 | Ga0495612_0000213 | 3300053078 | Bacteria | 24541 |
| 797 | Ga0495612_0007271 | 3300053078 | Bacteria | 4530 |
| 798 | Ga0495612_0013923 | 3300053078 | Bacteria | 3240 |
| 799 | Ga0495612_0019969 | 3300053078 | Bacteria | 2684 |
| 800 | Ga0495612_0039445 | 3300053078 | Bacteria | 1921 |
| 801 | Ga0500610_0086801 | 3300053079 | Bacteria | 1628 |
| 802 | Ga0495655_0009972 | 3300053083 | Bacteria | 1861 |
| 803 | Ga0495595_0000240 | 3300053084 | Bacteria | 21669 |
| 804 | Ga0495595_0034307 | 3300053084 | Bacteria | 2294 |
| 805 | Ga0495619_0001165 | 3300053085 | Bacteria | 17262 |
| 806 | Ga0495619_0002451 | 3300053085 | Bacteria | 12145 |
| 807 | Ga0495619_0010589 | 3300053085 | Bacteria | 5801 |
| 808 | Ga0495619_0017915 | 3300053085 | Bacteria | 4489 |
| 809 | Ga0495619_0029930 | 3300053085 | Bacteria | 3521 |
| 810 | Ga0495619_0059076 | 3300053085 | Bacteria | 2547 |
| 811 | Ga0495619_0168834 | 3300053085 | Bacteria | 1513 |
| 812 | Ga0495619_0342544 | 3300053085 | Bacteria | 1034 |
| 813 | Ga0500646_0003719 | 3300053090 | Bacteria | 3908 |
| 814 | Ga0500646_0041243 | 3300053090 | Bacteria | 1300 |
| 815 | Ga0500566_0001471 | 3300053094 | Bacteria | 13782 |
| 816 | Ga0500641_0013485 | 3300053096 | Bacteria | 3003 |
| 817 | Ga0500593_012270 | 3300053117 | Bacteria | 3629 |
| 818 | Ga0500594_0007213 | 3300053118 | Bacteria | 2514 |
| 819 | Ga0500595_007580 | 3300053119 | Bacteria | 4494 |
| 820 | Ga0500597_002499 | 3300053120 | Bacteria | 5128 |
| 821 | Ga0500614_002487 | 3300053123 | Bacteria | 4100 |
| 822 | Ga0500614_007050 | 3300053123 | Bacteria | 2365 |
| 823 | Ga0500642_0011249 | 3300053130 | Bacteria | 3194 |
| 824 | Ga0500642_0011917 | 3300053130 | Bacteria | 3133 |
| 825 | Ga0500642_0051038 | 3300053130 | Bacteria | 1826 |
| 826 | Ga0500642_0102596 | 3300053130 | Bacteria | 1332 |
| 827 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 828 | Ga0500652_050255 | 3300053131 | Bacteria | 1701 |
| 829 | Ga0500568_0037464 | 3300053139 | Bacteria | 1967 |
| 830 | Ga0500603_001708 | 3300053150 | Bacteria | 4945 |
| 831 | Ga0500604_0000255 | 3300053151 | Bacteria | 15224 |
| 832 | Ga0500604_0029923 | 3300053151 | Bacteria | 1590 |
| 833 | Ga0500616_0007706 | 3300053153 | Bacteria | 6796 |
| 834 | Ga0500636_0018124 | 3300053177 | Bacteria | 4163 |
| 835 | Ga0501084_0005808 | 3300054114 | Bacteria | 10158 |
| 836 | Ga0501084_0031558 | 3300054114 | Bacteria | 4429 |
| 837 | Ga0501084_0058828 | 3300054114 | Bacteria | 3216 |
| 838 | Ga0501084_0069657 | 3300054114 | Bacteria | 2945 |
| 839 | Ga0501084_0215005 | 3300054114 | Bacteria | 1622 |
| 840 | Ga0501084_0228168 | 3300054114 | Bacteria | 1572 |
| 841 | Ga0501084_0408553 | 3300054114 | Bacteria | 1147 |
| 842 | Ga0501082_0008388 | 3300060353 | Bacteria | 8913 |
| 843 | Ga0501082_0014628 | 3300060353 | Bacteria | 6759 |
| 844 | Ga0501082_0031447 | 3300060353 | Bacteria | 4577 |
| 845 | Ga0501082_0058534 | 3300060353 | Bacteria | 3320 |
| 846 | Ga0501082_0196289 | 3300060353 | Bacteria | 1756 |
| 847 | Ga0501082_0348010 | 3300060353 | Unclassified | 1292 |
| 848 | Ga0501082_0408408 | 3300060353 | Bacteria | 1185 |
| 849 | Ga0466962_0146378 | 3300061719 | Bacteria | 1145 |
| 850 | Ga0530510_0086846 | 3300061734 | Bacteria | 2279 |
| 851 | Ga0530510_0115336 | 3300061734 | Bacteria | 1969 |
| 852 | Ga0530510_0197812 | 3300061734 | Bacteria | 1492 |
| 853 | Ga0530510_0201128 | 3300061734 | Bacteria | 1480 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049577 | Ga0501041_0039800 | Ga0501041_0039800_1805_2692 | 258 |
| 2 | 3300049588 | Ga0501072_0226408 | Ga0501072_0226408_264_1151 | 258 |
| 3 | 3300049591 | Ga0501075_0253781 | Ga0501075_0253781_265_1152 | 258 |
| 4 | 3300049592 | Ga0501076_0053995 | Ga0501076_0053995_2164_3051 | 258 |
| 5 | 3300060353 | Ga0501082_0058534 | Ga0501082_0058534_953_1840 | 258 |
| 6 | 3300061734 | Ga0530510_0086846 | Ga0530510_0086846_1072_1959 | 258 |
| 7 | 3300013296 | Ga0157374_10720323 | Ga0157374_107203232 | 262 |
| 8 | 3300046516 | Ga0495628_0478825 | Ga0495628_0478825_13_801 | 262 |
| 9 | 3300046642 | Ga0495634_0345751 | Ga0495634_0345751_12_800 | 262 |
| 10 | 3300049574 | Ga0501038_0161500 | Ga0501038_0161500_443_1318 | 262 |
| 11 | 3300005614 | Ga0068856_100444007 | Ga0068856_1004440072 | 263 |
| 12 | 3300049574 | Ga0501038_0145817 | Ga0501038_0145817_95_892 | 265 |
| 13 | 3300049575 | Ga0501039_0158162 | Ga0501039_0158162_573_1370 | 265 |
| 14 | 3300049576 | Ga0501040_0011721 | Ga0501040_0011721_3665_4462 | 265 |
| 15 | 3300049824 | Ga0501045_0080201 | Ga0501045_0080201_848_1645 | 265 |
| 16 | 3300027695 | Ga0209966_1037864 | Ga0209966_10378641 | 266 |
| 17 | 3300003316 | rootH1_10101929 | rootH1_101019291 | 267 |
| 18 | 3300050516 | nmdc:mga0sz30_170760_c1 | nmdc:mga0sz30_170760_c1_150_953 | 267 |
| 19 | 3300006846 | Ga0075430_100001038 | Ga0075430_10000103818 | 268 |
| 20 | 3300006846 | Ga0075430_100025536 | Ga0075430_1000255364 | 268 |
| 21 | 3300013297 | Ga0157378_10435382 | Ga0157378_104353822 | 268 |
| 22 | 3300027360 | Ga0209969_1000301 | Ga0209969_10003015 | 268 |
| 23 | 3300027364 | Ga0209967_1001239 | Ga0209967_10012392 | 268 |
| 24 | 3300027378 | Ga0209981_1005492 | Ga0209981_10054922 | 268 |
| 25 | 3300027462 | Ga0210000_1001102 | Ga0210000_10011022 | 268 |
| 26 | 3300027526 | Ga0209968_1001052 | Ga0209968_10010523 | 268 |
| 27 | 3300048911 | Ga0496108_0758615 | Ga0496108_0758615_14_820 | 268 |
| 28 | 3300049743 | Ga0501081_0015350 | Ga0501081_0015350_617_1423 | 268 |
| 29 | 3300050509 | nmdc:mga0qj67_27803_c1 | nmdc:mga0qj67_27803_c1_839_1645 | 268 |
| 30 | 3300050509 | nmdc:mga0qj67_886_c1 | nmdc:mga0qj67_886_c1_16387_17193 | 268 |
| 31 | 3300050510 | nmdc:mga06r32_51135_c1 | nmdc:mga06r32_51135_c1_1946_2752 | 268 |
| 32 | 3300050510 | nmdc:mga06r32_671066_c1 | nmdc:mga06r32_671066_c1_14_820 | 268 |
| 33 | 3300006844 | Ga0075428_100115363 | Ga0075428_1001153632 | 269 |
| 34 | 3300049575 | Ga0501039_0286338 | Ga0501039_0286338_41_910 | 270 |
| 35 | 3300049824 | Ga0501045_0136770 | Ga0501045_0136770_781_1593 | 270 |
| 36 | 3300005614 | Ga0068856_100056846 | Ga0068856_1000568462 | 271 |
| 37 | 3300027907 | Ga0207428_10225018 | Ga0207428_102250182 | 271 |
| 38 | 3300049570 | Ga0501033_0039910 | Ga0501033_0039910_884_1756 | 271 |
| 39 | 3300049576 | Ga0501040_0078815 | Ga0501040_0078815_789_1661 | 271 |
| 40 | 3300049577 | Ga0501041_0106541 | Ga0501041_0106541_408_1280 | 271 |
| 41 | 3300049579 | Ga0501043_0122475 | Ga0501043_0122475_522_1394 | 271 |
| 42 | 3300049582 | Ga0501048_0056563 | Ga0501048_0056563_1396_2268 | 271 |
| 43 | 3300049588 | Ga0501072_0109117 | Ga0501072_0109117_367_1239 | 271 |
| 44 | 3300049590 | Ga0501074_0130476 | Ga0501074_0130476_707_1579 | 271 |
| 45 | 3300049741 | Ga0501079_0074273 | Ga0501079_0074273_968_1840 | 271 |
| 46 | 3300049743 | Ga0501081_0087087 | Ga0501081_0087087_696_1568 | 271 |
| 47 | 3300049824 | Ga0501045_0090153 | Ga0501045_0090153_930_1802 | 271 |
| 48 | 3300050510 | nmdc:mga06r32_101016_c1 | nmdc:mga06r32_101016_c1_786_1658 | 271 |
| 49 | 3300050510 | nmdc:mga06r32_326_c1 | nmdc:mga06r32_326_c1_38641_39513 | 271 |
| 50 | 3300050511 | nmdc:mga08y16_73373_c1 | nmdc:mga08y16_73373_c1_823_1698 | 271 |
| 51 | 3300060353 | Ga0501082_0031447 | Ga0501082_0031447_774_1646 | 271 |
| 52 | 3300061734 | Ga0530510_0197812 | Ga0530510_0197812_551_1423 | 271 |
| 53 | 3300006914 | Ga0075436_100054512 | Ga0075436_1000545122 | 275 |
| 54 | 3300031595 | Ga0265313_10000960 | Ga0265313_1000096014 | 275 |
| 55 | 3300006844 | Ga0075428_100043702 | Ga0075428_1000437023 | 276 |
| 56 | 3300006846 | Ga0075430_100121511 | Ga0075430_1001215112 | 276 |
| 57 | 3300006846 | Ga0075430_100165915 | Ga0075430_1001659152 | 276 |
| 58 | 3300006847 | Ga0075431_100169557 | Ga0075431_1001695572 | 276 |
| 59 | 3300009147 | Ga0114129_10111214 | Ga0114129_101112143 | 276 |
| 60 | 3300027395 | Ga0209996_1009934 | Ga0209996_10099342 | 276 |
| 61 | 3300027462 | Ga0210000_1010799 | Ga0210000_10107992 | 276 |
| 62 | 3300027543 | Ga0209999_1005741 | Ga0209999_10057413 | 276 |
| 63 | 3300027876 | Ga0209974_10005420 | Ga0209974_100054205 | 276 |
| 64 | 3300042435 | Ga0439434_0004801 | Ga0439434_0004801_1209_2039 | 276 |
| 65 | 3300042435 | Ga0439434_0082573 | Ga0439434_0082573_43_873 | 276 |
| 66 | 3300042436 | Ga0439435_0000044 | Ga0439435_0000044_2319_3149 | 276 |
| 67 | 3300042437 | Ga0439444_0003343 | Ga0439444_0003343_1050_1880 | 276 |
| 68 | 3300042461 | Ga0439460_0015586 | Ga0439460_0015586_582_1412 | 276 |
| 69 | 3300046511 | Ga0495608_0113266 | Ga0495608_0113266_544_1374 | 276 |
| 70 | 3300046526 | Ga0495666_0004437 | Ga0495666_0004437_14_844 | 276 |
| 71 | 3300046537 | Ga0495598_0051983 | Ga0495598_0051983_312_1214 | 276 |
| 72 | 3300048904 | Ga0496101_0295485 | Ga0496101_0295485_10_840 | 276 |
| 73 | 3300049579 | Ga0501043_0000013 | Ga0501043_0000013_9499_10368 | 276 |
| 74 | 3300049580 | Ga0501046_0000099 | Ga0501046_0000099_52706_53575 | 276 |
| 75 | 3300049581 | Ga0501047_0000040 | Ga0501047_0000040_9499_10368 | 276 |
| 76 | 3300049582 | Ga0501048_0000932 | Ga0501048_0000932_11240_12109 | 276 |
| 77 | 3300049590 | Ga0501074_0074422 | Ga0501074_0074422_867_1697 | 276 |
| 78 | 3300049824 | Ga0501045_0038056 | Ga0501045_0038056_852_1721 | 276 |
| 79 | 3300050507 | nmdc:mga05p37_13591_c2 | nmdc:mga05p37_13591_c2_3970_4800 | 276 |
| 80 | 3300050508 | nmdc:mga09592_2967_c1 | nmdc:mga09592_2967_c1_11696_12526 | 276 |
| 81 | 3300050509 | nmdc:mga0qj67_106085_c1 | nmdc:mga0qj67_106085_c1_367_1197 | 276 |
| 82 | 3300050510 | nmdc:mga06r32_2722_c1 | nmdc:mga06r32_2722_c1_14702_15532 | 276 |
| 83 | 3300050510 | nmdc:mga06r32_584639_c1 | nmdc:mga06r32_584639_c1_21_851 | 276 |
| 84 | 3300060353 | Ga0501082_0196289 | Ga0501082_0196289_430_1299 | 276 |
| 85 | 3300053118 | Ga0500594_0007213 | Ga0500594_0007213_755_1621 | 277 |
| 86 | 3300005345 | Ga0070692_10054837 | Ga0070692_100548372 | 278 |
| 87 | 3300025944 | Ga0207661_10323570 | Ga0207661_103235702 | 278 |
| 88 | 3300035090 | Ga0373949_0000762 | Ga0373949_0000762_778_1647 | 278 |
| 89 | 3300046690 | Ga0495624_0116267 | Ga0495624_0116267_182_1057 | 278 |
| 90 | 3300005535 | Ga0070684_100068425 | Ga0070684_1000684251 | 279 |
| 91 | 3300021384 | Ga0213876_10027264 | Ga0213876_100272642 | 279 |
| 92 | 3300026041 | Ga0207639_10126065 | Ga0207639_101260652 | 279 |
| 93 | 3300031251 | Ga0265327_10004354 | Ga0265327_100043545 | 279 |
| 94 | 3300039437 | Ga0436365_0763020 | Ga0436365_0763020_3532_4404 | 279 |
| 95 | 3300048907 | Ga0496104_0018794 | Ga0496104_0018794_4238_5110 | 279 |
| 96 | 3300048911 | Ga0496108_0346557 | Ga0496108_0346557_37_909 | 279 |
| 97 | 3300005365 | Ga0070688_100097895 | Ga0070688_1000978952 | 280 |
| 98 | 3300014968 | Ga0157379_10156673 | Ga0157379_101566732 | 280 |
| 99 | 3300025927 | Ga0207687_10110692 | Ga0207687_101106922 | 280 |
| 100 | 3300025931 | Ga0207644_10215155 | Ga0207644_102151552 | 280 |
| 101 | 3300046472 | Ga0495580_0113981 | Ga0495580_0113981_420_1295 | 280 |
| 102 | 3300048911 | Ga0496108_0065717 | Ga0496108_0065717_206_1081 | 280 |
| 103 | 3300048913 | Ga0496110_0009471 | Ga0496110_0009471_1457_2332 | 280 |
| 104 | 3300048915 | Ga0496112_0364814 | Ga0496112_0364814_174_1049 | 280 |
| 105 | 3300031824 | Ga0307413_10079368 | Ga0307413_100793682 | 281 |
| 106 | 3300031901 | Ga0307406_10402972 | Ga0307406_104029721 | 281 |
| 107 | 3300032002 | Ga0307416_100140989 | Ga0307416_1001409893 | 281 |
| 108 | 3300028800 | Ga0265338_10251082 | Ga0265338_102510822 | 282 |
| 109 | 3300031240 | Ga0265320_10008692 | Ga0265320_100086928 | 282 |
| 110 | 3300031711 | Ga0265314_10007016 | Ga0265314_100070168 | 282 |
| 111 | 3300035116 | Ga0373945_0002449 | Ga0373945_0002449_4700_5614 | 282 |
| 112 | 3300035170 | Ga0373943_0000537 | Ga0373943_0000537_7735_8649 | 282 |
| 113 | 3300035695 | Ga0373927_0002460 | Ga0373927_0002460_10980_11894 | 282 |
| 114 | 3300035725 | Ga0373947_0004973 | Ga0373947_0004973_5601_6473 | 282 |
| 115 | 3300037068 | Ga0373925_0002857 | Ga0373925_0002857_12542_13456 | 282 |
| 116 | 3300046517 | Ga0495630_0011171 | Ga0495630_0011171_4602_5516 | 282 |
| 117 | 3300046526 | Ga0495666_0032824 | Ga0495666_0032824_948_1820 | 282 |
| 118 | 3300046663 | Ga0495635_0157161 | Ga0495635_0157161_99_1013 | 282 |
| 119 | 3300047315 | Ga0495581_0069497 | Ga0495581_0069497_608_1480 | 282 |
| 120 | 3300047321 | Ga0495676_0225737 | Ga0495676_0225737_261_1175 | 282 |
| 121 | 3300047673 | Ga0495593_0006391 | Ga0495593_0006391_2370_3284 | 282 |
| 122 | 3300048089 | Ga0495614_0031776 | Ga0495614_0031776_1054_1968 | 282 |
| 123 | 3300044694 | Ga0466963_0128427 | Ga0466963_0128427_700_1572 | 283 |
| 124 | 3300044842 | Ga0466957_0250912 | Ga0466957_0250912_110_982 | 283 |
| 125 | 3300045836 | Ga0466958_0228396 | Ga0466958_0228396_156_1028 | 283 |
| 126 | 3300046528 | Ga0495642_0056930 | Ga0495642_0056930_710_1579 | 283 |
| 127 | 3300053123 | Ga0500614_007050 | Ga0500614_007050_1129_1998 | 283 |
| 128 | 3300061719 | Ga0466962_0146378 | Ga0466962_0146378_136_1008 | 283 |
| 129 | 3300005563 | Ga0068855_100359197 | Ga0068855_1003591972 | 284 |
| 130 | 3300005719 | Ga0068861_100110705 | Ga0068861_1001107053 | 284 |
| 131 | 3300009093 | Ga0105240_10636057 | Ga0105240_106360572 | 284 |
| 132 | 3300009094 | Ga0111539_10128038 | Ga0111539_101280382 | 284 |
| 133 | 3300009094 | Ga0111539_10137933 | Ga0111539_101379334 | 284 |
| 134 | 3300013306 | Ga0163162_10085892 | Ga0163162_100858922 | 284 |
| 135 | 3300031241 | Ga0265325_10008018 | Ga0265325_100080187 | 284 |
| 136 | 3300035088 | Ga0373940_0039283 | Ga0373940_0039283_401_1255 | 284 |
| 137 | 3300035092 | Ga0373952_0005802 | Ga0373952_0005802_1096_1950 | 284 |
| 138 | 3300035114 | Ga0373939_0000939 | Ga0373939_0000939_1445_2299 | 284 |
| 139 | 3300035115 | Ga0373941_0026413 | Ga0373941_0026413_764_1618 | 284 |
| 140 | 3300035207 | Ga0373942_0004147 | Ga0373942_0004147_2492_3346 | 284 |
| 141 | 3300035691 | Ga0373931_0000865 | Ga0373931_0000865_379_1233 | 284 |
| 142 | 3300047318 | Ga0495636_0203334 | Ga0495636_0203334_14_886 | 284 |
| 143 | 3300049573 | Ga0501037_0308163 | Ga0501037_0308163_35_907 | 284 |
| 144 | 3300049577 | Ga0501041_0112116 | Ga0501041_0112116_421_1293 | 284 |
| 145 | 3300049587 | Ga0501071_0029463 | Ga0501071_0029463_1198_2070 | 284 |
| 146 | 3300049588 | Ga0501072_0228177 | Ga0501072_0228177_174_1046 | 284 |
| 147 | 3300049742 | Ga0501080_0039043 | Ga0501080_0039043_2031_2903 | 284 |
| 148 | 3300050511 | nmdc:mga08y16_80106_c1 | nmdc:mga08y16_80106_c1_606_1460 | 284 |
| 149 | 3300050512 | nmdc:mga0n895_20825_c1 | nmdc:mga0n895_20825_c1_3796_4650 | 284 |
| 150 | 3300005985 | Ga0081539_10040250 | Ga0081539_100402502 | 285 |
| 151 | 3300021384 | Ga0213876_10046534 | Ga0213876_100465342 | 285 |
| 152 | 3300039437 | Ga0436365_0936231 | Ga0436365_0936231_595_1461 | 285 |
| 153 | 3300047471 | Ga0495684_0047235 | Ga0495684_0047235_680_1552 | 285 |
| 154 | 3300025986 | Ga0207658_10148586 | Ga0207658_101485862 | 287 |
| 155 | 3300049571 | Ga0501034_0236132 | Ga0501034_0236132_853_1725 | 287 |
| 156 | 3300049581 | Ga0501047_0079948 | Ga0501047_0079948_661_1533 | 287 |
| 157 | 3300005338 | Ga0068868_100418451 | Ga0068868_1004184512 | 288 |
| 158 | 3300005367 | Ga0070667_100194491 | Ga0070667_1001944911 | 288 |
| 159 | 3300009098 | Ga0105245_10009970 | Ga0105245_100099706 | 288 |
| 160 | 3300009148 | Ga0105243_10083844 | Ga0105243_100838442 | 288 |
| 161 | 3300009176 | Ga0105242_10425437 | Ga0105242_104254372 | 288 |
| 162 | 3300009177 | Ga0105248_10014889 | Ga0105248_100148896 | 288 |
| 163 | 3300025933 | Ga0207706_10206689 | Ga0207706_102066892 | 288 |
| 164 | 3300025935 | Ga0207709_10039578 | Ga0207709_100395783 | 288 |
| 165 | 3300025960 | Ga0207651_10071915 | Ga0207651_100719153 | 288 |
| 166 | 3300025986 | Ga0207658_10133627 | Ga0207658_101336271 | 288 |
| 167 | 3300053090 | Ga0500646_0003719 | Ga0500646_0003719_2388_3254 | 288 |
| 168 | 3300053139 | Ga0500568_0037464 | Ga0500568_0037464_279_1145 | 288 |
| 169 | 3300053151 | Ga0500604_0000255 | Ga0500604_0000255_8246_9112 | 288 |
| 170 | 3300005471 | Ga0070698_100107974 | Ga0070698_1001079742 | 289 |
| 171 | 3300005535 | Ga0070684_100175094 | Ga0070684_1001750942 | 289 |
| 172 | 3300005543 | Ga0070672_100086593 | Ga0070672_1000865932 | 289 |
| 173 | 3300005544 | Ga0070686_100105802 | Ga0070686_1001058022 | 289 |
| 174 | 3300005614 | Ga0068856_100282343 | Ga0068856_1002823431 | 289 |
| 175 | 3300005842 | Ga0068858_100396431 | Ga0068858_1003964312 | 289 |
| 176 | 3300005983 | Ga0081540_1007933 | Ga0081540_10079332 | 289 |
| 177 | 3300005983 | Ga0081540_1070642 | Ga0081540_10706422 | 289 |
| 178 | 3300006175 | Ga0070712_100001365 | Ga0070712_10000136510 | 289 |
| 179 | 3300006177 | Ga0075362_10025194 | Ga0075362_100251942 | 289 |
| 180 | 3300006195 | Ga0075366_10003908 | Ga0075366_100039087 | 289 |
| 181 | 3300006237 | Ga0097621_100034275 | Ga0097621_1000342754 | 289 |
| 182 | 3300006358 | Ga0068871_100040552 | Ga0068871_1000405522 | 289 |
| 183 | 3300009094 | Ga0111539_10439485 | Ga0111539_104394852 | 289 |
| 184 | 3300009101 | Ga0105247_10159397 | Ga0105247_101593972 | 289 |
| 185 | 3300009147 | Ga0114129_10110595 | Ga0114129_101105952 | 289 |
| 186 | 3300009147 | Ga0114129_10257894 | Ga0114129_102578942 | 289 |
| 187 | 3300009147 | Ga0114129_10643814 | Ga0114129_106438142 | 289 |
| 188 | 3300025291 | Ga0209675_1002489 | Ga0209675_10024898 | 289 |
| 189 | 3300025915 | Ga0207693_10004385 | Ga0207693_100043859 | 289 |
| 190 | 3300026035 | Ga0207703_10334189 | Ga0207703_103341892 | 289 |
| 191 | 3300031242 | Ga0265329_10011112 | Ga0265329_100111123 | 289 |
| 192 | 3300031247 | Ga0265340_10006108 | Ga0265340_100061083 | 289 |
| 193 | 3300031249 | Ga0265339_10009558 | Ga0265339_100095585 | 289 |
| 194 | 3300031250 | Ga0265331_10028922 | Ga0265331_100289222 | 289 |
| 195 | 3300031712 | Ga0265342_10000026 | Ga0265342_10000026120 | 289 |
| 196 | 3300031824 | Ga0307413_10256068 | Ga0307413_102560682 | 289 |
| 197 | 3300031911 | Ga0307412_10121879 | Ga0307412_101218792 | 289 |
| 198 | 3300035119 | Ga0373956_0052024 | Ga0373956_0052024_926_1795 | 289 |
| 199 | 3300035171 | Ga0373946_0088240 | Ga0373946_0088240_339_1208 | 289 |
| 200 | 3300035172 | Ga0373955_0057057 | Ga0373955_0057057_766_1635 | 289 |
| 201 | 3300035241 | Ga0373961_0033728 | Ga0373961_0033728_350_1219 | 289 |
| 202 | 3300035695 | Ga0373927_0019146 | Ga0373927_0019146_1116_1985 | 289 |
| 203 | 3300035724 | Ga0373933_0011665 | Ga0373933_0011665_1166_2035 | 289 |
| 204 | 3300036401 | Ga0373937_0023654 | Ga0373937_0023654_3200_4069 | 289 |
| 205 | 3300036712 | Ga0316584_0033825 | Ga0316584_0033825_1352_2221 | 289 |
| 206 | 3300037853 | Ga0436364_0006078 | Ga0436364_0006078_733_1602 | 289 |
| 207 | 3300037853 | Ga0436364_0295959 | Ga0436364_0295959_309_1181 | 289 |
| 208 | 3300037853 | Ga0436364_0505381 | Ga0436364_0505381_9436_10308 | 289 |
| 209 | 3300039438 | Ga0436360_0757620 | Ga0436360_0757620_529_1398 | 289 |
| 210 | 3300039447 | Ga0436361_0783087 | Ga0436361_0783087_4966_5835 | 289 |
| 211 | 3300046454 | Ga0495592_0047711 | Ga0495592_0047711_1551_2420 | 289 |
| 212 | 3300046462 | Ga0495651_0016719 | Ga0495651_0016719_3353_4222 | 289 |
| 213 | 3300046463 | Ga0495653_0013856 | Ga0495653_0013856_2388_3257 | 289 |
| 214 | 3300046511 | Ga0495608_0044624 | Ga0495608_0044624_1263_2132 | 289 |
| 215 | 3300046514 | Ga0495618_0015587 | Ga0495618_0015587_1382_2251 | 289 |
| 216 | 3300046516 | Ga0495628_0031255 | Ga0495628_0031255_3199_4068 | 289 |
| 217 | 3300046529 | Ga0495652_0005448 | Ga0495652_0005448_5703_6572 | 289 |
| 218 | 3300046533 | Ga0495640_0005918 | Ga0495640_0005918_4464_5333 | 289 |
| 219 | 3300046536 | Ga0495587_0018230 | Ga0495587_0018230_2920_3789 | 289 |
| 220 | 3300046537 | Ga0495598_0007747 | Ga0495598_0007747_1322_2191 | 289 |
| 221 | 3300046559 | Ga0495667_0002411 | Ga0495667_0002411_3889_4758 | 289 |
| 222 | 3300046615 | Ga0495656_0039772 | Ga0495656_0039772_533_1402 | 289 |
| 223 | 3300046642 | Ga0495634_0098788 | Ga0495634_0098788_440_1309 | 289 |
| 224 | 3300046663 | Ga0495635_0007512 | Ga0495635_0007512_3251_4120 | 289 |
| 225 | 3300046675 | Ga0495657_0075738 | Ga0495657_0075738_694_1563 | 289 |
| 226 | 3300046680 | Ga0495646_0019276 | Ga0495646_0019276_2447_3316 | 289 |
| 227 | 3300046681 | Ga0495647_0046698 | Ga0495647_0046698_144_1013 | 289 |
| 228 | 3300046809 | Ga0495600_0024345 | Ga0495600_0024345_273_1142 | 289 |
| 229 | 3300047317 | Ga0495604_0009356 | Ga0495604_0009356_5109_5978 | 289 |
| 230 | 3300047322 | Ga0495680_0006934 | Ga0495680_0006934_2217_3086 | 289 |
| 231 | 3300048088 | Ga0495602_0008235 | Ga0495602_0008235_1803_2672 | 289 |
| 232 | 3300048905 | Ga0496102_0024027 | Ga0496102_0024027_3104_3973 | 289 |
| 233 | 3300048907 | Ga0496104_0021537 | Ga0496104_0021537_4187_5056 | 289 |
| 234 | 3300048908 | Ga0496105_0037429 | Ga0496105_0037429_618_1487 | 289 |
| 235 | 3300049572 | Ga0501036_0072802 | Ga0501036_0072802_647_1516 | 289 |
| 236 | 3300049578 | Ga0501042_0001369 | Ga0501042_0001369_2972_3841 | 289 |
| 237 | 3300049582 | Ga0501048_0009377 | Ga0501048_0009377_2361_3230 | 289 |
| 238 | 3300049583 | Ga0501067_0021984 | Ga0501067_0021984_1593_2534 | 289 |
| 239 | 3300049584 | Ga0501068_0156298 | Ga0501068_0156298_291_1160 | 289 |
| 240 | 3300049587 | Ga0501071_0014941 | Ga0501071_0014941_1023_1892 | 289 |
| 241 | 3300049588 | Ga0501072_0250925 | Ga0501072_0250925_191_1063 | 289 |
| 242 | 3300049589 | Ga0501073_0061619 | Ga0501073_0061619_240_1112 | 289 |
| 243 | 3300049589 | Ga0501073_0100359 | Ga0501073_0100359_866_1735 | 289 |
| 244 | 3300049590 | Ga0501074_0031498 | Ga0501074_0031498_705_1577 | 289 |
| 245 | 3300049592 | Ga0501076_0004334 | Ga0501076_0004334_2492_3361 | 289 |
| 246 | 3300049742 | Ga0501080_0079114 | Ga0501080_0079114_738_1628 | 289 |
| 247 | 3300049743 | Ga0501081_0003673 | Ga0501081_0003673_8174_9043 | 289 |
| 248 | 3300050507 | nmdc:mga05p37_351922_c1 | nmdc:mga05p37_351922_c1_821_1690 | 289 |
| 249 | 3300050507 | nmdc:mga05p37_83131_c1 | nmdc:mga05p37_83131_c1_2386_3261 | 289 |
| 250 | 3300050515 | nmdc:mga0a205_132084_c1 | nmdc:mga0a205_132084_c1_531_1406 | 289 |
| 251 | 3300050515 | nmdc:mga0a205_527981_c1 | nmdc:mga0a205_527981_c1_143_1012 | 289 |
| 252 | 3300053077 | Ga0495601_0001595 | Ga0495601_0001595_8203_9072 | 289 |
| 253 | 3300053078 | Ga0495612_0019969 | Ga0495612_0019969_1505_2374 | 289 |
| 254 | 3300053078 | Ga0495612_0039445 | Ga0495612_0039445_371_1240 | 289 |
| 255 | 3300053084 | Ga0495595_0034307 | Ga0495595_0034307_550_1419 | 289 |
| 256 | 3300053085 | Ga0495619_0002451 | Ga0495619_0002451_10069_10938 | 289 |
| 257 | 3300053085 | Ga0495619_0059076 | Ga0495619_0059076_942_1811 | 289 |
| 258 | 3300053085 | Ga0495619_0342544 | Ga0495619_0342544_98_967 | 289 |
| 259 | 3300053094 | Ga0500566_0001471 | Ga0500566_0001471_2199_3068 | 289 |
| 260 | 3300053120 | Ga0500597_002499 | Ga0500597_002499_3260_4129 | 289 |
| 261 | 3300053123 | Ga0500614_002487 | Ga0500614_002487_1123_1992 | 289 |
| 262 | 3300053130 | Ga0500642_0011249 | Ga0500642_0011249_2272_3141 | 289 |
| 263 | 3300053130 | Ga0500642_0011917 | Ga0500642_0011917_2183_3052 | 289 |
| 264 | 3300053150 | Ga0500603_001708 | Ga0500603_001708_2351_3220 | 289 |
| 265 | 3300053177 | Ga0500636_0018124 | Ga0500636_0018124_2244_3113 | 289 |
| 266 | 3300054114 | Ga0501084_0058828 | Ga0501084_0058828_1516_2385 | 289 |
| 267 | 3300003215 | JGI25153J46596_10003964 | JGI25153J46596_100039646 | 290 |
| 268 | 3300005290 | Ga0065712_10022039 | Ga0065712_100220392 | 290 |
| 269 | 3300005295 | Ga0065707_10201144 | Ga0065707_102011441 | 290 |
| 270 | 3300005327 | Ga0070658_10007812 | Ga0070658_100078125 | 290 |
| 271 | 3300005327 | Ga0070658_10163506 | Ga0070658_101635062 | 290 |
| 272 | 3300005330 | Ga0070690_100011486 | Ga0070690_1000114865 | 290 |
| 273 | 3300005334 | Ga0068869_100032828 | Ga0068869_1000328284 | 290 |
| 274 | 3300005335 | Ga0070666_10187404 | Ga0070666_101874042 | 290 |
| 275 | 3300005336 | Ga0070680_100004671 | Ga0070680_1000046719 | 290 |
| 276 | 3300005336 | Ga0070680_100010183 | Ga0070680_1000101834 | 290 |
| 277 | 3300005336 | Ga0070680_100081170 | Ga0070680_1000811702 | 290 |
| 278 | 3300005337 | Ga0070682_100060440 | Ga0070682_1000604402 | 290 |
| 279 | 3300005338 | Ga0068868_100327538 | Ga0068868_1003275382 | 290 |
| 280 | 3300005339 | Ga0070660_100025632 | Ga0070660_1000256322 | 290 |
| 281 | 3300005339 | Ga0070660_100242405 | Ga0070660_1002424052 | 290 |
| 282 | 3300005340 | Ga0070689_100003048 | Ga0070689_10000304811 | 290 |
| 283 | 3300005340 | Ga0070689_100182890 | Ga0070689_1001828902 | 290 |
| 284 | 3300005341 | Ga0070691_10002385 | Ga0070691_100023852 | 290 |
| 285 | 3300005343 | Ga0070687_100223455 | Ga0070687_1002234551 | 290 |
| 286 | 3300005344 | Ga0070661_100129809 | Ga0070661_1001298092 | 290 |
| 287 | 3300005347 | Ga0070668_100175965 | Ga0070668_1001759652 | 290 |
| 288 | 3300005354 | Ga0070675_100227172 | Ga0070675_1002271722 | 290 |
| 289 | 3300005355 | Ga0070671_100001629 | Ga0070671_10000162919 | 290 |
| 290 | 3300005355 | Ga0070671_100179031 | Ga0070671_1001790312 | 290 |
| 291 | 3300005356 | Ga0070674_100005640 | Ga0070674_1000056407 | 290 |
| 292 | 3300005356 | Ga0070674_100265233 | Ga0070674_1002652332 | 290 |
| 293 | 3300005365 | Ga0070688_100010598 | Ga0070688_1000105983 | 290 |
| 294 | 3300005365 | Ga0070688_100103190 | Ga0070688_1001031902 | 290 |
| 295 | 3300005366 | Ga0070659_100138178 | Ga0070659_1001381782 | 290 |
| 296 | 3300005367 | Ga0070667_100238863 | Ga0070667_1002388632 | 290 |
| 297 | 3300005406 | Ga0070703_10000863 | Ga0070703_100008639 | 290 |
| 298 | 3300005434 | Ga0070709_10044315 | Ga0070709_100443153 | 290 |
| 299 | 3300005434 | Ga0070709_10089360 | Ga0070709_100893602 | 290 |
| 300 | 3300005435 | Ga0070714_100015537 | Ga0070714_1000155374 | 290 |
| 301 | 3300005435 | Ga0070714_100034473 | Ga0070714_1000344736 | 290 |
| 302 | 3300005436 | Ga0070713_100006445 | Ga0070713_1000064456 | 290 |
| 303 | 3300005436 | Ga0070713_100066826 | Ga0070713_1000668262 | 290 |
| 304 | 3300005436 | Ga0070713_100175961 | Ga0070713_1001759612 | 290 |
| 305 | 3300005439 | Ga0070711_100031327 | Ga0070711_1000313273 | 290 |
| 306 | 3300005439 | Ga0070711_100086139 | Ga0070711_1000861392 | 290 |
| 307 | 3300005439 | Ga0070711_100130881 | Ga0070711_1001308812 | 290 |
| 308 | 3300005439 | Ga0070711_100199513 | Ga0070711_1001995132 | 290 |
| 309 | 3300005440 | Ga0070705_100002047 | Ga0070705_1000020479 | 290 |
| 310 | 3300005441 | Ga0070700_100006099 | Ga0070700_1000060995 | 290 |
| 311 | 3300005441 | Ga0070700_100307430 | Ga0070700_1003074301 | 290 |
| 312 | 3300005444 | Ga0070694_100002834 | Ga0070694_1000028349 | 290 |
| 313 | 3300005444 | Ga0070694_100194113 | Ga0070694_1001941132 | 290 |
| 314 | 3300005456 | Ga0070678_100135240 | Ga0070678_1001352402 | 290 |
| 315 | 3300005457 | Ga0070662_100088159 | Ga0070662_1000881592 | 290 |
| 316 | 3300005457 | Ga0070662_100226547 | Ga0070662_1002265472 | 290 |
| 317 | 3300005458 | Ga0070681_10039242 | Ga0070681_100392422 | 290 |
| 318 | 3300005458 | Ga0070681_10046550 | Ga0070681_100465503 | 290 |
| 319 | 3300005459 | Ga0068867_100379411 | Ga0068867_1003794111 | 290 |
| 320 | 3300005466 | Ga0070685_10034379 | Ga0070685_100343792 | 290 |
| 321 | 3300005466 | Ga0070685_10068286 | Ga0070685_100682862 | 290 |
| 322 | 3300005466 | Ga0070685_10153428 | Ga0070685_101534282 | 290 |
| 323 | 3300005471 | Ga0070698_100138364 | Ga0070698_1001383642 | 290 |
| 324 | 3300005518 | Ga0070699_100000676 | Ga0070699_1000006766 | 290 |
| 325 | 3300005518 | Ga0070699_100008160 | Ga0070699_1000081609 | 290 |
| 326 | 3300005518 | Ga0070699_100037744 | Ga0070699_1000377443 | 290 |
| 327 | 3300005530 | Ga0070679_100018216 | Ga0070679_1000182168 | 290 |
| 328 | 3300005530 | Ga0070679_100031611 | Ga0070679_1000316114 | 290 |
| 329 | 3300005530 | Ga0070679_100080118 | Ga0070679_1000801182 | 290 |
| 330 | 3300005530 | Ga0070679_100543894 | Ga0070679_1005438942 | 290 |
| 331 | 3300005539 | Ga0068853_100448012 | Ga0068853_1004480121 | 290 |
| 332 | 3300005543 | Ga0070672_100129074 | Ga0070672_1001290742 | 290 |
| 333 | 3300005544 | Ga0070686_100053639 | Ga0070686_1000536392 | 290 |
| 334 | 3300005544 | Ga0070686_100148990 | Ga0070686_1001489901 | 290 |
| 335 | 3300005545 | Ga0070695_100002706 | Ga0070695_1000027069 | 290 |
| 336 | 3300005545 | Ga0070695_100088144 | Ga0070695_1000881442 | 290 |
| 337 | 3300005546 | Ga0070696_100003618 | Ga0070696_1000036189 | 290 |
| 338 | 3300005547 | Ga0070693_100258742 | Ga0070693_1002587421 | 290 |
| 339 | 3300005548 | Ga0070665_100009831 | Ga0070665_1000098314 | 290 |
| 340 | 3300005549 | Ga0070704_100002596 | Ga0070704_1000025969 | 290 |
| 341 | 3300005549 | Ga0070704_100192950 | Ga0070704_1001929502 | 290 |
| 342 | 3300005563 | Ga0068855_100019415 | Ga0068855_1000194155 | 290 |
| 343 | 3300005615 | Ga0070702_100017320 | Ga0070702_1000173203 | 290 |
| 344 | 3300005617 | Ga0068859_100053261 | Ga0068859_1000532615 | 290 |
| 345 | 3300005617 | Ga0068859_100148530 | Ga0068859_1001485302 | 290 |
| 346 | 3300005617 | Ga0068859_100157789 | Ga0068859_1001577892 | 290 |
| 347 | 3300005719 | Ga0068861_100334322 | Ga0068861_1003343222 | 290 |
| 348 | 3300005840 | Ga0068870_10032553 | Ga0068870_100325532 | 290 |
| 349 | 3300005937 | Ga0081455_10002266 | Ga0081455_100022665 | 290 |
| 350 | 3300005937 | Ga0081455_10014076 | Ga0081455_100140766 | 290 |
| 351 | 3300005937 | Ga0081455_10022274 | Ga0081455_100222745 | 290 |
| 352 | 3300005937 | Ga0081455_10071649 | Ga0081455_100716492 | 290 |
| 353 | 3300005981 | Ga0081538_10032375 | Ga0081538_100323753 | 290 |
| 354 | 3300005981 | Ga0081538_10035528 | Ga0081538_100355284 | 290 |
| 355 | 3300005981 | Ga0081538_10038133 | Ga0081538_100381332 | 290 |
| 356 | 3300005983 | Ga0081540_1000413 | Ga0081540_100041337 | 290 |
| 357 | 3300005983 | Ga0081540_1037671 | Ga0081540_10376712 | 290 |
| 358 | 3300005985 | Ga0081539_10009410 | Ga0081539_100094107 | 290 |
| 359 | 3300005985 | Ga0081539_10029464 | Ga0081539_100294642 | 290 |
| 360 | 3300005985 | Ga0081539_10055264 | Ga0081539_100552642 | 290 |
| 361 | 3300006028 | Ga0070717_10001832 | Ga0070717_1000183212 | 290 |
| 362 | 3300006028 | Ga0070717_10271317 | Ga0070717_102713172 | 290 |
| 363 | 3300006028 | Ga0070717_10291206 | Ga0070717_102912062 | 290 |
| 364 | 3300006038 | Ga0075365_10015329 | Ga0075365_100153292 | 290 |
| 365 | 3300006038 | Ga0075365_10031607 | Ga0075365_100316073 | 290 |
| 366 | 3300006038 | Ga0075365_10072168 | Ga0075365_100721682 | 290 |
| 367 | 3300006042 | Ga0075368_10051433 | Ga0075368_100514332 | 290 |
| 368 | 3300006051 | Ga0075364_10265500 | Ga0075364_102655002 | 290 |
| 369 | 3300006163 | Ga0070715_10000773 | Ga0070715_100007732 | 290 |
| 370 | 3300006173 | Ga0070716_100031558 | Ga0070716_1000315583 | 290 |
| 371 | 3300006175 | Ga0070712_100002949 | Ga0070712_1000029492 | 290 |
| 372 | 3300006177 | Ga0075362_10044880 | Ga0075362_100448802 | 290 |
| 373 | 3300006178 | Ga0075367_10010335 | Ga0075367_100103354 | 290 |
| 374 | 3300006178 | Ga0075367_10083360 | Ga0075367_100833602 | 290 |
| 375 | 3300006186 | Ga0075369_10003208 | Ga0075369_100032083 | 290 |
| 376 | 3300006186 | Ga0075369_10091376 | Ga0075369_100913762 | 290 |
| 377 | 3300006195 | Ga0075366_10003186 | Ga0075366_100031865 | 290 |
| 378 | 3300006237 | Ga0097621_100208396 | Ga0097621_1002083962 | 290 |
| 379 | 3300006358 | Ga0068871_100024425 | Ga0068871_1000244254 | 290 |
| 380 | 3300006844 | Ga0075428_100033401 | Ga0075428_1000334013 | 290 |
| 381 | 3300006844 | Ga0075428_100072613 | Ga0075428_1000726132 | 290 |
| 382 | 3300006844 | Ga0075428_100138265 | Ga0075428_1001382652 | 290 |
| 383 | 3300006844 | Ga0075428_100281631 | Ga0075428_1002816312 | 290 |
| 384 | 3300006844 | Ga0075428_100429258 | Ga0075428_1004292582 | 290 |
| 385 | 3300006846 | Ga0075430_100008855 | Ga0075430_1000088555 | 290 |
| 386 | 3300006846 | Ga0075430_100035755 | Ga0075430_1000357554 | 290 |
| 387 | 3300006846 | Ga0075430_100101673 | Ga0075430_1001016732 | 290 |
| 388 | 3300006846 | Ga0075430_100229900 | Ga0075430_1002299002 | 290 |
| 389 | 3300006847 | Ga0075431_100072882 | Ga0075431_1000728824 | 290 |
| 390 | 3300006847 | Ga0075431_100227964 | Ga0075431_1002279642 | 290 |
| 391 | 3300006847 | Ga0075431_100255749 | Ga0075431_1002557492 | 290 |
| 392 | 3300006852 | Ga0075433_10040253 | Ga0075433_100402535 | 290 |
| 393 | 3300006871 | Ga0075434_100006551 | Ga0075434_1000065515 | 290 |
| 394 | 3300006871 | Ga0075434_100036000 | Ga0075434_1000360003 | 290 |
| 395 | 3300006871 | Ga0075434_100226630 | Ga0075434_1002266302 | 290 |
| 396 | 3300006871 | Ga0075434_100453329 | Ga0075434_1004533292 | 290 |
| 397 | 3300006880 | Ga0075429_100118197 | Ga0075429_1001181972 | 290 |
| 398 | 3300006881 | Ga0068865_100139009 | Ga0068865_1001390092 | 290 |
| 399 | 3300006931 | Ga0097620_100053263 | Ga0097620_1000532635 | 290 |
| 400 | 3300006931 | Ga0097620_100148516 | Ga0097620_1001485162 | 290 |
| 401 | 3300006931 | Ga0097620_100157776 | Ga0097620_1001577762 | 290 |
| 402 | 3300007076 | Ga0075435_100061185 | Ga0075435_1000611852 | 290 |
| 403 | 3300007076 | Ga0075435_100189322 | Ga0075435_1001893222 | 290 |
| 404 | 3300009093 | Ga0105240_10018112 | Ga0105240_100181122 | 290 |
| 405 | 3300009094 | Ga0111539_10039620 | Ga0111539_100396204 | 290 |
| 406 | 3300009094 | Ga0111539_10406481 | Ga0111539_104064812 | 290 |
| 407 | 3300009094 | Ga0111539_10441686 | Ga0111539_104416862 | 290 |
| 408 | 3300009094 | Ga0111539_10521566 | Ga0111539_105215662 | 290 |
| 409 | 3300009094 | Ga0111539_10767389 | Ga0111539_107673892 | 290 |
| 410 | 3300009098 | Ga0105245_10007619 | Ga0105245_100076193 | 290 |
| 411 | 3300009147 | Ga0114129_10005876 | Ga0114129_100058765 | 290 |
| 412 | 3300009147 | Ga0114129_10031337 | Ga0114129_100313375 | 290 |
| 413 | 3300009147 | Ga0114129_10119370 | Ga0114129_101193703 | 290 |
| 414 | 3300009147 | Ga0114129_10210234 | Ga0114129_102102342 | 290 |
| 415 | 3300009147 | Ga0114129_10222381 | Ga0114129_102223812 | 290 |
| 416 | 3300009148 | Ga0105243_10057333 | Ga0105243_100573332 | 290 |
| 417 | 3300009174 | Ga0105241_10456676 | Ga0105241_104566761 | 290 |
| 418 | 3300009176 | Ga0105242_10042703 | Ga0105242_100427033 | 290 |
| 419 | 3300009177 | Ga0105248_10087238 | Ga0105248_100872382 | 290 |
| 420 | 3300009177 | Ga0105248_10158891 | Ga0105248_101588912 | 290 |
| 421 | 3300009177 | Ga0105248_10179367 | Ga0105248_101793672 | 290 |
| 422 | 3300009545 | Ga0105237_10074588 | Ga0105237_100745882 | 290 |
| 423 | 3300009551 | Ga0105238_10083801 | Ga0105238_100838012 | 290 |
| 424 | 3300009551 | Ga0105238_10121564 | Ga0105238_101215643 | 290 |
| 425 | 3300009553 | Ga0105249_10012920 | Ga0105249_100129205 | 290 |
| 426 | 3300009553 | Ga0105249_10348651 | Ga0105249_103486512 | 290 |
| 427 | 3300010375 | Ga0105239_10090721 | Ga0105239_100907212 | 290 |
| 428 | 3300010375 | Ga0105239_10473938 | Ga0105239_104739382 | 290 |
| 429 | 3300011119 | Ga0105246_10435893 | Ga0105246_104358932 | 290 |
| 430 | 3300013100 | Ga0157373_10078964 | Ga0157373_100789643 | 290 |
| 431 | 3300013105 | Ga0157369_10436259 | Ga0157369_104362592 | 290 |
| 432 | 3300013297 | Ga0157378_10113655 | Ga0157378_101136552 | 290 |
| 433 | 3300013306 | Ga0163162_10168685 | Ga0163162_101686852 | 290 |
| 434 | 3300013306 | Ga0163162_10304138 | Ga0163162_103041382 | 290 |
| 435 | 3300013308 | Ga0157375_10147328 | Ga0157375_101473282 | 290 |
| 436 | 3300013308 | Ga0157375_10363324 | Ga0157375_103633241 | 290 |
| 437 | 3300014325 | Ga0163163_10052576 | Ga0163163_100525764 | 290 |
| 438 | 3300014325 | Ga0163163_10235232 | Ga0163163_102352322 | 290 |
| 439 | 3300014326 | Ga0157380_10212780 | Ga0157380_102127802 | 290 |
| 440 | 3300014968 | Ga0157379_10019047 | Ga0157379_100190476 | 290 |
| 441 | 3300014968 | Ga0157379_10217508 | Ga0157379_102175082 | 290 |
| 442 | 3300014969 | Ga0157376_10660073 | Ga0157376_106600731 | 290 |
| 443 | 3300017792 | Ga0163161_10319628 | Ga0163161_103196282 | 290 |
| 444 | 3300021361 | Ga0213872_10037343 | Ga0213872_100373432 | 290 |
| 445 | 3300021377 | Ga0213874_10099192 | Ga0213874_100991921 | 290 |
| 446 | 3300025297 | Ga0209758_1003526 | Ga0209758_100352610 | 290 |
| 447 | 3300025885 | Ga0207653_10011134 | Ga0207653_100111342 | 290 |
| 448 | 3300025893 | Ga0207682_10036882 | Ga0207682_100368822 | 290 |
| 449 | 3300025898 | Ga0207692_10008130 | Ga0207692_100081302 | 290 |
| 450 | 3300025901 | Ga0207688_10093977 | Ga0207688_100939772 | 290 |
| 451 | 3300025905 | Ga0207685_10001687 | Ga0207685_100016873 | 290 |
| 452 | 3300025906 | Ga0207699_10125925 | Ga0207699_101259252 | 290 |
| 453 | 3300025906 | Ga0207699_10182043 | Ga0207699_101820431 | 290 |
| 454 | 3300025907 | Ga0207645_10084627 | Ga0207645_100846272 | 290 |
| 455 | 3300025907 | Ga0207645_10190517 | Ga0207645_101905171 | 290 |
| 456 | 3300025908 | Ga0207643_10077870 | Ga0207643_100778702 | 290 |
| 457 | 3300025909 | Ga0207705_10006429 | Ga0207705_100064297 | 290 |
| 458 | 3300025911 | Ga0207654_10305260 | Ga0207654_103052601 | 290 |
| 459 | 3300025912 | Ga0207707_10134306 | Ga0207707_101343062 | 290 |
| 460 | 3300025914 | Ga0207671_10248297 | Ga0207671_102482972 | 290 |
| 461 | 3300025915 | Ga0207693_10001110 | Ga0207693_1000111023 | 290 |
| 462 | 3300025915 | Ga0207693_10005324 | Ga0207693_100053249 | 290 |
| 463 | 3300025915 | Ga0207693_10018460 | Ga0207693_100184603 | 290 |
| 464 | 3300025916 | Ga0207663_10073555 | Ga0207663_100735552 | 290 |
| 465 | 3300025916 | Ga0207663_10242323 | Ga0207663_102423232 | 290 |
| 466 | 3300025916 | Ga0207663_10253747 | Ga0207663_102537472 | 290 |
| 467 | 3300025917 | Ga0207660_10003455 | Ga0207660_100034555 | 290 |
| 468 | 3300025917 | Ga0207660_10052516 | Ga0207660_100525162 | 290 |
| 469 | 3300025918 | Ga0207662_10021594 | Ga0207662_100215943 | 290 |
| 470 | 3300025918 | Ga0207662_10059225 | Ga0207662_100592252 | 290 |
| 471 | 3300025919 | Ga0207657_10048882 | Ga0207657_100488823 | 290 |
| 472 | 3300025919 | Ga0207657_10064034 | Ga0207657_100640342 | 290 |
| 473 | 3300025920 | Ga0207649_10271451 | Ga0207649_102714512 | 290 |
| 474 | 3300025921 | Ga0207652_10013357 | Ga0207652_100133576 | 290 |
| 475 | 3300025921 | Ga0207652_10141511 | Ga0207652_101415112 | 290 |
| 476 | 3300025921 | Ga0207652_10195031 | Ga0207652_101950312 | 290 |
| 477 | 3300025921 | Ga0207652_10229440 | Ga0207652_102294402 | 290 |
| 478 | 3300025922 | Ga0207646_10143246 | Ga0207646_101432462 | 290 |
| 479 | 3300025924 | Ga0207694_10170549 | Ga0207694_101705492 | 290 |
| 480 | 3300025925 | Ga0207650_10003903 | Ga0207650_100039039 | 290 |
| 481 | 3300025926 | Ga0207659_10149531 | Ga0207659_101495312 | 290 |
| 482 | 3300025927 | Ga0207687_10067466 | Ga0207687_100674661 | 290 |
| 483 | 3300025928 | Ga0207700_10007214 | Ga0207700_100072143 | 290 |
| 484 | 3300025928 | Ga0207700_10356154 | Ga0207700_103561542 | 290 |
| 485 | 3300025929 | Ga0207664_10106902 | Ga0207664_101069022 | 290 |
| 486 | 3300025931 | Ga0207644_10086654 | Ga0207644_100866542 | 290 |
| 487 | 3300025931 | Ga0207644_10094770 | Ga0207644_100947702 | 290 |
| 488 | 3300025932 | Ga0207690_10324857 | Ga0207690_103248571 | 290 |
| 489 | 3300025932 | Ga0207690_10344223 | Ga0207690_103442232 | 290 |
| 490 | 3300025933 | Ga0207706_10003165 | Ga0207706_1000316511 | 290 |
| 491 | 3300025933 | Ga0207706_10015943 | Ga0207706_100159433 | 290 |
| 492 | 3300025933 | Ga0207706_10028849 | Ga0207706_100288492 | 290 |
| 493 | 3300025933 | Ga0207706_10080732 | Ga0207706_100807321 | 290 |
| 494 | 3300025933 | Ga0207706_10265618 | Ga0207706_102656182 | 290 |
| 495 | 3300025935 | Ga0207709_10070805 | Ga0207709_100708052 | 290 |
| 496 | 3300025936 | Ga0207670_10005309 | Ga0207670_100053093 | 290 |
| 497 | 3300025936 | Ga0207670_10227793 | Ga0207670_102277932 | 290 |
| 498 | 3300025937 | Ga0207669_10008848 | Ga0207669_100088483 | 290 |
| 499 | 3300025937 | Ga0207669_10040865 | Ga0207669_100408652 | 290 |
| 500 | 3300025938 | Ga0207704_10070029 | Ga0207704_100700292 | 290 |
| 501 | 3300025939 | Ga0207665_10013442 | Ga0207665_100134421 | 290 |
| 502 | 3300025939 | Ga0207665_10085932 | Ga0207665_100859322 | 290 |
| 503 | 3300025940 | Ga0207691_10398930 | Ga0207691_103989302 | 290 |
| 504 | 3300025941 | Ga0207711_10066206 | Ga0207711_100662064 | 290 |
| 505 | 3300025941 | Ga0207711_10174196 | Ga0207711_101741961 | 290 |
| 506 | 3300025942 | Ga0207689_10050556 | Ga0207689_100505562 | 290 |
| 507 | 3300025942 | Ga0207689_10142109 | Ga0207689_101421092 | 290 |
| 508 | 3300025942 | Ga0207689_10160185 | Ga0207689_101601851 | 290 |
| 509 | 3300025949 | Ga0207667_10019489 | Ga0207667_100194896 | 290 |
| 510 | 3300025960 | Ga0207651_10047465 | Ga0207651_100474652 | 290 |
| 511 | 3300025961 | Ga0207712_10011425 | Ga0207712_100114255 | 290 |
| 512 | 3300025961 | Ga0207712_10342058 | Ga0207712_103420582 | 290 |
| 513 | 3300026041 | Ga0207639_10439269 | Ga0207639_104392692 | 290 |
| 514 | 3300026067 | Ga0207678_10046876 | Ga0207678_100468762 | 290 |
| 515 | 3300026075 | Ga0207708_10011998 | Ga0207708_100119983 | 290 |
| 516 | 3300026075 | Ga0207708_10322023 | Ga0207708_103220231 | 290 |
| 517 | 3300026078 | Ga0207702_10063784 | Ga0207702_100637842 | 290 |
| 518 | 3300026089 | Ga0207648_10013708 | Ga0207648_100137083 | 290 |
| 519 | 3300026089 | Ga0207648_10285261 | Ga0207648_102852611 | 290 |
| 520 | 3300026095 | Ga0207676_10108733 | Ga0207676_101087333 | 290 |
| 521 | 3300026118 | Ga0207675_100209894 | Ga0207675_1002098941 | 290 |
| 522 | 3300026118 | Ga0207675_100247715 | Ga0207675_1002477152 | 290 |
| 523 | 3300026118 | Ga0207675_100335293 | Ga0207675_1003352932 | 290 |
| 524 | 3300026118 | Ga0207675_100347589 | Ga0207675_1003475892 | 290 |
| 525 | 3300026121 | Ga0207683_10001401 | Ga0207683_100014017 | 290 |
| 526 | 3300026121 | Ga0207683_10019139 | Ga0207683_100191393 | 290 |
| 527 | 3300026121 | Ga0207683_10080537 | Ga0207683_100805372 | 290 |
| 528 | 3300027907 | Ga0207428_10026718 | Ga0207428_100267184 | 290 |
| 529 | 3300027907 | Ga0207428_10109244 | Ga0207428_101092442 | 290 |
| 530 | 3300028379 | Ga0268266_10004230 | Ga0268266_100042309 | 290 |
| 531 | 3300028380 | Ga0268265_10004057 | Ga0268265_1000405710 | 290 |
| 532 | 3300028380 | Ga0268265_10192742 | Ga0268265_101927422 | 290 |
| 533 | 3300028381 | Ga0268264_10172702 | Ga0268264_101727022 | 290 |
| 534 | 3300028577 | Ga0265318_10010067 | Ga0265318_100100676 | 290 |
| 535 | 3300031235 | Ga0265330_10082257 | Ga0265330_100822572 | 290 |
| 536 | 3300031242 | Ga0265329_10010598 | Ga0265329_100105983 | 290 |
| 537 | 3300031247 | Ga0265340_10014517 | Ga0265340_100145172 | 290 |
| 538 | 3300031247 | Ga0265340_10043374 | Ga0265340_100433742 | 290 |
| 539 | 3300031249 | Ga0265339_10119720 | Ga0265339_101197202 | 290 |
| 540 | 3300031344 | Ga0265316_10099440 | Ga0265316_100994402 | 290 |
| 541 | 3300031344 | Ga0265316_10371318 | Ga0265316_103713182 | 290 |
| 542 | 3300031711 | Ga0265314_10117099 | Ga0265314_101170992 | 290 |
| 543 | 3300031712 | Ga0265342_10050576 | Ga0265342_100505761 | 290 |
| 544 | 3300031712 | Ga0265342_10065218 | Ga0265342_100652182 | 290 |
| 545 | 3300032002 | Ga0307416_100570071 | Ga0307416_1005700711 | 290 |
| 546 | 3300034957 | Ga0373938_0020812 | Ga0373938_0020812_25_897 | 290 |
| 547 | 3300035083 | Ga0373926_0011875 | Ga0373926_0011875_181_1053 | 290 |
| 548 | 3300035114 | Ga0373939_0112862 | Ga0373939_0112862_57_929 | 290 |
| 549 | 3300035116 | Ga0373945_0038041 | Ga0373945_0038041_229_1101 | 290 |
| 550 | 3300035117 | Ga0373953_0081431 | Ga0373953_0081431_355_1227 | 290 |
| 551 | 3300035118 | Ga0373954_0001982 | Ga0373954_0001982_998_1870 | 290 |
| 552 | 3300035119 | Ga0373956_0003825 | Ga0373956_0003825_3131_4003 | 290 |
| 553 | 3300035120 | Ga0373957_0004410 | Ga0373957_0004410_2225_3097 | 290 |
| 554 | 3300035171 | Ga0373946_0018731 | Ga0373946_0018731_1242_2114 | 290 |
| 555 | 3300035172 | Ga0373955_0003925 | Ga0373955_0003925_483_1355 | 290 |
| 556 | 3300035398 | Ga0316574_0002290 | Ga0316574_0002290_8327_9199 | 290 |
| 557 | 3300035724 | Ga0373933_0006622 | Ga0373933_0006622_3230_4102 | 290 |
| 558 | 3300035725 | Ga0373947_0050005 | Ga0373947_0050005_907_1779 | 290 |
| 559 | 3300036401 | Ga0373937_0036110 | Ga0373937_0036110_2865_3737 | 290 |
| 560 | 3300037068 | Ga0373925_0135890 | Ga0373925_0135890_252_1124 | 290 |
| 561 | 3300037068 | Ga0373925_0369432 | Ga0373925_0369432_56_931 | 290 |
| 562 | 3300037068 | Ga0373925_0404112 | Ga0373925_0404112_23_895 | 290 |
| 563 | 3300037418 | Ga0395900_0244781 | Ga0395900_0244781_263_1144 | 290 |
| 564 | 3300038443 | Ga0395901_0387094 | Ga0395901_0387094_277_1158 | 290 |
| 565 | 3300038996 | Ga0242420_025739 | Ga0242420_025739_147_1019 | 290 |
| 566 | 3300039438 | Ga0436360_0871302 | Ga0436360_0871302_121_993 | 290 |
| 567 | 3300039450 | Ga0436363_0343864 | Ga0436363_0343864_78_950 | 290 |
| 568 | 3300045051 | Ga0451576_0516591 | Ga0451576_0516591_115_987 | 290 |
| 569 | 3300046454 | Ga0495592_0043227 | Ga0495592_0043227_1946_2818 | 290 |
| 570 | 3300046455 | Ga0495603_0107459 | Ga0495603_0107459_523_1395 | 290 |
| 571 | 3300046459 | Ga0495629_0012832 | Ga0495629_0012832_3192_4064 | 290 |
| 572 | 3300046459 | Ga0495629_0085072 | Ga0495629_0085072_710_1582 | 290 |
| 573 | 3300046460 | Ga0495638_0103390 | Ga0495638_0103390_60_932 | 290 |
| 574 | 3300046461 | Ga0495641_0064091 | Ga0495641_0064091_253_1125 | 290 |
| 575 | 3300046462 | Ga0495651_0028661 | Ga0495651_0028661_886_1758 | 290 |
| 576 | 3300046463 | Ga0495653_0004022 | Ga0495653_0004022_6347_7219 | 290 |
| 577 | 3300046463 | Ga0495653_0155596 | Ga0495653_0155596_139_1011 | 290 |
| 578 | 3300046472 | Ga0495580_0068199 | Ga0495580_0068199_546_1418 | 290 |
| 579 | 3300046474 | Ga0495605_0127938 | Ga0495605_0127938_36_908 | 290 |
| 580 | 3300046475 | Ga0495639_0026038 | Ga0495639_0026038_296_1168 | 290 |
| 581 | 3300046476 | Ga0495662_0001391 | Ga0495662_0001391_7244_8116 | 290 |
| 582 | 3300046476 | Ga0495662_0052257 | Ga0495662_0052257_885_1760 | 290 |
| 583 | 3300046476 | Ga0495662_0065124 | Ga0495662_0065124_595_1467 | 290 |
| 584 | 3300046477 | Ga0495664_0000854 | Ga0495664_0000854_2669_3541 | 290 |
| 585 | 3300046477 | Ga0495664_0014471 | Ga0495664_0014471_2996_3868 | 290 |
| 586 | 3300046477 | Ga0495664_0069690 | Ga0495664_0069690_885_1757 | 290 |
| 587 | 3300046499 | Ga0495594_0075553 | Ga0495594_0075553_35_907 | 290 |
| 588 | 3300046511 | Ga0495608_0012022 | Ga0495608_0012022_1803_2675 | 290 |
| 589 | 3300046514 | Ga0495618_0002357 | Ga0495618_0002357_7207_8079 | 290 |
| 590 | 3300046514 | Ga0495618_0005360 | Ga0495618_0005360_682_1554 | 290 |
| 591 | 3300046514 | Ga0495618_0074986 | Ga0495618_0074986_165_1040 | 290 |
| 592 | 3300046516 | Ga0495628_0029083 | Ga0495628_0029083_3059_3931 | 290 |
| 593 | 3300046517 | Ga0495630_0006177 | Ga0495630_0006177_3776_4648 | 290 |
| 594 | 3300046517 | Ga0495630_0181826 | Ga0495630_0181826_716_1588 | 290 |
| 595 | 3300046517 | Ga0495630_0488519 | Ga0495630_0488519_39_914 | 290 |
| 596 | 3300046529 | Ga0495652_0002979 | Ga0495652_0002979_5157_6029 | 290 |
| 597 | 3300046529 | Ga0495652_0154542 | Ga0495652_0154542_625_1497 | 290 |
| 598 | 3300046529 | Ga0495652_0202927 | Ga0495652_0202927_550_1422 | 290 |
| 599 | 3300046533 | Ga0495640_0040849 | Ga0495640_0040849_1803_2675 | 290 |
| 600 | 3300046535 | Ga0495586_0006577 | Ga0495586_0006577_1678_2550 | 290 |
| 601 | 3300046535 | Ga0495586_0012914 | Ga0495586_0012914_2778_3650 | 290 |
| 602 | 3300046539 | Ga0495621_0032725 | Ga0495621_0032725_578_1495 | 290 |
| 603 | 3300046543 | Ga0495645_0001772 | Ga0495645_0001772_12777_13649 | 290 |
| 604 | 3300046543 | Ga0495645_0004794 | Ga0495645_0004794_2622_3494 | 290 |
| 605 | 3300046559 | Ga0495667_0037832 | Ga0495667_0037832_1750_2622 | 290 |
| 606 | 3300046642 | Ga0495634_0006350 | Ga0495634_0006350_1583_2455 | 290 |
| 607 | 3300046642 | Ga0495634_0086219 | Ga0495634_0086219_422_1294 | 290 |
| 608 | 3300046642 | Ga0495634_0105933 | Ga0495634_0105933_655_1527 | 290 |
| 609 | 3300046663 | Ga0495635_0002197 | Ga0495635_0002197_4200_5072 | 290 |
| 610 | 3300046663 | Ga0495635_0009754 | Ga0495635_0009754_2824_3696 | 290 |
| 611 | 3300046664 | Ga0495659_0038466 | Ga0495659_0038466_781_1653 | 290 |
| 612 | 3300046674 | Ga0495588_0136294 | Ga0495588_0136294_319_1191 | 290 |
| 613 | 3300046675 | Ga0495657_0009163 | Ga0495657_0009163_4185_5057 | 290 |
| 614 | 3300046678 | Ga0495599_0036152 | Ga0495599_0036152_1675_2547 | 290 |
| 615 | 3300046679 | Ga0495623_0002799 | Ga0495623_0002799_7298_8170 | 290 |
| 616 | 3300046680 | Ga0495646_0003366 | Ga0495646_0003366_3578_4450 | 290 |
| 617 | 3300046680 | Ga0495646_0125466 | Ga0495646_0125466_407_1279 | 290 |
| 618 | 3300046683 | Ga0495658_0045835 | Ga0495658_0045835_1333_2205 | 290 |
| 619 | 3300046690 | Ga0495624_0029495 | Ga0495624_0029495_1456_2328 | 290 |
| 620 | 3300046690 | Ga0495624_0246814 | Ga0495624_0246814_72_944 | 290 |
| 621 | 3300046809 | Ga0495600_0015386 | Ga0495600_0015386_648_1520 | 290 |
| 622 | 3300047315 | Ga0495581_0258628 | Ga0495581_0258628_79_954 | 290 |
| 623 | 3300047317 | Ga0495604_0021564 | Ga0495604_0021564_4259_5131 | 290 |
| 624 | 3300047319 | Ga0495674_0010284 | Ga0495674_0010284_4599_5471 | 290 |
| 625 | 3300047319 | Ga0495674_0022332 | Ga0495674_0022332_130_1002 | 290 |
| 626 | 3300047320 | Ga0495672_0165851 | Ga0495672_0165851_96_968 | 290 |
| 627 | 3300047321 | Ga0495676_0118399 | Ga0495676_0118399_706_1578 | 290 |
| 628 | 3300047322 | Ga0495680_0021194 | Ga0495680_0021194_2659_3531 | 290 |
| 629 | 3300047322 | Ga0495680_0108044 | Ga0495680_0108044_209_1081 | 290 |
| 630 | 3300047444 | Ga0495675_0023103 | Ga0495675_0023103_2256_3128 | 290 |
| 631 | 3300047471 | Ga0495684_0042839 | Ga0495684_0042839_2582_3454 | 290 |
| 632 | 3300047673 | Ga0495593_0042302 | Ga0495593_0042302_567_1439 | 290 |
| 633 | 3300047673 | Ga0495593_0060782 | Ga0495593_0060782_1044_1916 | 290 |
| 634 | 3300048088 | Ga0495602_0083467 | Ga0495602_0083467_1675_2547 | 290 |
| 635 | 3300048090 | Ga0495615_0003005 | Ga0495615_0003005_1573_2490 | 290 |
| 636 | 3300048904 | Ga0496101_0003115 | Ga0496101_0003115_1494_2366 | 290 |
| 637 | 3300048904 | Ga0496101_0044622 | Ga0496101_0044622_1529_2404 | 290 |
| 638 | 3300048904 | Ga0496101_0231387 | Ga0496101_0231387_344_1216 | 290 |
| 639 | 3300048905 | Ga0496102_0005771 | Ga0496102_0005771_5105_5980 | 290 |
| 640 | 3300048905 | Ga0496102_0006136 | Ga0496102_0006136_3125_4033 | 290 |
| 641 | 3300048905 | Ga0496102_0055522 | Ga0496102_0055522_1087_1959 | 290 |
| 642 | 3300048905 | Ga0496102_0122032 | Ga0496102_0122032_1087_1959 | 290 |
| 643 | 3300048906 | Ga0496103_0063023 | Ga0496103_0063023_516_1391 | 290 |
| 644 | 3300048906 | Ga0496103_0080284 | Ga0496103_0080284_83_991 | 290 |
| 645 | 3300048906 | Ga0496103_0236674 | Ga0496103_0236674_214_1086 | 290 |
| 646 | 3300048907 | Ga0496104_0000618 | Ga0496104_0000618_29059_29931 | 290 |
| 647 | 3300048907 | Ga0496104_0005842 | Ga0496104_0005842_5895_6770 | 290 |
| 648 | 3300048907 | Ga0496104_0013745 | Ga0496104_0013745_1491_2363 | 290 |
| 649 | 3300048907 | Ga0496104_0273599 | Ga0496104_0273599_681_1589 | 290 |
| 650 | 3300048908 | Ga0496105_0001514 | Ga0496105_0001514_7263_8138 | 290 |
| 651 | 3300048908 | Ga0496105_0152872 | Ga0496105_0152872_500_1372 | 290 |
| 652 | 3300048909 | Ga0496106_0005441 | Ga0496106_0005441_2385_3293 | 290 |
| 653 | 3300048909 | Ga0496106_0069698 | Ga0496106_0069698_821_1693 | 290 |
| 654 | 3300048909 | Ga0496106_0076192 | Ga0496106_0076192_829_1701 | 290 |
| 655 | 3300048909 | Ga0496106_0077587 | Ga0496106_0077587_453_1328 | 290 |
| 656 | 3300048910 | Ga0496107_0003704 | Ga0496107_0003704_6180_7088 | 290 |
| 657 | 3300048910 | Ga0496107_0005110 | Ga0496107_0005110_1802_2674 | 290 |
| 658 | 3300048910 | Ga0496107_0162697 | Ga0496107_0162697_341_1216 | 290 |
| 659 | 3300048910 | Ga0496107_0313672 | Ga0496107_0313672_19_891 | 290 |
| 660 | 3300048911 | Ga0496108_0000544 | Ga0496108_0000544_7289_8164 | 290 |
| 661 | 3300048912 | Ga0496109_0003416 | Ga0496109_0003416_7313_8188 | 290 |
| 662 | 3300048912 | Ga0496109_0030575 | Ga0496109_0030575_1107_1979 | 290 |
| 663 | 3300048912 | Ga0496109_0578427 | Ga0496109_0578427_74_946 | 290 |
| 664 | 3300048913 | Ga0496110_0001581 | Ga0496110_0001581_6996_7871 | 290 |
| 665 | 3300048913 | Ga0496110_0007612 | Ga0496110_0007612_6545_7417 | 290 |
| 666 | 3300048913 | Ga0496110_0152444 | Ga0496110_0152444_514_1386 | 290 |
| 667 | 3300048914 | Ga0496111_0002315 | Ga0496111_0002315_7345_8220 | 290 |
| 668 | 3300048914 | Ga0496111_0105187 | Ga0496111_0105187_456_1331 | 290 |
| 669 | 3300048914 | Ga0496111_0107427 | Ga0496111_0107427_576_1448 | 290 |
| 670 | 3300048914 | Ga0496111_0120556 | Ga0496111_0120556_118_990 | 290 |
| 671 | 3300048915 | Ga0496112_0001706 | Ga0496112_0001706_8300_9175 | 290 |
| 672 | 3300048915 | Ga0496112_0221587 | Ga0496112_0221587_255_1127 | 290 |
| 673 | 3300048915 | Ga0496112_0269834 | Ga0496112_0269834_52_924 | 290 |
| 674 | 3300048915 | Ga0496112_0295482 | Ga0496112_0295482_424_1296 | 290 |
| 675 | 3300048916 | Ga0496113_0000577 | Ga0496113_0000577_10113_10988 | 290 |
| 676 | 3300048916 | Ga0496113_0035036 | Ga0496113_0035036_1889_2761 | 290 |
| 677 | 3300048917 | Ga0496114_0043891 | Ga0496114_0043891_466_1338 | 290 |
| 678 | 3300048917 | Ga0496114_0249014 | Ga0496114_0249014_153_1028 | 290 |
| 679 | 3300048917 | Ga0496114_0685759 | Ga0496114_0685759_13_885 | 290 |
| 680 | 3300048918 | Ga0496115_0035876 | Ga0496115_0035876_1362_2234 | 290 |
| 681 | 3300048918 | Ga0496115_0082311 | Ga0496115_0082311_356_1228 | 290 |
| 682 | 3300048918 | Ga0496115_0092249 | Ga0496115_0092249_1203_2093 | 290 |
| 683 | 3300048918 | Ga0496115_0188444 | Ga0496115_0188444_290_1162 | 290 |
| 684 | 3300048918 | Ga0496115_0267086 | Ga0496115_0267086_514_1389 | 290 |
| 685 | 3300048918 | Ga0496115_0334878 | Ga0496115_0334878_216_1088 | 290 |
| 686 | 3300048929 | Ga0496126_0188476 | Ga0496126_0188476_471_1343 | 290 |
| 687 | 3300049568 | Ga0501031_0015531 | Ga0501031_0015531_2531_3403 | 290 |
| 688 | 3300049569 | Ga0501032_0173066 | Ga0501032_0173066_358_1230 | 290 |
| 689 | 3300049570 | Ga0501033_0004789 | Ga0501033_0004789_2518_3390 | 290 |
| 690 | 3300049570 | Ga0501033_0005891 | Ga0501033_0005891_3075_3947 | 290 |
| 691 | 3300049570 | Ga0501033_0031280 | Ga0501033_0031280_2917_3789 | 290 |
| 692 | 3300049570 | Ga0501033_0201702 | Ga0501033_0201702_299_1171 | 290 |
| 693 | 3300049571 | Ga0501034_0145164 | Ga0501034_0145164_565_1437 | 290 |
| 694 | 3300049571 | Ga0501034_0239469 | Ga0501034_0239469_575_1447 | 290 |
| 695 | 3300049572 | Ga0501036_0010564 | Ga0501036_0010564_5988_6860 | 290 |
| 696 | 3300049572 | Ga0501036_0410737 | Ga0501036_0410737_213_1085 | 290 |
| 697 | 3300049572 | Ga0501036_0494959 | Ga0501036_0494959_58_948 | 290 |
| 698 | 3300049573 | Ga0501037_0000124 | Ga0501037_0000124_57815_58687 | 290 |
| 699 | 3300049573 | Ga0501037_0003538 | Ga0501037_0003538_8953_9825 | 290 |
| 700 | 3300049574 | Ga0501038_0058663 | Ga0501038_0058663_974_1846 | 290 |
| 701 | 3300049574 | Ga0501038_0061414 | Ga0501038_0061414_1742_2614 | 290 |
| 702 | 3300049574 | Ga0501038_0119788 | Ga0501038_0119788_245_1117 | 290 |
| 703 | 3300049577 | Ga0501041_0089201 | Ga0501041_0089201_306_1178 | 290 |
| 704 | 3300049578 | Ga0501042_0093140 | Ga0501042_0093140_534_1409 | 290 |
| 705 | 3300049578 | Ga0501042_0237568 | Ga0501042_0237568_353_1225 | 290 |
| 706 | 3300049578 | Ga0501042_0303388 | Ga0501042_0303388_95_967 | 290 |
| 707 | 3300049579 | Ga0501043_0000003 | Ga0501043_0000003_110138_111010 | 290 |
| 708 | 3300049579 | Ga0501043_0181663 | Ga0501043_0181663_170_1042 | 290 |
| 709 | 3300049579 | Ga0501043_0201984 | Ga0501043_0201984_252_1124 | 290 |
| 710 | 3300049580 | Ga0501046_0170160 | Ga0501046_0170160_632_1504 | 290 |
| 711 | 3300049581 | Ga0501047_0022490 | Ga0501047_0022490_3148_4020 | 290 |
| 712 | 3300049581 | Ga0501047_0087222 | Ga0501047_0087222_935_1807 | 290 |
| 713 | 3300049581 | Ga0501047_0114871 | Ga0501047_0114871_174_1046 | 290 |
| 714 | 3300049581 | Ga0501047_0120953 | Ga0501047_0120953_795_1667 | 290 |
| 715 | 3300049581 | Ga0501047_0171066 | Ga0501047_0171066_89_961 | 290 |
| 716 | 3300049581 | Ga0501047_0226851 | Ga0501047_0226851_670_1542 | 290 |
| 717 | 3300049581 | Ga0501047_0314551 | Ga0501047_0314551_495_1367 | 290 |
| 718 | 3300049581 | Ga0501047_0375949 | Ga0501047_0375949_203_1075 | 290 |
| 719 | 3300049582 | Ga0501048_0019726 | Ga0501048_0019726_2832_3704 | 290 |
| 720 | 3300049583 | Ga0501067_0156157 | Ga0501067_0156157_13_885 | 290 |
| 721 | 3300049584 | Ga0501068_0043899 | Ga0501068_0043899_1545_2417 | 290 |
| 722 | 3300049585 | Ga0501069_0000003 | Ga0501069_0000003_125713_126585 | 290 |
| 723 | 3300049585 | Ga0501069_0003992 | Ga0501069_0003992_5878_6750 | 290 |
| 724 | 3300049585 | Ga0501069_0011946 | Ga0501069_0011946_3200_4072 | 290 |
| 725 | 3300049585 | Ga0501069_0049927 | Ga0501069_0049927_408_1280 | 290 |
| 726 | 3300049586 | Ga0501070_0000321 | Ga0501070_0000321_19262_20134 | 290 |
| 727 | 3300049586 | Ga0501070_0000665 | Ga0501070_0000665_1099_1971 | 290 |
| 728 | 3300049586 | Ga0501070_0001482 | Ga0501070_0001482_8572_9444 | 290 |
| 729 | 3300049586 | Ga0501070_0168173 | Ga0501070_0168173_92_964 | 290 |
| 730 | 3300049587 | Ga0501071_0004774 | Ga0501071_0004774_6242_7114 | 290 |
| 731 | 3300049587 | Ga0501071_0397196 | Ga0501071_0397196_105_977 | 290 |
| 732 | 3300049588 | Ga0501072_0008121 | Ga0501072_0008121_3289_4161 | 290 |
| 733 | 3300049588 | Ga0501072_0263922 | Ga0501072_0263922_195_1067 | 290 |
| 734 | 3300049589 | Ga0501073_0066558 | Ga0501073_0066558_788_1660 | 290 |
| 735 | 3300049590 | Ga0501074_0000027 | Ga0501074_0000027_1833_2705 | 290 |
| 736 | 3300049590 | Ga0501074_0005145 | Ga0501074_0005145_4902_5774 | 290 |
| 737 | 3300049590 | Ga0501074_0005821 | Ga0501074_0005821_5988_6860 | 290 |
| 738 | 3300049590 | Ga0501074_0031335 | Ga0501074_0031335_1312_2184 | 290 |
| 739 | 3300049591 | Ga0501075_0109380 | Ga0501075_0109380_823_1713 | 290 |
| 740 | 3300049592 | Ga0501076_0146955 | Ga0501076_0146955_791_1666 | 290 |
| 741 | 3300049592 | Ga0501076_0410109 | Ga0501076_0410109_181_1053 | 290 |
| 742 | 3300049593 | Ga0501077_0053073 | Ga0501077_0053073_45_917 | 290 |
| 743 | 3300049593 | Ga0501077_0192731 | Ga0501077_0192731_209_1084 | 290 |
| 744 | 3300049593 | Ga0501077_0340474 | Ga0501077_0340474_20_910 | 290 |
| 745 | 3300049741 | Ga0501079_0009079 | Ga0501079_0009079_6513_7385 | 290 |
| 746 | 3300049741 | Ga0501079_0023785 | Ga0501079_0023785_598_1470 | 290 |
| 747 | 3300049741 | Ga0501079_0064766 | Ga0501079_0064766_822_1694 | 290 |
| 748 | 3300049742 | Ga0501080_0000139 | Ga0501080_0000139_48408_49280 | 290 |
| 749 | 3300049742 | Ga0501080_0005001 | Ga0501080_0005001_5391_6263 | 290 |
| 750 | 3300049742 | Ga0501080_0306870 | Ga0501080_0306870_142_1017 | 290 |
| 751 | 3300049743 | Ga0501081_0008074 | Ga0501081_0008074_4388_5260 | 290 |
| 752 | 3300049744 | Ga0501083_0000024 | Ga0501083_0000024_73669_74541 | 290 |
| 753 | 3300049744 | Ga0501083_0069649 | Ga0501083_0069649_374_1246 | 290 |
| 754 | 3300049744 | Ga0501083_0105408 | Ga0501083_0105408_831_1703 | 290 |
| 755 | 3300049744 | Ga0501083_0182952 | Ga0501083_0182952_336_1208 | 290 |
| 756 | 3300049822 | Ga0501035_0001357 | Ga0501035_0001357_9446_10318 | 290 |
| 757 | 3300049822 | Ga0501035_0003123 | Ga0501035_0003123_8832_9704 | 290 |
| 758 | 3300049822 | Ga0501035_0007814 | Ga0501035_0007814_5695_6567 | 290 |
| 759 | 3300049822 | Ga0501035_0045837 | Ga0501035_0045837_2032_2904 | 290 |
| 760 | 3300049822 | Ga0501035_0051453 | Ga0501035_0051453_2504_3376 | 290 |
| 761 | 3300049822 | Ga0501035_0068824 | Ga0501035_0068824_1851_2723 | 290 |
| 762 | 3300049822 | Ga0501035_0096757 | Ga0501035_0096757_537_1409 | 290 |
| 763 | 3300049822 | Ga0501035_0103582 | Ga0501035_0103582_989_1861 | 290 |
| 764 | 3300049822 | Ga0501035_0122363 | Ga0501035_0122363_495_1385 | 290 |
| 765 | 3300049822 | Ga0501035_0435005 | Ga0501035_0435005_203_1075 | 290 |
| 766 | 3300049823 | Ga0501044_0000016 | Ga0501044_0000016_125705_126577 | 290 |
| 767 | 3300049823 | Ga0501044_0001046 | Ga0501044_0001046_31486_32358 | 290 |
| 768 | 3300049823 | Ga0501044_0014332 | Ga0501044_0014332_3190_4062 | 290 |
| 769 | 3300049823 | Ga0501044_0030367 | Ga0501044_0030367_905_1777 | 290 |
| 770 | 3300049823 | Ga0501044_0037941 | Ga0501044_0037941_3236_4108 | 290 |
| 771 | 3300049823 | Ga0501044_0039887 | Ga0501044_0039887_3496_4368 | 290 |
| 772 | 3300049823 | Ga0501044_0109989 | Ga0501044_0109989_954_1826 | 290 |
| 773 | 3300049823 | Ga0501044_0288048 | Ga0501044_0288048_528_1400 | 290 |
| 774 | 3300049823 | Ga0501044_0292359 | Ga0501044_0292359_532_1404 | 290 |
| 775 | 3300049824 | Ga0501045_0133518 | Ga0501045_0133518_74_946 | 290 |
| 776 | 3300049824 | Ga0501045_0135655 | Ga0501045_0135655_159_1031 | 290 |
| 777 | 3300050489 | nmdc:mga03683_19246_c2 | nmdc:mga03683_19246_c2_222_1097 | 290 |
| 778 | 3300050491 | nmdc:mga00v17_101375_c1 | nmdc:mga00v17_101375_c1_677_1549 | 290 |
| 779 | 3300050491 | nmdc:mga00v17_94680_c1 | nmdc:mga00v17_94680_c1_236_1108 | 290 |
| 780 | 3300050492 | nmdc:mga0yw44_25714_c1 | nmdc:mga0yw44_25714_c1_331_1203 | 290 |
| 781 | 3300050492 | nmdc:mga0yw44_36773_c1 | nmdc:mga0yw44_36773_c1_1510_2385 | 290 |
| 782 | 3300050492 | nmdc:mga0yw44_7206_c1 | nmdc:mga0yw44_7206_c1_3238_4113 | 290 |
| 783 | 3300050493 | nmdc:mga0k408_2879_c1 | nmdc:mga0k408_2879_c1_5354_6226 | 290 |
| 784 | 3300050494 | nmdc:mga06z11_146544_c1 | nmdc:mga06z11_146544_c1_202_1074 | 290 |
| 785 | 3300050494 | nmdc:mga06z11_55368_c1 | nmdc:mga06z11_55368_c1_496_1368 | 290 |
| 786 | 3300050494 | nmdc:mga06z11_6143_c1 | nmdc:mga06z11_6143_c1_1147_2019 | 290 |
| 787 | 3300050495 | nmdc:mga04h51_13416_c1 | nmdc:mga04h51_13416_c1_485_1357 | 290 |
| 788 | 3300050507 | nmdc:mga05p37_110528_c1 | nmdc:mga05p37_110528_c1_1095_1967 | 290 |
| 789 | 3300050507 | nmdc:mga05p37_144139_c1 | nmdc:mga05p37_144139_c1_590_1462 | 290 |
| 790 | 3300050507 | nmdc:mga05p37_23642_c1 | nmdc:mga05p37_23642_c1_1413_2288 | 290 |
| 791 | 3300050507 | nmdc:mga05p37_30735_c2 | nmdc:mga05p37_30735_c2_1939_2814 | 290 |
| 792 | 3300050508 | nmdc:mga09592_131804_c1 | nmdc:mga09592_131804_c1_176_1051 | 290 |
| 793 | 3300050508 | nmdc:mga09592_97108_c1 | nmdc:mga09592_97108_c1_84_956 | 290 |
| 794 | 3300050509 | nmdc:mga0qj67_10255_c1 | nmdc:mga0qj67_10255_c1_2109_2981 | 290 |
| 795 | 3300050509 | nmdc:mga0qj67_11822_c1 | nmdc:mga0qj67_11822_c1_5332_6204 | 290 |
| 796 | 3300050509 | nmdc:mga0qj67_65631_c1 | nmdc:mga0qj67_65631_c1_284_1156 | 290 |
| 797 | 3300050509 | nmdc:mga0qj67_88087_c1 | nmdc:mga0qj67_88087_c1_850_1722 | 290 |
| 798 | 3300050510 | nmdc:mga06r32_108764_c1 | nmdc:mga06r32_108764_c1_1806_2678 | 290 |
| 799 | 3300050510 | nmdc:mga06r32_19380_c1 | nmdc:mga06r32_19380_c1_5117_5989 | 290 |
| 800 | 3300050510 | nmdc:mga06r32_271596_c1 | nmdc:mga06r32_271596_c1_720_1592 | 290 |
| 801 | 3300050510 | nmdc:mga06r32_84675_c1 | nmdc:mga06r32_84675_c1_750_1622 | 290 |
| 802 | 3300050511 | nmdc:mga08y16_100602_c1 | nmdc:mga08y16_100602_c1_1836_2711 | 290 |
| 803 | 3300050511 | nmdc:mga08y16_119201_c1 | nmdc:mga08y16_119201_c1_701_1573 | 290 |
| 804 | 3300050511 | nmdc:mga08y16_160340_c1 | nmdc:mga08y16_160340_c1_334_1206 | 290 |
| 805 | 3300050511 | nmdc:mga08y16_293895_c1 | nmdc:mga08y16_293895_c1_41_928 | 290 |
| 806 | 3300050511 | nmdc:mga08y16_52055_c1 | nmdc:mga08y16_52055_c1_3239_4114 | 290 |
| 807 | 3300050511 | nmdc:mga08y16_63461_c1 | nmdc:mga08y16_63461_c1_2097_3068 | 290 |
| 808 | 3300050512 | nmdc:mga0n895_22291_c1 | nmdc:mga0n895_22291_c1_2684_3559 | 290 |
| 809 | 3300050512 | nmdc:mga0n895_343408_c1 | nmdc:mga0n895_343408_c1_315_1187 | 290 |
| 810 | 3300050512 | nmdc:mga0n895_49235_c1 | nmdc:mga0n895_49235_c1_1703_2614 | 290 |
| 811 | 3300050512 | nmdc:mga0n895_526793_c1 | nmdc:mga0n895_526793_c1_33_905 | 290 |
| 812 | 3300050512 | nmdc:mga0n895_79479_c1 | nmdc:mga0n895_79479_c1_1668_2558 | 290 |
| 813 | 3300050513 | nmdc:mga0rr50_33097_c1 | nmdc:mga0rr50_33097_c1_1521_2396 | 290 |
| 814 | 3300050513 | nmdc:mga0rr50_93733_c1 | nmdc:mga0rr50_93733_c1_72_944 | 290 |
| 815 | 3300050514 | nmdc:mga08x19_162899_c1 | nmdc:mga08x19_162899_c1_473_1345 | 290 |
| 816 | 3300050514 | nmdc:mga08x19_88759_c1 | nmdc:mga08x19_88759_c1_288_1163 | 290 |
| 817 | 3300050516 | nmdc:mga0sz30_15352_c1 | nmdc:mga0sz30_15352_c1_41_913 | 290 |
| 818 | 3300053077 | Ga0495601_0001311 | Ga0495601_0001311_567_1439 | 290 |
| 819 | 3300053077 | Ga0495601_0012075 | Ga0495601_0012075_2755_3627 | 290 |
| 820 | 3300053077 | Ga0495601_0054380 | Ga0495601_0054380_735_1607 | 290 |
| 821 | 3300053078 | Ga0495612_0000213 | Ga0495612_0000213_3545_4417 | 290 |
| 822 | 3300053078 | Ga0495612_0007271 | Ga0495612_0007271_1946_2818 | 290 |
| 823 | 3300053078 | Ga0495612_0013923 | Ga0495612_0013923_151_1023 | 290 |
| 824 | 3300053079 | Ga0500610_0086801 | Ga0500610_0086801_114_986 | 290 |
| 825 | 3300053083 | Ga0495655_0009972 | Ga0495655_0009972_949_1821 | 290 |
| 826 | 3300053084 | Ga0495595_0000240 | Ga0495595_0000240_10257_11129 | 290 |
| 827 | 3300053085 | Ga0495619_0001165 | Ga0495619_0001165_10072_10944 | 290 |
| 828 | 3300053085 | Ga0495619_0010589 | Ga0495619_0010589_321_1193 | 290 |
| 829 | 3300053085 | Ga0495619_0017915 | Ga0495619_0017915_1675_2547 | 290 |
| 830 | 3300053085 | Ga0495619_0029930 | Ga0495619_0029930_1441_2316 | 290 |
| 831 | 3300053085 | Ga0495619_0168834 | Ga0495619_0168834_451_1323 | 290 |
| 832 | 3300053090 | Ga0500646_0041243 | Ga0500646_0041243_409_1281 | 290 |
| 833 | 3300053096 | Ga0500641_0013485 | Ga0500641_0013485_1676_2548 | 290 |
| 834 | 3300053117 | Ga0500593_012270 | Ga0500593_012270_1672_2544 | 290 |
| 835 | 3300053119 | Ga0500595_007580 | Ga0500595_007580_1455_2327 | 290 |
| 836 | 3300053130 | Ga0500642_0051038 | Ga0500642_0051038_455_1330 | 290 |
| 837 | 3300053130 | Ga0500642_0102596 | Ga0500642_0102596_321_1193 | 290 |
| 838 | 3300053131 | Ga0500652_000003 | Ga0500652_000003_159180_160052 | 290 |
| 839 | 3300053131 | Ga0500652_050255 | Ga0500652_050255_791_1666 | 290 |
| 840 | 3300053151 | Ga0500604_0029923 | Ga0500604_0029923_201_1073 | 290 |
| 841 | 3300053153 | Ga0500616_0007706 | Ga0500616_0007706_1748_2623 | 290 |
| 842 | 3300054114 | Ga0501084_0005808 | Ga0501084_0005808_5657_6529 | 290 |
| 843 | 3300054114 | Ga0501084_0031558 | Ga0501084_0031558_2856_3728 | 290 |
| 844 | 3300054114 | Ga0501084_0069657 | Ga0501084_0069657_1655_2527 | 290 |
| 845 | 3300054114 | Ga0501084_0215005 | Ga0501084_0215005_408_1280 | 290 |
| 846 | 3300054114 | Ga0501084_0228168 | Ga0501084_0228168_14_889 | 290 |
| 847 | 3300054114 | Ga0501084_0408553 | Ga0501084_0408553_24_896 | 290 |
| 848 | 3300060353 | Ga0501082_0008388 | Ga0501082_0008388_595_1467 | 290 |
| 849 | 3300060353 | Ga0501082_0014628 | Ga0501082_0014628_3248_4120 | 290 |
| 850 | 3300060353 | Ga0501082_0348010 | Ga0501082_0348010_300_1172 | 290 |
| 851 | 3300060353 | Ga0501082_0408408 | Ga0501082_0408408_41_931 | 290 |
| 852 | 3300061734 | Ga0530510_0115336 | Ga0530510_0115336_767_1642 | 290 |
| 853 | 3300061734 | Ga0530510_0201128 | Ga0530510_0201128_190_1101 | 290 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5297 | 7 | 279 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5172 | 8 | 282 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5146 | 7 | 279 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5007 | 6 | 282 |
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.4958 | 7 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9175 | 10 | 275 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8649 | 10 | 275 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.864 | 12 | 278 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.818 | 12 | 278 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7854 | 12 | 275 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W6CKT9-F1-model_v4 | Branched-chain amino acid ABC transporter | 0.9868 | 6 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A231HHQ6-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9826 | 4 | 290 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A433SED4-F1-model_v4 | High-affinity branched-chain amino acid transport system permease protein LivH | 0.9804 | 4 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A4Q7DK43-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9788 | 5 | 288 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A399I3A9-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9787 | 4 | 290 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar