F483509
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 852 | 467 | 727 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300033179|Ga0307507_10000007|Ga0307507_1000000719 |
| Length | 326 |
| Sequence | MHGLGDSVRFIGVAAVNLHQGFEPLTIRAADQTPTGTVQRVTRIDAHHHLWDLSQTEQAWLQGPAMAPIHRTFSVADLAPEAAAAGIDRSVLVQVLPDVGETRGFLALAAESDLVAGVVGWADLTGADFADMLAGLRAGPGGELLLGIRHLVQGEADPRWLCRPDVLRALGVLADAGLRYDLLTLPHQLPAAIEAVRTLPQLTFVLDHLSKPPIASGELEPWATSVRELAAEPNVYCKLSGMVTEADYQSWTVESLRPYAETVLDSFGPERLMFGSDWPVCLLAASYAEVTDAAEQLVSELSKDEQAEVFGGTAARAYRLAVPTTD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 3 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 4 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 5 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 6 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 7 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 8 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 9 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 10 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 11 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 12 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 13 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 14 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 15 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 16 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 17 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 18 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 19 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 20 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 21 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 22 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 23 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 24 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 25 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 26 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 27 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 28 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 29 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 30 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 31 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 32 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 33 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 34 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 35 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 36 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 37 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 38 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 39 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 40 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 41 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 42 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 43 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 44 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 45 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 46 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 47 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 48 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 49 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 50 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 51 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 52 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 53 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 54 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 55 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 56 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 57 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 58 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 59 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 60 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 61 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 62 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 63 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 64 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 65 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 66 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 67 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 68 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 69 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 70 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 71 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 72 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 73 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 74 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 75 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 76 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 77 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 78 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 79 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 80 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 81 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 82 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 83 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 84 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 85 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 86 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 87 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 88 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 89 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 90 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 91 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 92 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 93 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 94 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 95 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 96 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 97 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 98 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 99 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 100 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 101 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 102 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 103 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 104 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 105 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 106 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 107 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 108 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 109 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 110 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 111 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 112 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 113 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 114 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 115 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 118 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 119 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 120 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 122 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 123 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 124 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 130 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 143 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 144 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 146 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 149 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 150 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 151 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 152 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 154 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 155 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 156 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 157 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 158 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 159 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 160 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 161 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 163 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 164 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 165 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 166 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 167 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 168 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 169 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 192 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 195 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 196 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 197 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 199 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 200 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 201 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 202 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 212 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 213 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 215 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 259 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 260 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 262 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 264 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 265 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 266 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 267 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 268 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 269 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 270 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 271 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 272 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 273 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 274 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 275 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 276 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 277 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 281 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 282 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 294 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 295 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 296 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 297 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 298 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 299 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 300 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 301 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 304 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 305 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 306 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 307 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 308 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 309 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 310 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 311 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 312 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 313 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 314 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 315 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 316 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 317 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 320 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 387 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 388 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 389 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 392 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 393 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 394 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 395 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 396 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 397 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 398 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 399 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 400 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 401 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 402 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 403 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 404 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 405 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 406 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 407 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 408 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 426 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 427 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 437 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 439 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 440 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 441 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 442 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 443 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 445 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 446 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 447 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 450 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 451 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 452 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 455 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 456 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 458 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 459 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 461 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 462 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 463 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 464 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 465 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 466 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 467 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.98 |
| Metatranscriptomes | 0.23 |
| Isolates | 14.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.21 |
| Nodule | 1.64 |
| Rhizoplane | 3.4 |
| Rhizosphere | 63.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8798837 | 2162886012 | Unclassified | 1100 |
| 2 | JGI25155J39150_1000192 | 3300002704 | Bacteria | 25932 |
| 3 | JGI25155J39150_1001145 | 3300002704 | Bacteria | 2489 |
| 4 | JGI25156J39149_1000077 | 3300002705 | Bacteria | 74919 |
| 5 | JGI25156J39149_1000098 | 3300002705 | Bacteria | 64288 |
| 6 | JGI25162J39368_1000067 | 3300002737 | Bacteria | 129813 |
| 7 | JGI25154J39366_1000103 | 3300002738 | Bacteria | 74908 |
| 8 | JGI25154J39366_1003016 | 3300002738 | Bacteria | 3827 |
| 9 | JGI25154J39366_1004497 | 3300002738 | Bacteria | 2485 |
| 10 | JGI25157J39369_1000668 | 3300002741 | Bacteria | 18866 |
| 11 | JGI25163J39215_1000114 | 3300002771 | Bacteria | 33694 |
| 12 | JGI25164J39214_1000039 | 3300002772 | Bacteria | 129437 |
| 13 | rootH1_10047640 | 3300003316 | Bacteria | 1334 |
| 14 | rootH1_10047640 | 3300003323 | Bacteria | 2215 |
| 15 | rootH1_10101285 | 3300003316 | Bacteria | 1171 |
| 16 | rootH1_10175001 | 3300003316 | Bacteria | 1070 |
| 17 | rootH2_10144418 | 3300003320 | Bacteria | 1356 |
| 18 | rootH2_10154600 | 3300003320 | Bacteria | 1148 |
| 19 | rootL2_10021303 | 3300003322 | Bacteria | 14986 |
| 20 | rootL2_10043140 | 3300003322 | Bacteria | 6029 |
| 21 | rootL2_10046969 | 3300003322 | Bacteria | 1042 |
| 22 | rootL2_10072560 | 3300003322 | Bacteria | 1150 |
| 23 | rootH1_10007502 | 3300003323 | Bacteria | 1855 |
| 24 | rootH1_10090190 | 3300003323 | Bacteria | 1069 |
| 25 | JGI25160J50197_1012539 | 3300003354 | Bacteria | 2936 |
| 26 | JGI25160J50197_1048070 | 3300003354 | Bacteria | 924 |
| 27 | Ga0006562J51391_1034596 | 3300003578 | Bacteria | 2270 |
| 28 | Ga0055538_1000008 | 3300003751 | Bacteria | 398547 |
| 29 | Ga0055538_1000052 | 3300003751 | Bacteria | 129813 |
| 30 | Ga0055538_1000059 | 3300003751 | Bacteria | 112508 |
| 31 | Ga0055539_1000012 | 3300003752 | Bacteria | 398547 |
| 32 | Ga0055539_1000077 | 3300003752 | Bacteria | 129445 |
| 33 | Ga0055539_1000089 | 3300003752 | Bacteria | 112508 |
| 34 | Ga0055533_1000015 | 3300003756 | Bacteria | 398547 |
| 35 | Ga0055533_1000083 | 3300003756 | Bacteria | 129813 |
| 36 | Ga0055533_1000098 | 3300003756 | Bacteria | 112508 |
| 37 | Ga0055532_1000034 | 3300003758 | Bacteria | 210984 |
| 38 | Ga0055525_1000017 | 3300003759 | Bacteria | 398547 |
| 39 | Ga0055525_1000110 | 3300003759 | Bacteria | 129813 |
| 40 | Ga0055525_1000130 | 3300003759 | Bacteria | 112508 |
| 41 | Ga0055541_1000009 | 3300003841 | Bacteria | 398547 |
| 42 | Ga0055541_1000054 | 3300003841 | Bacteria | 129813 |
| 43 | Ga0055541_1000061 | 3300003841 | Bacteria | 112508 |
| 44 | Ga0058692_1000208 | 3300003856 | Bacteria | 35014 |
| 45 | Ga0058692_1012125 | 3300003856 | Bacteria | 2054 |
| 46 | Ga0058692_1012865 | 3300003856 | Bacteria | 1966 |
| 47 | Ga0065704_10000086 | 3300005289 | Bacteria | 27230 |
| 48 | Ga0065704_10097814 | 3300005289 | Unclassified | 2377 |
| 49 | Ga0065715_10001912 | 3300005293 | Bacteria | 7628 |
| 50 | Ga0065707_10083832 | 3300005295 | Bacteria | 8151 |
| 51 | Ga0070658_10007287 | 3300005327 | Bacteria | 8930 |
| 52 | Ga0070658_10028027 | 3300005327 | Bacteria | 4521 |
| 53 | Ga0070658_10059294 | 3300005327 | Bacteria | 3117 |
| 54 | Ga0070683_100005836 | 3300005329 | Bacteria | 10299 |
| 55 | Ga0070683_100055726 | 3300005329 | Bacteria | 3669 |
| 56 | Ga0070683_100147444 | 3300005329 | Bacteria | 2230 |
| 57 | Ga0070683_100288301 | 3300005329 | Bacteria | 1561 |
| 58 | Ga0070680_100245152 | 3300005336 | Bacteria | 1515 |
| 59 | Ga0070680_100405030 | 3300005336 | Bacteria | 1163 |
| 60 | Ga0070660_100027547 | 3300005339 | Bacteria | 4242 |
| 61 | Ga0070689_100125795 | 3300005340 | Unclassified | 2051 |
| 62 | Ga0070661_100055402 | 3300005344 | Bacteria | 2903 |
| 63 | Ga0070661_100063873 | 3300005344 | Bacteria | 2705 |
| 64 | Ga0070668_100191791 | 3300005347 | Bacteria | 1674 |
| 65 | Ga0070675_100073419 | 3300005354 | Bacteria | 2840 |
| 66 | Ga0070675_100224108 | 3300005354 | Unclassified | 1638 |
| 67 | Ga0070673_100102779 | 3300005364 | Bacteria | 2357 |
| 68 | Ga0070659_100098961 | 3300005366 | Bacteria | 2345 |
| 69 | Ga0070659_100189195 | 3300005366 | Bacteria | 1691 |
| 70 | Ga0070659_100258314 | 3300005366 | Bacteria | 1445 |
| 71 | Ga0070709_10023164 | 3300005434 | Bacteria | 3643 |
| 72 | Ga0070714_100002746 | 3300005435 | Bacteria | 12972 |
| 73 | Ga0070714_100031348 | 3300005435 | Bacteria | 4435 |
| 74 | Ga0070714_100176419 | 3300005435 | Bacteria | 1942 |
| 75 | Ga0070713_100014860 | 3300005436 | Bacteria | 5795 |
| 76 | Ga0070710_10178135 | 3300005437 | Bacteria | 1329 |
| 77 | Ga0070711_100069571 | 3300005439 | Bacteria | 2476 |
| 78 | Ga0070708_100065585 | 3300005445 | Unclassified | 3256 |
| 79 | Ga0070663_100032160 | 3300005455 | Bacteria | 3613 |
| 80 | Ga0070681_10109540 | 3300005458 | Bacteria | 2702 |
| 81 | Ga0070681_10139293 | 3300005458 | Bacteria | 2356 |
| 82 | Ga0070679_100010324 | 3300005530 | Bacteria | 8853 |
| 83 | Ga0070684_100002727 | 3300005535 | Bacteria | 13053 |
| 84 | Ga0070684_100063768 | 3300005535 | Bacteria | 3231 |
| 85 | Ga0070684_100077083 | 3300005535 | Bacteria | 2943 |
| 86 | Ga0070684_100102359 | 3300005535 | Bacteria | 2560 |
| 87 | Ga0070684_100271218 | 3300005535 | Bacteria | 1553 |
| 88 | Ga0068853_100045923 | 3300005539 | Bacteria | 3744 |
| 89 | Ga0070672_100028803 | 3300005543 | Bacteria | 4158 |
| 90 | Ga0070665_100176282 | 3300005548 | Bacteria | 2139 |
| 91 | Ga0070665_100200105 | 3300005548 | Bacteria | 1998 |
| 92 | Ga0070665_100277093 | 3300005548 | Bacteria | 1679 |
| 93 | Ga0068855_100000175 | 3300005563 | Bacteria | 82401 |
| 94 | Ga0068855_100000366 | 3300005563 | Bacteria | 55965 |
| 95 | Ga0068855_100037965 | 3300005563 | Bacteria | 5725 |
| 96 | Ga0068855_100041258 | 3300005563 | Bacteria | 5471 |
| 97 | Ga0068857_100043585 | 3300005577 | Bacteria | 3979 |
| 98 | Ga0068857_100071577 | 3300005577 | Unclassified | 3089 |
| 99 | Ga0068857_100120766 | 3300005577 | Bacteria | 2359 |
| 100 | Ga0068857_100190532 | 3300005577 | Bacteria | 1868 |
| 101 | Ga0068857_100251196 | 3300005577 | Bacteria | 1621 |
| 102 | Ga0068857_100395760 | 3300005577 | Bacteria | 1285 |
| 103 | Ga0068854_100005738 | 3300005578 | Bacteria | 7851 |
| 104 | Ga0068854_100056145 | 3300005578 | Bacteria | 2837 |
| 105 | Ga0068856_100012052 | 3300005614 | Bacteria | 8375 |
| 106 | Ga0068856_100359894 | 3300005614 | Bacteria | 1474 |
| 107 | Ga0068856_100364720 | 3300005614 | Bacteria | 1463 |
| 108 | Ga0070702_100042509 | 3300005615 | Bacteria | 2556 |
| 109 | Ga0068852_100005949 | 3300005616 | Bacteria | 8779 |
| 110 | Ga0068852_100235036 | 3300005616 | Bacteria | 1749 |
| 111 | Ga0068852_100359951 | 3300005616 | Bacteria | 1423 |
| 112 | Ga0068851_10102046 | 3300005834 | Bacteria | 1523 |
| 113 | Ga0068851_10157609 | 3300005834 | Bacteria | 1245 |
| 114 | Ga0068863_100019824 | 3300005841 | Bacteria | 6433 |
| 115 | Ga0068863_100207719 | 3300005841 | Bacteria | 1885 |
| 116 | Ga0068863_100283855 | 3300005841 | Bacteria | 1604 |
| 117 | Ga0068860_100280636 | 3300005843 | Bacteria | 1628 |
| 118 | Ga0068862_100028380 | 3300005844 | Bacteria | 4712 |
| 119 | Ga0081455_10032557 | 3300005937 | Bacteria | 4696 |
| 120 | Ga0081455_10166816 | 3300005937 | Bacteria | 1681 |
| 121 | Ga0075365_10071840 | 3300006038 | Bacteria | 2330 |
| 122 | Ga0075368_10005280 | 3300006042 | Bacteria | 4434 |
| 123 | Ga0070712_100065041 | 3300006175 | Bacteria | 2587 |
| 124 | Ga0075367_10005258 | 3300006178 | Bacteria | 6399 |
| 125 | Ga0075427_10009992 | 3300006194 | Bacteria | 1416 |
| 126 | Ga0075366_10006496 | 3300006195 | Bacteria | 6409 |
| 127 | Ga0075366_10045115 | 3300006195 | Unclassified | 2613 |
| 128 | Ga0068871_100094214 | 3300006358 | Bacteria | 2500 |
| 129 | Ga0075430_100000732 | 3300006846 | Bacteria | 25147 |
| 130 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 131 | Ga0079104_1002334 | 3300006946 | Bacteria | 10422 |
| 132 | Ga0079104_1012486 | 3300006946 | Bacteria | 2666 |
| 133 | Ga0099794_10056151 | 3300007265 | Bacteria | 1904 |
| 134 | Ga0105251_10000136 | 3300009011 | Bacteria | 74604 |
| 135 | Ga0105251_10003397 | 3300009011 | Bacteria | 11570 |
| 136 | Ga0105251_10003413 | 3300009011 | Bacteria | 11523 |
| 137 | Ga0105251_10038404 | 3300009011 | Bacteria | 2346 |
| 138 | Ga0105244_10000690 | 3300009036 | Bacteria | 29348 |
| 139 | Ga0105244_10018611 | 3300009036 | Bacteria | 3893 |
| 140 | Ga0105244_10026662 | 3300009036 | Bacteria | 3124 |
| 141 | Ga0105244_10132082 | 3300009036 | Bacteria | 1204 |
| 142 | Ga0105244_10175036 | 3300009036 | Bacteria | 1020 |
| 143 | Ga0105250_10001925 | 3300009092 | Bacteria | 10771 |
| 144 | Ga0105250_10004638 | 3300009092 | Bacteria | 6288 |
| 145 | Ga0105240_10000219 | 3300009093 | Bacteria | 115431 |
| 146 | Ga0105240_10000799 | 3300009093 | Bacteria | 56992 |
| 147 | Ga0105240_10001342 | 3300009093 | Bacteria | 42197 |
| 148 | Ga0105240_10009192 | 3300009093 | Bacteria | 14016 |
| 149 | Ga0105240_10022396 | 3300009093 | Bacteria | 8375 |
| 150 | Ga0105240_10124062 | 3300009093 | Bacteria | 3106 |
| 151 | Ga0111539_10004450 | 3300009094 | Bacteria | 18316 |
| 152 | Ga0111539_10017567 | 3300009094 | Bacteria | 8853 |
| 153 | Ga0105245_10017716 | 3300009098 | Bacteria | 6217 |
| 154 | Ga0105245_10461960 | 3300009098 | Bacteria | 1280 |
| 155 | Ga0105247_10000147 | 3300009101 | Bacteria | 69476 |
| 156 | Ga0114129_10062463 | 3300009147 | Bacteria | 5203 |
| 157 | Ga0105243_10280027 | 3300009148 | Bacteria | 1502 |
| 158 | Ga0105241_10000008 | 3300009174 | Bacteria | 334281 |
| 159 | Ga0105241_10091304 | 3300009174 | Bacteria | 2402 |
| 160 | Ga0105248_10352031 | 3300009177 | Bacteria | 1658 |
| 161 | Ga0105237_10000111 | 3300009545 | Bacteria | 114572 |
| 162 | Ga0105237_10001632 | 3300009545 | Bacteria | 29125 |
| 163 | Ga0105237_10001966 | 3300009545 | Bacteria | 26141 |
| 164 | Ga0105237_10002495 | 3300009545 | Bacteria | 22817 |
| 165 | Ga0105237_10073916 | 3300009545 | Bacteria | 3400 |
| 166 | Ga0105237_10083766 | 3300009545 | Bacteria | 3179 |
| 167 | Ga0105237_10581460 | 3300009545 | Bacteria | 1127 |
| 168 | Ga0105237_10716216 | 3300009545 | Bacteria | 1007 |
| 169 | Ga0105238_10000031 | 3300009551 | Bacteria | 179497 |
| 170 | Ga0105238_10000062 | 3300009551 | Bacteria | 126356 |
| 171 | Ga0105238_10042170 | 3300009551 | Bacteria | 4621 |
| 172 | Ga0105238_10104066 | 3300009551 | Bacteria | 2820 |
| 173 | Ga0105238_10128765 | 3300009551 | Bacteria | 2510 |
| 174 | Ga0105238_10665890 | 3300009551 | Bacteria | 1052 |
| 175 | Ga0105249_10004825 | 3300009553 | Bacteria | 11637 |
| 176 | Ga0105249_10204011 | 3300009553 | Bacteria | 1936 |
| 177 | Ga0105239_10004287 | 3300010375 | Bacteria | 17106 |
| 178 | Ga0105239_10008953 | 3300010375 | Bacteria | 11327 |
| 179 | Ga0105239_10056421 | 3300010375 | Bacteria | 4308 |
| 180 | Ga0105239_10095021 | 3300010375 | Bacteria | 3293 |
| 181 | Ga0105239_10748068 | 3300010375 | Bacteria | 1119 |
| 182 | Ga0105246_10008663 | 3300011119 | Bacteria | 6256 |
| 183 | Ga0105246_10120365 | 3300011119 | Unclassified | 1944 |
| 184 | Ga0157373_10181475 | 3300013100 | Bacteria | 1482 |
| 185 | Ga0157371_10000075 | 3300013102 | Bacteria | 162328 |
| 186 | Ga0157371_10009934 | 3300013102 | Bacteria | 7450 |
| 187 | Ga0157369_10076389 | 3300013105 | Bacteria | 3590 |
| 188 | Ga0157369_10335896 | 3300013105 | Bacteria | 1570 |
| 189 | Ga0157369_10361694 | 3300013105 | Bacteria | 1507 |
| 190 | Ga0157372_10025546 | 3300013307 | Bacteria | 6425 |
| 191 | Ga0157372_10254983 | 3300013307 | Bacteria | 2037 |
| 192 | Ga0157375_10050022 | 3300013308 | Bacteria | 4098 |
| 193 | Ga0157375_10202376 | 3300013308 | Unclassified | 2142 |
| 194 | Ga0157375_10437359 | 3300013308 | Bacteria | 1474 |
| 195 | Ga0157380_10038961 | 3300014326 | Bacteria | 3693 |
| 196 | Ga0182008_10010812 | 3300014497 | Bacteria | 4874 |
| 197 | Ga0182008_10033470 | 3300014497 | Bacteria | 2578 |
| 198 | Ga0182008_10095085 | 3300014497 | Bacteria | 1470 |
| 199 | Ga0157379_10014193 | 3300014968 | Bacteria | 6986 |
| 200 | Ga0157376_10098546 | 3300014969 | Bacteria | 2548 |
| 201 | Ga0157376_10434453 | 3300014969 | Unclassified | 1277 |
| 202 | Ga0182006_1000874 | 3300015261 | Bacteria | 20234 |
| 203 | Ga0182006_1018572 | 3300015261 | Bacteria | 2936 |
| 204 | Ga0182006_1022705 | 3300015261 | Bacteria | 2605 |
| 205 | Ga0182007_10000409 | 3300015262 | Bacteria | 26386 |
| 206 | Ga0182007_10045024 | 3300015262 | Bacteria | 1463 |
| 207 | Ga0183367_1011 | 3300015688 | Bacteria | 397353 |
| 208 | Ga0163161_10000002 | 3300017792 | Bacteria | 411983 |
| 209 | Ga0163161_10000012 | 3300017792 | Bacteria | 264639 |
| 210 | Ga0163161_10078867 | 3300017792 | Bacteria | 2421 |
| 211 | Ga0206353_10332444 | 3300020082 | Bacteria | 2963 |
| 212 | Ga0213872_10003902 | 3300021361 | Bacteria | 8093 |
| 213 | Ga0213872_10005805 | 3300021361 | Bacteria | 6270 |
| 214 | Ga0213872_10014729 | 3300021361 | Bacteria | 3644 |
| 215 | Ga0213876_10006516 | 3300021384 | Bacteria | 6363 |
| 216 | Ga0213876_10047398 | 3300021384 | Bacteria | 2272 |
| 217 | Ga0213876_10103894 | 3300021384 | Bacteria | 1507 |
| 218 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 219 | Ga0209435_100124 | 3300025206 | Bacteria | 27904 |
| 220 | Ga0209760_100070 | 3300025207 | Bacteria | 83162 |
| 221 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 222 | Ga0209784_100012 | 3300025224 | Bacteria | 535823 |
| 223 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 224 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 225 | Ga0209566_100010 | 3300025225 | Bacteria | 535823 |
| 226 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 227 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 228 | Ga0209674_100023 | 3300025226 | Bacteria | 535823 |
| 229 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 230 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 231 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 232 | Ga0209563_100027 | 3300025230 | Bacteria | 535823 |
| 233 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 234 | Ga0207427_100017 | 3300025231 | Bacteria | 535823 |
| 235 | Ga0209437_100029 | 3300025233 | Bacteria | 535823 |
| 236 | Ga0209437_100215 | 3300025233 | Bacteria | 106873 |
| 237 | Ga0209437_100647 | 3300025233 | Bacteria | 20285 |
| 238 | Ga0209258_100115 | 3300025242 | Bacteria | 190367 |
| 239 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 240 | Ga0209646_1000238 | 3300025246 | Bacteria | 57384 |
| 241 | Ga0209026_1000063 | 3300025250 | Bacteria | 211324 |
| 242 | Ga0209026_1006998 | 3300025250 | Bacteria | 2633 |
| 243 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 244 | Ga0209677_100014 | 3300025253 | Bacteria | 535823 |
| 245 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 246 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 247 | Ga0209759_1006095 | 3300025256 | Bacteria | 4108 |
| 248 | Ga0209233_1000890 | 3300025261 | Bacteria | 13052 |
| 249 | Ga0209758_1007280 | 3300025297 | Bacteria | 7598 |
| 250 | Ga0207426_1003013 | 3300025302 | Bacteria | 9781 |
| 251 | Ga0207426_1006750 | 3300025302 | Bacteria | 4918 |
| 252 | Ga0207426_1015986 | 3300025302 | Bacteria | 2707 |
| 253 | Ga0207426_1043471 | 3300025302 | Bacteria | 1380 |
| 254 | Ga0207697_10034961 | 3300025315 | Unclassified | 2057 |
| 255 | Ga0207696_1000009 | 3300025711 | Bacteria | 564405 |
| 256 | Ga0207696_1000658 | 3300025711 | Bacteria | 24673 |
| 257 | Ga0207655_1000243 | 3300025728 | Bacteria | 89023 |
| 258 | Ga0207655_1001127 | 3300025728 | Bacteria | 26100 |
| 259 | Ga0207655_1005786 | 3300025728 | Bacteria | 8329 |
| 260 | Ga0207713_1000034 | 3300025735 | Bacteria | 266214 |
| 261 | Ga0207713_1000055 | 3300025735 | Bacteria | 221387 |
| 262 | Ga0207713_1019768 | 3300025735 | Bacteria | 3283 |
| 263 | Ga0207710_10000015 | 3300025900 | Bacteria | 393018 |
| 264 | Ga0207647_10005581 | 3300025904 | Bacteria | 9201 |
| 265 | Ga0207647_10023123 | 3300025904 | Bacteria | 4115 |
| 266 | Ga0207685_10133653 | 3300025905 | Bacteria | 1104 |
| 267 | Ga0207705_10048639 | 3300025909 | Bacteria | 3050 |
| 268 | Ga0207684_10402667 | 3300025910 | Bacteria | 1176 |
| 269 | Ga0207654_10000009 | 3300025911 | Bacteria | 334291 |
| 270 | Ga0207707_10069790 | 3300025912 | Bacteria | 3062 |
| 271 | Ga0207707_10084117 | 3300025912 | Bacteria | 2778 |
| 272 | Ga0207695_10000048 | 3300025913 | Bacteria | 421800 |
| 273 | Ga0207695_10000480 | 3300025913 | Bacteria | 85456 |
| 274 | Ga0207695_10001014 | 3300025913 | Bacteria | 49482 |
| 275 | Ga0207695_10002743 | 3300025913 | Bacteria | 25683 |
| 276 | Ga0207695_10004788 | 3300025913 | Bacteria | 18313 |
| 277 | Ga0207671_10000087 | 3300025914 | Bacteria | 141774 |
| 278 | Ga0207671_10003849 | 3300025914 | Bacteria | 14683 |
| 279 | Ga0207671_10003970 | 3300025914 | Bacteria | 14384 |
| 280 | Ga0207671_10004320 | 3300025914 | Bacteria | 13655 |
| 281 | Ga0207671_10004346 | 3300025914 | Bacteria | 13598 |
| 282 | Ga0207671_10153575 | 3300025914 | Bacteria | 1780 |
| 283 | Ga0207662_10021286 | 3300025918 | Bacteria | 3706 |
| 284 | Ga0207652_10093598 | 3300025921 | Bacteria | 2644 |
| 285 | Ga0207694_10000062 | 3300025924 | Bacteria | 140156 |
| 286 | Ga0207694_10000114 | 3300025924 | Bacteria | 84485 |
| 287 | Ga0207694_10122133 | 3300025924 | Bacteria | 2080 |
| 288 | Ga0207700_10195322 | 3300025928 | Bacteria | 1702 |
| 289 | Ga0207664_10215919 | 3300025929 | Bacteria | 1661 |
| 290 | Ga0207664_10249369 | 3300025929 | Bacteria | 1549 |
| 291 | Ga0207664_10261225 | 3300025929 | Bacteria | 1514 |
| 292 | Ga0207709_10100381 | 3300025935 | Bacteria | 1912 |
| 293 | Ga0207704_10167954 | 3300025938 | Bacteria | 1570 |
| 294 | Ga0207665_10031939 | 3300025939 | Bacteria | 3485 |
| 295 | Ga0207665_10135723 | 3300025939 | Bacteria | 1750 |
| 296 | Ga0207711_10050225 | 3300025941 | Bacteria | 3570 |
| 297 | Ga0207689_10168690 | 3300025942 | Bacteria | 1804 |
| 298 | Ga0207661_10004102 | 3300025944 | Bacteria | 10181 |
| 299 | Ga0207661_10035293 | 3300025944 | Bacteria | 3895 |
| 300 | Ga0207661_10065173 | 3300025944 | Bacteria | 2956 |
| 301 | Ga0207661_10233292 | 3300025944 | Bacteria | 1630 |
| 302 | Ga0207679_10320871 | 3300025945 | Bacteria | 1341 |
| 303 | Ga0207667_10000028 | 3300025949 | Bacteria | 334510 |
| 304 | Ga0207667_10000044 | 3300025949 | Bacteria | 248251 |
| 305 | Ga0207667_10013042 | 3300025949 | Bacteria | 9540 |
| 306 | Ga0207667_10041707 | 3300025949 | Bacteria | 4880 |
| 307 | Ga0207712_10009028 | 3300025961 | Bacteria | 6307 |
| 308 | Ga0207668_10138421 | 3300025972 | Bacteria | 1869 |
| 309 | Ga0207640_10012781 | 3300025981 | Bacteria | 4793 |
| 310 | Ga0207640_10023681 | 3300025981 | Bacteria | 3694 |
| 311 | Ga0207678_10000040 | 3300026067 | Bacteria | 100102 |
| 312 | Ga0207678_10108628 | 3300026067 | Bacteria | 2366 |
| 313 | Ga0207702_10012084 | 3300026078 | Bacteria | 7181 |
| 314 | Ga0207702_10345831 | 3300026078 | Bacteria | 1422 |
| 315 | Ga0207702_10549229 | 3300026078 | Bacteria | 1130 |
| 316 | Ga0207641_10045889 | 3300026088 | Unclassified | 3682 |
| 317 | Ga0207641_10051661 | 3300026088 | Bacteria | 3481 |
| 318 | Ga0207676_10175060 | 3300026095 | Bacteria | 1873 |
| 319 | Ga0207674_10004347 | 3300026116 | Bacteria | 17088 |
| 320 | Ga0207674_10079829 | 3300026116 | Unclassified | 3275 |
| 321 | Ga0207674_10163914 | 3300026116 | Bacteria | 2177 |
| 322 | Ga0207674_10190262 | 3300026116 | Bacteria | 2002 |
| 323 | Ga0207674_10203653 | 3300026116 | Bacteria | 1928 |
| 324 | Ga0207674_10360944 | 3300026116 | Bacteria | 1404 |
| 325 | Ga0207698_10008214 | 3300026142 | Bacteria | 6585 |
| 326 | Ga0207698_10084201 | 3300026142 | Unclassified | 2577 |
| 327 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 328 | Ga0209281_1000054 | 3300027111 | Bacteria | 309505 |
| 329 | Ga0209281_1012901 | 3300027111 | Bacteria | 1820 |
| 330 | Ga0209281_1020393 | 3300027111 | Bacteria | 1296 |
| 331 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 332 | Ga0209371_1000134 | 3300027312 | Bacteria | 121747 |
| 333 | Ga0209371_1002387 | 3300027312 | Bacteria | 10608 |
| 334 | Ga0207428_10000630 | 3300027907 | Bacteria | 41466 |
| 335 | Ga0207428_10072003 | 3300027907 | Unclassified | 2714 |
| 336 | Ga0268266_10093083 | 3300028379 | Bacteria | 2645 |
| 337 | Ga0268266_10106761 | 3300028379 | Bacteria | 2476 |
| 338 | Ga0268265_10008416 | 3300028380 | Bacteria | 6964 |
| 339 | Ga0268265_10429602 | 3300028380 | Bacteria | 1229 |
| 340 | Ga0307517_10018496 | 3300028786 | Bacteria | 9006 |
| 341 | Ga0307515_10003694 | 3300028794 | Bacteria | 32127 |
| 342 | Ga0307515_10099669 | 3300028794 | Bacteria | 3525 |
| 343 | Ga0268256_1000051 | 3300030500 | Bacteria | 283626 |
| 344 | Ga0268256_1003318 | 3300030500 | Bacteria | 7382 |
| 345 | Ga0268256_1004842 | 3300030500 | Bacteria | 5454 |
| 346 | Ga0307511_10119094 | 3300030521 | Bacteria | 1642 |
| 347 | Ga0265332_10002813 | 3300031238 | Bacteria | 8647 |
| 348 | Ga0307513_10011059 | 3300031456 | Bacteria | 11252 |
| 349 | Ga0307513_10012493 | 3300031456 | Bacteria | 10474 |
| 350 | Ga0307513_10097365 | 3300031456 | Bacteria | 2977 |
| 351 | Ga0307513_10251801 | 3300031456 | Bacteria | 1562 |
| 352 | Ga0307509_10000098 | 3300031507 | Bacteria | 121442 |
| 353 | Ga0307509_10008752 | 3300031507 | Bacteria | 12803 |
| 354 | Ga0307509_10014751 | 3300031507 | Bacteria | 9163 |
| 355 | Ga0307509_10056753 | 3300031507 | Bacteria | 4155 |
| 356 | Ga0307408_100445840 | 3300031548 | Bacteria | 1122 |
| 357 | Ga0307508_10000100 | 3300031616 | Bacteria | 102032 |
| 358 | Ga0307508_10001048 | 3300031616 | Bacteria | 32001 |
| 359 | Ga0307508_10014270 | 3300031616 | Bacteria | 7247 |
| 360 | Ga0307514_10005174 | 3300031649 | Bacteria | 11764 |
| 361 | Ga0307514_10031572 | 3300031649 | Bacteria | 4247 |
| 362 | Ga0307514_10101389 | 3300031649 | Bacteria | 2066 |
| 363 | Ga0316579_10068377 | 3300031691 | Bacteria | 1680 |
| 364 | Ga0265342_10075332 | 3300031712 | Bacteria | 1958 |
| 365 | Ga0316576_10007563 | 3300031727 | Bacteria | 6856 |
| 366 | Ga0316578_10012740 | 3300031728 | Bacteria | 4439 |
| 367 | Ga0307516_10000841 | 3300031730 | Bacteria | 42119 |
| 368 | Ga0307516_10001109 | 3300031730 | Bacteria | 37546 |
| 369 | Ga0307516_10014239 | 3300031730 | Bacteria | 8424 |
| 370 | Ga0307516_10023170 | 3300031730 | Bacteria | 6368 |
| 371 | Ga0307516_10338217 | 3300031730 | Bacteria | 1173 |
| 372 | Ga0307516_10343482 | 3300031730 | Bacteria | 1159 |
| 373 | Ga0307405_10014467 | 3300031731 | Bacteria | 4243 |
| 374 | Ga0307413_10021520 | 3300031824 | Bacteria | 3456 |
| 375 | Ga0307518_10064698 | 3300031838 | Bacteria | 2654 |
| 376 | Ga0307518_10230503 | 3300031838 | Bacteria | 1199 |
| 377 | Ga0307410_10293063 | 3300031852 | Bacteria | 1281 |
| 378 | Ga0307406_10006762 | 3300031901 | Bacteria | 6342 |
| 379 | Ga0307409_100021278 | 3300031995 | Bacteria | 4443 |
| 380 | Ga0307416_100004859 | 3300032002 | Bacteria | 8178 |
| 381 | Ga0307416_100055870 | 3300032002 | Bacteria | 3182 |
| 382 | Ga0307414_10003179 | 3300032004 | Bacteria | 8731 |
| 383 | Ga0307415_100133211 | 3300032126 | Bacteria | 1885 |
| 384 | Ga0307507_10000007 | 3300033179 | Bacteria | 269525 |
| 385 | Ga0373957_0062710 | 3300035120 | Bacteria | 1443 |
| 386 | Ga0316574_0290303 | 3300035398 | Bacteria | 1041 |
| 387 | Ga0373931_0220337 | 3300035691 | Bacteria | 1142 |
| 388 | Ga0373947_0110565 | 3300035725 | Bacteria | 1736 |
| 389 | Ga0316582_0178767 | 3300036647 | Bacteria | 1443 |
| 390 | Ga0316584_0190816 | 3300036712 | Bacteria | 1515 |
| 391 | Ga0373925_0059270 | 3300037068 | Bacteria | 2872 |
| 392 | Ga0395899_0038761 | 3300037312 | Bacteria | 3567 |
| 393 | Ga0395900_0037875 | 3300037418 | Bacteria | 4971 |
| 394 | Ga0395900_0063563 | 3300037418 | Bacteria | 3794 |
| 395 | Ga0395898_0010491 | 3300037466 | Bacteria | 9685 |
| 396 | Ga0395898_0098767 | 3300037466 | Bacteria | 2803 |
| 397 | Ga0395898_0179012 | 3300037466 | Bacteria | 2026 |
| 398 | Ga0395905_0060852 | 3300037471 | Bacteria | 3531 |
| 399 | Ga0395905_0488995 | 3300037471 | Bacteria | 1130 |
| 400 | Ga0395905_0508742 | 3300037471 | Bacteria | 1105 |
| 401 | Ga0436364_0380175 | 3300037853 | Bacteria | 8114 |
| 402 | Ga0395901_0092795 | 3300038443 | Bacteria | 3160 |
| 403 | Ga0395901_0095434 | 3300038443 | Bacteria | 3116 |
| 404 | Ga0395901_0125450 | 3300038443 | Bacteria | 2698 |
| 405 | Ga0395901_0231457 | 3300038443 | Bacteria | 1929 |
| 406 | Ga0436365_0624325 | 3300039437 | Bacteria | 1500 |
| 407 | Ga0436365_0837397 | 3300039437 | Bacteria | 13021 |
| 408 | Ga0436365_1283794 | 3300039437 | Bacteria | 9095 |
| 409 | Ga0436365_1474640 | 3300039437 | Bacteria | 3867 |
| 410 | Ga0436361_0220616 | 3300039447 | Bacteria | 4301 |
| 411 | Ga0436361_0480362 | 3300039447 | Bacteria | 1160 |
| 412 | Ga0436361_0584428 | 3300039447 | Bacteria | 3540 |
| 413 | Ga0436361_0689999 | 3300039447 | Bacteria | 10015 |
| 414 | Ga0436363_0853496 | 3300039450 | Bacteria | 1963 |
| 415 | Ga0436362_1175501 | 3300039453 | Bacteria | 2729 |
| 416 | Ga0439438_000018 | 3300041405 | Bacteria | 123959 |
| 417 | Ga0451789_0906811 | 3300041443 | Bacteria | 1968 |
| 418 | Ga0451804_0918993 | 3300041463 | Bacteria | 1147 |
| 419 | Ga0451841_0165068 | 3300041498 | Bacteria | 1108 |
| 420 | Ga0439433_0028063 | 3300041999 | Bacteria | 1279 |
| 421 | Ga0439432_001254 | 3300042006 | Bacteria | 9595 |
| 422 | Ga0439432_011248 | 3300042006 | Bacteria | 3086 |
| 423 | Ga0439449_0000378 | 3300042007 | Bacteria | 16401 |
| 424 | Ga0439449_0037996 | 3300042007 | Bacteria | 1791 |
| 425 | Ga0439455_0014244 | 3300042012 | Bacteria | 1813 |
| 426 | Ga0439457_000120 | 3300042014 | Bacteria | 19130 |
| 427 | Ga0439457_025458 | 3300042014 | Bacteria | 1309 |
| 428 | Ga0450894_000440 | 3300042131 | Bacteria | 7135 |
| 429 | Ga0450898_002025 | 3300042134 | Bacteria | 2778 |
| 430 | Ga0450899_000209 | 3300042135 | Bacteria | 6082 |
| 431 | Ga0450906_000137 | 3300042145 | Bacteria | 13182 |
| 432 | Ga0439458_0003854 | 3300042157 | Bacteria | 3468 |
| 433 | Ga0439458_0006900 | 3300042157 | Bacteria | 2532 |
| 434 | Ga0451577_0142015 | 3300042876 | Bacteria | 2158 |
| 435 | Ga0466969_0024240 | 3300044656 | Bacteria | 3121 |
| 436 | Ga0466969_0082058 | 3300044656 | Bacteria | 1537 |
| 437 | Ga0466972_0001073 | 3300044658 | Bacteria | 13098 |
| 438 | Ga0466965_0064353 | 3300044683 | Bacteria | 1836 |
| 439 | Ga0466966_0009910 | 3300044684 | Bacteria | 6317 |
| 440 | Ga0466966_0068979 | 3300044684 | Bacteria | 2218 |
| 441 | Ga0466966_0239123 | 3300044684 | Bacteria | 1095 |
| 442 | Ga0466961_0012100 | 3300044693 | Bacteria | 5517 |
| 443 | Ga0466961_0036482 | 3300044693 | Bacteria | 3155 |
| 444 | Ga0466961_0039268 | 3300044693 | Bacteria | 3035 |
| 445 | Ga0466961_0101424 | 3300044693 | Bacteria | 1813 |
| 446 | Ga0466961_0126714 | 3300044693 | Bacteria | 1601 |
| 447 | Ga0466961_0172784 | 3300044693 | Bacteria | 1344 |
| 448 | Ga0466963_0041252 | 3300044694 | Bacteria | 3027 |
| 449 | Ga0453684_0000287 | 3300044712 | Bacteria | 216926 |
| 450 | Ga0466971_0006564 | 3300044719 | Bacteria | 5054 |
| 451 | Ga0466971_0022808 | 3300044719 | Bacteria | 2789 |
| 452 | Ga0466971_0023476 | 3300044719 | Bacteria | 2750 |
| 453 | Ga0466970_0009728 | 3300044765 | Bacteria | 4865 |
| 454 | Ga0466970_0114295 | 3300044765 | Bacteria | 1475 |
| 455 | Ga0466960_0063861 | 3300044901 | Bacteria | 1814 |
| 456 | Ga0466959_0012601 | 3300045049 | Bacteria | 6115 |
| 457 | Ga0466959_0019241 | 3300045049 | Bacteria | 5020 |
| 458 | Ga0451576_0077319 | 3300045051 | Bacteria | 3463 |
| 459 | Ga0466958_0020885 | 3300045836 | Bacteria | 3822 |
| 460 | Ga0466958_0123481 | 3300045836 | Bacteria | 1622 |
| 461 | Ga0466967_0513494 | 3300045976 | Bacteria | 1177 |
| 462 | Ga0495617_007014 | 3300046452 | Bacteria | 3927 |
| 463 | Ga0495627_000042 | 3300046453 | Bacteria | 189845 |
| 464 | Ga0495590_0072797 | 3300046457 | Bacteria | 1207 |
| 465 | Ga0495591_000006 | 3300046458 | Bacteria | 390570 |
| 466 | Ga0495591_000933 | 3300046458 | Bacteria | 20017 |
| 467 | Ga0495591_003374 | 3300046458 | Bacteria | 8290 |
| 468 | Ga0495591_016094 | 3300046458 | Bacteria | 2617 |
| 469 | Ga0495629_0277115 | 3300046459 | Bacteria | 1151 |
| 470 | Ga0495638_0098673 | 3300046460 | Bacteria | 1750 |
| 471 | Ga0495638_0116477 | 3300046460 | Bacteria | 1583 |
| 472 | Ga0495651_0043595 | 3300046462 | Bacteria | 3480 |
| 473 | Ga0495650_0000102 | 3300046471 | Bacteria | 211007 |
| 474 | Ga0495650_0001196 | 3300046471 | Bacteria | 27428 |
| 475 | Ga0495605_0000037 | 3300046474 | Bacteria | 200004 |
| 476 | Ga0495605_0000222 | 3300046474 | Bacteria | 70142 |
| 477 | Ga0495605_0016761 | 3300046474 | Bacteria | 3959 |
| 478 | Ga0495605_0086778 | 3300046474 | Bacteria | 1456 |
| 479 | Ga0495605_0113557 | 3300046474 | Bacteria | 1234 |
| 480 | Ga0495662_0011382 | 3300046476 | Bacteria | 4348 |
| 481 | Ga0495584_0009858 | 3300046491 | Bacteria | 4911 |
| 482 | Ga0495585_0054773 | 3300046492 | Bacteria | 2204 |
| 483 | Ga0495594_0049738 | 3300046499 | Bacteria | 2304 |
| 484 | Ga0495596_0008274 | 3300046500 | Bacteria | 4638 |
| 485 | Ga0495607_0000149 | 3300046501 | Bacteria | 73673 |
| 486 | Ga0495607_0000403 | 3300046501 | Bacteria | 43834 |
| 487 | Ga0495607_0012756 | 3300046501 | Bacteria | 5532 |
| 488 | Ga0495607_0023327 | 3300046501 | Bacteria | 3874 |
| 489 | Ga0495607_0049901 | 3300046501 | Bacteria | 2438 |
| 490 | Ga0495583_0001428 | 3300046506 | Bacteria | 24290 |
| 491 | Ga0495583_0002044 | 3300046506 | Bacteria | 18357 |
| 492 | Ga0495583_0006587 | 3300046506 | Bacteria | 7555 |
| 493 | Ga0495606_0000094 | 3300046507 | Bacteria | 151840 |
| 494 | Ga0495606_0000674 | 3300046507 | Bacteria | 53418 |
| 495 | Ga0495606_0000792 | 3300046507 | Bacteria | 48271 |
| 496 | Ga0495606_0037720 | 3300046507 | Bacteria | 3278 |
| 497 | Ga0495610_0004252 | 3300046512 | Bacteria | 10662 |
| 498 | Ga0495610_0033752 | 3300046512 | Bacteria | 2642 |
| 499 | Ga0495616_0022501 | 3300046513 | Bacteria | 3404 |
| 500 | Ga0495616_0135835 | 3300046513 | Bacteria | 1123 |
| 501 | Ga0495620_0000296 | 3300046515 | Bacteria | 35364 |
| 502 | Ga0495620_0001367 | 3300046515 | Bacteria | 14739 |
| 503 | Ga0495620_0001634 | 3300046515 | Bacteria | 13278 |
| 504 | Ga0495628_0206277 | 3300046516 | Bacteria | 1479 |
| 505 | Ga0495631_0009073 | 3300046518 | Bacteria | 4982 |
| 506 | Ga0495632_0001504 | 3300046519 | Bacteria | 19279 |
| 507 | Ga0495632_0025622 | 3300046519 | Bacteria | 3117 |
| 508 | Ga0495632_0028475 | 3300046519 | Bacteria | 2915 |
| 509 | Ga0495632_0032770 | 3300046519 | Bacteria | 2674 |
| 510 | Ga0495632_0064880 | 3300046519 | Bacteria | 1764 |
| 511 | Ga0495637_0000015 | 3300046520 | Bacteria | 228949 |
| 512 | Ga0495637_0000077 | 3300046520 | Bacteria | 78543 |
| 513 | Ga0495637_0002223 | 3300046520 | Bacteria | 10829 |
| 514 | Ga0495643_0009173 | 3300046522 | Bacteria | 6175 |
| 515 | Ga0495643_0013688 | 3300046522 | Bacteria | 4847 |
| 516 | Ga0495643_0050031 | 3300046522 | Bacteria | 2251 |
| 517 | Ga0495643_0059077 | 3300046522 | Bacteria | 2039 |
| 518 | Ga0495644_0000719 | 3300046523 | Bacteria | 13715 |
| 519 | Ga0495648_0001437 | 3300046524 | Bacteria | 23314 |
| 520 | Ga0495648_0010818 | 3300046524 | Bacteria | 6928 |
| 521 | Ga0495648_0150218 | 3300046524 | Bacteria | 1216 |
| 522 | Ga0495654_0000013 | 3300046530 | Bacteria | 327576 |
| 523 | Ga0495654_0001350 | 3300046530 | Bacteria | 17070 |
| 524 | Ga0495654_0019919 | 3300046530 | Bacteria | 3502 |
| 525 | Ga0495609_0000148 | 3300046538 | Bacteria | 72666 |
| 526 | Ga0495609_0000162 | 3300046538 | Bacteria | 69584 |
| 527 | Ga0495609_0004988 | 3300046538 | Bacteria | 7103 |
| 528 | Ga0495597_0017251 | 3300046542 | Bacteria | 3401 |
| 529 | Ga0495633_0139080 | 3300046558 | Bacteria | 1123 |
| 530 | Ga0495668_0027794 | 3300046616 | Bacteria | 3204 |
| 531 | Ga0495668_0028856 | 3300046616 | Bacteria | 3136 |
| 532 | Ga0495611_0001027 | 3300046648 | Bacteria | 14786 |
| 533 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 534 | Ga0495625_0000428 | 3300046660 | Bacteria | 63353 |
| 535 | Ga0495625_0016386 | 3300046660 | Bacteria | 5835 |
| 536 | Ga0495635_0048642 | 3300046663 | Bacteria | 2923 |
| 537 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 538 | Ga0495661_0032826 | 3300046665 | Bacteria | 3278 |
| 539 | Ga0495661_0071627 | 3300046665 | Bacteria | 2025 |
| 540 | Ga0495658_0044193 | 3300046683 | Bacteria | 2495 |
| 541 | Ga0495613_0027459 | 3300046689 | Bacteria | 4235 |
| 542 | Ga0495613_0171300 | 3300046689 | Bacteria | 1541 |
| 543 | Ga0495613_0230963 | 3300046689 | Bacteria | 1296 |
| 544 | Ga0495670_0007579 | 3300046691 | Bacteria | 5335 |
| 545 | Ga0495670_0115241 | 3300046691 | Bacteria | 1393 |
| 546 | Ga0495671_0008265 | 3300046692 | Bacteria | 5865 |
| 547 | Ga0495671_0037117 | 3300046692 | Bacteria | 2465 |
| 548 | Ga0495649_0172631 | 3300046694 | Bacteria | 1130 |
| 549 | Ga0495589_0000005 | 3300046794 | Bacteria | 405112 |
| 550 | Ga0495589_0000646 | 3300046794 | Bacteria | 22845 |
| 551 | Ga0495589_0038845 | 3300046794 | Bacteria | 2381 |
| 552 | Ga0495660_0000006 | 3300046810 | Bacteria | 571713 |
| 553 | Ga0495660_0009143 | 3300046810 | Bacteria | 5786 |
| 554 | Ga0495660_0035217 | 3300046810 | Bacteria | 2798 |
| 555 | Ga0495660_0080977 | 3300046810 | Bacteria | 1703 |
| 556 | Ga0495581_0156784 | 3300047315 | Bacteria | 1331 |
| 557 | Ga0495674_0126406 | 3300047319 | Bacteria | 2157 |
| 558 | Ga0495672_0049161 | 3300047320 | Bacteria | 2497 |
| 559 | Ga0495672_0118007 | 3300047320 | Bacteria | 1415 |
| 560 | Ga0495676_0000004 | 3300047321 | Bacteria | 313696 |
| 561 | Ga0495676_0086254 | 3300047321 | Bacteria | 2363 |
| 562 | Ga0495683_0015137 | 3300047323 | Bacteria | 4018 |
| 563 | Ga0495683_0103972 | 3300047323 | Bacteria | 1363 |
| 564 | Ga0495687_002821 | 3300047443 | Bacteria | 13387 |
| 565 | Ga0495687_010294 | 3300047443 | Bacteria | 5137 |
| 566 | Ga0495687_010867 | 3300047443 | Bacteria | 4946 |
| 567 | Ga0495679_000308 | 3300047446 | Bacteria | 39070 |
| 568 | Ga0495679_000774 | 3300047446 | Bacteria | 20300 |
| 569 | Ga0495679_040234 | 3300047446 | Bacteria | 1454 |
| 570 | Ga0495685_000931 | 3300047447 | Bacteria | 8880 |
| 571 | Ga0495685_027233 | 3300047447 | Bacteria | 1966 |
| 572 | Ga0495673_0000980 | 3300047469 | Bacteria | 25613 |
| 573 | Ga0495673_0002082 | 3300047469 | Bacteria | 14612 |
| 574 | Ga0495673_0002720 | 3300047469 | Bacteria | 12150 |
| 575 | Ga0495673_0006802 | 3300047469 | Bacteria | 6678 |
| 576 | Ga0495673_0018856 | 3300047469 | Bacteria | 3469 |
| 577 | Ga0495673_0032136 | 3300047469 | Bacteria | 2451 |
| 578 | Ga0495681_0002551 | 3300047470 | Bacteria | 12977 |
| 579 | Ga0495681_0003241 | 3300047470 | Bacteria | 11353 |
| 580 | Ga0495681_0004262 | 3300047470 | Bacteria | 9811 |
| 581 | Ga0495681_0034246 | 3300047470 | Bacteria | 2532 |
| 582 | Ga0495681_0057977 | 3300047470 | Bacteria | 1796 |
| 583 | Ga0495686_0000018 | 3300047472 | Bacteria | 434962 |
| 584 | Ga0495686_0000933 | 3300047472 | Bacteria | 36364 |
| 585 | Ga0495686_0061992 | 3300047472 | Bacteria | 2320 |
| 586 | Ga0495602_0017711 | 3300048088 | Bacteria | 7135 |
| 587 | Ga0495626_0000012 | 3300048091 | Bacteria | 258483 |
| 588 | Ga0496101_0235888 | 3300048904 | Bacteria | 1423 |
| 589 | Ga0496102_0060411 | 3300048905 | Bacteria | 3466 |
| 590 | Ga0496104_0000071 | 3300048907 | Bacteria | 106442 |
| 591 | Ga0496104_0001453 | 3300048907 | Bacteria | 20471 |
| 592 | Ga0496104_0138784 | 3300048907 | Bacteria | 2336 |
| 593 | Ga0496104_0485893 | 3300048907 | Bacteria | 1146 |
| 594 | Ga0496105_0404251 | 3300048908 | Bacteria | 1084 |
| 595 | Ga0496108_0033009 | 3300048911 | Bacteria | 4300 |
| 596 | Ga0496108_0179735 | 3300048911 | Bacteria | 1832 |
| 597 | Ga0496109_0174896 | 3300048912 | Bacteria | 2015 |
| 598 | Ga0496109_0179044 | 3300048912 | Unclassified | 1991 |
| 599 | Ga0496109_0284820 | 3300048912 | Bacteria | 1557 |
| 600 | Ga0496110_0131045 | 3300048913 | Bacteria | 2264 |
| 601 | Ga0496111_0136682 | 3300048914 | Bacteria | 1816 |
| 602 | Ga0496112_0017590 | 3300048915 | Bacteria | 6720 |
| 603 | Ga0496112_0039858 | 3300048915 | Bacteria | 4590 |
| 604 | Ga0496112_0112870 | 3300048915 | Bacteria | 2688 |
| 605 | Ga0496113_0009247 | 3300048916 | Bacteria | 6466 |
| 606 | Ga0496114_0004287 | 3300048917 | Bacteria | 11042 |
| 607 | Ga0496114_0093548 | 3300048917 | Bacteria | 2556 |
| 608 | Ga0496115_0459229 | 3300048918 | Bacteria | 1028 |
| 609 | Ga0496116_0000015 | 3300048919 | Bacteria | 560702 |
| 610 | Ga0496116_0000020 | 3300048919 | Bacteria | 501307 |
| 611 | Ga0496116_0005552 | 3300048919 | Bacteria | 11636 |
| 612 | Ga0496116_0026638 | 3300048919 | Bacteria | 4223 |
| 613 | Ga0496116_0033427 | 3300048919 | Bacteria | 3650 |
| 614 | Ga0496117_0000858 | 3300048920 | Bacteria | 47050 |
| 615 | Ga0496117_0006493 | 3300048920 | Bacteria | 11803 |
| 616 | Ga0496117_0010790 | 3300048920 | Bacteria | 8251 |
| 617 | Ga0496117_0067039 | 3300048920 | Bacteria | 2431 |
| 618 | Ga0496118_0002115 | 3300048921 | Bacteria | 27830 |
| 619 | Ga0496118_0003691 | 3300048921 | Bacteria | 18973 |
| 620 | Ga0496118_0016088 | 3300048921 | Bacteria | 6881 |
| 621 | Ga0496118_0032947 | 3300048921 | Bacteria | 4259 |
| 622 | Ga0496118_0190743 | 3300048921 | Bacteria | 1226 |
| 623 | Ga0496119_0000481 | 3300048922 | Bacteria | 54605 |
| 624 | Ga0496119_0002429 | 3300048922 | Bacteria | 20452 |
| 625 | Ga0496120_0002963 | 3300048923 | Bacteria | 16155 |
| 626 | Ga0496120_0008793 | 3300048923 | Bacteria | 7256 |
| 627 | Ga0496120_0014276 | 3300048923 | Bacteria | 5300 |
| 628 | Ga0496121_0001569 | 3300048924 | Bacteria | 38098 |
| 629 | Ga0496121_0001684 | 3300048924 | Bacteria | 36354 |
| 630 | Ga0496121_0010160 | 3300048924 | Bacteria | 10660 |
| 631 | Ga0496121_0013603 | 3300048924 | Bacteria | 8726 |
| 632 | Ga0496121_0044124 | 3300048924 | Bacteria | 3851 |
| 633 | Ga0496121_0186814 | 3300048924 | Bacteria | 1490 |
| 634 | Ga0496121_0322559 | 3300048924 | Bacteria | 1039 |
| 635 | Ga0496122_0000010 | 3300048925 | Bacteria | 547417 |
| 636 | Ga0496122_0000570 | 3300048925 | Bacteria | 75506 |
| 637 | Ga0496122_0003675 | 3300048925 | Bacteria | 19902 |
| 638 | Ga0496122_0014537 | 3300048925 | Bacteria | 7600 |
| 639 | Ga0496122_0020992 | 3300048925 | Bacteria | 5866 |
| 640 | Ga0496122_0068821 | 3300048925 | Bacteria | 2539 |
| 641 | Ga0496122_0101295 | 3300048925 | Bacteria | 1924 |
| 642 | Ga0496122_0247837 | 3300048925 | Bacteria | 999 |
| 643 | Ga0496123_0000061 | 3300048926 | Bacteria | 220856 |
| 644 | Ga0496123_0000438 | 3300048926 | Bacteria | 74878 |
| 645 | Ga0496123_0002948 | 3300048926 | Bacteria | 19877 |
| 646 | Ga0496123_0009809 | 3300048926 | Bacteria | 8552 |
| 647 | Ga0496123_0013325 | 3300048926 | Bacteria | 6916 |
| 648 | Ga0496123_0047467 | 3300048926 | Bacteria | 2901 |
| 649 | Ga0496123_0077038 | 3300048926 | Bacteria | 2050 |
| 650 | Ga0496124_0000031 | 3300048927 | Bacteria | 344232 |
| 651 | Ga0496124_0000084 | 3300048927 | Bacteria | 204993 |
| 652 | Ga0496124_0000272 | 3300048927 | Bacteria | 99703 |
| 653 | Ga0496124_0001245 | 3300048927 | Bacteria | 39104 |
| 654 | Ga0496124_0001315 | 3300048927 | Bacteria | 37519 |
| 655 | Ga0496124_0007040 | 3300048927 | Bacteria | 12046 |
| 656 | Ga0496124_0338350 | 3300048927 | Bacteria | 1070 |
| 657 | Ga0496125_0000071 | 3300048928 | Bacteria | 243580 |
| 658 | Ga0496125_0000701 | 3300048928 | Bacteria | 55423 |
| 659 | Ga0496125_0000997 | 3300048928 | Bacteria | 44176 |
| 660 | Ga0496125_0003276 | 3300048928 | Bacteria | 19912 |
| 661 | Ga0496126_0002615 | 3300048929 | Bacteria | 23994 |
| 662 | Ga0496126_0011165 | 3300048929 | Bacteria | 9322 |
| 663 | Ga0496126_0048937 | 3300048929 | Bacteria | 3860 |
| 664 | Ga0496126_0080694 | 3300048929 | Bacteria | 2878 |
| 665 | Ga0495678_000052 | 3300049459 | Bacteria | 157731 |
| 666 | Ga0495678_048847 | 3300049459 | Bacteria | 1648 |
| 667 | Ga0495682_0001456 | 3300049460 | Bacteria | 12711 |
| 668 | Ga0501032_0000476 | 3300049569 | Bacteria | 32393 |
| 669 | Ga0501036_0006947 | 3300049572 | Bacteria | 9204 |
| 670 | Ga0501039_0341311 | 3300049575 | Bacteria | 1177 |
| 671 | Ga0501040_0060591 | 3300049576 | Bacteria | 2601 |
| 672 | Ga0501042_0053038 | 3300049578 | Bacteria | 2893 |
| 673 | Ga0501043_0146688 | 3300049579 | Bacteria | 1847 |
| 674 | Ga0501046_0083449 | 3300049580 | Bacteria | 2466 |
| 675 | Ga0501046_0145754 | 3300049580 | Bacteria | 1788 |
| 676 | Ga0501047_0079870 | 3300049581 | Bacteria | 3144 |
| 677 | Ga0501048_0213867 | 3300049582 | Bacteria | 1367 |
| 678 | Ga0501067_0002675 | 3300049583 | Bacteria | 9852 |
| 679 | Ga0501070_0283232 | 3300049586 | Bacteria | 1352 |
| 680 | Ga0501035_0000543 | 3300049822 | Bacteria | 41919 |
| 681 | Ga0501044_0000127 | 3300049823 | Bacteria | 92724 |
| 682 | Ga0501045_0281899 | 3300049824 | Bacteria | 1237 |
| 683 | nmdc:mga0yw44_81474_c1 | 3300050492 | Bacteria | 2029 |
| 684 | nmdc:mga0k408_1636_c1 | 3300050493 | Bacteria | 12115 |
| 685 | nmdc:mga06z11_3522_c1 | 3300050494 | Bacteria | 6065 |
| 686 | nmdc:mga04h51_2391_c1 | 3300050495 | Bacteria | 4449 |
| 687 | nmdc:mga05p37_253397_c1 | 3300050507 | Bacteria | 2110 |
| 688 | nmdc:mga05p37_5339_c1 | 3300050507 | Bacteria | 15091 |
| 689 | nmdc:mga09592_6044_c1 | 3300050508 | Bacteria | 9874 |
| 690 | nmdc:mga0qj67_1327_c1 | 3300050509 | Bacteria | 17394 |
| 691 | nmdc:mga06r32_14827_c1 | 3300050510 | Bacteria | 7071 |
| 692 | nmdc:mga08y16_2151_c1 | 3300050511 | Bacteria | 20215 |
| 693 | nmdc:mga08y16_93223_c1 | 3300050511 | Unclassified | 3138 |
| 694 | nmdc:mga08x19_284836_c1 | 3300050514 | Bacteria | 1145 |
| 695 | Ga0495601_0012505 | 3300053077 | Bacteria | 5090 |
| 696 | Ga0495601_0149649 | 3300053077 | Bacteria | 1524 |
| 697 | Ga0495612_0039681 | 3300053078 | Bacteria | 1915 |
| 698 | Ga0500578_0192746 | 3300053086 | Bacteria | 1250 |
| 699 | Ga0500644_0045920 | 3300053088 | Bacteria | 1474 |
| 700 | Ga0500566_0009242 | 3300053094 | Bacteria | 5831 |
| 701 | Ga0500566_0033762 | 3300053094 | Bacteria | 2979 |
| 702 | Ga0500640_000065 | 3300053095 | Bacteria | 17226 |
| 703 | Ga0500553_026081 | 3300053101 | Bacteria | 2944 |
| 704 | Ga0500554_000067 | 3300053102 | Bacteria | 18761 |
| 705 | Ga0500569_006115 | 3300053109 | Bacteria | 2625 |
| 706 | Ga0500572_002384 | 3300053111 | Bacteria | 4539 |
| 707 | Ga0500595_000110 | 3300053119 | Bacteria | 55326 |
| 708 | Ga0500597_064159 | 3300053120 | Bacteria | 1581 |
| 709 | Ga0500614_001859 | 3300053123 | Bacteria | 4879 |
| 710 | Ga0500618_000901 | 3300053125 | Bacteria | 15618 |
| 711 | Ga0500618_001175 | 3300053125 | Bacteria | 12632 |
| 712 | Ga0500618_004390 | 3300053125 | Bacteria | 4533 |
| 713 | Ga0500658_0031822 | 3300053134 | Bacteria | 2065 |
| 714 | Ga0500658_0058363 | 3300053134 | Bacteria | 1598 |
| 715 | Ga0500559_0014801 | 3300053136 | Bacteria | 3295 |
| 716 | Ga0500561_0000979 | 3300053137 | Bacteria | 4578 |
| 717 | Ga0500579_099605 | 3300053143 | Bacteria | 1522 |
| 718 | Ga0500600_0006627 | 3300053149 | Bacteria | 6923 |
| 719 | Ga0500616_0005770 | 3300053153 | Bacteria | 8315 |
| 720 | Ga0500622_0001692 | 3300053156 | Bacteria | 17162 |
| 721 | Ga0500622_0010351 | 3300053156 | Bacteria | 5123 |
| 722 | Ga0500633_0005241 | 3300053160 | Bacteria | 3058 |
| 723 | Ga0500634_0011919 | 3300053161 | Bacteria | 4508 |
| 724 | Ga0500637_0229244 | 3300053178 | Bacteria | 1047 |
| 725 | Ga0500587_013771 | 3300053739 | Bacteria | 1023 |
| 726 | Ga0501084_0123997 | 3300054114 | Bacteria | 2173 |
| 727 | Ga0501082_0031154 | 3300060353 | Bacteria | 4597 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_10008953 | Ga0105239_1000895310 | 224 |
| 2 | 3300041498 | Ga0451841_0165068 | Ga0451841_0165068_39_887 | 228 |
| 3 | 3300048925 | Ga0496122_0247837 | Ga0496122_0247837_245_988 | 230 |
| 4 | 3300046794 | Ga0495589_0038845 | Ga0495589_0038845_1368_2132 | 237 |
| 5 | 3300005841 | Ga0068863_100019824 | Ga0068863_1000198246 | 240 |
| 6 | 3300025942 | Ga0207689_10168690 | Ga0207689_101686902 | 240 |
| 7 | 3300026088 | Ga0207641_10045889 | Ga0207641_100458892 | 240 |
| 8 | 3300009148 | Ga0105243_10280027 | Ga0105243_102800271 | 241 |
| 9 | 3300025935 | Ga0207709_10100381 | Ga0207709_101003812 | 241 |
| 10 | 3300037466 | Ga0395898_0179012 | Ga0395898_0179012_292_1080 | 242 |
| 11 | 3300042012 | Ga0439455_0014244 | Ga0439455_0014244_426_1214 | 242 |
| 12 | 3300048904 | Ga0496101_0235888 | Ga0496101_0235888_557_1375 | 242 |
| 13 | 3300037471 | Ga0395905_0488995 | Ga0395905_0488995_301_1089 | 243 |
| 14 | 3300009094 | Ga0111539_10017567 | Ga0111539_100175676 | 244 |
| 15 | 3300038443 | Ga0395901_0231457 | Ga0395901_0231457_782_1570 | 244 |
| 16 | 3300050507 | nmdc:mga05p37_5339_c1 | nmdc:mga05p37_5339_c1_9372_10160 | 244 |
| 17 | 3300050508 | nmdc:mga09592_6044_c1 | nmdc:mga09592_6044_c1_424_1212 | 244 |
| 18 | 3300050509 | nmdc:mga0qj67_1327_c1 | nmdc:mga0qj67_1327_c1_10899_11687 | 244 |
| 19 | 3300050510 | nmdc:mga06r32_14827_c1 | nmdc:mga06r32_14827_c1_296_1084 | 244 |
| 20 | 3300050511 | nmdc:mga08y16_2151_c1 | nmdc:mga08y16_2151_c1_8664_9452 | 244 |
| 21 | 3300003856 | Ga0058692_1012125 | Ga0058692_10121252 | 245 |
| 22 | 3300027312 | Ga0209371_1000010 | Ga0209371_100001057 | 245 |
| 23 | 3300030500 | Ga0268256_1000051 | Ga0268256_1000051149 | 245 |
| 24 | 3300037471 | Ga0395905_0508742 | Ga0395905_0508742_125_889 | 245 |
| 25 | 3300005616 | Ga0068852_100005949 | Ga0068852_1000059493 | 248 |
| 26 | 3300025913 | Ga0207695_10001014 | Ga0207695_1000101447 | 248 |
| 27 | 3300025924 | Ga0207694_10122133 | Ga0207694_101221332 | 248 |
| 28 | 3300026142 | Ga0207698_10008214 | Ga0207698_100082143 | 248 |
| 29 | 3300031507 | Ga0307509_10000098 | Ga0307509_1000009832 | 250 |
| 30 | 3300003316 | rootH1_10047640 | rootH1_100476402 | 251 |
| 31 | 3300005329 | Ga0070683_100005836 | Ga0070683_1000058366 | 253 |
| 32 | 3300005535 | Ga0070684_100002727 | Ga0070684_1000027274 | 253 |
| 33 | 3300005577 | Ga0068857_100120766 | Ga0068857_1001207663 | 253 |
| 34 | 3300025944 | Ga0207661_10004102 | Ga0207661_1000410213 | 253 |
| 35 | 3300049578 | Ga0501042_0053038 | Ga0501042_0053038_2029_2853 | 253 |
| 36 | 3300006038 | Ga0075365_10071840 | Ga0075365_100718402 | 254 |
| 37 | 3300025905 | Ga0207685_10133653 | Ga0207685_101336532 | 254 |
| 38 | 3300048914 | Ga0496111_0136682 | Ga0496111_0136682_28_828 | 254 |
| 39 | 3300048918 | Ga0496115_0459229 | Ga0496115_0459229_232_1002 | 254 |
| 40 | 3300050492 | nmdc:mga0yw44_81474_c1 | nmdc:mga0yw44_81474_c1_560_1387 | 254 |
| 41 | 3300035691 | Ga0373931_0220337 | Ga0373931_0220337_108_1001 | 255 |
| 42 | 3300005434 | Ga0070709_10023164 | Ga0070709_100231643 | 257 |
| 43 | 3300005435 | Ga0070714_100176419 | Ga0070714_1001764192 | 257 |
| 44 | 3300005436 | Ga0070713_100014860 | Ga0070713_1000148603 | 257 |
| 45 | 3300005439 | Ga0070711_100069571 | Ga0070711_1000695712 | 257 |
| 46 | 3300025928 | Ga0207700_10195322 | Ga0207700_101953222 | 257 |
| 47 | 3300025929 | Ga0207664_10261225 | Ga0207664_102612252 | 257 |
| 48 | 3300037068 | Ga0373925_0059270 | Ga0373925_0059270_1809_2702 | 257 |
| 49 | 3300006194 | Ga0075427_10009992 | Ga0075427_100099921 | 259 |
| 50 | 3300006846 | Ga0075430_100000732 | Ga0075430_10000073211 | 259 |
| 51 | 3300027907 | Ga0207428_10000630 | Ga0207428_1000063024 | 259 |
| 52 | 3300031731 | Ga0307405_10014467 | Ga0307405_100144672 | 259 |
| 53 | 3300031824 | Ga0307413_10021520 | Ga0307413_100215201 | 259 |
| 54 | 3300031901 | Ga0307406_10006762 | Ga0307406_100067626 | 259 |
| 55 | 3300031995 | Ga0307409_100021278 | Ga0307409_1000212782 | 259 |
| 56 | 3300032002 | Ga0307416_100004859 | Ga0307416_1000048596 | 259 |
| 57 | 3300009098 | Ga0105245_10461960 | Ga0105245_104619602 | 260 |
| 58 | 3300014969 | Ga0157376_10098546 | Ga0157376_100985462 | 260 |
| 59 | 3300031730 | Ga0307516_10014239 | Ga0307516_100142395 | 261 |
| 60 | 3300031852 | Ga0307410_10293063 | Ga0307410_102930632 | 261 |
| 61 | 3300032126 | Ga0307415_100133211 | Ga0307415_1001332112 | 261 |
| 62 | 3300005614 | Ga0068856_100012052 | Ga0068856_1000120523 | 262 |
| 63 | 3300013308 | Ga0157375_10437359 | Ga0157375_104373592 | 262 |
| 64 | 3300017792 | Ga0163161_10078867 | Ga0163161_100788673 | 262 |
| 65 | 3300026078 | Ga0207702_10012084 | Ga0207702_100120845 | 262 |
| 66 | 3300039437 | Ga0436365_0624325 | Ga0436365_0624325_419_1231 | 262 |
| 67 | 3300048927 | Ga0496124_0007040 | Ga0496124_0007040_3989_4843 | 262 |
| 68 | 3300013105 | Ga0157369_10335896 | Ga0157369_103358962 | 263 |
| 69 | 3300013308 | Ga0157375_10050022 | Ga0157375_100500222 | 263 |
| 70 | 3300026067 | Ga0207678_10108628 | Ga0207678_101086284 | 263 |
| 71 | 3300005535 | Ga0070684_100102359 | Ga0070684_1001023593 | 264 |
| 72 | iso_pu_bacteria | 2751185782 | 2753266733 | 264 |
| 73 | 3300005548 | Ga0070665_100200105 | Ga0070665_1002001052 | 265 |
| 74 | 3300005841 | Ga0068863_100283855 | Ga0068863_1002838552 | 265 |
| 75 | 3300026088 | Ga0207641_10051661 | Ga0207641_100516614 | 265 |
| 76 | 3300026095 | Ga0207676_10175060 | Ga0207676_101750602 | 265 |
| 77 | 3300028379 | Ga0268266_10106761 | Ga0268266_101067612 | 265 |
| 78 | 3300048907 | Ga0496104_0485893 | Ga0496104_0485893_122_1018 | 265 |
| 79 | 3300048915 | Ga0496112_0017590 | Ga0496112_0017590_5256_6086 | 265 |
| 80 | 3300048915 | Ga0496112_0039858 | Ga0496112_0039858_3269_4099 | 265 |
| 81 | 3300048917 | Ga0496114_0004287 | Ga0496114_0004287_16_912 | 265 |
| 82 | iso_pu_bacteria | 2513237305 | 2514417435 | 265 |
| 83 | iso_pu_bacteria | 2582581313 | 2585304328 | 265 |
| 84 | iso_pu_bacteria | 2585428062 | 2587757896 | 265 |
| 85 | iso_pu_bacteria | 2721755686 | 2723574154 | 265 |
| 86 | iso_pu_bacteria | 2882632389 | 2882639423 | 265 |
| 87 | 3300047447 | Ga0495685_027233 | Ga0495685_027233_656_1537 | 266 |
| 88 | 3300025913 | Ga0207695_10004788 | Ga0207695_100047888 | 267 |
| 89 | 3300037312 | Ga0395899_0038761 | Ga0395899_0038761_1266_2102 | 267 |
| 90 | 3300037418 | Ga0395900_0037875 | Ga0395900_0037875_2306_3142 | 267 |
| 91 | 3300037418 | Ga0395900_0063563 | Ga0395900_0063563_2626_3462 | 267 |
| 92 | 3300037466 | Ga0395898_0098767 | Ga0395898_0098767_539_1375 | 267 |
| 93 | 3300037471 | Ga0395905_0060852 | Ga0395905_0060852_1429_2265 | 267 |
| 94 | 3300038443 | Ga0395901_0092795 | Ga0395901_0092795_1392_2228 | 267 |
| 95 | 3300038443 | Ga0395901_0095434 | Ga0395901_0095434_1742_2578 | 267 |
| 96 | 3300049583 | Ga0501067_0002675 | Ga0501067_0002675_8635_9504 | 267 |
| 97 | iso_pu_bacteria | 2521172590 | 2521556927 | 267 |
| 98 | iso_pu_bacteria | 2548876994 | 2550694881 | 267 |
| 99 | iso_pu_bacteria | 2775506901 | 2776257308 | 267 |
| 100 | iso_pu_bacteria | 2818991445 | 2819593970 | 267 |
| 101 | iso_pu_bacteria | 2904439833 | 2904440373 | 267 |
| 102 | iso_pu_bacteria | 2904530477 | 2904530712 | 267 |
| 103 | iso_pu_bacteria | 2904584206 | 2904585875 | 267 |
| 104 | iso_pu_bacteria | 2904589729 | 2904592312 | 267 |
| 105 | iso_pu_bacteria | 2904601388 | 2904601552 | 267 |
| 106 | iso_pu_bacteria | 2919079590 | 2919082796 | 267 |
| 107 | 3300003323 | rootH1_10007502 | rootH1_100075022 | 268 |
| 108 | 3300005347 | Ga0070668_100191791 | Ga0070668_1001917912 | 268 |
| 109 | 3300005548 | Ga0070665_100176282 | Ga0070665_1001762822 | 268 |
| 110 | 3300005548 | Ga0070665_100277093 | Ga0070665_1002770932 | 268 |
| 111 | 3300005563 | Ga0068855_100037965 | Ga0068855_1000379656 | 268 |
| 112 | 3300005578 | Ga0068854_100056145 | Ga0068854_1000561453 | 268 |
| 113 | 3300005841 | Ga0068863_100207719 | Ga0068863_1002077192 | 268 |
| 114 | 3300009093 | Ga0105240_10022396 | Ga0105240_100223964 | 268 |
| 115 | 3300009545 | Ga0105237_10581460 | Ga0105237_105814602 | 268 |
| 116 | 3300009551 | Ga0105238_10000062 | Ga0105238_1000006256 | 268 |
| 117 | 3300010375 | Ga0105239_10056421 | Ga0105239_100564213 | 268 |
| 118 | 3300014326 | Ga0157380_10038961 | Ga0157380_100389613 | 268 |
| 119 | 3300015261 | Ga0182006_1018572 | Ga0182006_10185723 | 268 |
| 120 | 3300025297 | Ga0209758_1007280 | Ga0209758_10072803 | 268 |
| 121 | 3300025302 | Ga0207426_1043471 | Ga0207426_10434712 | 268 |
| 122 | 3300025914 | Ga0207671_10004320 | Ga0207671_1000432012 | 268 |
| 123 | 3300025924 | Ga0207694_10000114 | Ga0207694_1000011451 | 268 |
| 124 | 3300025949 | Ga0207667_10041707 | Ga0207667_100417073 | 268 |
| 125 | 3300025972 | Ga0207668_10138421 | Ga0207668_101384212 | 268 |
| 126 | 3300025981 | Ga0207640_10023681 | Ga0207640_100236813 | 268 |
| 127 | 3300028379 | Ga0268266_10093083 | Ga0268266_100930832 | 268 |
| 128 | 3300031456 | Ga0307513_10012493 | Ga0307513_100124935 | 268 |
| 129 | 3300031507 | Ga0307509_10008752 | Ga0307509_1000875212 | 268 |
| 130 | 3300031507 | Ga0307509_10056753 | Ga0307509_100567534 | 268 |
| 131 | 3300031548 | Ga0307408_100445840 | Ga0307408_1004458402 | 268 |
| 132 | 3300031730 | Ga0307516_10000841 | Ga0307516_100008412 | 268 |
| 133 | 3300044683 | Ga0466965_0064353 | Ga0466965_0064353_291_1121 | 268 |
| 134 | 3300047320 | Ga0495672_0118007 | Ga0495672_0118007_15_884 | 268 |
| 135 | 3300048912 | Ga0496109_0179044 | Ga0496109_0179044_538_1380 | 268 |
| 136 | 3300053088 | Ga0500644_0045920 | Ga0500644_0045920_473_1348 | 268 |
| 137 | 3300053134 | Ga0500658_0058363 | Ga0500658_0058363_401_1270 | 268 |
| 138 | 3300053156 | Ga0500622_0001692 | Ga0500622_0001692_2169_3038 | 268 |
| 139 | 3300053156 | Ga0500622_0010351 | Ga0500622_0010351_2411_3280 | 268 |
| 140 | iso_pu_bacteria | 2511231025 | 2511382980 | 268 |
| 141 | iso_pu_bacteria | 2511231035 | 2511433275 | 268 |
| 142 | iso_pu_bacteria | 2534681786 | 2535484016 | 268 |
| 143 | iso_pu_bacteria | 2551306416 | 2553004715 | 268 |
| 144 | iso_pu_bacteria | 2675903060 | 2676491465 | 268 |
| 145 | iso_pu_bacteria | 2854911287 | 2854914109 | 268 |
| 146 | iso_pu_bacteria | 2867475112 | 2867477039 | 268 |
| 147 | iso_pu_bacteria | 2884693830 | 2884696475 | 268 |
| 148 | iso_pu_bacteria | 2895442618 | 2895449828 | 268 |
| 149 | iso_pu_bacteria | 2915650412 | 2915650957 | 268 |
| 150 | iso_pu_bacteria | 2919046199 | 2919049725 | 268 |
| 151 | iso_pu_bacteria | 2928130867 | 2928134464 | 268 |
| 152 | iso_pu_bacteria | 2997451912 | 2997454156 | 268 |
| 153 | 3300003751 | Ga0055538_1000008 | Ga0055538_1000008214 | 269 |
| 154 | 3300003752 | Ga0055539_1000012 | Ga0055539_1000012214 | 269 |
| 155 | 3300003756 | Ga0055533_1000015 | Ga0055533_1000015214 | 269 |
| 156 | 3300003759 | Ga0055525_1000017 | Ga0055525_1000017129 | 269 |
| 157 | 3300003841 | Ga0055541_1000009 | Ga0055541_1000009214 | 269 |
| 158 | 3300005563 | Ga0068855_100000175 | Ga0068855_10000017517 | 269 |
| 159 | 3300009545 | Ga0105237_10073916 | Ga0105237_100739164 | 269 |
| 160 | 3300021361 | Ga0213872_10003902 | Ga0213872_100039024 | 269 |
| 161 | 3300025224 | Ga0209784_100005 | Ga0209784_100005211 | 269 |
| 162 | 3300025225 | Ga0209566_100005 | Ga0209566_100005211 | 269 |
| 163 | 3300025226 | Ga0209674_100009 | Ga0209674_100009211 | 269 |
| 164 | 3300025230 | Ga0209563_100012 | Ga0209563_100012211 | 269 |
| 165 | 3300025253 | Ga0209677_100006 | Ga0209677_100006211 | 269 |
| 166 | 3300025914 | Ga0207671_10153575 | Ga0207671_101535752 | 269 |
| 167 | 3300025949 | Ga0207667_10000028 | Ga0207667_10000028139 | 269 |
| 168 | 3300031456 | Ga0307513_10097365 | Ga0307513_100973652 | 269 |
| 169 | 3300031616 | Ga0307508_10001048 | Ga0307508_1000104823 | 269 |
| 170 | 3300031649 | Ga0307514_10031572 | Ga0307514_100315723 | 269 |
| 171 | 3300039447 | Ga0436361_0480362 | Ga0436361_0480362_127_996 | 269 |
| 172 | 3300039447 | Ga0436361_0689999 | Ga0436361_0689999_5980_6888 | 269 |
| 173 | 3300046474 | Ga0495605_0086778 | Ga0495605_0086778_278_1168 | 269 |
| 174 | 3300046512 | Ga0495610_0033752 | Ga0495610_0033752_1104_1988 | 269 |
| 175 | 3300046519 | Ga0495632_0025622 | Ga0495632_0025622_1278_2162 | 269 |
| 176 | 3300053739 | Ga0500587_013771 | Ga0500587_013771_43_927 | 269 |
| 177 | iso_pu_bacteria | 2511231003 | 2511251600 | 269 |
| 178 | iso_pu_bacteria | 2602042109 | 2603868379 | 269 |
| 179 | iso_pu_bacteria | 2643221690 | 2644503330 | 269 |
| 180 | iso_pu_bacteria | 2765235838 | 2765568120 | 269 |
| 181 | iso_pu_bacteria | 2795385470 | 2795785421 | 269 |
| 182 | iso_pu_bacteria | 2808606386 | 2808983633 | 269 |
| 183 | iso_pu_bacteria | 2808606415 | 2809129297 | 269 |
| 184 | iso_pu_bacteria | 2808606419 | 2809149648 | 269 |
| 185 | iso_pu_bacteria | 2839094727 | 2839097587 | 269 |
| 186 | iso_pu_bacteria | 2852618963 | 2852619800 | 269 |
| 187 | iso_pu_bacteria | 2884811622 | 2884811800 | 269 |
| 188 | iso_pu_bacteria | 2884836552 | 2884839791 | 269 |
| 189 | iso_pu_bacteria | 2884852848 | 2884856398 | 269 |
| 190 | iso_pu_bacteria | 2888373701 | 2888375140 | 269 |
| 191 | iso_pu_bacteria | 2895427314 | 2895430171 | 269 |
| 192 | iso_pu_bacteria | 2896154374 | 2896158763 | 269 |
| 193 | iso_pu_bacteria | 2908669403 | 2908673900 | 269 |
| 194 | iso_pu_bacteria | 8003314358 | 8003318742 | 269 |
| 195 | 3300003751 | Ga0055538_1000059 | Ga0055538_100005947 | 270 |
| 196 | 3300003752 | Ga0055539_1000089 | Ga0055539_100008947 | 270 |
| 197 | 3300003756 | Ga0055533_1000098 | Ga0055533_100009847 | 270 |
| 198 | 3300003759 | Ga0055525_1000130 | Ga0055525_100013047 | 270 |
| 199 | 3300003841 | Ga0055541_1000061 | Ga0055541_100006147 | 270 |
| 200 | 3300005455 | Ga0070663_100032160 | Ga0070663_1000321603 | 270 |
| 201 | 3300005563 | Ga0068855_100000366 | Ga0068855_10000036651 | 270 |
| 202 | 3300005563 | Ga0068855_100041258 | Ga0068855_1000412582 | 270 |
| 203 | 3300005577 | Ga0068857_100251196 | Ga0068857_1002511962 | 270 |
| 204 | 3300005578 | Ga0068854_100005738 | Ga0068854_1000057383 | 270 |
| 205 | 3300005834 | Ga0068851_10102046 | Ga0068851_101020462 | 270 |
| 206 | 3300005834 | Ga0068851_10157609 | Ga0068851_101576092 | 270 |
| 207 | 3300006946 | Ga0079104_1012486 | Ga0079104_10124862 | 270 |
| 208 | 3300009036 | Ga0105244_10026662 | Ga0105244_100266622 | 270 |
| 209 | 3300009093 | Ga0105240_10124062 | Ga0105240_101240622 | 270 |
| 210 | 3300009545 | Ga0105237_10002495 | Ga0105237_100024954 | 270 |
| 211 | 3300009551 | Ga0105238_10000031 | Ga0105238_10000031110 | 270 |
| 212 | 3300009553 | Ga0105249_10204011 | Ga0105249_102040113 | 270 |
| 213 | 3300010375 | Ga0105239_10004287 | Ga0105239_100042877 | 270 |
| 214 | 3300015261 | Ga0182006_1000874 | Ga0182006_10008742 | 270 |
| 215 | 3300015262 | Ga0182007_10045024 | Ga0182007_100450241 | 270 |
| 216 | 3300021361 | Ga0213872_10005805 | Ga0213872_100058053 | 270 |
| 217 | 3300021361 | Ga0213872_10014729 | Ga0213872_100147292 | 270 |
| 218 | 3300021384 | Ga0213876_10047398 | Ga0213876_100473982 | 270 |
| 219 | 3300025224 | Ga0209784_100018 | Ga0209784_100018287 | 270 |
| 220 | 3300025225 | Ga0209566_100016 | Ga0209566_100016287 | 270 |
| 221 | 3300025226 | Ga0209674_100030 | Ga0209674_100030287 | 270 |
| 222 | 3300025230 | Ga0209563_100034 | Ga0209563_100034287 | 270 |
| 223 | 3300025253 | Ga0209677_100019 | Ga0209677_100019287 | 270 |
| 224 | 3300025913 | Ga0207695_10000480 | Ga0207695_100004806 | 270 |
| 225 | 3300025914 | Ga0207671_10003970 | Ga0207671_100039703 | 270 |
| 226 | 3300025924 | Ga0207694_10000062 | Ga0207694_1000006222 | 270 |
| 227 | 3300025949 | Ga0207667_10000044 | Ga0207667_10000044165 | 270 |
| 228 | 3300025949 | Ga0207667_10013042 | Ga0207667_100130424 | 270 |
| 229 | 3300025981 | Ga0207640_10012781 | Ga0207640_100127813 | 270 |
| 230 | 3300026067 | Ga0207678_10000040 | Ga0207678_1000004038 | 270 |
| 231 | 3300026116 | Ga0207674_10203653 | Ga0207674_102036532 | 270 |
| 232 | 3300027111 | Ga0209281_1020393 | Ga0209281_10203931 | 270 |
| 233 | 3300028380 | Ga0268265_10429602 | Ga0268265_104296022 | 270 |
| 234 | 3300028794 | Ga0307515_10003694 | Ga0307515_100036949 | 270 |
| 235 | 3300031691 | Ga0316579_10068377 | Ga0316579_100683772 | 270 |
| 236 | 3300031727 | Ga0316576_10007563 | Ga0316576_100075634 | 270 |
| 237 | 3300031728 | Ga0316578_10012740 | Ga0316578_100127405 | 270 |
| 238 | 3300031730 | Ga0307516_10001109 | Ga0307516_1000110924 | 270 |
| 239 | 3300035398 | Ga0316574_0290303 | Ga0316574_0290303_24_857 | 270 |
| 240 | 3300036647 | Ga0316582_0178767 | Ga0316582_0178767_43_876 | 270 |
| 241 | 3300036712 | Ga0316584_0190816 | Ga0316584_0190816_430_1263 | 270 |
| 242 | 3300039437 | Ga0436365_1474640 | Ga0436365_1474640_2148_2987 | 270 |
| 243 | 3300039447 | Ga0436361_0220616 | Ga0436361_0220616_239_1177 | 270 |
| 244 | 3300039447 | Ga0436361_0584428 | Ga0436361_0584428_1749_2612 | 270 |
| 245 | 3300041463 | Ga0451804_0918993 | Ga0451804_0918993_159_1067 | 270 |
| 246 | 3300046522 | Ga0495643_0050031 | Ga0495643_0050031_788_1696 | 270 |
| 247 | 3300046660 | Ga0495625_0016386 | Ga0495625_0016386_1075_1983 | 270 |
| 248 | 3300048924 | Ga0496121_0044124 | Ga0496121_0044124_715_1596 | 270 |
| 249 | 3300048924 | Ga0496121_0322559 | Ga0496121_0322559_57_932 | 270 |
| 250 | 3300053125 | Ga0500618_000901 | Ga0500618_000901_953_1834 | 270 |
| 251 | 3300053125 | Ga0500618_001175 | Ga0500618_001175_11474_12397 | 270 |
| 252 | 3300053125 | Ga0500618_004390 | Ga0500618_004390_2951_3856 | 270 |
| 253 | iso_pu_bacteria | 2521172590 | 2521560422 | 270 |
| 254 | iso_pu_bacteria | 2551306416 | 2553005533 | 270 |
| 255 | iso_pu_bacteria | 2599185240 | 2599747327 | 270 |
| 256 | iso_pu_bacteria | 2599185355 | 2600209048 | 270 |
| 257 | iso_pu_bacteria | 2667528173 | 2671107884 | 270 |
| 258 | iso_pu_bacteria | 2675903129 | 2676745076 | 270 |
| 259 | iso_pu_bacteria | 2724679232 | 2725946908 | 270 |
| 260 | iso_pu_bacteria | 2738541272 | 2738697296 | 270 |
| 261 | iso_pu_bacteria | 2738543027 | 2739326806 | 270 |
| 262 | iso_pu_bacteria | 2765235838 | 2765567911 | 270 |
| 263 | iso_pu_bacteria | 2808606386 | 2808982855 | 270 |
| 264 | iso_pu_bacteria | 2808606415 | 2809130367 | 270 |
| 265 | iso_pu_bacteria | 2808606419 | 2809150156 | 270 |
| 266 | iso_pu_bacteria | 2818991449 | 2819617094 | 270 |
| 267 | iso_pu_bacteria | 2818991472 | 2819744702 | 270 |
| 268 | iso_pu_bacteria | 2839094727 | 2839097802 | 270 |
| 269 | iso_pu_bacteria | 2852618963 | 2852621623 | 270 |
| 270 | iso_pu_bacteria | 2889042446 | 2889045282 | 270 |
| 271 | iso_pu_bacteria | 2904439833 | 2904442722 | 270 |
| 272 | iso_pu_bacteria | 2904474040 | 2904476899 | 270 |
| 273 | iso_pu_bacteria | 2904490793 | 2904492156 | 270 |
| 274 | iso_pu_bacteria | 2904530477 | 2904535065 | 270 |
| 275 | iso_pu_bacteria | 2904584206 | 2904588597 | 270 |
| 276 | iso_pu_bacteria | 2904589729 | 2904594329 | 270 |
| 277 | iso_pu_bacteria | 2904601388 | 2904604828 | 270 |
| 278 | iso_pu_bacteria | 2919046199 | 2919047351 | 270 |
| 279 | iso_pu_bacteria | 2919079590 | 2919083069 | 270 |
| 280 | iso_pu_bacteria | 2919150387 | 2919153068 | 270 |
| 281 | iso_pu_bacteria | 2919160200 | 2919161385 | 270 |
| 282 | iso_pu_bacteria | 2923510766 | 2923514200 | 270 |
| 283 | iso_pu_bacteria | 2927143783 | 2927147029 | 270 |
| 284 | iso_pu_bacteria | 2928130867 | 2928132923 | 270 |
| 285 | iso_pu_bacteria | 2931384279 | 2931388715 | 270 |
| 286 | iso_pu_bacteria | 2945991243 | 2945992707 | 270 |
| 287 | iso_pu_bacteria | 2946053406 | 2946055459 | 270 |
| 288 | iso_pu_bacteria | 8054849141 | 8054851158 | 270 |
| 289 | iso_pu_bacteria | 8057304971 | 8057306932 | 270 |
| 290 | 3300002704 | JGI25155J39150_1000192 | JGI25155J39150_10001923 | 271 |
| 291 | 3300002704 | JGI25155J39150_1001145 | JGI25155J39150_10011453 | 271 |
| 292 | 3300002705 | JGI25156J39149_1000077 | JGI25156J39149_100007768 | 271 |
| 293 | 3300002705 | JGI25156J39149_1000098 | JGI25156J39149_100009813 | 271 |
| 294 | 3300002738 | JGI25154J39366_1000103 | JGI25154J39366_100010368 | 271 |
| 295 | 3300002738 | JGI25154J39366_1003016 | JGI25154J39366_10030162 | 271 |
| 296 | 3300002738 | JGI25154J39366_1004497 | JGI25154J39366_10044971 | 271 |
| 297 | 3300002741 | JGI25157J39369_1000668 | JGI25157J39369_10006686 | 271 |
| 298 | 3300003758 | Ga0055532_1000034 | Ga0055532_1000034108 | 271 |
| 299 | 3300005327 | Ga0070658_10007287 | Ga0070658_100072873 | 271 |
| 300 | 3300005329 | Ga0070683_100055726 | Ga0070683_1000557263 | 271 |
| 301 | 3300005329 | Ga0070683_100288301 | Ga0070683_1002883012 | 271 |
| 302 | 3300005336 | Ga0070680_100405030 | Ga0070680_1004050301 | 271 |
| 303 | 3300005339 | Ga0070660_100027547 | Ga0070660_1000275474 | 271 |
| 304 | 3300005344 | Ga0070661_100055402 | Ga0070661_1000554023 | 271 |
| 305 | 3300005366 | Ga0070659_100098961 | Ga0070659_1000989613 | 271 |
| 306 | 3300005458 | Ga0070681_10139293 | Ga0070681_101392932 | 271 |
| 307 | 3300005530 | Ga0070679_100010324 | Ga0070679_1000103245 | 271 |
| 308 | 3300005535 | Ga0070684_100063768 | Ga0070684_1000637683 | 271 |
| 309 | 3300005614 | Ga0068856_100364720 | Ga0068856_1003647202 | 271 |
| 310 | 3300005616 | Ga0068852_100359951 | Ga0068852_1003599512 | 271 |
| 311 | 3300006042 | Ga0075368_10005280 | Ga0075368_100052802 | 271 |
| 312 | 3300006178 | Ga0075367_10005258 | Ga0075367_100052585 | 271 |
| 313 | 3300006195 | Ga0075366_10045115 | Ga0075366_100451152 | 271 |
| 314 | 3300006946 | Ga0079104_1000003 | Ga0079104_1000003345 | 271 |
| 315 | 3300009011 | Ga0105251_10038404 | Ga0105251_100384042 | 271 |
| 316 | 3300009093 | Ga0105240_10000799 | Ga0105240_1000079952 | 271 |
| 317 | 3300009093 | Ga0105240_10009192 | Ga0105240_1000919217 | 271 |
| 318 | 3300009551 | Ga0105238_10042170 | Ga0105238_100421705 | 271 |
| 319 | 3300010375 | Ga0105239_10095021 | Ga0105239_100950214 | 271 |
| 320 | 3300010375 | Ga0105239_10748068 | Ga0105239_107480682 | 271 |
| 321 | 3300013105 | Ga0157369_10361694 | Ga0157369_103616943 | 271 |
| 322 | 3300013307 | Ga0157372_10254983 | Ga0157372_102549833 | 271 |
| 323 | 3300014497 | Ga0182008_10033470 | Ga0182008_100334702 | 271 |
| 324 | 3300014497 | Ga0182008_10095085 | Ga0182008_100950852 | 271 |
| 325 | 3300015261 | Ga0182006_1022705 | Ga0182006_10227054 | 271 |
| 326 | 3300025206 | Ga0209435_100007 | Ga0209435_100007108 | 271 |
| 327 | 3300025206 | Ga0209435_100124 | Ga0209435_1001249 | 271 |
| 328 | 3300025229 | Ga0209147_100017 | Ga0209147_100017364 | 271 |
| 329 | 3300025233 | Ga0209437_100215 | Ga0209437_10021585 | 271 |
| 330 | 3300025242 | Ga0209258_100115 | Ga0209258_10011597 | 271 |
| 331 | 3300025246 | Ga0209646_1000044 | Ga0209646_1000044205 | 271 |
| 332 | 3300025246 | Ga0209646_1000238 | Ga0209646_100023819 | 271 |
| 333 | 3300025250 | Ga0209026_1000063 | Ga0209026_1000063108 | 271 |
| 334 | 3300025250 | Ga0209026_1006998 | Ga0209026_10069981 | 271 |
| 335 | 3300025256 | Ga0209759_1000048 | Ga0209759_1000048108 | 271 |
| 336 | 3300025256 | Ga0209759_1006095 | Ga0209759_10060952 | 271 |
| 337 | 3300025909 | Ga0207705_10048639 | Ga0207705_100486393 | 271 |
| 338 | 3300025913 | Ga0207695_10002743 | Ga0207695_1000274317 | 271 |
| 339 | 3300025939 | Ga0207665_10135723 | Ga0207665_101357233 | 271 |
| 340 | 3300025944 | Ga0207661_10065173 | Ga0207661_100651733 | 271 |
| 341 | 3300025944 | Ga0207661_10233292 | Ga0207661_102332922 | 271 |
| 342 | 3300026078 | Ga0207702_10549229 | Ga0207702_105492291 | 271 |
| 343 | 3300026116 | Ga0207674_10163914 | Ga0207674_101639142 | 271 |
| 344 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021558 | 271 |
| 345 | 3300046660 | Ga0495625_0000428 | Ga0495625_0000428_1510_2397 | 271 |
| 346 | 3300048919 | Ga0496116_0005552 | Ga0496116_0005552_1178_2062 | 271 |
| 347 | 3300048919 | Ga0496116_0026638 | Ga0496116_0026638_1797_2714 | 271 |
| 348 | 3300048921 | Ga0496118_0190743 | Ga0496118_0190743_71_988 | 271 |
| 349 | 3300048924 | Ga0496121_0010160 | Ga0496121_0010160_7246_8118 | 271 |
| 350 | 3300048924 | Ga0496121_0186814 | Ga0496121_0186814_219_1103 | 271 |
| 351 | 3300048925 | Ga0496122_0000570 | Ga0496122_0000570_1435_2322 | 271 |
| 352 | 3300048925 | Ga0496122_0003675 | Ga0496122_0003675_1634_2551 | 271 |
| 353 | 3300048926 | Ga0496123_0000438 | Ga0496123_0000438_637_1524 | 271 |
| 354 | 3300048926 | Ga0496123_0002948 | Ga0496123_0002948_1641_2558 | 271 |
| 355 | 3300048928 | Ga0496125_0000701 | Ga0496125_0000701_41336_42250 | 271 |
| 356 | 3300048928 | Ga0496125_0003276 | Ga0496125_0003276_1638_2555 | 271 |
| 357 | 3300050494 | nmdc:mga06z11_3522_c1 | nmdc:mga06z11_3522_c1_2513_3346 | 271 |
| 358 | 3300050495 | nmdc:mga04h51_2391_c1 | nmdc:mga04h51_2391_c1_1736_2569 | 271 |
| 359 | iso_pu_bacteria | 2506520007 | 2506576609 | 271 |
| 360 | iso_pu_bacteria | 2506520008 | 2506581747 | 271 |
| 361 | iso_pu_bacteria | 2508501071 | 2508850556 | 271 |
| 362 | iso_pu_bacteria | 2654587920 | 2656275750 | 271 |
| 363 | iso_pu_bacteria | 2687453601 | 2689442985 | 271 |
| 364 | iso_pu_bacteria | 2751185734 | 2753076412 | 271 |
| 365 | iso_pu_bacteria | 2786546132 | 2786666841 | 271 |
| 366 | iso_pu_bacteria | 2806310673 | 2807177901 | 271 |
| 367 | iso_pu_bacteria | 2818991438 | 2819551646 | 271 |
| 368 | iso_pu_bacteria | 2869551831 | 2869552389 | 271 |
| 369 | iso_pu_bacteria | 2891395885 | 2891402160 | 271 |
| 370 | iso_pu_bacteria | 2954673503 | 2954681926 | 271 |
| 371 | iso_pu_bacteria | 2954682443 | 2954690998 | 271 |
| 372 | iso_pu_bacteria | 2990059506 | 2990064129 | 271 |
| 373 | iso_pu_bacteria | 640753048 | 640936149 | 271 |
| 374 | 3300003322 | rootL2_10046969 | rootL2_100469692 | 272 |
| 375 | 3300003354 | JGI25160J50197_1012539 | JGI25160J50197_10125393 | 272 |
| 376 | 3300003354 | JGI25160J50197_1048070 | JGI25160J50197_10480701 | 272 |
| 377 | 3300003578 | Ga0006562J51391_1034596 | Ga0006562J51391_10345963 | 272 |
| 378 | 3300003856 | Ga0058692_1000208 | Ga0058692_100020826 | 272 |
| 379 | 3300003856 | Ga0058692_1012865 | Ga0058692_10128652 | 272 |
| 380 | 3300005577 | Ga0068857_100395760 | Ga0068857_1003957602 | 272 |
| 381 | 3300005937 | Ga0081455_10032557 | Ga0081455_100325574 | 272 |
| 382 | 3300009036 | Ga0105244_10000690 | Ga0105244_1000069028 | 272 |
| 383 | 3300011119 | Ga0105246_10008663 | Ga0105246_100086632 | 272 |
| 384 | 3300025302 | Ga0207426_1003013 | Ga0207426_10030137 | 272 |
| 385 | 3300025302 | Ga0207426_1006750 | Ga0207426_10067502 | 272 |
| 386 | 3300025302 | Ga0207426_1015986 | Ga0207426_10159862 | 272 |
| 387 | 3300025728 | Ga0207655_1005786 | Ga0207655_10057862 | 272 |
| 388 | 3300026116 | Ga0207674_10360944 | Ga0207674_103609442 | 272 |
| 389 | 3300027312 | Ga0209371_1000134 | Ga0209371_1000134105 | 272 |
| 390 | 3300027312 | Ga0209371_1002387 | Ga0209371_10023873 | 272 |
| 391 | 3300030500 | Ga0268256_1003318 | Ga0268256_10033184 | 272 |
| 392 | 3300030500 | Ga0268256_1004842 | Ga0268256_10048423 | 272 |
| 393 | 3300031712 | Ga0265342_10075332 | Ga0265342_100753322 | 272 |
| 394 | 3300042134 | Ga0450898_002025 | Ga0450898_002025_1764_2672 | 272 |
| 395 | 3300042135 | Ga0450899_000209 | Ga0450899_000209_1208_2116 | 272 |
| 396 | 3300044693 | Ga0466961_0101424 | Ga0466961_0101424_408_1268 | 272 |
| 397 | 3300046458 | Ga0495591_000006 | Ga0495591_000006_95006_95860 | 272 |
| 398 | 3300046458 | Ga0495591_000933 | Ga0495591_000933_3103_3942 | 272 |
| 399 | 3300046460 | Ga0495638_0116477 | Ga0495638_0116477_283_1134 | 272 |
| 400 | 3300046474 | Ga0495605_0000037 | Ga0495605_0000037_19771_20610 | 272 |
| 401 | 3300046474 | Ga0495605_0113557 | Ga0495605_0113557_179_1030 | 272 |
| 402 | 3300046476 | Ga0495662_0011382 | Ga0495662_0011382_1682_2521 | 272 |
| 403 | 3300046501 | Ga0495607_0000149 | Ga0495607_0000149_32998_33837 | 272 |
| 404 | 3300046515 | Ga0495620_0000296 | Ga0495620_0000296_17658_18497 | 272 |
| 405 | 3300046522 | Ga0495643_0059077 | Ga0495643_0059077_482_1333 | 272 |
| 406 | 3300046524 | Ga0495648_0150218 | Ga0495648_0150218_120_959 | 272 |
| 407 | 3300046530 | Ga0495654_0000013 | Ga0495654_0000013_147296_148150 | 272 |
| 408 | 3300046616 | Ga0495668_0028856 | Ga0495668_0028856_1394_2233 | 272 |
| 409 | 3300046663 | Ga0495635_0048642 | Ga0495635_0048642_1164_2003 | 272 |
| 410 | 3300046665 | Ga0495661_0071627 | Ga0495661_0071627_1056_1895 | 272 |
| 411 | 3300046689 | Ga0495613_0027459 | Ga0495613_0027459_863_1702 | 272 |
| 412 | 3300047321 | Ga0495676_0086254 | Ga0495676_0086254_34_876 | 272 |
| 413 | 3300047443 | Ga0495687_010867 | Ga0495687_010867_3080_3931 | 272 |
| 414 | 3300047446 | Ga0495679_040234 | Ga0495679_040234_37_888 | 272 |
| 415 | 3300047469 | Ga0495673_0002720 | Ga0495673_0002720_8087_8926 | 272 |
| 416 | 3300048913 | Ga0496110_0131045 | Ga0496110_0131045_1307_2146 | 272 |
| 417 | 3300048920 | Ga0496117_0000858 | Ga0496117_0000858_17419_18246 | 272 |
| 418 | 3300048921 | Ga0496118_0016088 | Ga0496118_0016088_3500_4327 | 272 |
| 419 | 3300048922 | Ga0496119_0002429 | Ga0496119_0002429_8145_8972 | 272 |
| 420 | 3300048923 | Ga0496120_0008793 | Ga0496120_0008793_419_1246 | 272 |
| 421 | 3300048925 | Ga0496122_0101295 | Ga0496122_0101295_528_1355 | 272 |
| 422 | 3300048926 | Ga0496123_0009809 | Ga0496123_0009809_5749_6576 | 272 |
| 423 | 3300048926 | Ga0496123_0077038 | Ga0496123_0077038_281_1135 | 272 |
| 424 | 3300048927 | Ga0496124_0001245 | Ga0496124_0001245_14372_15199 | 272 |
| 425 | 3300048927 | Ga0496124_0338350 | Ga0496124_0338350_81_1004 | 272 |
| 426 | 3300048928 | Ga0496125_0000997 | Ga0496125_0000997_14687_15514 | 272 |
| 427 | 3300048929 | Ga0496126_0011165 | Ga0496126_0011165_4380_5207 | 272 |
| 428 | 3300048929 | Ga0496126_0080694 | Ga0496126_0080694_1104_1958 | 272 |
| 429 | 3300049460 | Ga0495682_0001456 | Ga0495682_0001456_5837_6676 | 272 |
| 430 | 3300049576 | Ga0501040_0060591 | Ga0501040_0060591_378_1274 | 272 |
| 431 | iso_pu_bacteria | 2585427591 | 2585827026 | 272 |
| 432 | iso_pu_bacteria | 2585427592 | 2585833080 | 272 |
| 433 | iso_pu_bacteria | 2751185782 | 2753270110 | 272 |
| 434 | iso_pu_bacteria | 2990059506 | 2990066970 | 272 |
| 435 | 3300002737 | JGI25162J39368_1000067 | JGI25162J39368_1000067108 | 273 |
| 436 | 3300002771 | JGI25163J39215_1000114 | JGI25163J39215_100011417 | 273 |
| 437 | 3300002772 | JGI25164J39214_1000039 | JGI25164J39214_100003931 | 273 |
| 438 | 3300003316 | rootH1_10101285 | rootH1_101012852 | 273 |
| 439 | 3300003316 | rootH1_10175001 | rootH1_101750012 | 273 |
| 440 | 3300003320 | rootH2_10154600 | rootH2_101546002 | 273 |
| 441 | 3300003322 | rootL2_10072560 | rootL2_100725602 | 273 |
| 442 | 3300003323 | rootH1_10090190 | rootH1_100901901 | 273 |
| 443 | 3300003751 | Ga0055538_1000052 | Ga0055538_100005231 | 273 |
| 444 | 3300003752 | Ga0055539_1000077 | Ga0055539_100007731 | 273 |
| 445 | 3300003756 | Ga0055533_1000083 | Ga0055533_100008331 | 273 |
| 446 | 3300003759 | Ga0055525_1000110 | Ga0055525_100011031 | 273 |
| 447 | 3300003841 | Ga0055541_1000054 | Ga0055541_100005431 | 273 |
| 448 | 3300005289 | Ga0065704_10000086 | Ga0065704_1000008614 | 273 |
| 449 | 3300005293 | Ga0065715_10001912 | Ga0065715_100019125 | 273 |
| 450 | 3300005327 | Ga0070658_10028027 | Ga0070658_100280272 | 273 |
| 451 | 3300005329 | Ga0070683_100147444 | Ga0070683_1001474441 | 273 |
| 452 | 3300005336 | Ga0070680_100245152 | Ga0070680_1002451522 | 273 |
| 453 | 3300005340 | Ga0070689_100125795 | Ga0070689_1001257952 | 273 |
| 454 | 3300005344 | Ga0070661_100063873 | Ga0070661_1000638731 | 273 |
| 455 | 3300005366 | Ga0070659_100189195 | Ga0070659_1001891951 | 273 |
| 456 | 3300005435 | Ga0070714_100031348 | Ga0070714_1000313481 | 273 |
| 457 | 3300005437 | Ga0070710_10178135 | Ga0070710_101781352 | 273 |
| 458 | 3300005458 | Ga0070681_10109540 | Ga0070681_101095403 | 273 |
| 459 | 3300005535 | Ga0070684_100077083 | Ga0070684_1000770832 | 273 |
| 460 | 3300005535 | Ga0070684_100271218 | Ga0070684_1002712182 | 273 |
| 461 | 3300005539 | Ga0068853_100045923 | Ga0068853_1000459233 | 273 |
| 462 | 3300005577 | Ga0068857_100043585 | Ga0068857_1000435853 | 273 |
| 463 | 3300005615 | Ga0070702_100042509 | Ga0070702_1000425091 | 273 |
| 464 | 3300005616 | Ga0068852_100235036 | Ga0068852_1002350362 | 273 |
| 465 | 3300006175 | Ga0070712_100065041 | Ga0070712_1000650413 | 273 |
| 466 | 3300009036 | Ga0105244_10018611 | Ga0105244_100186112 | 273 |
| 467 | 3300009092 | Ga0105250_10001925 | Ga0105250_100019255 | 273 |
| 468 | 3300009093 | Ga0105240_10001342 | Ga0105240_1000134237 | 273 |
| 469 | 3300009098 | Ga0105245_10017716 | Ga0105245_100177162 | 273 |
| 470 | 3300009177 | Ga0105248_10352031 | Ga0105248_103520312 | 273 |
| 471 | 3300009545 | Ga0105237_10001632 | Ga0105237_100016323 | 273 |
| 472 | 3300009545 | Ga0105237_10716216 | Ga0105237_107162162 | 273 |
| 473 | 3300009551 | Ga0105238_10128765 | Ga0105238_101287652 | 273 |
| 474 | 3300009551 | Ga0105238_10665890 | Ga0105238_106658901 | 273 |
| 475 | 3300013102 | Ga0157371_10000075 | Ga0157371_1000007523 | 273 |
| 476 | 3300013102 | Ga0157371_10009934 | Ga0157371_100099346 | 273 |
| 477 | 3300013105 | Ga0157369_10076389 | Ga0157369_100763891 | 273 |
| 478 | 3300014497 | Ga0182008_10010812 | Ga0182008_100108123 | 273 |
| 479 | 3300015262 | Ga0182007_10000409 | Ga0182007_1000040915 | 273 |
| 480 | 3300021384 | Ga0213876_10006516 | Ga0213876_100065166 | 273 |
| 481 | 3300021384 | Ga0213876_10103894 | Ga0213876_101038942 | 273 |
| 482 | 3300025207 | Ga0209760_100070 | Ga0209760_10007018 | 273 |
| 483 | 3300025224 | Ga0209784_100012 | Ga0209784_100012468 | 273 |
| 484 | 3300025225 | Ga0209566_100010 | Ga0209566_100010468 | 273 |
| 485 | 3300025226 | Ga0209674_100023 | Ga0209674_100023468 | 273 |
| 486 | 3300025230 | Ga0209563_100027 | Ga0209563_100027468 | 273 |
| 487 | 3300025231 | Ga0207427_100017 | Ga0207427_100017468 | 273 |
| 488 | 3300025233 | Ga0209437_100029 | Ga0209437_100029468 | 273 |
| 489 | 3300025253 | Ga0209677_100014 | Ga0209677_100014468 | 273 |
| 490 | 3300025261 | Ga0209233_1000890 | Ga0209233_100089010 | 273 |
| 491 | 3300025711 | Ga0207696_1000658 | Ga0207696_10006588 | 273 |
| 492 | 3300025728 | Ga0207655_1000243 | Ga0207655_100024353 | 273 |
| 493 | 3300025728 | Ga0207655_1001127 | Ga0207655_10011272 | 273 |
| 494 | 3300025904 | Ga0207647_10023123 | Ga0207647_100231234 | 273 |
| 495 | 3300025912 | Ga0207707_10069790 | Ga0207707_100697903 | 273 |
| 496 | 3300025912 | Ga0207707_10084117 | Ga0207707_100841172 | 273 |
| 497 | 3300025914 | Ga0207671_10004346 | Ga0207671_100043463 | 273 |
| 498 | 3300025918 | Ga0207662_10021286 | Ga0207662_100212862 | 273 |
| 499 | 3300025921 | Ga0207652_10093598 | Ga0207652_100935982 | 273 |
| 500 | 3300025929 | Ga0207664_10249369 | Ga0207664_102493692 | 273 |
| 501 | 3300025939 | Ga0207665_10031939 | Ga0207665_100319392 | 273 |
| 502 | 3300025941 | Ga0207711_10050225 | Ga0207711_100502252 | 273 |
| 503 | 3300025944 | Ga0207661_10035293 | Ga0207661_100352934 | 273 |
| 504 | 3300025945 | Ga0207679_10320871 | Ga0207679_103208711 | 273 |
| 505 | 3300026116 | Ga0207674_10004347 | Ga0207674_100043473 | 273 |
| 506 | 3300026142 | Ga0207698_10084201 | Ga0207698_100842012 | 273 |
| 507 | 3300031238 | Ga0265332_10002813 | Ga0265332_100028135 | 273 |
| 508 | 3300031456 | Ga0307513_10011059 | Ga0307513_100110599 | 273 |
| 509 | 3300031507 | Ga0307509_10014751 | Ga0307509_100147519 | 273 |
| 510 | 3300031838 | Ga0307518_10064698 | Ga0307518_100646982 | 273 |
| 511 | 3300032004 | Ga0307414_10003179 | Ga0307414_100031795 | 273 |
| 512 | 3300035120 | Ga0373957_0062710 | Ga0373957_0062710_419_1279 | 273 |
| 513 | 3300035725 | Ga0373947_0110565 | Ga0373947_0110565_660_1553 | 273 |
| 514 | 3300037466 | Ga0395898_0010491 | Ga0395898_0010491_3500_4402 | 273 |
| 515 | 3300037853 | Ga0436364_0380175 | Ga0436364_0380175_3521_4363 | 273 |
| 516 | 3300038443 | Ga0395901_0125450 | Ga0395901_0125450_140_1045 | 273 |
| 517 | 3300039437 | Ga0436365_0837397 | Ga0436365_0837397_3431_4294 | 273 |
| 518 | 3300039437 | Ga0436365_1283794 | Ga0436365_1283794_2409_3251 | 273 |
| 519 | 3300039450 | Ga0436363_0853496 | Ga0436363_0853496_615_1457 | 273 |
| 520 | 3300039453 | Ga0436362_1175501 | Ga0436362_1175501_155_1018 | 273 |
| 521 | 3300041405 | Ga0439438_000018 | Ga0439438_000018_27336_28193 | 273 |
| 522 | 3300041999 | Ga0439433_0028063 | Ga0439433_0028063_345_1262 | 273 |
| 523 | 3300042006 | Ga0439432_011248 | Ga0439432_011248_1332_2189 | 273 |
| 524 | 3300042014 | Ga0439457_000120 | Ga0439457_000120_10353_11270 | 273 |
| 525 | 3300042014 | Ga0439457_025458 | Ga0439457_025458_19_909 | 273 |
| 526 | 3300042131 | Ga0450894_000440 | Ga0450894_000440_5523_6413 | 273 |
| 527 | 3300042145 | Ga0450906_000137 | Ga0450906_000137_791_1681 | 273 |
| 528 | 3300044656 | Ga0466969_0024240 | Ga0466969_0024240_1759_2661 | 273 |
| 529 | 3300044658 | Ga0466972_0001073 | Ga0466972_0001073_1745_2647 | 273 |
| 530 | 3300044693 | Ga0466961_0036482 | Ga0466961_0036482_784_1686 | 273 |
| 531 | 3300044901 | Ga0466960_0063861 | Ga0466960_0063861_724_1632 | 273 |
| 532 | 3300045051 | Ga0451576_0077319 | Ga0451576_0077319_15_875 | 273 |
| 533 | 3300045976 | Ga0466967_0513494 | Ga0466967_0513494_227_1087 | 273 |
| 534 | 3300046471 | Ga0495650_0000102 | Ga0495650_0000102_61066_61920 | 273 |
| 535 | 3300046500 | Ga0495596_0008274 | Ga0495596_0008274_3761_4627 | 273 |
| 536 | 3300046506 | Ga0495583_0006587 | Ga0495583_0006587_4774_5622 | 273 |
| 537 | 3300046516 | Ga0495628_0206277 | Ga0495628_0206277_87_989 | 273 |
| 538 | 3300046542 | Ga0495597_0017251 | Ga0495597_0017251_1022_1924 | 273 |
| 539 | 3300046616 | Ga0495668_0027794 | Ga0495668_0027794_498_1400 | 273 |
| 540 | 3300046689 | Ga0495613_0171300 | Ga0495613_0171300_576_1436 | 273 |
| 541 | 3300046689 | Ga0495613_0230963 | Ga0495613_0230963_303_1205 | 273 |
| 542 | 3300046810 | Ga0495660_0000006 | Ga0495660_0000006_454305_455159 | 273 |
| 543 | 3300046810 | Ga0495660_0080977 | Ga0495660_0080977_241_1143 | 273 |
| 544 | 3300047443 | Ga0495687_002821 | Ga0495687_002821_6761_7663 | 273 |
| 545 | 3300048088 | Ga0495602_0017711 | Ga0495602_0017711_3502_4356 | 273 |
| 546 | 3300048907 | Ga0496104_0001453 | Ga0496104_0001453_10873_11727 | 273 |
| 547 | 3300048907 | Ga0496104_0138784 | Ga0496104_0138784_1048_1941 | 273 |
| 548 | 3300048908 | Ga0496105_0404251 | Ga0496105_0404251_26_919 | 273 |
| 549 | 3300048911 | Ga0496108_0033009 | Ga0496108_0033009_922_1815 | 273 |
| 550 | 3300048912 | Ga0496109_0284820 | Ga0496109_0284820_485_1378 | 273 |
| 551 | 3300048915 | Ga0496112_0112870 | Ga0496112_0112870_1551_2444 | 273 |
| 552 | 3300048916 | Ga0496113_0009247 | Ga0496113_0009247_4088_4981 | 273 |
| 553 | 3300048919 | Ga0496116_0000020 | Ga0496116_0000020_470268_471122 | 273 |
| 554 | 3300048920 | Ga0496117_0006493 | Ga0496117_0006493_2386_3240 | 273 |
| 555 | 3300048920 | Ga0496117_0067039 | Ga0496117_0067039_1278_2189 | 273 |
| 556 | 3300048921 | Ga0496118_0002115 | Ga0496118_0002115_11165_12076 | 273 |
| 557 | 3300048921 | Ga0496118_0003691 | Ga0496118_0003691_604_1458 | 273 |
| 558 | 3300048923 | Ga0496120_0014276 | Ga0496120_0014276_1182_2036 | 273 |
| 559 | 3300048924 | Ga0496121_0001569 | Ga0496121_0001569_22376_23260 | 273 |
| 560 | 3300048925 | Ga0496122_0000010 | Ga0496122_0000010_170749_171603 | 273 |
| 561 | 3300048925 | Ga0496122_0068821 | Ga0496122_0068821_58_885 | 273 |
| 562 | 3300048926 | Ga0496123_0000061 | Ga0496123_0000061_45075_45929 | 273 |
| 563 | 3300048927 | Ga0496124_0000084 | Ga0496124_0000084_32760_33614 | 273 |
| 564 | 3300048927 | Ga0496124_0001315 | Ga0496124_0001315_24387_25271 | 273 |
| 565 | 3300048928 | Ga0496125_0000071 | Ga0496125_0000071_45624_46478 | 273 |
| 566 | 3300048929 | Ga0496126_0002615 | Ga0496126_0002615_13643_14497 | 273 |
| 567 | 3300049459 | Ga0495678_048847 | Ga0495678_048847_391_1293 | 273 |
| 568 | 3300049569 | Ga0501032_0000476 | Ga0501032_0000476_9837_10682 | 273 |
| 569 | 3300049572 | Ga0501036_0006947 | Ga0501036_0006947_6224_7069 | 273 |
| 570 | 3300049579 | Ga0501043_0146688 | Ga0501043_0146688_914_1759 | 273 |
| 571 | 3300049580 | Ga0501046_0083449 | Ga0501046_0083449_237_1082 | 273 |
| 572 | 3300049580 | Ga0501046_0145754 | Ga0501046_0145754_707_1552 | 273 |
| 573 | 3300049581 | Ga0501047_0079870 | Ga0501047_0079870_1385_2230 | 273 |
| 574 | 3300049582 | Ga0501048_0213867 | Ga0501048_0213867_211_1056 | 273 |
| 575 | 3300049822 | Ga0501035_0000543 | Ga0501035_0000543_16593_17438 | 273 |
| 576 | 3300049823 | Ga0501044_0000127 | Ga0501044_0000127_21729_22574 | 273 |
| 577 | 3300050514 | nmdc:mga08x19_284836_c1 | nmdc:mga08x19_284836_c1_34_897 | 273 |
| 578 | 3300053077 | Ga0495601_0149649 | Ga0495601_0149649_538_1431 | 273 |
| 579 | iso_pu_bacteria | 2585427527 | 2585535305 | 273 |
| 580 | iso_pu_bacteria | 2615840626 | 2616310888 | 273 |
| 581 | iso_pu_bacteria | 2738541279 | 2738732331 | 273 |
| 582 | iso_pu_bacteria | 2738541285 | 2738764896 | 273 |
| 583 | iso_pu_bacteria | 2738543007 | 2739213911 | 273 |
| 584 | iso_pu_bacteria | 2784746763 | 2785339113 | 273 |
| 585 | iso_pu_bacteria | 2867346516 | 2867348327 | 273 |
| 586 | iso_pu_bacteria | 2877676314 | 2877683653 | 273 |
| 587 | iso_pu_bacteria | 2947224130 | 2947224256 | 273 |
| 588 | 3300003320 | rootH2_10144418 | rootH2_101444181 | 274 |
| 589 | 3300005289 | Ga0065704_10097814 | Ga0065704_100978142 | 274 |
| 590 | 3300005295 | Ga0065707_10083832 | Ga0065707_100838326 | 274 |
| 591 | 3300005354 | Ga0070675_100073419 | Ga0070675_1000734192 | 274 |
| 592 | 3300005354 | Ga0070675_100224108 | Ga0070675_1002241082 | 274 |
| 593 | 3300005364 | Ga0070673_100102779 | Ga0070673_1001027791 | 274 |
| 594 | 3300005366 | Ga0070659_100258314 | Ga0070659_1002583142 | 274 |
| 595 | 3300005435 | Ga0070714_100002746 | Ga0070714_1000027466 | 274 |
| 596 | 3300005543 | Ga0070672_100028803 | Ga0070672_1000288034 | 274 |
| 597 | 3300005577 | Ga0068857_100071577 | Ga0068857_1000715774 | 274 |
| 598 | 3300005577 | Ga0068857_100190532 | Ga0068857_1001905322 | 274 |
| 599 | 3300005614 | Ga0068856_100359894 | Ga0068856_1003598943 | 274 |
| 600 | 3300005844 | Ga0068862_100028380 | Ga0068862_1000283804 | 274 |
| 601 | 3300006195 | Ga0075366_10006496 | Ga0075366_100064962 | 274 |
| 602 | 3300006946 | Ga0079104_1002334 | Ga0079104_10023344 | 274 |
| 603 | 3300009011 | Ga0105251_10000136 | Ga0105251_1000013663 | 274 |
| 604 | 3300009011 | Ga0105251_10003397 | Ga0105251_100033978 | 274 |
| 605 | 3300009011 | Ga0105251_10003413 | Ga0105251_100034137 | 274 |
| 606 | 3300009036 | Ga0105244_10132082 | Ga0105244_101320822 | 274 |
| 607 | 3300009036 | Ga0105244_10175036 | Ga0105244_101750361 | 274 |
| 608 | 3300009092 | Ga0105250_10004638 | Ga0105250_100046384 | 274 |
| 609 | 3300009093 | Ga0105240_10000219 | Ga0105240_1000021970 | 274 |
| 610 | 3300009094 | Ga0111539_10004450 | Ga0111539_100044508 | 274 |
| 611 | 3300009101 | Ga0105247_10000147 | Ga0105247_1000014748 | 274 |
| 612 | 3300009147 | Ga0114129_10062463 | Ga0114129_100624632 | 274 |
| 613 | 3300009174 | Ga0105241_10000008 | Ga0105241_1000000870 | 274 |
| 614 | 3300009174 | Ga0105241_10091304 | Ga0105241_100913042 | 274 |
| 615 | 3300009545 | Ga0105237_10000111 | Ga0105237_1000011183 | 274 |
| 616 | 3300009545 | Ga0105237_10001966 | Ga0105237_100019661 | 274 |
| 617 | 3300009545 | Ga0105237_10083766 | Ga0105237_100837662 | 274 |
| 618 | 3300009551 | Ga0105238_10104066 | Ga0105238_101040666 | 274 |
| 619 | 3300009553 | Ga0105249_10004825 | Ga0105249_100048253 | 274 |
| 620 | 3300011119 | Ga0105246_10120365 | Ga0105246_101203652 | 274 |
| 621 | 3300013100 | Ga0157373_10181475 | Ga0157373_101814752 | 274 |
| 622 | 3300013307 | Ga0157372_10025546 | Ga0157372_100255462 | 274 |
| 623 | 3300015688 | Ga0183367_1011 | Ga0183367_101142 | 274 |
| 624 | 3300017792 | Ga0163161_10000002 | Ga0163161_10000002118 | 274 |
| 625 | 3300017792 | Ga0163161_10000012 | Ga0163161_10000012177 | 274 |
| 626 | 3300020082 | Ga0206353_10332444 | Ga0206353_103324443 | 274 |
| 627 | 3300025233 | Ga0209437_100647 | Ga0209437_1006477 | 274 |
| 628 | 3300025315 | Ga0207697_10034961 | Ga0207697_100349612 | 274 |
| 629 | 3300025711 | Ga0207696_1000009 | Ga0207696_1000009254 | 274 |
| 630 | 3300025735 | Ga0207713_1000034 | Ga0207713_100003476 | 274 |
| 631 | 3300025735 | Ga0207713_1000055 | Ga0207713_100005559 | 274 |
| 632 | 3300025735 | Ga0207713_1019768 | Ga0207713_10197683 | 274 |
| 633 | 3300025900 | Ga0207710_10000015 | Ga0207710_10000015270 | 274 |
| 634 | 3300025904 | Ga0207647_10005581 | Ga0207647_100055817 | 274 |
| 635 | 3300025911 | Ga0207654_10000009 | Ga0207654_1000000970 | 274 |
| 636 | 3300025913 | Ga0207695_10000048 | Ga0207695_10000048309 | 274 |
| 637 | 3300025914 | Ga0207671_10000087 | Ga0207671_10000087119 | 274 |
| 638 | 3300025914 | Ga0207671_10003849 | Ga0207671_100038497 | 274 |
| 639 | 3300025929 | Ga0207664_10215919 | Ga0207664_102159192 | 274 |
| 640 | 3300025961 | Ga0207712_10009028 | Ga0207712_100090284 | 274 |
| 641 | 3300026078 | Ga0207702_10345831 | Ga0207702_103458313 | 274 |
| 642 | 3300026116 | Ga0207674_10079829 | Ga0207674_100798294 | 274 |
| 643 | 3300026116 | Ga0207674_10190262 | Ga0207674_101902623 | 274 |
| 644 | 3300027111 | Ga0209281_1000054 | Ga0209281_100005453 | 274 |
| 645 | 3300027111 | Ga0209281_1012901 | Ga0209281_10129012 | 274 |
| 646 | 3300027907 | Ga0207428_10072003 | Ga0207428_100720032 | 274 |
| 647 | 3300028380 | Ga0268265_10008416 | Ga0268265_100084164 | 274 |
| 648 | 3300028786 | Ga0307517_10018496 | Ga0307517_100184967 | 274 |
| 649 | 3300028794 | Ga0307515_10099669 | Ga0307515_100996693 | 274 |
| 650 | 3300030521 | Ga0307511_10119094 | Ga0307511_101190942 | 274 |
| 651 | 3300031456 | Ga0307513_10251801 | Ga0307513_102518012 | 274 |
| 652 | 3300031616 | Ga0307508_10014270 | Ga0307508_100142705 | 274 |
| 653 | 3300031649 | Ga0307514_10005174 | Ga0307514_1000517410 | 274 |
| 654 | 3300031649 | Ga0307514_10101389 | Ga0307514_101013892 | 274 |
| 655 | 3300031730 | Ga0307516_10023170 | Ga0307516_100231703 | 274 |
| 656 | 3300031730 | Ga0307516_10338217 | Ga0307516_103382171 | 274 |
| 657 | 3300031730 | Ga0307516_10343482 | Ga0307516_103434822 | 274 |
| 658 | 3300031838 | Ga0307518_10230503 | Ga0307518_102305032 | 274 |
| 659 | 3300032002 | Ga0307416_100055870 | Ga0307416_1000558702 | 274 |
| 660 | 3300033179 | Ga0307507_10000007 | Ga0307507_1000000719 | 274 |
| 661 | 3300041443 | Ga0451789_0906811 | Ga0451789_0906811_985_1860 | 274 |
| 662 | 3300042006 | Ga0439432_001254 | Ga0439432_001254_6643_7506 | 274 |
| 663 | 3300042007 | Ga0439449_0000378 | Ga0439449_0000378_5745_6653 | 274 |
| 664 | 3300042007 | Ga0439449_0037996 | Ga0439449_0037996_50_943 | 274 |
| 665 | 3300042157 | Ga0439458_0003854 | Ga0439458_0003854_1434_2336 | 274 |
| 666 | 3300042157 | Ga0439458_0006900 | Ga0439458_0006900_155_1063 | 274 |
| 667 | 3300044656 | Ga0466969_0082058 | Ga0466969_0082058_471_1328 | 274 |
| 668 | 3300044684 | Ga0466966_0009910 | Ga0466966_0009910_2741_3589 | 274 |
| 669 | 3300044684 | Ga0466966_0068979 | Ga0466966_0068979_1135_1992 | 274 |
| 670 | 3300044684 | Ga0466966_0239123 | Ga0466966_0239123_186_1034 | 274 |
| 671 | 3300044693 | Ga0466961_0012100 | Ga0466961_0012100_3802_4659 | 274 |
| 672 | 3300044693 | Ga0466961_0039268 | Ga0466961_0039268_1342_2196 | 274 |
| 673 | 3300044693 | Ga0466961_0126714 | Ga0466961_0126714_593_1450 | 274 |
| 674 | 3300044693 | Ga0466961_0172784 | Ga0466961_0172784_473_1321 | 274 |
| 675 | 3300044694 | Ga0466963_0041252 | Ga0466963_0041252_506_1354 | 274 |
| 676 | 3300044719 | Ga0466971_0006564 | Ga0466971_0006564_2789_3637 | 274 |
| 677 | 3300044719 | Ga0466971_0022808 | Ga0466971_0022808_1781_2638 | 274 |
| 678 | 3300044719 | Ga0466971_0023476 | Ga0466971_0023476_1296_2153 | 274 |
| 679 | 3300044765 | Ga0466970_0009728 | Ga0466970_0009728_2414_3271 | 274 |
| 680 | 3300044765 | Ga0466970_0114295 | Ga0466970_0114295_602_1450 | 274 |
| 681 | 3300045049 | Ga0466959_0012601 | Ga0466959_0012601_2729_3577 | 274 |
| 682 | 3300045049 | Ga0466959_0019241 | Ga0466959_0019241_3157_4014 | 274 |
| 683 | 3300045836 | Ga0466958_0020885 | Ga0466958_0020885_119_976 | 274 |
| 684 | 3300045836 | Ga0466958_0123481 | Ga0466958_0123481_374_1222 | 274 |
| 685 | 3300046452 | Ga0495617_007014 | Ga0495617_007014_660_1541 | 274 |
| 686 | 3300046453 | Ga0495627_000042 | Ga0495627_000042_78443_79282 | 274 |
| 687 | 3300046457 | Ga0495590_0072797 | Ga0495590_0072797_261_1142 | 274 |
| 688 | 3300046458 | Ga0495591_003374 | Ga0495591_003374_6626_7507 | 274 |
| 689 | 3300046458 | Ga0495591_016094 | Ga0495591_016094_976_1821 | 274 |
| 690 | 3300046459 | Ga0495629_0277115 | Ga0495629_0277115_85_1002 | 274 |
| 691 | 3300046460 | Ga0495638_0098673 | Ga0495638_0098673_157_1044 | 274 |
| 692 | 3300046462 | Ga0495651_0043595 | Ga0495651_0043595_2284_3177 | 274 |
| 693 | 3300046471 | Ga0495650_0001196 | Ga0495650_0001196_12494_13375 | 274 |
| 694 | 3300046474 | Ga0495605_0000222 | Ga0495605_0000222_38259_39104 | 274 |
| 695 | 3300046474 | Ga0495605_0016761 | Ga0495605_0016761_2499_3380 | 274 |
| 696 | 3300046491 | Ga0495584_0009858 | Ga0495584_0009858_2917_3798 | 274 |
| 697 | 3300046492 | Ga0495585_0054773 | Ga0495585_0054773_29_874 | 274 |
| 698 | 3300046499 | Ga0495594_0049738 | Ga0495594_0049738_1321_2208 | 274 |
| 699 | 3300046501 | Ga0495607_0000403 | Ga0495607_0000403_21403_22269 | 274 |
| 700 | 3300046501 | Ga0495607_0012756 | Ga0495607_0012756_1462_2343 | 274 |
| 701 | 3300046501 | Ga0495607_0023327 | Ga0495607_0023327_210_1097 | 274 |
| 702 | 3300046501 | Ga0495607_0049901 | Ga0495607_0049901_360_1205 | 274 |
| 703 | 3300046506 | Ga0495583_0001428 | Ga0495583_0001428_7390_8271 | 274 |
| 704 | 3300046506 | Ga0495583_0002044 | Ga0495583_0002044_11512_12390 | 274 |
| 705 | 3300046507 | Ga0495606_0000094 | Ga0495606_0000094_81481_82374 | 274 |
| 706 | 3300046507 | Ga0495606_0000674 | Ga0495606_0000674_30832_31713 | 274 |
| 707 | 3300046507 | Ga0495606_0000792 | Ga0495606_0000792_35199_36041 | 274 |
| 708 | 3300046507 | Ga0495606_0037720 | Ga0495606_0037720_349_1230 | 274 |
| 709 | 3300046512 | Ga0495610_0004252 | Ga0495610_0004252_5343_6203 | 274 |
| 710 | 3300046513 | Ga0495616_0022501 | Ga0495616_0022501_900_1781 | 274 |
| 711 | 3300046513 | Ga0495616_0135835 | Ga0495616_0135835_59_901 | 274 |
| 712 | 3300046515 | Ga0495620_0001367 | Ga0495620_0001367_11123_12004 | 274 |
| 713 | 3300046515 | Ga0495620_0001634 | Ga0495620_0001634_5523_6383 | 274 |
| 714 | 3300046518 | Ga0495631_0009073 | Ga0495631_0009073_1445_2290 | 274 |
| 715 | 3300046519 | Ga0495632_0001504 | Ga0495632_0001504_11535_12395 | 274 |
| 716 | 3300046519 | Ga0495632_0028475 | Ga0495632_0028475_1397_2278 | 274 |
| 717 | 3300046519 | Ga0495632_0032770 | Ga0495632_0032770_745_1626 | 274 |
| 718 | 3300046519 | Ga0495632_0064880 | Ga0495632_0064880_28_873 | 274 |
| 719 | 3300046520 | Ga0495637_0000015 | Ga0495637_0000015_135246_136127 | 274 |
| 720 | 3300046520 | Ga0495637_0000077 | Ga0495637_0000077_28029_28910 | 274 |
| 721 | 3300046520 | Ga0495637_0002223 | Ga0495637_0002223_4063_4944 | 274 |
| 722 | 3300046522 | Ga0495643_0009173 | Ga0495643_0009173_960_1847 | 274 |
| 723 | 3300046522 | Ga0495643_0013688 | Ga0495643_0013688_830_1711 | 274 |
| 724 | 3300046523 | Ga0495644_0000719 | Ga0495644_0000719_6824_7705 | 274 |
| 725 | 3300046524 | Ga0495648_0001437 | Ga0495648_0001437_17150_17995 | 274 |
| 726 | 3300046524 | Ga0495648_0010818 | Ga0495648_0010818_979_1860 | 274 |
| 727 | 3300046530 | Ga0495654_0001350 | Ga0495654_0001350_11985_12848 | 274 |
| 728 | 3300046530 | Ga0495654_0019919 | Ga0495654_0019919_1597_2460 | 274 |
| 729 | 3300046538 | Ga0495609_0000148 | Ga0495609_0000148_55297_56178 | 274 |
| 730 | 3300046538 | Ga0495609_0000162 | Ga0495609_0000162_48436_49311 | 274 |
| 731 | 3300046538 | Ga0495609_0004988 | Ga0495609_0004988_672_1529 | 274 |
| 732 | 3300046558 | Ga0495633_0139080 | Ga0495633_0139080_166_1047 | 274 |
| 733 | 3300046648 | Ga0495611_0001027 | Ga0495611_0001027_3652_4533 | 274 |
| 734 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_318829_319710 | 274 |
| 735 | 3300046665 | Ga0495661_0000006 | Ga0495661_0000006_95102_95983 | 274 |
| 736 | 3300046665 | Ga0495661_0032826 | Ga0495661_0032826_792_1637 | 274 |
| 737 | 3300046683 | Ga0495658_0044193 | Ga0495658_0044193_185_1072 | 274 |
| 738 | 3300046691 | Ga0495670_0007579 | Ga0495670_0007579_3245_4132 | 274 |
| 739 | 3300046691 | Ga0495670_0115241 | Ga0495670_0115241_113_994 | 274 |
| 740 | 3300046692 | Ga0495671_0008265 | Ga0495671_0008265_340_1221 | 274 |
| 741 | 3300046692 | Ga0495671_0037117 | Ga0495671_0037117_784_1665 | 274 |
| 742 | 3300046694 | Ga0495649_0172631 | Ga0495649_0172631_41_922 | 274 |
| 743 | 3300046794 | Ga0495589_0000005 | Ga0495589_0000005_322253_323116 | 274 |
| 744 | 3300046794 | Ga0495589_0000646 | Ga0495589_0000646_14417_15277 | 274 |
| 745 | 3300046810 | Ga0495660_0009143 | Ga0495660_0009143_3585_4466 | 274 |
| 746 | 3300046810 | Ga0495660_0035217 | Ga0495660_0035217_746_1627 | 274 |
| 747 | 3300047315 | Ga0495581_0156784 | Ga0495581_0156784_284_1171 | 274 |
| 748 | 3300047320 | Ga0495672_0049161 | Ga0495672_0049161_936_1781 | 274 |
| 749 | 3300047321 | Ga0495676_0000004 | Ga0495676_0000004_205340_206221 | 274 |
| 750 | 3300047323 | Ga0495683_0015137 | Ga0495683_0015137_2592_3473 | 274 |
| 751 | 3300047323 | Ga0495683_0103972 | Ga0495683_0103972_223_1110 | 274 |
| 752 | 3300047443 | Ga0495687_010294 | Ga0495687_010294_1692_2579 | 274 |
| 753 | 3300047446 | Ga0495679_000308 | Ga0495679_000308_12502_13383 | 274 |
| 754 | 3300047446 | Ga0495679_000774 | Ga0495679_000774_7743_8603 | 274 |
| 755 | 3300047447 | Ga0495685_000931 | Ga0495685_000931_5887_6774 | 274 |
| 756 | 3300047469 | Ga0495673_0000980 | Ga0495673_0000980_18301_19182 | 274 |
| 757 | 3300047469 | Ga0495673_0002082 | Ga0495673_0002082_10535_11416 | 274 |
| 758 | 3300047469 | Ga0495673_0006802 | Ga0495673_0006802_2697_3578 | 274 |
| 759 | 3300047469 | Ga0495673_0018856 | Ga0495673_0018856_862_1743 | 274 |
| 760 | 3300047469 | Ga0495673_0032136 | Ga0495673_0032136_502_1377 | 274 |
| 761 | 3300047470 | Ga0495681_0002551 | Ga0495681_0002551_6891_7751 | 274 |
| 762 | 3300047470 | Ga0495681_0003241 | Ga0495681_0003241_1532_2413 | 274 |
| 763 | 3300047470 | Ga0495681_0004262 | Ga0495681_0004262_8034_8894 | 274 |
| 764 | 3300047470 | Ga0495681_0034246 | Ga0495681_0034246_309_1196 | 274 |
| 765 | 3300047470 | Ga0495681_0057977 | Ga0495681_0057977_869_1711 | 274 |
| 766 | 3300047472 | Ga0495686_0000018 | Ga0495686_0000018_395484_396368 | 274 |
| 767 | 3300047472 | Ga0495686_0000933 | Ga0495686_0000933_2919_3794 | 274 |
| 768 | 3300047472 | Ga0495686_0061992 | Ga0495686_0061992_407_1249 | 274 |
| 769 | 3300048091 | Ga0495626_0000012 | Ga0495626_0000012_12069_12950 | 274 |
| 770 | 3300048905 | Ga0496102_0060411 | Ga0496102_0060411_255_1136 | 274 |
| 771 | 3300048907 | Ga0496104_0000071 | Ga0496104_0000071_51993_52841 | 274 |
| 772 | 3300048911 | Ga0496108_0179735 | Ga0496108_0179735_487_1344 | 274 |
| 773 | 3300048912 | Ga0496109_0174896 | Ga0496109_0174896_607_1464 | 274 |
| 774 | 3300048917 | Ga0496114_0093548 | Ga0496114_0093548_1417_2274 | 274 |
| 775 | 3300048919 | Ga0496116_0000015 | Ga0496116_0000015_273902_274741 | 274 |
| 776 | 3300048919 | Ga0496116_0033427 | Ga0496116_0033427_2587_3468 | 274 |
| 777 | 3300048920 | Ga0496117_0010790 | Ga0496117_0010790_1188_2027 | 274 |
| 778 | 3300048921 | Ga0496118_0032947 | Ga0496118_0032947_846_1727 | 274 |
| 779 | 3300048922 | Ga0496119_0000481 | Ga0496119_0000481_49860_50726 | 274 |
| 780 | 3300048923 | Ga0496120_0002963 | Ga0496120_0002963_11410_12276 | 274 |
| 781 | 3300048924 | Ga0496121_0001684 | Ga0496121_0001684_3880_4746 | 274 |
| 782 | 3300048924 | Ga0496121_0013603 | Ga0496121_0013603_5206_6087 | 274 |
| 783 | 3300048925 | Ga0496122_0014537 | Ga0496122_0014537_2459_3325 | 274 |
| 784 | 3300048925 | Ga0496122_0020992 | Ga0496122_0020992_3078_3959 | 274 |
| 785 | 3300048926 | Ga0496123_0013325 | Ga0496123_0013325_3261_4142 | 274 |
| 786 | 3300048926 | Ga0496123_0047467 | Ga0496123_0047467_138_1004 | 274 |
| 787 | 3300048927 | Ga0496124_0000031 | Ga0496124_0000031_15300_16145 | 274 |
| 788 | 3300048927 | Ga0496124_0000272 | Ga0496124_0000272_91644_92525 | 274 |
| 789 | 3300048929 | Ga0496126_0048937 | Ga0496126_0048937_1005_1871 | 274 |
| 790 | 3300049459 | Ga0495678_000052 | Ga0495678_000052_155474_156355 | 274 |
| 791 | 3300049575 | Ga0501039_0341311 | Ga0501039_0341311_32_910 | 274 |
| 792 | 3300049586 | Ga0501070_0283232 | Ga0501070_0283232_49_957 | 274 |
| 793 | 3300049824 | Ga0501045_0281899 | Ga0501045_0281899_300_1178 | 274 |
| 794 | 3300050493 | nmdc:mga0k408_1636_c1 | nmdc:mga0k408_1636_c1_10615_11448 | 274 |
| 795 | 3300050507 | nmdc:mga05p37_253397_c1 | nmdc:mga05p37_253397_c1_1023_1901 | 274 |
| 796 | 3300050511 | nmdc:mga08y16_93223_c1 | nmdc:mga08y16_93223_c1_1232_2056 | 274 |
| 797 | 3300053077 | Ga0495601_0012505 | Ga0495601_0012505_365_1258 | 274 |
| 798 | 3300053078 | Ga0495612_0039681 | Ga0495612_0039681_588_1481 | 274 |
| 799 | 3300053086 | Ga0500578_0192746 | Ga0500578_0192746_110_997 | 274 |
| 800 | 3300053094 | Ga0500566_0009242 | Ga0500566_0009242_2668_3519 | 274 |
| 801 | 3300053094 | Ga0500566_0033762 | Ga0500566_0033762_1959_2831 | 274 |
| 802 | 3300053095 | Ga0500640_000065 | Ga0500640_000065_16356_17207 | 274 |
| 803 | 3300053101 | Ga0500553_026081 | Ga0500553_026081_298_1215 | 274 |
| 804 | 3300053102 | Ga0500554_000067 | Ga0500554_000067_3586_4437 | 274 |
| 805 | 3300053109 | Ga0500569_006115 | Ga0500569_006115_128_1015 | 274 |
| 806 | 3300053111 | Ga0500572_002384 | Ga0500572_002384_454_1305 | 274 |
| 807 | 3300053119 | Ga0500595_000110 | Ga0500595_000110_30312_31163 | 274 |
| 808 | 3300053120 | Ga0500597_064159 | Ga0500597_064159_620_1471 | 274 |
| 809 | 3300053123 | Ga0500614_001859 | Ga0500614_001859_2392_3309 | 274 |
| 810 | 3300053134 | Ga0500658_0031822 | Ga0500658_0031822_263_1150 | 274 |
| 811 | 3300053136 | Ga0500559_0014801 | Ga0500559_0014801_206_1057 | 274 |
| 812 | 3300053137 | Ga0500561_0000979 | Ga0500561_0000979_128_1015 | 274 |
| 813 | 3300053143 | Ga0500579_099605 | Ga0500579_099605_27_914 | 274 |
| 814 | 3300053149 | Ga0500600_0006627 | Ga0500600_0006627_726_1613 | 274 |
| 815 | 3300053153 | Ga0500616_0005770 | Ga0500616_0005770_6416_7303 | 274 |
| 816 | 3300053160 | Ga0500633_0005241 | Ga0500633_0005241_1068_1955 | 274 |
| 817 | 3300053161 | Ga0500634_0011919 | Ga0500634_0011919_2086_2973 | 274 |
| 818 | 3300053178 | Ga0500637_0229244 | Ga0500637_0229244_15_875 | 274 |
| 819 | 3300054114 | Ga0501084_0123997 | Ga0501084_0123997_209_1087 | 274 |
| 820 | 3300060353 | Ga0501082_0031154 | Ga0501082_0031154_2822_3700 | 274 |
| 821 | iso_pu_bacteria | 2600255283 | 2601624945 | 274 |
| 822 | iso_pu_bacteria | 2643221714 | 2644627347 | 274 |
| 823 | iso_pu_bacteria | 2738541271 | 2738688468 | 274 |
| 824 | iso_pu_bacteria | 2738543016 | 2739264200 | 274 |
| 825 | iso_pu_bacteria | 2784746763 | 2785346320 | 274 |
| 826 | iso_pu_bacteria | 2856741275 | 2856745028 | 274 |
| 827 | iso_pu_bacteria | 2862705112 | 2862707783 | 274 |
| 828 | iso_pu_bacteria | 2891554331 | 2891562694 | 274 |
| 829 | iso_pu_bacteria | 2891562705 | 2891569223 | 274 |
| 830 | iso_pu_bacteria | 2945961074 | 2945964594 | 274 |
| 831 | iso_pu_bacteria | 2990044586 | 2990049096 | 274 |
| 832 | iso_pu_bacteria | 8008485437 | 8008489897 | 274 |
| 833 | iso_pu_bacteria | 8025524527 | 8025529371 | 274 |
| 834 | iso_pu_bacteria | 8048406513 | 8048410551 | 274 |
| 835 | 2162886012 | MBSR1b_contig_8798837 | MBSR1b_0842.00007760 | 275 |
| 836 | 3300003322 | rootL2_10021303 | rootL2_1002130310 | 275 |
| 837 | 3300003322 | rootL2_10043140 | rootL2_100431403 | 275 |
| 838 | 3300005327 | Ga0070658_10059294 | Ga0070658_100592942 | 275 |
| 839 | 3300005445 | Ga0070708_100065585 | Ga0070708_1000655853 | 275 |
| 840 | 3300005843 | Ga0068860_100280636 | Ga0068860_1002806362 | 275 |
| 841 | 3300005937 | Ga0081455_10166816 | Ga0081455_101668162 | 275 |
| 842 | 3300006358 | Ga0068871_100094214 | Ga0068871_1000942142 | 275 |
| 843 | 3300007265 | Ga0099794_10056151 | Ga0099794_100561512 | 275 |
| 844 | 3300013308 | Ga0157375_10202376 | Ga0157375_102023763 | 275 |
| 845 | 3300014968 | Ga0157379_10014193 | Ga0157379_100141932 | 275 |
| 846 | 3300014969 | Ga0157376_10434453 | Ga0157376_104344532 | 275 |
| 847 | 3300025910 | Ga0207684_10402667 | Ga0207684_104026671 | 275 |
| 848 | 3300025938 | Ga0207704_10167954 | Ga0207704_101679542 | 275 |
| 849 | 3300031616 | Ga0307508_10000100 | Ga0307508_1000010017 | 275 |
| 850 | 3300042876 | Ga0451577_0142015 | Ga0451577_0142015_825_1661 | 275 |
| 851 | 3300044712 | Ga0453684_0000287 | Ga0453684_0000287_119188_120024 | 275 |
| 852 | 3300047319 | Ga0495674_0126406 | Ga0495674_0126406_1217_2089 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dnm-assembly1.cif.gz_A | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 | 0.9739 | 1 | 274 |
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.9684 | 1 | 274 |
| 4dnm-assembly1.cif.gz_A | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 | 0.967 | 1 | 274 |
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.9615 | 1 | 274 |
| 6uvz-assembly3.cif.gz_C | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8523 | 2 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4do7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9684 | 1 | 274 | 3.20.20.140 |
| 4do7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9615 | 1 | 274 | 3.20.20.140 |
| 2ffiA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7996 | 2 | 275 | 3.20.20.140 |
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7974 | 1 | 272 | 3.20.20.140 |
| 4i6kA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7904 | 2 | 273 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5U2V1-F1-model_v4 | Amidohydrolase family protein | 0.9971 | 1 | 275 |
GO:0016787
|
| AF-A0A329QWR8-F1-model_v4 | Amidohydrolase | 0.9937 | 1 | 273 |
GO:0016787
|
| AF-A0A3C0ITN5-F1-model_v4 | Amidohydrolase | 0.9935 | 2 | 78 |
GO:0016787
|
| AF-A0A7Y5U2V1-F1-model_v4 | Amidohydrolase family protein | 0.9935 | 1 | 275 |
GO:0016787
|
| AF-X1HHN0-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.993 | 171 | 275 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar