F483509

General Info

Members Datasets Scaffolds Average Seq Length
852 467 727 286

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10000007|Ga0307507_1000000719
Length 326
Sequence MHGLGDSVRFIGVAAVNLHQGFEPLTIRAADQTPTGTVQRVTRIDAHHHLWDLSQTEQAWLQGPAMAPIHRTFSVADLAPEAAAAGIDRSVLVQVLPDVGETRGFLALAAESDLVAGVVGWADLTGADFADMLAGLRAGPGGELLLGIRHLVQGEADPRWLCRPDVLRALGVLADAGLRYDLLTLPHQLPAAIEAVRTLPQLTFVLDHLSKPPIASGELEPWATSVRELAAEPNVYCKLSGMVTEADYQSWTVESLRPYAETVLDSFGPERLMFGSDWPVCLLAASYAEVTDAAEQLVSELSKDEQAEVFGGTAARAYRLAVPTTD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
9 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
10 2534681786 Brucella suis 92/29 Isolate Unclassified
11 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
12 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
13 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
14 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
15 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
16 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
17 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
18 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
19 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
20 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
21 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
22 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
23 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
24 2643221714 Streptomyces sp. Root264 Isolate Unclassified
25 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
26 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
27 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
28 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
29 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
30 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
31 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
32 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
33 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
34 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
35 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
36 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
37 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
38 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
39 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
40 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
41 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
42 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
43 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
44 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
45 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
46 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
47 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
48 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
49 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
50 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
51 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
52 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
53 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
54 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
55 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
56 2854911287 Brucella lupini LUP21 Isolate Unclassified
57 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
58 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
59 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
60 2867475112 Streptomyces sp. TM32 Isolate Unclassified
61 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
62 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
63 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
64 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
65 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
66 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
67 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
68 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
69 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
70 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
71 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
72 2891562705 Microbispora tritici MT50 Isolate Unclassified
73 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
74 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
75 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
76 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
77 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
78 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
79 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
80 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
81 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
82 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
83 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
84 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
85 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
86 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
87 2919150387 Rahnella aceris 1817 Isolate Unclassified
88 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
89 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
90 2927143783 Rahnella sp. 2050 Isolate Unclassified
91 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
92 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
93 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
94 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
95 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
96 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
97 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
98 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
99 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
100 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
101 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
102 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
103 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
104 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
105 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
106 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
107 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
108 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
109 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
110 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
111 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
112 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
113 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
114 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
115 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
118 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
119 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
120 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
121 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
122 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
123 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
125 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
126 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
127 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
128 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
129 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
130 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
131 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
132 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
133 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
134 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
135 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
136 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
137 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
138 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
139 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
140 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
141 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
142 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
143 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
144 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
145 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
146 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
150 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
151 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
152 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
153 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
154 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
155 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
156 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
159 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
160 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
161 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
166 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
167 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
168 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
169 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
170 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
171 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
176 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
180 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
181 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
182 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
186 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
187 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
188 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
189 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
190 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
191 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
192 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
193 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
194 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
195 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
196 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
197 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
198 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
200 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
201 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
202 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
210 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
212 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
213 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
217 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
218 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
254 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
259 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
260 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
261 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
262 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
263 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
264 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
267 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
268 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
269 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
270 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
271 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
272 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
273 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
274 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
275 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
276 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
277 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
295 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
296 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
299 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
300 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
301 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
302 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
303 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
304 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
305 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
306 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
307 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
308 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
309 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
310 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
311 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
312 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
313 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
314 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
315 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
316 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
317 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
320 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
330 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
331 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
332 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
343 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
344 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
347 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
351 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
355 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
356 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
370 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
371 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
372 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
376 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
377 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
378 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
379 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
386 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
390 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
393 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
394 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
395 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
396 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
397 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
398 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
399 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
400 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
401 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
402 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
403 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
404 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
405 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
406 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
407 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
408 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
409 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
420 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
421 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
424 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
425 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
426 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
427 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
428 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
429 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
430 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
431 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
432 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
433 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
436 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
437 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
438 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
439 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
440 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
441 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
442 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
443 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
444 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
445 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
446 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
447 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
448 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
449 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
450 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
451 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
452 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
455 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
456 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
457 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
458 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
459 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 640753048 Serratia proteamaculans 568 Isolate Endosphere
462 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
463 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
464 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
465 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
466 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
467 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.98
Metatranscriptomes 0.23
Isolates 14.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.21
Nodule 1.64
Rhizoplane 3.4
Rhizosphere 63.38
Stem 0
Stem Tuber 0
Unclassified 21.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8798837 2162886012 Unclassified 1100
2 JGI25155J39150_1000192 3300002704 Bacteria 25932
3 JGI25155J39150_1001145 3300002704 Bacteria 2489
4 JGI25156J39149_1000077 3300002705 Bacteria 74919
5 JGI25156J39149_1000098 3300002705 Bacteria 64288
6 JGI25162J39368_1000067 3300002737 Bacteria 129813
7 JGI25154J39366_1000103 3300002738 Bacteria 74908
8 JGI25154J39366_1003016 3300002738 Bacteria 3827
9 JGI25154J39366_1004497 3300002738 Bacteria 2485
10 JGI25157J39369_1000668 3300002741 Bacteria 18866
11 JGI25163J39215_1000114 3300002771 Bacteria 33694
12 JGI25164J39214_1000039 3300002772 Bacteria 129437
13 rootH1_10047640 3300003316 Bacteria 1334
14 rootH1_10047640 3300003323 Bacteria 2215
15 rootH1_10101285 3300003316 Bacteria 1171
16 rootH1_10175001 3300003316 Bacteria 1070
17 rootH2_10144418 3300003320 Bacteria 1356
18 rootH2_10154600 3300003320 Bacteria 1148
19 rootL2_10021303 3300003322 Bacteria 14986
20 rootL2_10043140 3300003322 Bacteria 6029
21 rootL2_10046969 3300003322 Bacteria 1042
22 rootL2_10072560 3300003322 Bacteria 1150
23 rootH1_10007502 3300003323 Bacteria 1855
24 rootH1_10090190 3300003323 Bacteria 1069
25 JGI25160J50197_1012539 3300003354 Bacteria 2936
26 JGI25160J50197_1048070 3300003354 Bacteria 924
27 Ga0006562J51391_1034596 3300003578 Bacteria 2270
28 Ga0055538_1000008 3300003751 Bacteria 398547
29 Ga0055538_1000052 3300003751 Bacteria 129813
30 Ga0055538_1000059 3300003751 Bacteria 112508
31 Ga0055539_1000012 3300003752 Bacteria 398547
32 Ga0055539_1000077 3300003752 Bacteria 129445
33 Ga0055539_1000089 3300003752 Bacteria 112508
34 Ga0055533_1000015 3300003756 Bacteria 398547
35 Ga0055533_1000083 3300003756 Bacteria 129813
36 Ga0055533_1000098 3300003756 Bacteria 112508
37 Ga0055532_1000034 3300003758 Bacteria 210984
38 Ga0055525_1000017 3300003759 Bacteria 398547
39 Ga0055525_1000110 3300003759 Bacteria 129813
40 Ga0055525_1000130 3300003759 Bacteria 112508
41 Ga0055541_1000009 3300003841 Bacteria 398547
42 Ga0055541_1000054 3300003841 Bacteria 129813
43 Ga0055541_1000061 3300003841 Bacteria 112508
44 Ga0058692_1000208 3300003856 Bacteria 35014
45 Ga0058692_1012125 3300003856 Bacteria 2054
46 Ga0058692_1012865 3300003856 Bacteria 1966
47 Ga0065704_10000086 3300005289 Bacteria 27230
48 Ga0065704_10097814 3300005289 Unclassified 2377
49 Ga0065715_10001912 3300005293 Bacteria 7628
50 Ga0065707_10083832 3300005295 Bacteria 8151
51 Ga0070658_10007287 3300005327 Bacteria 8930
52 Ga0070658_10028027 3300005327 Bacteria 4521
53 Ga0070658_10059294 3300005327 Bacteria 3117
54 Ga0070683_100005836 3300005329 Bacteria 10299
55 Ga0070683_100055726 3300005329 Bacteria 3669
56 Ga0070683_100147444 3300005329 Bacteria 2230
57 Ga0070683_100288301 3300005329 Bacteria 1561
58 Ga0070680_100245152 3300005336 Bacteria 1515
59 Ga0070680_100405030 3300005336 Bacteria 1163
60 Ga0070660_100027547 3300005339 Bacteria 4242
61 Ga0070689_100125795 3300005340 Unclassified 2051
62 Ga0070661_100055402 3300005344 Bacteria 2903
63 Ga0070661_100063873 3300005344 Bacteria 2705
64 Ga0070668_100191791 3300005347 Bacteria 1674
65 Ga0070675_100073419 3300005354 Bacteria 2840
66 Ga0070675_100224108 3300005354 Unclassified 1638
67 Ga0070673_100102779 3300005364 Bacteria 2357
68 Ga0070659_100098961 3300005366 Bacteria 2345
69 Ga0070659_100189195 3300005366 Bacteria 1691
70 Ga0070659_100258314 3300005366 Bacteria 1445
71 Ga0070709_10023164 3300005434 Bacteria 3643
72 Ga0070714_100002746 3300005435 Bacteria 12972
73 Ga0070714_100031348 3300005435 Bacteria 4435
74 Ga0070714_100176419 3300005435 Bacteria 1942
75 Ga0070713_100014860 3300005436 Bacteria 5795
76 Ga0070710_10178135 3300005437 Bacteria 1329
77 Ga0070711_100069571 3300005439 Bacteria 2476
78 Ga0070708_100065585 3300005445 Unclassified 3256
79 Ga0070663_100032160 3300005455 Bacteria 3613
80 Ga0070681_10109540 3300005458 Bacteria 2702
81 Ga0070681_10139293 3300005458 Bacteria 2356
82 Ga0070679_100010324 3300005530 Bacteria 8853
83 Ga0070684_100002727 3300005535 Bacteria 13053
84 Ga0070684_100063768 3300005535 Bacteria 3231
85 Ga0070684_100077083 3300005535 Bacteria 2943
86 Ga0070684_100102359 3300005535 Bacteria 2560
87 Ga0070684_100271218 3300005535 Bacteria 1553
88 Ga0068853_100045923 3300005539 Bacteria 3744
89 Ga0070672_100028803 3300005543 Bacteria 4158
90 Ga0070665_100176282 3300005548 Bacteria 2139
91 Ga0070665_100200105 3300005548 Bacteria 1998
92 Ga0070665_100277093 3300005548 Bacteria 1679
93 Ga0068855_100000175 3300005563 Bacteria 82401
94 Ga0068855_100000366 3300005563 Bacteria 55965
95 Ga0068855_100037965 3300005563 Bacteria 5725
96 Ga0068855_100041258 3300005563 Bacteria 5471
97 Ga0068857_100043585 3300005577 Bacteria 3979
98 Ga0068857_100071577 3300005577 Unclassified 3089
99 Ga0068857_100120766 3300005577 Bacteria 2359
100 Ga0068857_100190532 3300005577 Bacteria 1868
101 Ga0068857_100251196 3300005577 Bacteria 1621
102 Ga0068857_100395760 3300005577 Bacteria 1285
103 Ga0068854_100005738 3300005578 Bacteria 7851
104 Ga0068854_100056145 3300005578 Bacteria 2837
105 Ga0068856_100012052 3300005614 Bacteria 8375
106 Ga0068856_100359894 3300005614 Bacteria 1474
107 Ga0068856_100364720 3300005614 Bacteria 1463
108 Ga0070702_100042509 3300005615 Bacteria 2556
109 Ga0068852_100005949 3300005616 Bacteria 8779
110 Ga0068852_100235036 3300005616 Bacteria 1749
111 Ga0068852_100359951 3300005616 Bacteria 1423
112 Ga0068851_10102046 3300005834 Bacteria 1523
113 Ga0068851_10157609 3300005834 Bacteria 1245
114 Ga0068863_100019824 3300005841 Bacteria 6433
115 Ga0068863_100207719 3300005841 Bacteria 1885
116 Ga0068863_100283855 3300005841 Bacteria 1604
117 Ga0068860_100280636 3300005843 Bacteria 1628
118 Ga0068862_100028380 3300005844 Bacteria 4712
119 Ga0081455_10032557 3300005937 Bacteria 4696
120 Ga0081455_10166816 3300005937 Bacteria 1681
121 Ga0075365_10071840 3300006038 Bacteria 2330
122 Ga0075368_10005280 3300006042 Bacteria 4434
123 Ga0070712_100065041 3300006175 Bacteria 2587
124 Ga0075367_10005258 3300006178 Bacteria 6399
125 Ga0075427_10009992 3300006194 Bacteria 1416
126 Ga0075366_10006496 3300006195 Bacteria 6409
127 Ga0075366_10045115 3300006195 Unclassified 2613
128 Ga0068871_100094214 3300006358 Bacteria 2500
129 Ga0075430_100000732 3300006846 Bacteria 25147
130 Ga0079104_1000003 3300006946 Bacteria 468966
131 Ga0079104_1002334 3300006946 Bacteria 10422
132 Ga0079104_1012486 3300006946 Bacteria 2666
133 Ga0099794_10056151 3300007265 Bacteria 1904
134 Ga0105251_10000136 3300009011 Bacteria 74604
135 Ga0105251_10003397 3300009011 Bacteria 11570
136 Ga0105251_10003413 3300009011 Bacteria 11523
137 Ga0105251_10038404 3300009011 Bacteria 2346
138 Ga0105244_10000690 3300009036 Bacteria 29348
139 Ga0105244_10018611 3300009036 Bacteria 3893
140 Ga0105244_10026662 3300009036 Bacteria 3124
141 Ga0105244_10132082 3300009036 Bacteria 1204
142 Ga0105244_10175036 3300009036 Bacteria 1020
143 Ga0105250_10001925 3300009092 Bacteria 10771
144 Ga0105250_10004638 3300009092 Bacteria 6288
145 Ga0105240_10000219 3300009093 Bacteria 115431
146 Ga0105240_10000799 3300009093 Bacteria 56992
147 Ga0105240_10001342 3300009093 Bacteria 42197
148 Ga0105240_10009192 3300009093 Bacteria 14016
149 Ga0105240_10022396 3300009093 Bacteria 8375
150 Ga0105240_10124062 3300009093 Bacteria 3106
151 Ga0111539_10004450 3300009094 Bacteria 18316
152 Ga0111539_10017567 3300009094 Bacteria 8853
153 Ga0105245_10017716 3300009098 Bacteria 6217
154 Ga0105245_10461960 3300009098 Bacteria 1280
155 Ga0105247_10000147 3300009101 Bacteria 69476
156 Ga0114129_10062463 3300009147 Bacteria 5203
157 Ga0105243_10280027 3300009148 Bacteria 1502
158 Ga0105241_10000008 3300009174 Bacteria 334281
159 Ga0105241_10091304 3300009174 Bacteria 2402
160 Ga0105248_10352031 3300009177 Bacteria 1658
161 Ga0105237_10000111 3300009545 Bacteria 114572
162 Ga0105237_10001632 3300009545 Bacteria 29125
163 Ga0105237_10001966 3300009545 Bacteria 26141
164 Ga0105237_10002495 3300009545 Bacteria 22817
165 Ga0105237_10073916 3300009545 Bacteria 3400
166 Ga0105237_10083766 3300009545 Bacteria 3179
167 Ga0105237_10581460 3300009545 Bacteria 1127
168 Ga0105237_10716216 3300009545 Bacteria 1007
169 Ga0105238_10000031 3300009551 Bacteria 179497
170 Ga0105238_10000062 3300009551 Bacteria 126356
171 Ga0105238_10042170 3300009551 Bacteria 4621
172 Ga0105238_10104066 3300009551 Bacteria 2820
173 Ga0105238_10128765 3300009551 Bacteria 2510
174 Ga0105238_10665890 3300009551 Bacteria 1052
175 Ga0105249_10004825 3300009553 Bacteria 11637
176 Ga0105249_10204011 3300009553 Bacteria 1936
177 Ga0105239_10004287 3300010375 Bacteria 17106
178 Ga0105239_10008953 3300010375 Bacteria 11327
179 Ga0105239_10056421 3300010375 Bacteria 4308
180 Ga0105239_10095021 3300010375 Bacteria 3293
181 Ga0105239_10748068 3300010375 Bacteria 1119
182 Ga0105246_10008663 3300011119 Bacteria 6256
183 Ga0105246_10120365 3300011119 Unclassified 1944
184 Ga0157373_10181475 3300013100 Bacteria 1482
185 Ga0157371_10000075 3300013102 Bacteria 162328
186 Ga0157371_10009934 3300013102 Bacteria 7450
187 Ga0157369_10076389 3300013105 Bacteria 3590
188 Ga0157369_10335896 3300013105 Bacteria 1570
189 Ga0157369_10361694 3300013105 Bacteria 1507
190 Ga0157372_10025546 3300013307 Bacteria 6425
191 Ga0157372_10254983 3300013307 Bacteria 2037
192 Ga0157375_10050022 3300013308 Bacteria 4098
193 Ga0157375_10202376 3300013308 Unclassified 2142
194 Ga0157375_10437359 3300013308 Bacteria 1474
195 Ga0157380_10038961 3300014326 Bacteria 3693
196 Ga0182008_10010812 3300014497 Bacteria 4874
197 Ga0182008_10033470 3300014497 Bacteria 2578
198 Ga0182008_10095085 3300014497 Bacteria 1470
199 Ga0157379_10014193 3300014968 Bacteria 6986
200 Ga0157376_10098546 3300014969 Bacteria 2548
201 Ga0157376_10434453 3300014969 Unclassified 1277
202 Ga0182006_1000874 3300015261 Bacteria 20234
203 Ga0182006_1018572 3300015261 Bacteria 2936
204 Ga0182006_1022705 3300015261 Bacteria 2605
205 Ga0182007_10000409 3300015262 Bacteria 26386
206 Ga0182007_10045024 3300015262 Bacteria 1463
207 Ga0183367_1011 3300015688 Bacteria 397353
208 Ga0163161_10000002 3300017792 Bacteria 411983
209 Ga0163161_10000012 3300017792 Bacteria 264639
210 Ga0163161_10078867 3300017792 Bacteria 2421
211 Ga0206353_10332444 3300020082 Bacteria 2963
212 Ga0213872_10003902 3300021361 Bacteria 8093
213 Ga0213872_10005805 3300021361 Bacteria 6270
214 Ga0213872_10014729 3300021361 Bacteria 3644
215 Ga0213876_10006516 3300021384 Bacteria 6363
216 Ga0213876_10047398 3300021384 Bacteria 2272
217 Ga0213876_10103894 3300021384 Bacteria 1507
218 Ga0209435_100007 3300025206 Bacteria 516857
219 Ga0209435_100124 3300025206 Bacteria 27904
220 Ga0209760_100070 3300025207 Bacteria 83162
221 Ga0209784_100005 3300025224 Bacteria 1040422
222 Ga0209784_100012 3300025224 Bacteria 535823
223 Ga0209784_100018 3300025224 Bacteria 456816
224 Ga0209566_100005 3300025225 Bacteria 1040422
225 Ga0209566_100010 3300025225 Bacteria 535823
226 Ga0209566_100016 3300025225 Bacteria 456824
227 Ga0209674_100009 3300025226 Bacteria 1040422
228 Ga0209674_100023 3300025226 Bacteria 535823
229 Ga0209674_100030 3300025226 Bacteria 456824
230 Ga0209147_100017 3300025229 Bacteria 516857
231 Ga0209563_100012 3300025230 Bacteria 1040422
232 Ga0209563_100027 3300025230 Bacteria 535823
233 Ga0209563_100034 3300025230 Bacteria 456824
234 Ga0207427_100017 3300025231 Bacteria 535823
235 Ga0209437_100029 3300025233 Bacteria 535823
236 Ga0209437_100215 3300025233 Bacteria 106873
237 Ga0209437_100647 3300025233 Bacteria 20285
238 Ga0209258_100115 3300025242 Bacteria 190367
239 Ga0209646_1000044 3300025246 Bacteria 334596
240 Ga0209646_1000238 3300025246 Bacteria 57384
241 Ga0209026_1000063 3300025250 Bacteria 211324
242 Ga0209026_1006998 3300025250 Bacteria 2633
243 Ga0209677_100006 3300025253 Bacteria 1040422
244 Ga0209677_100014 3300025253 Bacteria 535823
245 Ga0209677_100019 3300025253 Bacteria 456824
246 Ga0209759_1000048 3300025256 Bacteria 224817
247 Ga0209759_1006095 3300025256 Bacteria 4108
248 Ga0209233_1000890 3300025261 Bacteria 13052
249 Ga0209758_1007280 3300025297 Bacteria 7598
250 Ga0207426_1003013 3300025302 Bacteria 9781
251 Ga0207426_1006750 3300025302 Bacteria 4918
252 Ga0207426_1015986 3300025302 Bacteria 2707
253 Ga0207426_1043471 3300025302 Bacteria 1380
254 Ga0207697_10034961 3300025315 Unclassified 2057
255 Ga0207696_1000009 3300025711 Bacteria 564405
256 Ga0207696_1000658 3300025711 Bacteria 24673
257 Ga0207655_1000243 3300025728 Bacteria 89023
258 Ga0207655_1001127 3300025728 Bacteria 26100
259 Ga0207655_1005786 3300025728 Bacteria 8329
260 Ga0207713_1000034 3300025735 Bacteria 266214
261 Ga0207713_1000055 3300025735 Bacteria 221387
262 Ga0207713_1019768 3300025735 Bacteria 3283
263 Ga0207710_10000015 3300025900 Bacteria 393018
264 Ga0207647_10005581 3300025904 Bacteria 9201
265 Ga0207647_10023123 3300025904 Bacteria 4115
266 Ga0207685_10133653 3300025905 Bacteria 1104
267 Ga0207705_10048639 3300025909 Bacteria 3050
268 Ga0207684_10402667 3300025910 Bacteria 1176
269 Ga0207654_10000009 3300025911 Bacteria 334291
270 Ga0207707_10069790 3300025912 Bacteria 3062
271 Ga0207707_10084117 3300025912 Bacteria 2778
272 Ga0207695_10000048 3300025913 Bacteria 421800
273 Ga0207695_10000480 3300025913 Bacteria 85456
274 Ga0207695_10001014 3300025913 Bacteria 49482
275 Ga0207695_10002743 3300025913 Bacteria 25683
276 Ga0207695_10004788 3300025913 Bacteria 18313
277 Ga0207671_10000087 3300025914 Bacteria 141774
278 Ga0207671_10003849 3300025914 Bacteria 14683
279 Ga0207671_10003970 3300025914 Bacteria 14384
280 Ga0207671_10004320 3300025914 Bacteria 13655
281 Ga0207671_10004346 3300025914 Bacteria 13598
282 Ga0207671_10153575 3300025914 Bacteria 1780
283 Ga0207662_10021286 3300025918 Bacteria 3706
284 Ga0207652_10093598 3300025921 Bacteria 2644
285 Ga0207694_10000062 3300025924 Bacteria 140156
286 Ga0207694_10000114 3300025924 Bacteria 84485
287 Ga0207694_10122133 3300025924 Bacteria 2080
288 Ga0207700_10195322 3300025928 Bacteria 1702
289 Ga0207664_10215919 3300025929 Bacteria 1661
290 Ga0207664_10249369 3300025929 Bacteria 1549
291 Ga0207664_10261225 3300025929 Bacteria 1514
292 Ga0207709_10100381 3300025935 Bacteria 1912
293 Ga0207704_10167954 3300025938 Bacteria 1570
294 Ga0207665_10031939 3300025939 Bacteria 3485
295 Ga0207665_10135723 3300025939 Bacteria 1750
296 Ga0207711_10050225 3300025941 Bacteria 3570
297 Ga0207689_10168690 3300025942 Bacteria 1804
298 Ga0207661_10004102 3300025944 Bacteria 10181
299 Ga0207661_10035293 3300025944 Bacteria 3895
300 Ga0207661_10065173 3300025944 Bacteria 2956
301 Ga0207661_10233292 3300025944 Bacteria 1630
302 Ga0207679_10320871 3300025945 Bacteria 1341
303 Ga0207667_10000028 3300025949 Bacteria 334510
304 Ga0207667_10000044 3300025949 Bacteria 248251
305 Ga0207667_10013042 3300025949 Bacteria 9540
306 Ga0207667_10041707 3300025949 Bacteria 4880
307 Ga0207712_10009028 3300025961 Bacteria 6307
308 Ga0207668_10138421 3300025972 Bacteria 1869
309 Ga0207640_10012781 3300025981 Bacteria 4793
310 Ga0207640_10023681 3300025981 Bacteria 3694
311 Ga0207678_10000040 3300026067 Bacteria 100102
312 Ga0207678_10108628 3300026067 Bacteria 2366
313 Ga0207702_10012084 3300026078 Bacteria 7181
314 Ga0207702_10345831 3300026078 Bacteria 1422
315 Ga0207702_10549229 3300026078 Bacteria 1130
316 Ga0207641_10045889 3300026088 Unclassified 3682
317 Ga0207641_10051661 3300026088 Bacteria 3481
318 Ga0207676_10175060 3300026095 Bacteria 1873
319 Ga0207674_10004347 3300026116 Bacteria 17088
320 Ga0207674_10079829 3300026116 Unclassified 3275
321 Ga0207674_10163914 3300026116 Bacteria 2177
322 Ga0207674_10190262 3300026116 Bacteria 2002
323 Ga0207674_10203653 3300026116 Bacteria 1928
324 Ga0207674_10360944 3300026116 Bacteria 1404
325 Ga0207698_10008214 3300026142 Bacteria 6585
326 Ga0207698_10084201 3300026142 Unclassified 2577
327 Ga0209281_1000002 3300027111 Bacteria 1924012
328 Ga0209281_1000054 3300027111 Bacteria 309505
329 Ga0209281_1012901 3300027111 Bacteria 1820
330 Ga0209281_1020393 3300027111 Bacteria 1296
331 Ga0209371_1000010 3300027312 Bacteria 922021
332 Ga0209371_1000134 3300027312 Bacteria 121747
333 Ga0209371_1002387 3300027312 Bacteria 10608
334 Ga0207428_10000630 3300027907 Bacteria 41466
335 Ga0207428_10072003 3300027907 Unclassified 2714
336 Ga0268266_10093083 3300028379 Bacteria 2645
337 Ga0268266_10106761 3300028379 Bacteria 2476
338 Ga0268265_10008416 3300028380 Bacteria 6964
339 Ga0268265_10429602 3300028380 Bacteria 1229
340 Ga0307517_10018496 3300028786 Bacteria 9006
341 Ga0307515_10003694 3300028794 Bacteria 32127
342 Ga0307515_10099669 3300028794 Bacteria 3525
343 Ga0268256_1000051 3300030500 Bacteria 283626
344 Ga0268256_1003318 3300030500 Bacteria 7382
345 Ga0268256_1004842 3300030500 Bacteria 5454
346 Ga0307511_10119094 3300030521 Bacteria 1642
347 Ga0265332_10002813 3300031238 Bacteria 8647
348 Ga0307513_10011059 3300031456 Bacteria 11252
349 Ga0307513_10012493 3300031456 Bacteria 10474
350 Ga0307513_10097365 3300031456 Bacteria 2977
351 Ga0307513_10251801 3300031456 Bacteria 1562
352 Ga0307509_10000098 3300031507 Bacteria 121442
353 Ga0307509_10008752 3300031507 Bacteria 12803
354 Ga0307509_10014751 3300031507 Bacteria 9163
355 Ga0307509_10056753 3300031507 Bacteria 4155
356 Ga0307408_100445840 3300031548 Bacteria 1122
357 Ga0307508_10000100 3300031616 Bacteria 102032
358 Ga0307508_10001048 3300031616 Bacteria 32001
359 Ga0307508_10014270 3300031616 Bacteria 7247
360 Ga0307514_10005174 3300031649 Bacteria 11764
361 Ga0307514_10031572 3300031649 Bacteria 4247
362 Ga0307514_10101389 3300031649 Bacteria 2066
363 Ga0316579_10068377 3300031691 Bacteria 1680
364 Ga0265342_10075332 3300031712 Bacteria 1958
365 Ga0316576_10007563 3300031727 Bacteria 6856
366 Ga0316578_10012740 3300031728 Bacteria 4439
367 Ga0307516_10000841 3300031730 Bacteria 42119
368 Ga0307516_10001109 3300031730 Bacteria 37546
369 Ga0307516_10014239 3300031730 Bacteria 8424
370 Ga0307516_10023170 3300031730 Bacteria 6368
371 Ga0307516_10338217 3300031730 Bacteria 1173
372 Ga0307516_10343482 3300031730 Bacteria 1159
373 Ga0307405_10014467 3300031731 Bacteria 4243
374 Ga0307413_10021520 3300031824 Bacteria 3456
375 Ga0307518_10064698 3300031838 Bacteria 2654
376 Ga0307518_10230503 3300031838 Bacteria 1199
377 Ga0307410_10293063 3300031852 Bacteria 1281
378 Ga0307406_10006762 3300031901 Bacteria 6342
379 Ga0307409_100021278 3300031995 Bacteria 4443
380 Ga0307416_100004859 3300032002 Bacteria 8178
381 Ga0307416_100055870 3300032002 Bacteria 3182
382 Ga0307414_10003179 3300032004 Bacteria 8731
383 Ga0307415_100133211 3300032126 Bacteria 1885
384 Ga0307507_10000007 3300033179 Bacteria 269525
385 Ga0373957_0062710 3300035120 Bacteria 1443
386 Ga0316574_0290303 3300035398 Bacteria 1041
387 Ga0373931_0220337 3300035691 Bacteria 1142
388 Ga0373947_0110565 3300035725 Bacteria 1736
389 Ga0316582_0178767 3300036647 Bacteria 1443
390 Ga0316584_0190816 3300036712 Bacteria 1515
391 Ga0373925_0059270 3300037068 Bacteria 2872
392 Ga0395899_0038761 3300037312 Bacteria 3567
393 Ga0395900_0037875 3300037418 Bacteria 4971
394 Ga0395900_0063563 3300037418 Bacteria 3794
395 Ga0395898_0010491 3300037466 Bacteria 9685
396 Ga0395898_0098767 3300037466 Bacteria 2803
397 Ga0395898_0179012 3300037466 Bacteria 2026
398 Ga0395905_0060852 3300037471 Bacteria 3531
399 Ga0395905_0488995 3300037471 Bacteria 1130
400 Ga0395905_0508742 3300037471 Bacteria 1105
401 Ga0436364_0380175 3300037853 Bacteria 8114
402 Ga0395901_0092795 3300038443 Bacteria 3160
403 Ga0395901_0095434 3300038443 Bacteria 3116
404 Ga0395901_0125450 3300038443 Bacteria 2698
405 Ga0395901_0231457 3300038443 Bacteria 1929
406 Ga0436365_0624325 3300039437 Bacteria 1500
407 Ga0436365_0837397 3300039437 Bacteria 13021
408 Ga0436365_1283794 3300039437 Bacteria 9095
409 Ga0436365_1474640 3300039437 Bacteria 3867
410 Ga0436361_0220616 3300039447 Bacteria 4301
411 Ga0436361_0480362 3300039447 Bacteria 1160
412 Ga0436361_0584428 3300039447 Bacteria 3540
413 Ga0436361_0689999 3300039447 Bacteria 10015
414 Ga0436363_0853496 3300039450 Bacteria 1963
415 Ga0436362_1175501 3300039453 Bacteria 2729
416 Ga0439438_000018 3300041405 Bacteria 123959
417 Ga0451789_0906811 3300041443 Bacteria 1968
418 Ga0451804_0918993 3300041463 Bacteria 1147
419 Ga0451841_0165068 3300041498 Bacteria 1108
420 Ga0439433_0028063 3300041999 Bacteria 1279
421 Ga0439432_001254 3300042006 Bacteria 9595
422 Ga0439432_011248 3300042006 Bacteria 3086
423 Ga0439449_0000378 3300042007 Bacteria 16401
424 Ga0439449_0037996 3300042007 Bacteria 1791
425 Ga0439455_0014244 3300042012 Bacteria 1813
426 Ga0439457_000120 3300042014 Bacteria 19130
427 Ga0439457_025458 3300042014 Bacteria 1309
428 Ga0450894_000440 3300042131 Bacteria 7135
429 Ga0450898_002025 3300042134 Bacteria 2778
430 Ga0450899_000209 3300042135 Bacteria 6082
431 Ga0450906_000137 3300042145 Bacteria 13182
432 Ga0439458_0003854 3300042157 Bacteria 3468
433 Ga0439458_0006900 3300042157 Bacteria 2532
434 Ga0451577_0142015 3300042876 Bacteria 2158
435 Ga0466969_0024240 3300044656 Bacteria 3121
436 Ga0466969_0082058 3300044656 Bacteria 1537
437 Ga0466972_0001073 3300044658 Bacteria 13098
438 Ga0466965_0064353 3300044683 Bacteria 1836
439 Ga0466966_0009910 3300044684 Bacteria 6317
440 Ga0466966_0068979 3300044684 Bacteria 2218
441 Ga0466966_0239123 3300044684 Bacteria 1095
442 Ga0466961_0012100 3300044693 Bacteria 5517
443 Ga0466961_0036482 3300044693 Bacteria 3155
444 Ga0466961_0039268 3300044693 Bacteria 3035
445 Ga0466961_0101424 3300044693 Bacteria 1813
446 Ga0466961_0126714 3300044693 Bacteria 1601
447 Ga0466961_0172784 3300044693 Bacteria 1344
448 Ga0466963_0041252 3300044694 Bacteria 3027
449 Ga0453684_0000287 3300044712 Bacteria 216926
450 Ga0466971_0006564 3300044719 Bacteria 5054
451 Ga0466971_0022808 3300044719 Bacteria 2789
452 Ga0466971_0023476 3300044719 Bacteria 2750
453 Ga0466970_0009728 3300044765 Bacteria 4865
454 Ga0466970_0114295 3300044765 Bacteria 1475
455 Ga0466960_0063861 3300044901 Bacteria 1814
456 Ga0466959_0012601 3300045049 Bacteria 6115
457 Ga0466959_0019241 3300045049 Bacteria 5020
458 Ga0451576_0077319 3300045051 Bacteria 3463
459 Ga0466958_0020885 3300045836 Bacteria 3822
460 Ga0466958_0123481 3300045836 Bacteria 1622
461 Ga0466967_0513494 3300045976 Bacteria 1177
462 Ga0495617_007014 3300046452 Bacteria 3927
463 Ga0495627_000042 3300046453 Bacteria 189845
464 Ga0495590_0072797 3300046457 Bacteria 1207
465 Ga0495591_000006 3300046458 Bacteria 390570
466 Ga0495591_000933 3300046458 Bacteria 20017
467 Ga0495591_003374 3300046458 Bacteria 8290
468 Ga0495591_016094 3300046458 Bacteria 2617
469 Ga0495629_0277115 3300046459 Bacteria 1151
470 Ga0495638_0098673 3300046460 Bacteria 1750
471 Ga0495638_0116477 3300046460 Bacteria 1583
472 Ga0495651_0043595 3300046462 Bacteria 3480
473 Ga0495650_0000102 3300046471 Bacteria 211007
474 Ga0495650_0001196 3300046471 Bacteria 27428
475 Ga0495605_0000037 3300046474 Bacteria 200004
476 Ga0495605_0000222 3300046474 Bacteria 70142
477 Ga0495605_0016761 3300046474 Bacteria 3959
478 Ga0495605_0086778 3300046474 Bacteria 1456
479 Ga0495605_0113557 3300046474 Bacteria 1234
480 Ga0495662_0011382 3300046476 Bacteria 4348
481 Ga0495584_0009858 3300046491 Bacteria 4911
482 Ga0495585_0054773 3300046492 Bacteria 2204
483 Ga0495594_0049738 3300046499 Bacteria 2304
484 Ga0495596_0008274 3300046500 Bacteria 4638
485 Ga0495607_0000149 3300046501 Bacteria 73673
486 Ga0495607_0000403 3300046501 Bacteria 43834
487 Ga0495607_0012756 3300046501 Bacteria 5532
488 Ga0495607_0023327 3300046501 Bacteria 3874
489 Ga0495607_0049901 3300046501 Bacteria 2438
490 Ga0495583_0001428 3300046506 Bacteria 24290
491 Ga0495583_0002044 3300046506 Bacteria 18357
492 Ga0495583_0006587 3300046506 Bacteria 7555
493 Ga0495606_0000094 3300046507 Bacteria 151840
494 Ga0495606_0000674 3300046507 Bacteria 53418
495 Ga0495606_0000792 3300046507 Bacteria 48271
496 Ga0495606_0037720 3300046507 Bacteria 3278
497 Ga0495610_0004252 3300046512 Bacteria 10662
498 Ga0495610_0033752 3300046512 Bacteria 2642
499 Ga0495616_0022501 3300046513 Bacteria 3404
500 Ga0495616_0135835 3300046513 Bacteria 1123
501 Ga0495620_0000296 3300046515 Bacteria 35364
502 Ga0495620_0001367 3300046515 Bacteria 14739
503 Ga0495620_0001634 3300046515 Bacteria 13278
504 Ga0495628_0206277 3300046516 Bacteria 1479
505 Ga0495631_0009073 3300046518 Bacteria 4982
506 Ga0495632_0001504 3300046519 Bacteria 19279
507 Ga0495632_0025622 3300046519 Bacteria 3117
508 Ga0495632_0028475 3300046519 Bacteria 2915
509 Ga0495632_0032770 3300046519 Bacteria 2674
510 Ga0495632_0064880 3300046519 Bacteria 1764
511 Ga0495637_0000015 3300046520 Bacteria 228949
512 Ga0495637_0000077 3300046520 Bacteria 78543
513 Ga0495637_0002223 3300046520 Bacteria 10829
514 Ga0495643_0009173 3300046522 Bacteria 6175
515 Ga0495643_0013688 3300046522 Bacteria 4847
516 Ga0495643_0050031 3300046522 Bacteria 2251
517 Ga0495643_0059077 3300046522 Bacteria 2039
518 Ga0495644_0000719 3300046523 Bacteria 13715
519 Ga0495648_0001437 3300046524 Bacteria 23314
520 Ga0495648_0010818 3300046524 Bacteria 6928
521 Ga0495648_0150218 3300046524 Bacteria 1216
522 Ga0495654_0000013 3300046530 Bacteria 327576
523 Ga0495654_0001350 3300046530 Bacteria 17070
524 Ga0495654_0019919 3300046530 Bacteria 3502
525 Ga0495609_0000148 3300046538 Bacteria 72666
526 Ga0495609_0000162 3300046538 Bacteria 69584
527 Ga0495609_0004988 3300046538 Bacteria 7103
528 Ga0495597_0017251 3300046542 Bacteria 3401
529 Ga0495633_0139080 3300046558 Bacteria 1123
530 Ga0495668_0027794 3300046616 Bacteria 3204
531 Ga0495668_0028856 3300046616 Bacteria 3136
532 Ga0495611_0001027 3300046648 Bacteria 14786
533 Ga0495625_0000004 3300046660 Bacteria 611314
534 Ga0495625_0000428 3300046660 Bacteria 63353
535 Ga0495625_0016386 3300046660 Bacteria 5835
536 Ga0495635_0048642 3300046663 Bacteria 2923
537 Ga0495661_0000006 3300046665 Bacteria 427288
538 Ga0495661_0032826 3300046665 Bacteria 3278
539 Ga0495661_0071627 3300046665 Bacteria 2025
540 Ga0495658_0044193 3300046683 Bacteria 2495
541 Ga0495613_0027459 3300046689 Bacteria 4235
542 Ga0495613_0171300 3300046689 Bacteria 1541
543 Ga0495613_0230963 3300046689 Bacteria 1296
544 Ga0495670_0007579 3300046691 Bacteria 5335
545 Ga0495670_0115241 3300046691 Bacteria 1393
546 Ga0495671_0008265 3300046692 Bacteria 5865
547 Ga0495671_0037117 3300046692 Bacteria 2465
548 Ga0495649_0172631 3300046694 Bacteria 1130
549 Ga0495589_0000005 3300046794 Bacteria 405112
550 Ga0495589_0000646 3300046794 Bacteria 22845
551 Ga0495589_0038845 3300046794 Bacteria 2381
552 Ga0495660_0000006 3300046810 Bacteria 571713
553 Ga0495660_0009143 3300046810 Bacteria 5786
554 Ga0495660_0035217 3300046810 Bacteria 2798
555 Ga0495660_0080977 3300046810 Bacteria 1703
556 Ga0495581_0156784 3300047315 Bacteria 1331
557 Ga0495674_0126406 3300047319 Bacteria 2157
558 Ga0495672_0049161 3300047320 Bacteria 2497
559 Ga0495672_0118007 3300047320 Bacteria 1415
560 Ga0495676_0000004 3300047321 Bacteria 313696
561 Ga0495676_0086254 3300047321 Bacteria 2363
562 Ga0495683_0015137 3300047323 Bacteria 4018
563 Ga0495683_0103972 3300047323 Bacteria 1363
564 Ga0495687_002821 3300047443 Bacteria 13387
565 Ga0495687_010294 3300047443 Bacteria 5137
566 Ga0495687_010867 3300047443 Bacteria 4946
567 Ga0495679_000308 3300047446 Bacteria 39070
568 Ga0495679_000774 3300047446 Bacteria 20300
569 Ga0495679_040234 3300047446 Bacteria 1454
570 Ga0495685_000931 3300047447 Bacteria 8880
571 Ga0495685_027233 3300047447 Bacteria 1966
572 Ga0495673_0000980 3300047469 Bacteria 25613
573 Ga0495673_0002082 3300047469 Bacteria 14612
574 Ga0495673_0002720 3300047469 Bacteria 12150
575 Ga0495673_0006802 3300047469 Bacteria 6678
576 Ga0495673_0018856 3300047469 Bacteria 3469
577 Ga0495673_0032136 3300047469 Bacteria 2451
578 Ga0495681_0002551 3300047470 Bacteria 12977
579 Ga0495681_0003241 3300047470 Bacteria 11353
580 Ga0495681_0004262 3300047470 Bacteria 9811
581 Ga0495681_0034246 3300047470 Bacteria 2532
582 Ga0495681_0057977 3300047470 Bacteria 1796
583 Ga0495686_0000018 3300047472 Bacteria 434962
584 Ga0495686_0000933 3300047472 Bacteria 36364
585 Ga0495686_0061992 3300047472 Bacteria 2320
586 Ga0495602_0017711 3300048088 Bacteria 7135
587 Ga0495626_0000012 3300048091 Bacteria 258483
588 Ga0496101_0235888 3300048904 Bacteria 1423
589 Ga0496102_0060411 3300048905 Bacteria 3466
590 Ga0496104_0000071 3300048907 Bacteria 106442
591 Ga0496104_0001453 3300048907 Bacteria 20471
592 Ga0496104_0138784 3300048907 Bacteria 2336
593 Ga0496104_0485893 3300048907 Bacteria 1146
594 Ga0496105_0404251 3300048908 Bacteria 1084
595 Ga0496108_0033009 3300048911 Bacteria 4300
596 Ga0496108_0179735 3300048911 Bacteria 1832
597 Ga0496109_0174896 3300048912 Bacteria 2015
598 Ga0496109_0179044 3300048912 Unclassified 1991
599 Ga0496109_0284820 3300048912 Bacteria 1557
600 Ga0496110_0131045 3300048913 Bacteria 2264
601 Ga0496111_0136682 3300048914 Bacteria 1816
602 Ga0496112_0017590 3300048915 Bacteria 6720
603 Ga0496112_0039858 3300048915 Bacteria 4590
604 Ga0496112_0112870 3300048915 Bacteria 2688
605 Ga0496113_0009247 3300048916 Bacteria 6466
606 Ga0496114_0004287 3300048917 Bacteria 11042
607 Ga0496114_0093548 3300048917 Bacteria 2556
608 Ga0496115_0459229 3300048918 Bacteria 1028
609 Ga0496116_0000015 3300048919 Bacteria 560702
610 Ga0496116_0000020 3300048919 Bacteria 501307
611 Ga0496116_0005552 3300048919 Bacteria 11636
612 Ga0496116_0026638 3300048919 Bacteria 4223
613 Ga0496116_0033427 3300048919 Bacteria 3650
614 Ga0496117_0000858 3300048920 Bacteria 47050
615 Ga0496117_0006493 3300048920 Bacteria 11803
616 Ga0496117_0010790 3300048920 Bacteria 8251
617 Ga0496117_0067039 3300048920 Bacteria 2431
618 Ga0496118_0002115 3300048921 Bacteria 27830
619 Ga0496118_0003691 3300048921 Bacteria 18973
620 Ga0496118_0016088 3300048921 Bacteria 6881
621 Ga0496118_0032947 3300048921 Bacteria 4259
622 Ga0496118_0190743 3300048921 Bacteria 1226
623 Ga0496119_0000481 3300048922 Bacteria 54605
624 Ga0496119_0002429 3300048922 Bacteria 20452
625 Ga0496120_0002963 3300048923 Bacteria 16155
626 Ga0496120_0008793 3300048923 Bacteria 7256
627 Ga0496120_0014276 3300048923 Bacteria 5300
628 Ga0496121_0001569 3300048924 Bacteria 38098
629 Ga0496121_0001684 3300048924 Bacteria 36354
630 Ga0496121_0010160 3300048924 Bacteria 10660
631 Ga0496121_0013603 3300048924 Bacteria 8726
632 Ga0496121_0044124 3300048924 Bacteria 3851
633 Ga0496121_0186814 3300048924 Bacteria 1490
634 Ga0496121_0322559 3300048924 Bacteria 1039
635 Ga0496122_0000010 3300048925 Bacteria 547417
636 Ga0496122_0000570 3300048925 Bacteria 75506
637 Ga0496122_0003675 3300048925 Bacteria 19902
638 Ga0496122_0014537 3300048925 Bacteria 7600
639 Ga0496122_0020992 3300048925 Bacteria 5866
640 Ga0496122_0068821 3300048925 Bacteria 2539
641 Ga0496122_0101295 3300048925 Bacteria 1924
642 Ga0496122_0247837 3300048925 Bacteria 999
643 Ga0496123_0000061 3300048926 Bacteria 220856
644 Ga0496123_0000438 3300048926 Bacteria 74878
645 Ga0496123_0002948 3300048926 Bacteria 19877
646 Ga0496123_0009809 3300048926 Bacteria 8552
647 Ga0496123_0013325 3300048926 Bacteria 6916
648 Ga0496123_0047467 3300048926 Bacteria 2901
649 Ga0496123_0077038 3300048926 Bacteria 2050
650 Ga0496124_0000031 3300048927 Bacteria 344232
651 Ga0496124_0000084 3300048927 Bacteria 204993
652 Ga0496124_0000272 3300048927 Bacteria 99703
653 Ga0496124_0001245 3300048927 Bacteria 39104
654 Ga0496124_0001315 3300048927 Bacteria 37519
655 Ga0496124_0007040 3300048927 Bacteria 12046
656 Ga0496124_0338350 3300048927 Bacteria 1070
657 Ga0496125_0000071 3300048928 Bacteria 243580
658 Ga0496125_0000701 3300048928 Bacteria 55423
659 Ga0496125_0000997 3300048928 Bacteria 44176
660 Ga0496125_0003276 3300048928 Bacteria 19912
661 Ga0496126_0002615 3300048929 Bacteria 23994
662 Ga0496126_0011165 3300048929 Bacteria 9322
663 Ga0496126_0048937 3300048929 Bacteria 3860
664 Ga0496126_0080694 3300048929 Bacteria 2878
665 Ga0495678_000052 3300049459 Bacteria 157731
666 Ga0495678_048847 3300049459 Bacteria 1648
667 Ga0495682_0001456 3300049460 Bacteria 12711
668 Ga0501032_0000476 3300049569 Bacteria 32393
669 Ga0501036_0006947 3300049572 Bacteria 9204
670 Ga0501039_0341311 3300049575 Bacteria 1177
671 Ga0501040_0060591 3300049576 Bacteria 2601
672 Ga0501042_0053038 3300049578 Bacteria 2893
673 Ga0501043_0146688 3300049579 Bacteria 1847
674 Ga0501046_0083449 3300049580 Bacteria 2466
675 Ga0501046_0145754 3300049580 Bacteria 1788
676 Ga0501047_0079870 3300049581 Bacteria 3144
677 Ga0501048_0213867 3300049582 Bacteria 1367
678 Ga0501067_0002675 3300049583 Bacteria 9852
679 Ga0501070_0283232 3300049586 Bacteria 1352
680 Ga0501035_0000543 3300049822 Bacteria 41919
681 Ga0501044_0000127 3300049823 Bacteria 92724
682 Ga0501045_0281899 3300049824 Bacteria 1237
683 nmdc:mga0yw44_81474_c1 3300050492 Bacteria 2029
684 nmdc:mga0k408_1636_c1 3300050493 Bacteria 12115
685 nmdc:mga06z11_3522_c1 3300050494 Bacteria 6065
686 nmdc:mga04h51_2391_c1 3300050495 Bacteria 4449
687 nmdc:mga05p37_253397_c1 3300050507 Bacteria 2110
688 nmdc:mga05p37_5339_c1 3300050507 Bacteria 15091
689 nmdc:mga09592_6044_c1 3300050508 Bacteria 9874
690 nmdc:mga0qj67_1327_c1 3300050509 Bacteria 17394
691 nmdc:mga06r32_14827_c1 3300050510 Bacteria 7071
692 nmdc:mga08y16_2151_c1 3300050511 Bacteria 20215
693 nmdc:mga08y16_93223_c1 3300050511 Unclassified 3138
694 nmdc:mga08x19_284836_c1 3300050514 Bacteria 1145
695 Ga0495601_0012505 3300053077 Bacteria 5090
696 Ga0495601_0149649 3300053077 Bacteria 1524
697 Ga0495612_0039681 3300053078 Bacteria 1915
698 Ga0500578_0192746 3300053086 Bacteria 1250
699 Ga0500644_0045920 3300053088 Bacteria 1474
700 Ga0500566_0009242 3300053094 Bacteria 5831
701 Ga0500566_0033762 3300053094 Bacteria 2979
702 Ga0500640_000065 3300053095 Bacteria 17226
703 Ga0500553_026081 3300053101 Bacteria 2944
704 Ga0500554_000067 3300053102 Bacteria 18761
705 Ga0500569_006115 3300053109 Bacteria 2625
706 Ga0500572_002384 3300053111 Bacteria 4539
707 Ga0500595_000110 3300053119 Bacteria 55326
708 Ga0500597_064159 3300053120 Bacteria 1581
709 Ga0500614_001859 3300053123 Bacteria 4879
710 Ga0500618_000901 3300053125 Bacteria 15618
711 Ga0500618_001175 3300053125 Bacteria 12632
712 Ga0500618_004390 3300053125 Bacteria 4533
713 Ga0500658_0031822 3300053134 Bacteria 2065
714 Ga0500658_0058363 3300053134 Bacteria 1598
715 Ga0500559_0014801 3300053136 Bacteria 3295
716 Ga0500561_0000979 3300053137 Bacteria 4578
717 Ga0500579_099605 3300053143 Bacteria 1522
718 Ga0500600_0006627 3300053149 Bacteria 6923
719 Ga0500616_0005770 3300053153 Bacteria 8315
720 Ga0500622_0001692 3300053156 Bacteria 17162
721 Ga0500622_0010351 3300053156 Bacteria 5123
722 Ga0500633_0005241 3300053160 Bacteria 3058
723 Ga0500634_0011919 3300053161 Bacteria 4508
724 Ga0500637_0229244 3300053178 Bacteria 1047
725 Ga0500587_013771 3300053739 Bacteria 1023
726 Ga0501084_0123997 3300054114 Bacteria 2173
727 Ga0501082_0031154 3300060353 Bacteria 4597

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10008953 Ga0105239_1000895310 224
2 3300041498 Ga0451841_0165068 Ga0451841_0165068_39_887 228
3 3300048925 Ga0496122_0247837 Ga0496122_0247837_245_988 230
4 3300046794 Ga0495589_0038845 Ga0495589_0038845_1368_2132 237
5 3300005841 Ga0068863_100019824 Ga0068863_1000198246 240
6 3300025942 Ga0207689_10168690 Ga0207689_101686902 240
7 3300026088 Ga0207641_10045889 Ga0207641_100458892 240
8 3300009148 Ga0105243_10280027 Ga0105243_102800271 241
9 3300025935 Ga0207709_10100381 Ga0207709_101003812 241
10 3300037466 Ga0395898_0179012 Ga0395898_0179012_292_1080 242
11 3300042012 Ga0439455_0014244 Ga0439455_0014244_426_1214 242
12 3300048904 Ga0496101_0235888 Ga0496101_0235888_557_1375 242
13 3300037471 Ga0395905_0488995 Ga0395905_0488995_301_1089 243
14 3300009094 Ga0111539_10017567 Ga0111539_100175676 244
15 3300038443 Ga0395901_0231457 Ga0395901_0231457_782_1570 244
16 3300050507 nmdc:mga05p37_5339_c1 nmdc:mga05p37_5339_c1_9372_10160 244
17 3300050508 nmdc:mga09592_6044_c1 nmdc:mga09592_6044_c1_424_1212 244
18 3300050509 nmdc:mga0qj67_1327_c1 nmdc:mga0qj67_1327_c1_10899_11687 244
19 3300050510 nmdc:mga06r32_14827_c1 nmdc:mga06r32_14827_c1_296_1084 244
20 3300050511 nmdc:mga08y16_2151_c1 nmdc:mga08y16_2151_c1_8664_9452 244
21 3300003856 Ga0058692_1012125 Ga0058692_10121252 245
22 3300027312 Ga0209371_1000010 Ga0209371_100001057 245
23 3300030500 Ga0268256_1000051 Ga0268256_1000051149 245
24 3300037471 Ga0395905_0508742 Ga0395905_0508742_125_889 245
25 3300005616 Ga0068852_100005949 Ga0068852_1000059493 248
26 3300025913 Ga0207695_10001014 Ga0207695_1000101447 248
27 3300025924 Ga0207694_10122133 Ga0207694_101221332 248
28 3300026142 Ga0207698_10008214 Ga0207698_100082143 248
29 3300031507 Ga0307509_10000098 Ga0307509_1000009832 250
30 3300003316 rootH1_10047640 rootH1_100476402 251
31 3300005329 Ga0070683_100005836 Ga0070683_1000058366 253
32 3300005535 Ga0070684_100002727 Ga0070684_1000027274 253
33 3300005577 Ga0068857_100120766 Ga0068857_1001207663 253
34 3300025944 Ga0207661_10004102 Ga0207661_1000410213 253
35 3300049578 Ga0501042_0053038 Ga0501042_0053038_2029_2853 253
36 3300006038 Ga0075365_10071840 Ga0075365_100718402 254
37 3300025905 Ga0207685_10133653 Ga0207685_101336532 254
38 3300048914 Ga0496111_0136682 Ga0496111_0136682_28_828 254
39 3300048918 Ga0496115_0459229 Ga0496115_0459229_232_1002 254
40 3300050492 nmdc:mga0yw44_81474_c1 nmdc:mga0yw44_81474_c1_560_1387 254
41 3300035691 Ga0373931_0220337 Ga0373931_0220337_108_1001 255
42 3300005434 Ga0070709_10023164 Ga0070709_100231643 257
43 3300005435 Ga0070714_100176419 Ga0070714_1001764192 257
44 3300005436 Ga0070713_100014860 Ga0070713_1000148603 257
45 3300005439 Ga0070711_100069571 Ga0070711_1000695712 257
46 3300025928 Ga0207700_10195322 Ga0207700_101953222 257
47 3300025929 Ga0207664_10261225 Ga0207664_102612252 257
48 3300037068 Ga0373925_0059270 Ga0373925_0059270_1809_2702 257
49 3300006194 Ga0075427_10009992 Ga0075427_100099921 259
50 3300006846 Ga0075430_100000732 Ga0075430_10000073211 259
51 3300027907 Ga0207428_10000630 Ga0207428_1000063024 259
52 3300031731 Ga0307405_10014467 Ga0307405_100144672 259
53 3300031824 Ga0307413_10021520 Ga0307413_100215201 259
54 3300031901 Ga0307406_10006762 Ga0307406_100067626 259
55 3300031995 Ga0307409_100021278 Ga0307409_1000212782 259
56 3300032002 Ga0307416_100004859 Ga0307416_1000048596 259
57 3300009098 Ga0105245_10461960 Ga0105245_104619602 260
58 3300014969 Ga0157376_10098546 Ga0157376_100985462 260
59 3300031730 Ga0307516_10014239 Ga0307516_100142395 261
60 3300031852 Ga0307410_10293063 Ga0307410_102930632 261
61 3300032126 Ga0307415_100133211 Ga0307415_1001332112 261
62 3300005614 Ga0068856_100012052 Ga0068856_1000120523 262
63 3300013308 Ga0157375_10437359 Ga0157375_104373592 262
64 3300017792 Ga0163161_10078867 Ga0163161_100788673 262
65 3300026078 Ga0207702_10012084 Ga0207702_100120845 262
66 3300039437 Ga0436365_0624325 Ga0436365_0624325_419_1231 262
67 3300048927 Ga0496124_0007040 Ga0496124_0007040_3989_4843 262
68 3300013105 Ga0157369_10335896 Ga0157369_103358962 263
69 3300013308 Ga0157375_10050022 Ga0157375_100500222 263
70 3300026067 Ga0207678_10108628 Ga0207678_101086284 263
71 3300005535 Ga0070684_100102359 Ga0070684_1001023593 264
72 iso_pu_bacteria 2751185782 2753266733 264
73 3300005548 Ga0070665_100200105 Ga0070665_1002001052 265
74 3300005841 Ga0068863_100283855 Ga0068863_1002838552 265
75 3300026088 Ga0207641_10051661 Ga0207641_100516614 265
76 3300026095 Ga0207676_10175060 Ga0207676_101750602 265
77 3300028379 Ga0268266_10106761 Ga0268266_101067612 265
78 3300048907 Ga0496104_0485893 Ga0496104_0485893_122_1018 265
79 3300048915 Ga0496112_0017590 Ga0496112_0017590_5256_6086 265
80 3300048915 Ga0496112_0039858 Ga0496112_0039858_3269_4099 265
81 3300048917 Ga0496114_0004287 Ga0496114_0004287_16_912 265
82 iso_pu_bacteria 2513237305 2514417435 265
83 iso_pu_bacteria 2582581313 2585304328 265
84 iso_pu_bacteria 2585428062 2587757896 265
85 iso_pu_bacteria 2721755686 2723574154 265
86 iso_pu_bacteria 2882632389 2882639423 265
87 3300047447 Ga0495685_027233 Ga0495685_027233_656_1537 266
88 3300025913 Ga0207695_10004788 Ga0207695_100047888 267
89 3300037312 Ga0395899_0038761 Ga0395899_0038761_1266_2102 267
90 3300037418 Ga0395900_0037875 Ga0395900_0037875_2306_3142 267
91 3300037418 Ga0395900_0063563 Ga0395900_0063563_2626_3462 267
92 3300037466 Ga0395898_0098767 Ga0395898_0098767_539_1375 267
93 3300037471 Ga0395905_0060852 Ga0395905_0060852_1429_2265 267
94 3300038443 Ga0395901_0092795 Ga0395901_0092795_1392_2228 267
95 3300038443 Ga0395901_0095434 Ga0395901_0095434_1742_2578 267
96 3300049583 Ga0501067_0002675 Ga0501067_0002675_8635_9504 267
97 iso_pu_bacteria 2521172590 2521556927 267
98 iso_pu_bacteria 2548876994 2550694881 267
99 iso_pu_bacteria 2775506901 2776257308 267
100 iso_pu_bacteria 2818991445 2819593970 267
101 iso_pu_bacteria 2904439833 2904440373 267
102 iso_pu_bacteria 2904530477 2904530712 267
103 iso_pu_bacteria 2904584206 2904585875 267
104 iso_pu_bacteria 2904589729 2904592312 267
105 iso_pu_bacteria 2904601388 2904601552 267
106 iso_pu_bacteria 2919079590 2919082796 267
107 3300003323 rootH1_10007502 rootH1_100075022 268
108 3300005347 Ga0070668_100191791 Ga0070668_1001917912 268
109 3300005548 Ga0070665_100176282 Ga0070665_1001762822 268
110 3300005548 Ga0070665_100277093 Ga0070665_1002770932 268
111 3300005563 Ga0068855_100037965 Ga0068855_1000379656 268
112 3300005578 Ga0068854_100056145 Ga0068854_1000561453 268
113 3300005841 Ga0068863_100207719 Ga0068863_1002077192 268
114 3300009093 Ga0105240_10022396 Ga0105240_100223964 268
115 3300009545 Ga0105237_10581460 Ga0105237_105814602 268
116 3300009551 Ga0105238_10000062 Ga0105238_1000006256 268
117 3300010375 Ga0105239_10056421 Ga0105239_100564213 268
118 3300014326 Ga0157380_10038961 Ga0157380_100389613 268
119 3300015261 Ga0182006_1018572 Ga0182006_10185723 268
120 3300025297 Ga0209758_1007280 Ga0209758_10072803 268
121 3300025302 Ga0207426_1043471 Ga0207426_10434712 268
122 3300025914 Ga0207671_10004320 Ga0207671_1000432012 268
123 3300025924 Ga0207694_10000114 Ga0207694_1000011451 268
124 3300025949 Ga0207667_10041707 Ga0207667_100417073 268
125 3300025972 Ga0207668_10138421 Ga0207668_101384212 268
126 3300025981 Ga0207640_10023681 Ga0207640_100236813 268
127 3300028379 Ga0268266_10093083 Ga0268266_100930832 268
128 3300031456 Ga0307513_10012493 Ga0307513_100124935 268
129 3300031507 Ga0307509_10008752 Ga0307509_1000875212 268
130 3300031507 Ga0307509_10056753 Ga0307509_100567534 268
131 3300031548 Ga0307408_100445840 Ga0307408_1004458402 268
132 3300031730 Ga0307516_10000841 Ga0307516_100008412 268
133 3300044683 Ga0466965_0064353 Ga0466965_0064353_291_1121 268
134 3300047320 Ga0495672_0118007 Ga0495672_0118007_15_884 268
135 3300048912 Ga0496109_0179044 Ga0496109_0179044_538_1380 268
136 3300053088 Ga0500644_0045920 Ga0500644_0045920_473_1348 268
137 3300053134 Ga0500658_0058363 Ga0500658_0058363_401_1270 268
138 3300053156 Ga0500622_0001692 Ga0500622_0001692_2169_3038 268
139 3300053156 Ga0500622_0010351 Ga0500622_0010351_2411_3280 268
140 iso_pu_bacteria 2511231025 2511382980 268
141 iso_pu_bacteria 2511231035 2511433275 268
142 iso_pu_bacteria 2534681786 2535484016 268
143 iso_pu_bacteria 2551306416 2553004715 268
144 iso_pu_bacteria 2675903060 2676491465 268
145 iso_pu_bacteria 2854911287 2854914109 268
146 iso_pu_bacteria 2867475112 2867477039 268
147 iso_pu_bacteria 2884693830 2884696475 268
148 iso_pu_bacteria 2895442618 2895449828 268
149 iso_pu_bacteria 2915650412 2915650957 268
150 iso_pu_bacteria 2919046199 2919049725 268
151 iso_pu_bacteria 2928130867 2928134464 268
152 iso_pu_bacteria 2997451912 2997454156 268
153 3300003751 Ga0055538_1000008 Ga0055538_1000008214 269
154 3300003752 Ga0055539_1000012 Ga0055539_1000012214 269
155 3300003756 Ga0055533_1000015 Ga0055533_1000015214 269
156 3300003759 Ga0055525_1000017 Ga0055525_1000017129 269
157 3300003841 Ga0055541_1000009 Ga0055541_1000009214 269
158 3300005563 Ga0068855_100000175 Ga0068855_10000017517 269
159 3300009545 Ga0105237_10073916 Ga0105237_100739164 269
160 3300021361 Ga0213872_10003902 Ga0213872_100039024 269
161 3300025224 Ga0209784_100005 Ga0209784_100005211 269
162 3300025225 Ga0209566_100005 Ga0209566_100005211 269
163 3300025226 Ga0209674_100009 Ga0209674_100009211 269
164 3300025230 Ga0209563_100012 Ga0209563_100012211 269
165 3300025253 Ga0209677_100006 Ga0209677_100006211 269
166 3300025914 Ga0207671_10153575 Ga0207671_101535752 269
167 3300025949 Ga0207667_10000028 Ga0207667_10000028139 269
168 3300031456 Ga0307513_10097365 Ga0307513_100973652 269
169 3300031616 Ga0307508_10001048 Ga0307508_1000104823 269
170 3300031649 Ga0307514_10031572 Ga0307514_100315723 269
171 3300039447 Ga0436361_0480362 Ga0436361_0480362_127_996 269
172 3300039447 Ga0436361_0689999 Ga0436361_0689999_5980_6888 269
173 3300046474 Ga0495605_0086778 Ga0495605_0086778_278_1168 269
174 3300046512 Ga0495610_0033752 Ga0495610_0033752_1104_1988 269
175 3300046519 Ga0495632_0025622 Ga0495632_0025622_1278_2162 269
176 3300053739 Ga0500587_013771 Ga0500587_013771_43_927 269
177 iso_pu_bacteria 2511231003 2511251600 269
178 iso_pu_bacteria 2602042109 2603868379 269
179 iso_pu_bacteria 2643221690 2644503330 269
180 iso_pu_bacteria 2765235838 2765568120 269
181 iso_pu_bacteria 2795385470 2795785421 269
182 iso_pu_bacteria 2808606386 2808983633 269
183 iso_pu_bacteria 2808606415 2809129297 269
184 iso_pu_bacteria 2808606419 2809149648 269
185 iso_pu_bacteria 2839094727 2839097587 269
186 iso_pu_bacteria 2852618963 2852619800 269
187 iso_pu_bacteria 2884811622 2884811800 269
188 iso_pu_bacteria 2884836552 2884839791 269
189 iso_pu_bacteria 2884852848 2884856398 269
190 iso_pu_bacteria 2888373701 2888375140 269
191 iso_pu_bacteria 2895427314 2895430171 269
192 iso_pu_bacteria 2896154374 2896158763 269
193 iso_pu_bacteria 2908669403 2908673900 269
194 iso_pu_bacteria 8003314358 8003318742 269
195 3300003751 Ga0055538_1000059 Ga0055538_100005947 270
196 3300003752 Ga0055539_1000089 Ga0055539_100008947 270
197 3300003756 Ga0055533_1000098 Ga0055533_100009847 270
198 3300003759 Ga0055525_1000130 Ga0055525_100013047 270
199 3300003841 Ga0055541_1000061 Ga0055541_100006147 270
200 3300005455 Ga0070663_100032160 Ga0070663_1000321603 270
201 3300005563 Ga0068855_100000366 Ga0068855_10000036651 270
202 3300005563 Ga0068855_100041258 Ga0068855_1000412582 270
203 3300005577 Ga0068857_100251196 Ga0068857_1002511962 270
204 3300005578 Ga0068854_100005738 Ga0068854_1000057383 270
205 3300005834 Ga0068851_10102046 Ga0068851_101020462 270
206 3300005834 Ga0068851_10157609 Ga0068851_101576092 270
207 3300006946 Ga0079104_1012486 Ga0079104_10124862 270
208 3300009036 Ga0105244_10026662 Ga0105244_100266622 270
209 3300009093 Ga0105240_10124062 Ga0105240_101240622 270
210 3300009545 Ga0105237_10002495 Ga0105237_100024954 270
211 3300009551 Ga0105238_10000031 Ga0105238_10000031110 270
212 3300009553 Ga0105249_10204011 Ga0105249_102040113 270
213 3300010375 Ga0105239_10004287 Ga0105239_100042877 270
214 3300015261 Ga0182006_1000874 Ga0182006_10008742 270
215 3300015262 Ga0182007_10045024 Ga0182007_100450241 270
216 3300021361 Ga0213872_10005805 Ga0213872_100058053 270
217 3300021361 Ga0213872_10014729 Ga0213872_100147292 270
218 3300021384 Ga0213876_10047398 Ga0213876_100473982 270
219 3300025224 Ga0209784_100018 Ga0209784_100018287 270
220 3300025225 Ga0209566_100016 Ga0209566_100016287 270
221 3300025226 Ga0209674_100030 Ga0209674_100030287 270
222 3300025230 Ga0209563_100034 Ga0209563_100034287 270
223 3300025253 Ga0209677_100019 Ga0209677_100019287 270
224 3300025913 Ga0207695_10000480 Ga0207695_100004806 270
225 3300025914 Ga0207671_10003970 Ga0207671_100039703 270
226 3300025924 Ga0207694_10000062 Ga0207694_1000006222 270
227 3300025949 Ga0207667_10000044 Ga0207667_10000044165 270
228 3300025949 Ga0207667_10013042 Ga0207667_100130424 270
229 3300025981 Ga0207640_10012781 Ga0207640_100127813 270
230 3300026067 Ga0207678_10000040 Ga0207678_1000004038 270
231 3300026116 Ga0207674_10203653 Ga0207674_102036532 270
232 3300027111 Ga0209281_1020393 Ga0209281_10203931 270
233 3300028380 Ga0268265_10429602 Ga0268265_104296022 270
234 3300028794 Ga0307515_10003694 Ga0307515_100036949 270
235 3300031691 Ga0316579_10068377 Ga0316579_100683772 270
236 3300031727 Ga0316576_10007563 Ga0316576_100075634 270
237 3300031728 Ga0316578_10012740 Ga0316578_100127405 270
238 3300031730 Ga0307516_10001109 Ga0307516_1000110924 270
239 3300035398 Ga0316574_0290303 Ga0316574_0290303_24_857 270
240 3300036647 Ga0316582_0178767 Ga0316582_0178767_43_876 270
241 3300036712 Ga0316584_0190816 Ga0316584_0190816_430_1263 270
242 3300039437 Ga0436365_1474640 Ga0436365_1474640_2148_2987 270
243 3300039447 Ga0436361_0220616 Ga0436361_0220616_239_1177 270
244 3300039447 Ga0436361_0584428 Ga0436361_0584428_1749_2612 270
245 3300041463 Ga0451804_0918993 Ga0451804_0918993_159_1067 270
246 3300046522 Ga0495643_0050031 Ga0495643_0050031_788_1696 270
247 3300046660 Ga0495625_0016386 Ga0495625_0016386_1075_1983 270
248 3300048924 Ga0496121_0044124 Ga0496121_0044124_715_1596 270
249 3300048924 Ga0496121_0322559 Ga0496121_0322559_57_932 270
250 3300053125 Ga0500618_000901 Ga0500618_000901_953_1834 270
251 3300053125 Ga0500618_001175 Ga0500618_001175_11474_12397 270
252 3300053125 Ga0500618_004390 Ga0500618_004390_2951_3856 270
253 iso_pu_bacteria 2521172590 2521560422 270
254 iso_pu_bacteria 2551306416 2553005533 270
255 iso_pu_bacteria 2599185240 2599747327 270
256 iso_pu_bacteria 2599185355 2600209048 270
257 iso_pu_bacteria 2667528173 2671107884 270
258 iso_pu_bacteria 2675903129 2676745076 270
259 iso_pu_bacteria 2724679232 2725946908 270
260 iso_pu_bacteria 2738541272 2738697296 270
261 iso_pu_bacteria 2738543027 2739326806 270
262 iso_pu_bacteria 2765235838 2765567911 270
263 iso_pu_bacteria 2808606386 2808982855 270
264 iso_pu_bacteria 2808606415 2809130367 270
265 iso_pu_bacteria 2808606419 2809150156 270
266 iso_pu_bacteria 2818991449 2819617094 270
267 iso_pu_bacteria 2818991472 2819744702 270
268 iso_pu_bacteria 2839094727 2839097802 270
269 iso_pu_bacteria 2852618963 2852621623 270
270 iso_pu_bacteria 2889042446 2889045282 270
271 iso_pu_bacteria 2904439833 2904442722 270
272 iso_pu_bacteria 2904474040 2904476899 270
273 iso_pu_bacteria 2904490793 2904492156 270
274 iso_pu_bacteria 2904530477 2904535065 270
275 iso_pu_bacteria 2904584206 2904588597 270
276 iso_pu_bacteria 2904589729 2904594329 270
277 iso_pu_bacteria 2904601388 2904604828 270
278 iso_pu_bacteria 2919046199 2919047351 270
279 iso_pu_bacteria 2919079590 2919083069 270
280 iso_pu_bacteria 2919150387 2919153068 270
281 iso_pu_bacteria 2919160200 2919161385 270
282 iso_pu_bacteria 2923510766 2923514200 270
283 iso_pu_bacteria 2927143783 2927147029 270
284 iso_pu_bacteria 2928130867 2928132923 270
285 iso_pu_bacteria 2931384279 2931388715 270
286 iso_pu_bacteria 2945991243 2945992707 270
287 iso_pu_bacteria 2946053406 2946055459 270
288 iso_pu_bacteria 8054849141 8054851158 270
289 iso_pu_bacteria 8057304971 8057306932 270
290 3300002704 JGI25155J39150_1000192 JGI25155J39150_10001923 271
291 3300002704 JGI25155J39150_1001145 JGI25155J39150_10011453 271
292 3300002705 JGI25156J39149_1000077 JGI25156J39149_100007768 271
293 3300002705 JGI25156J39149_1000098 JGI25156J39149_100009813 271
294 3300002738 JGI25154J39366_1000103 JGI25154J39366_100010368 271
295 3300002738 JGI25154J39366_1003016 JGI25154J39366_10030162 271
296 3300002738 JGI25154J39366_1004497 JGI25154J39366_10044971 271
297 3300002741 JGI25157J39369_1000668 JGI25157J39369_10006686 271
298 3300003758 Ga0055532_1000034 Ga0055532_1000034108 271
299 3300005327 Ga0070658_10007287 Ga0070658_100072873 271
300 3300005329 Ga0070683_100055726 Ga0070683_1000557263 271
301 3300005329 Ga0070683_100288301 Ga0070683_1002883012 271
302 3300005336 Ga0070680_100405030 Ga0070680_1004050301 271
303 3300005339 Ga0070660_100027547 Ga0070660_1000275474 271
304 3300005344 Ga0070661_100055402 Ga0070661_1000554023 271
305 3300005366 Ga0070659_100098961 Ga0070659_1000989613 271
306 3300005458 Ga0070681_10139293 Ga0070681_101392932 271
307 3300005530 Ga0070679_100010324 Ga0070679_1000103245 271
308 3300005535 Ga0070684_100063768 Ga0070684_1000637683 271
309 3300005614 Ga0068856_100364720 Ga0068856_1003647202 271
310 3300005616 Ga0068852_100359951 Ga0068852_1003599512 271
311 3300006042 Ga0075368_10005280 Ga0075368_100052802 271
312 3300006178 Ga0075367_10005258 Ga0075367_100052585 271
313 3300006195 Ga0075366_10045115 Ga0075366_100451152 271
314 3300006946 Ga0079104_1000003 Ga0079104_1000003345 271
315 3300009011 Ga0105251_10038404 Ga0105251_100384042 271
316 3300009093 Ga0105240_10000799 Ga0105240_1000079952 271
317 3300009093 Ga0105240_10009192 Ga0105240_1000919217 271
318 3300009551 Ga0105238_10042170 Ga0105238_100421705 271
319 3300010375 Ga0105239_10095021 Ga0105239_100950214 271
320 3300010375 Ga0105239_10748068 Ga0105239_107480682 271
321 3300013105 Ga0157369_10361694 Ga0157369_103616943 271
322 3300013307 Ga0157372_10254983 Ga0157372_102549833 271
323 3300014497 Ga0182008_10033470 Ga0182008_100334702 271
324 3300014497 Ga0182008_10095085 Ga0182008_100950852 271
325 3300015261 Ga0182006_1022705 Ga0182006_10227054 271
326 3300025206 Ga0209435_100007 Ga0209435_100007108 271
327 3300025206 Ga0209435_100124 Ga0209435_1001249 271
328 3300025229 Ga0209147_100017 Ga0209147_100017364 271
329 3300025233 Ga0209437_100215 Ga0209437_10021585 271
330 3300025242 Ga0209258_100115 Ga0209258_10011597 271
331 3300025246 Ga0209646_1000044 Ga0209646_1000044205 271
332 3300025246 Ga0209646_1000238 Ga0209646_100023819 271
333 3300025250 Ga0209026_1000063 Ga0209026_1000063108 271
334 3300025250 Ga0209026_1006998 Ga0209026_10069981 271
335 3300025256 Ga0209759_1000048 Ga0209759_1000048108 271
336 3300025256 Ga0209759_1006095 Ga0209759_10060952 271
337 3300025909 Ga0207705_10048639 Ga0207705_100486393 271
338 3300025913 Ga0207695_10002743 Ga0207695_1000274317 271
339 3300025939 Ga0207665_10135723 Ga0207665_101357233 271
340 3300025944 Ga0207661_10065173 Ga0207661_100651733 271
341 3300025944 Ga0207661_10233292 Ga0207661_102332922 271
342 3300026078 Ga0207702_10549229 Ga0207702_105492291 271
343 3300026116 Ga0207674_10163914 Ga0207674_101639142 271
344 3300027111 Ga0209281_1000002 Ga0209281_10000021558 271
345 3300046660 Ga0495625_0000428 Ga0495625_0000428_1510_2397 271
346 3300048919 Ga0496116_0005552 Ga0496116_0005552_1178_2062 271
347 3300048919 Ga0496116_0026638 Ga0496116_0026638_1797_2714 271
348 3300048921 Ga0496118_0190743 Ga0496118_0190743_71_988 271
349 3300048924 Ga0496121_0010160 Ga0496121_0010160_7246_8118 271
350 3300048924 Ga0496121_0186814 Ga0496121_0186814_219_1103 271
351 3300048925 Ga0496122_0000570 Ga0496122_0000570_1435_2322 271
352 3300048925 Ga0496122_0003675 Ga0496122_0003675_1634_2551 271
353 3300048926 Ga0496123_0000438 Ga0496123_0000438_637_1524 271
354 3300048926 Ga0496123_0002948 Ga0496123_0002948_1641_2558 271
355 3300048928 Ga0496125_0000701 Ga0496125_0000701_41336_42250 271
356 3300048928 Ga0496125_0003276 Ga0496125_0003276_1638_2555 271
357 3300050494 nmdc:mga06z11_3522_c1 nmdc:mga06z11_3522_c1_2513_3346 271
358 3300050495 nmdc:mga04h51_2391_c1 nmdc:mga04h51_2391_c1_1736_2569 271
359 iso_pu_bacteria 2506520007 2506576609 271
360 iso_pu_bacteria 2506520008 2506581747 271
361 iso_pu_bacteria 2508501071 2508850556 271
362 iso_pu_bacteria 2654587920 2656275750 271
363 iso_pu_bacteria 2687453601 2689442985 271
364 iso_pu_bacteria 2751185734 2753076412 271
365 iso_pu_bacteria 2786546132 2786666841 271
366 iso_pu_bacteria 2806310673 2807177901 271
367 iso_pu_bacteria 2818991438 2819551646 271
368 iso_pu_bacteria 2869551831 2869552389 271
369 iso_pu_bacteria 2891395885 2891402160 271
370 iso_pu_bacteria 2954673503 2954681926 271
371 iso_pu_bacteria 2954682443 2954690998 271
372 iso_pu_bacteria 2990059506 2990064129 271
373 iso_pu_bacteria 640753048 640936149 271
374 3300003322 rootL2_10046969 rootL2_100469692 272
375 3300003354 JGI25160J50197_1012539 JGI25160J50197_10125393 272
376 3300003354 JGI25160J50197_1048070 JGI25160J50197_10480701 272
377 3300003578 Ga0006562J51391_1034596 Ga0006562J51391_10345963 272
378 3300003856 Ga0058692_1000208 Ga0058692_100020826 272
379 3300003856 Ga0058692_1012865 Ga0058692_10128652 272
380 3300005577 Ga0068857_100395760 Ga0068857_1003957602 272
381 3300005937 Ga0081455_10032557 Ga0081455_100325574 272
382 3300009036 Ga0105244_10000690 Ga0105244_1000069028 272
383 3300011119 Ga0105246_10008663 Ga0105246_100086632 272
384 3300025302 Ga0207426_1003013 Ga0207426_10030137 272
385 3300025302 Ga0207426_1006750 Ga0207426_10067502 272
386 3300025302 Ga0207426_1015986 Ga0207426_10159862 272
387 3300025728 Ga0207655_1005786 Ga0207655_10057862 272
388 3300026116 Ga0207674_10360944 Ga0207674_103609442 272
389 3300027312 Ga0209371_1000134 Ga0209371_1000134105 272
390 3300027312 Ga0209371_1002387 Ga0209371_10023873 272
391 3300030500 Ga0268256_1003318 Ga0268256_10033184 272
392 3300030500 Ga0268256_1004842 Ga0268256_10048423 272
393 3300031712 Ga0265342_10075332 Ga0265342_100753322 272
394 3300042134 Ga0450898_002025 Ga0450898_002025_1764_2672 272
395 3300042135 Ga0450899_000209 Ga0450899_000209_1208_2116 272
396 3300044693 Ga0466961_0101424 Ga0466961_0101424_408_1268 272
397 3300046458 Ga0495591_000006 Ga0495591_000006_95006_95860 272
398 3300046458 Ga0495591_000933 Ga0495591_000933_3103_3942 272
399 3300046460 Ga0495638_0116477 Ga0495638_0116477_283_1134 272
400 3300046474 Ga0495605_0000037 Ga0495605_0000037_19771_20610 272
401 3300046474 Ga0495605_0113557 Ga0495605_0113557_179_1030 272
402 3300046476 Ga0495662_0011382 Ga0495662_0011382_1682_2521 272
403 3300046501 Ga0495607_0000149 Ga0495607_0000149_32998_33837 272
404 3300046515 Ga0495620_0000296 Ga0495620_0000296_17658_18497 272
405 3300046522 Ga0495643_0059077 Ga0495643_0059077_482_1333 272
406 3300046524 Ga0495648_0150218 Ga0495648_0150218_120_959 272
407 3300046530 Ga0495654_0000013 Ga0495654_0000013_147296_148150 272
408 3300046616 Ga0495668_0028856 Ga0495668_0028856_1394_2233 272
409 3300046663 Ga0495635_0048642 Ga0495635_0048642_1164_2003 272
410 3300046665 Ga0495661_0071627 Ga0495661_0071627_1056_1895 272
411 3300046689 Ga0495613_0027459 Ga0495613_0027459_863_1702 272
412 3300047321 Ga0495676_0086254 Ga0495676_0086254_34_876 272
413 3300047443 Ga0495687_010867 Ga0495687_010867_3080_3931 272
414 3300047446 Ga0495679_040234 Ga0495679_040234_37_888 272
415 3300047469 Ga0495673_0002720 Ga0495673_0002720_8087_8926 272
416 3300048913 Ga0496110_0131045 Ga0496110_0131045_1307_2146 272
417 3300048920 Ga0496117_0000858 Ga0496117_0000858_17419_18246 272
418 3300048921 Ga0496118_0016088 Ga0496118_0016088_3500_4327 272
419 3300048922 Ga0496119_0002429 Ga0496119_0002429_8145_8972 272
420 3300048923 Ga0496120_0008793 Ga0496120_0008793_419_1246 272
421 3300048925 Ga0496122_0101295 Ga0496122_0101295_528_1355 272
422 3300048926 Ga0496123_0009809 Ga0496123_0009809_5749_6576 272
423 3300048926 Ga0496123_0077038 Ga0496123_0077038_281_1135 272
424 3300048927 Ga0496124_0001245 Ga0496124_0001245_14372_15199 272
425 3300048927 Ga0496124_0338350 Ga0496124_0338350_81_1004 272
426 3300048928 Ga0496125_0000997 Ga0496125_0000997_14687_15514 272
427 3300048929 Ga0496126_0011165 Ga0496126_0011165_4380_5207 272
428 3300048929 Ga0496126_0080694 Ga0496126_0080694_1104_1958 272
429 3300049460 Ga0495682_0001456 Ga0495682_0001456_5837_6676 272
430 3300049576 Ga0501040_0060591 Ga0501040_0060591_378_1274 272
431 iso_pu_bacteria 2585427591 2585827026 272
432 iso_pu_bacteria 2585427592 2585833080 272
433 iso_pu_bacteria 2751185782 2753270110 272
434 iso_pu_bacteria 2990059506 2990066970 272
435 3300002737 JGI25162J39368_1000067 JGI25162J39368_1000067108 273
436 3300002771 JGI25163J39215_1000114 JGI25163J39215_100011417 273
437 3300002772 JGI25164J39214_1000039 JGI25164J39214_100003931 273
438 3300003316 rootH1_10101285 rootH1_101012852 273
439 3300003316 rootH1_10175001 rootH1_101750012 273
440 3300003320 rootH2_10154600 rootH2_101546002 273
441 3300003322 rootL2_10072560 rootL2_100725602 273
442 3300003323 rootH1_10090190 rootH1_100901901 273
443 3300003751 Ga0055538_1000052 Ga0055538_100005231 273
444 3300003752 Ga0055539_1000077 Ga0055539_100007731 273
445 3300003756 Ga0055533_1000083 Ga0055533_100008331 273
446 3300003759 Ga0055525_1000110 Ga0055525_100011031 273
447 3300003841 Ga0055541_1000054 Ga0055541_100005431 273
448 3300005289 Ga0065704_10000086 Ga0065704_1000008614 273
449 3300005293 Ga0065715_10001912 Ga0065715_100019125 273
450 3300005327 Ga0070658_10028027 Ga0070658_100280272 273
451 3300005329 Ga0070683_100147444 Ga0070683_1001474441 273
452 3300005336 Ga0070680_100245152 Ga0070680_1002451522 273
453 3300005340 Ga0070689_100125795 Ga0070689_1001257952 273
454 3300005344 Ga0070661_100063873 Ga0070661_1000638731 273
455 3300005366 Ga0070659_100189195 Ga0070659_1001891951 273
456 3300005435 Ga0070714_100031348 Ga0070714_1000313481 273
457 3300005437 Ga0070710_10178135 Ga0070710_101781352 273
458 3300005458 Ga0070681_10109540 Ga0070681_101095403 273
459 3300005535 Ga0070684_100077083 Ga0070684_1000770832 273
460 3300005535 Ga0070684_100271218 Ga0070684_1002712182 273
461 3300005539 Ga0068853_100045923 Ga0068853_1000459233 273
462 3300005577 Ga0068857_100043585 Ga0068857_1000435853 273
463 3300005615 Ga0070702_100042509 Ga0070702_1000425091 273
464 3300005616 Ga0068852_100235036 Ga0068852_1002350362 273
465 3300006175 Ga0070712_100065041 Ga0070712_1000650413 273
466 3300009036 Ga0105244_10018611 Ga0105244_100186112 273
467 3300009092 Ga0105250_10001925 Ga0105250_100019255 273
468 3300009093 Ga0105240_10001342 Ga0105240_1000134237 273
469 3300009098 Ga0105245_10017716 Ga0105245_100177162 273
470 3300009177 Ga0105248_10352031 Ga0105248_103520312 273
471 3300009545 Ga0105237_10001632 Ga0105237_100016323 273
472 3300009545 Ga0105237_10716216 Ga0105237_107162162 273
473 3300009551 Ga0105238_10128765 Ga0105238_101287652 273
474 3300009551 Ga0105238_10665890 Ga0105238_106658901 273
475 3300013102 Ga0157371_10000075 Ga0157371_1000007523 273
476 3300013102 Ga0157371_10009934 Ga0157371_100099346 273
477 3300013105 Ga0157369_10076389 Ga0157369_100763891 273
478 3300014497 Ga0182008_10010812 Ga0182008_100108123 273
479 3300015262 Ga0182007_10000409 Ga0182007_1000040915 273
480 3300021384 Ga0213876_10006516 Ga0213876_100065166 273
481 3300021384 Ga0213876_10103894 Ga0213876_101038942 273
482 3300025207 Ga0209760_100070 Ga0209760_10007018 273
483 3300025224 Ga0209784_100012 Ga0209784_100012468 273
484 3300025225 Ga0209566_100010 Ga0209566_100010468 273
485 3300025226 Ga0209674_100023 Ga0209674_100023468 273
486 3300025230 Ga0209563_100027 Ga0209563_100027468 273
487 3300025231 Ga0207427_100017 Ga0207427_100017468 273
488 3300025233 Ga0209437_100029 Ga0209437_100029468 273
489 3300025253 Ga0209677_100014 Ga0209677_100014468 273
490 3300025261 Ga0209233_1000890 Ga0209233_100089010 273
491 3300025711 Ga0207696_1000658 Ga0207696_10006588 273
492 3300025728 Ga0207655_1000243 Ga0207655_100024353 273
493 3300025728 Ga0207655_1001127 Ga0207655_10011272 273
494 3300025904 Ga0207647_10023123 Ga0207647_100231234 273
495 3300025912 Ga0207707_10069790 Ga0207707_100697903 273
496 3300025912 Ga0207707_10084117 Ga0207707_100841172 273
497 3300025914 Ga0207671_10004346 Ga0207671_100043463 273
498 3300025918 Ga0207662_10021286 Ga0207662_100212862 273
499 3300025921 Ga0207652_10093598 Ga0207652_100935982 273
500 3300025929 Ga0207664_10249369 Ga0207664_102493692 273
501 3300025939 Ga0207665_10031939 Ga0207665_100319392 273
502 3300025941 Ga0207711_10050225 Ga0207711_100502252 273
503 3300025944 Ga0207661_10035293 Ga0207661_100352934 273
504 3300025945 Ga0207679_10320871 Ga0207679_103208711 273
505 3300026116 Ga0207674_10004347 Ga0207674_100043473 273
506 3300026142 Ga0207698_10084201 Ga0207698_100842012 273
507 3300031238 Ga0265332_10002813 Ga0265332_100028135 273
508 3300031456 Ga0307513_10011059 Ga0307513_100110599 273
509 3300031507 Ga0307509_10014751 Ga0307509_100147519 273
510 3300031838 Ga0307518_10064698 Ga0307518_100646982 273
511 3300032004 Ga0307414_10003179 Ga0307414_100031795 273
512 3300035120 Ga0373957_0062710 Ga0373957_0062710_419_1279 273
513 3300035725 Ga0373947_0110565 Ga0373947_0110565_660_1553 273
514 3300037466 Ga0395898_0010491 Ga0395898_0010491_3500_4402 273
515 3300037853 Ga0436364_0380175 Ga0436364_0380175_3521_4363 273
516 3300038443 Ga0395901_0125450 Ga0395901_0125450_140_1045 273
517 3300039437 Ga0436365_0837397 Ga0436365_0837397_3431_4294 273
518 3300039437 Ga0436365_1283794 Ga0436365_1283794_2409_3251 273
519 3300039450 Ga0436363_0853496 Ga0436363_0853496_615_1457 273
520 3300039453 Ga0436362_1175501 Ga0436362_1175501_155_1018 273
521 3300041405 Ga0439438_000018 Ga0439438_000018_27336_28193 273
522 3300041999 Ga0439433_0028063 Ga0439433_0028063_345_1262 273
523 3300042006 Ga0439432_011248 Ga0439432_011248_1332_2189 273
524 3300042014 Ga0439457_000120 Ga0439457_000120_10353_11270 273
525 3300042014 Ga0439457_025458 Ga0439457_025458_19_909 273
526 3300042131 Ga0450894_000440 Ga0450894_000440_5523_6413 273
527 3300042145 Ga0450906_000137 Ga0450906_000137_791_1681 273
528 3300044656 Ga0466969_0024240 Ga0466969_0024240_1759_2661 273
529 3300044658 Ga0466972_0001073 Ga0466972_0001073_1745_2647 273
530 3300044693 Ga0466961_0036482 Ga0466961_0036482_784_1686 273
531 3300044901 Ga0466960_0063861 Ga0466960_0063861_724_1632 273
532 3300045051 Ga0451576_0077319 Ga0451576_0077319_15_875 273
533 3300045976 Ga0466967_0513494 Ga0466967_0513494_227_1087 273
534 3300046471 Ga0495650_0000102 Ga0495650_0000102_61066_61920 273
535 3300046500 Ga0495596_0008274 Ga0495596_0008274_3761_4627 273
536 3300046506 Ga0495583_0006587 Ga0495583_0006587_4774_5622 273
537 3300046516 Ga0495628_0206277 Ga0495628_0206277_87_989 273
538 3300046542 Ga0495597_0017251 Ga0495597_0017251_1022_1924 273
539 3300046616 Ga0495668_0027794 Ga0495668_0027794_498_1400 273
540 3300046689 Ga0495613_0171300 Ga0495613_0171300_576_1436 273
541 3300046689 Ga0495613_0230963 Ga0495613_0230963_303_1205 273
542 3300046810 Ga0495660_0000006 Ga0495660_0000006_454305_455159 273
543 3300046810 Ga0495660_0080977 Ga0495660_0080977_241_1143 273
544 3300047443 Ga0495687_002821 Ga0495687_002821_6761_7663 273
545 3300048088 Ga0495602_0017711 Ga0495602_0017711_3502_4356 273
546 3300048907 Ga0496104_0001453 Ga0496104_0001453_10873_11727 273
547 3300048907 Ga0496104_0138784 Ga0496104_0138784_1048_1941 273
548 3300048908 Ga0496105_0404251 Ga0496105_0404251_26_919 273
549 3300048911 Ga0496108_0033009 Ga0496108_0033009_922_1815 273
550 3300048912 Ga0496109_0284820 Ga0496109_0284820_485_1378 273
551 3300048915 Ga0496112_0112870 Ga0496112_0112870_1551_2444 273
552 3300048916 Ga0496113_0009247 Ga0496113_0009247_4088_4981 273
553 3300048919 Ga0496116_0000020 Ga0496116_0000020_470268_471122 273
554 3300048920 Ga0496117_0006493 Ga0496117_0006493_2386_3240 273
555 3300048920 Ga0496117_0067039 Ga0496117_0067039_1278_2189 273
556 3300048921 Ga0496118_0002115 Ga0496118_0002115_11165_12076 273
557 3300048921 Ga0496118_0003691 Ga0496118_0003691_604_1458 273
558 3300048923 Ga0496120_0014276 Ga0496120_0014276_1182_2036 273
559 3300048924 Ga0496121_0001569 Ga0496121_0001569_22376_23260 273
560 3300048925 Ga0496122_0000010 Ga0496122_0000010_170749_171603 273
561 3300048925 Ga0496122_0068821 Ga0496122_0068821_58_885 273
562 3300048926 Ga0496123_0000061 Ga0496123_0000061_45075_45929 273
563 3300048927 Ga0496124_0000084 Ga0496124_0000084_32760_33614 273
564 3300048927 Ga0496124_0001315 Ga0496124_0001315_24387_25271 273
565 3300048928 Ga0496125_0000071 Ga0496125_0000071_45624_46478 273
566 3300048929 Ga0496126_0002615 Ga0496126_0002615_13643_14497 273
567 3300049459 Ga0495678_048847 Ga0495678_048847_391_1293 273
568 3300049569 Ga0501032_0000476 Ga0501032_0000476_9837_10682 273
569 3300049572 Ga0501036_0006947 Ga0501036_0006947_6224_7069 273
570 3300049579 Ga0501043_0146688 Ga0501043_0146688_914_1759 273
571 3300049580 Ga0501046_0083449 Ga0501046_0083449_237_1082 273
572 3300049580 Ga0501046_0145754 Ga0501046_0145754_707_1552 273
573 3300049581 Ga0501047_0079870 Ga0501047_0079870_1385_2230 273
574 3300049582 Ga0501048_0213867 Ga0501048_0213867_211_1056 273
575 3300049822 Ga0501035_0000543 Ga0501035_0000543_16593_17438 273
576 3300049823 Ga0501044_0000127 Ga0501044_0000127_21729_22574 273
577 3300050514 nmdc:mga08x19_284836_c1 nmdc:mga08x19_284836_c1_34_897 273
578 3300053077 Ga0495601_0149649 Ga0495601_0149649_538_1431 273
579 iso_pu_bacteria 2585427527 2585535305 273
580 iso_pu_bacteria 2615840626 2616310888 273
581 iso_pu_bacteria 2738541279 2738732331 273
582 iso_pu_bacteria 2738541285 2738764896 273
583 iso_pu_bacteria 2738543007 2739213911 273
584 iso_pu_bacteria 2784746763 2785339113 273
585 iso_pu_bacteria 2867346516 2867348327 273
586 iso_pu_bacteria 2877676314 2877683653 273
587 iso_pu_bacteria 2947224130 2947224256 273
588 3300003320 rootH2_10144418 rootH2_101444181 274
589 3300005289 Ga0065704_10097814 Ga0065704_100978142 274
590 3300005295 Ga0065707_10083832 Ga0065707_100838326 274
591 3300005354 Ga0070675_100073419 Ga0070675_1000734192 274
592 3300005354 Ga0070675_100224108 Ga0070675_1002241082 274
593 3300005364 Ga0070673_100102779 Ga0070673_1001027791 274
594 3300005366 Ga0070659_100258314 Ga0070659_1002583142 274
595 3300005435 Ga0070714_100002746 Ga0070714_1000027466 274
596 3300005543 Ga0070672_100028803 Ga0070672_1000288034 274
597 3300005577 Ga0068857_100071577 Ga0068857_1000715774 274
598 3300005577 Ga0068857_100190532 Ga0068857_1001905322 274
599 3300005614 Ga0068856_100359894 Ga0068856_1003598943 274
600 3300005844 Ga0068862_100028380 Ga0068862_1000283804 274
601 3300006195 Ga0075366_10006496 Ga0075366_100064962 274
602 3300006946 Ga0079104_1002334 Ga0079104_10023344 274
603 3300009011 Ga0105251_10000136 Ga0105251_1000013663 274
604 3300009011 Ga0105251_10003397 Ga0105251_100033978 274
605 3300009011 Ga0105251_10003413 Ga0105251_100034137 274
606 3300009036 Ga0105244_10132082 Ga0105244_101320822 274
607 3300009036 Ga0105244_10175036 Ga0105244_101750361 274
608 3300009092 Ga0105250_10004638 Ga0105250_100046384 274
609 3300009093 Ga0105240_10000219 Ga0105240_1000021970 274
610 3300009094 Ga0111539_10004450 Ga0111539_100044508 274
611 3300009101 Ga0105247_10000147 Ga0105247_1000014748 274
612 3300009147 Ga0114129_10062463 Ga0114129_100624632 274
613 3300009174 Ga0105241_10000008 Ga0105241_1000000870 274
614 3300009174 Ga0105241_10091304 Ga0105241_100913042 274
615 3300009545 Ga0105237_10000111 Ga0105237_1000011183 274
616 3300009545 Ga0105237_10001966 Ga0105237_100019661 274
617 3300009545 Ga0105237_10083766 Ga0105237_100837662 274
618 3300009551 Ga0105238_10104066 Ga0105238_101040666 274
619 3300009553 Ga0105249_10004825 Ga0105249_100048253 274
620 3300011119 Ga0105246_10120365 Ga0105246_101203652 274
621 3300013100 Ga0157373_10181475 Ga0157373_101814752 274
622 3300013307 Ga0157372_10025546 Ga0157372_100255462 274
623 3300015688 Ga0183367_1011 Ga0183367_101142 274
624 3300017792 Ga0163161_10000002 Ga0163161_10000002118 274
625 3300017792 Ga0163161_10000012 Ga0163161_10000012177 274
626 3300020082 Ga0206353_10332444 Ga0206353_103324443 274
627 3300025233 Ga0209437_100647 Ga0209437_1006477 274
628 3300025315 Ga0207697_10034961 Ga0207697_100349612 274
629 3300025711 Ga0207696_1000009 Ga0207696_1000009254 274
630 3300025735 Ga0207713_1000034 Ga0207713_100003476 274
631 3300025735 Ga0207713_1000055 Ga0207713_100005559 274
632 3300025735 Ga0207713_1019768 Ga0207713_10197683 274
633 3300025900 Ga0207710_10000015 Ga0207710_10000015270 274
634 3300025904 Ga0207647_10005581 Ga0207647_100055817 274
635 3300025911 Ga0207654_10000009 Ga0207654_1000000970 274
636 3300025913 Ga0207695_10000048 Ga0207695_10000048309 274
637 3300025914 Ga0207671_10000087 Ga0207671_10000087119 274
638 3300025914 Ga0207671_10003849 Ga0207671_100038497 274
639 3300025929 Ga0207664_10215919 Ga0207664_102159192 274
640 3300025961 Ga0207712_10009028 Ga0207712_100090284 274
641 3300026078 Ga0207702_10345831 Ga0207702_103458313 274
642 3300026116 Ga0207674_10079829 Ga0207674_100798294 274
643 3300026116 Ga0207674_10190262 Ga0207674_101902623 274
644 3300027111 Ga0209281_1000054 Ga0209281_100005453 274
645 3300027111 Ga0209281_1012901 Ga0209281_10129012 274
646 3300027907 Ga0207428_10072003 Ga0207428_100720032 274
647 3300028380 Ga0268265_10008416 Ga0268265_100084164 274
648 3300028786 Ga0307517_10018496 Ga0307517_100184967 274
649 3300028794 Ga0307515_10099669 Ga0307515_100996693 274
650 3300030521 Ga0307511_10119094 Ga0307511_101190942 274
651 3300031456 Ga0307513_10251801 Ga0307513_102518012 274
652 3300031616 Ga0307508_10014270 Ga0307508_100142705 274
653 3300031649 Ga0307514_10005174 Ga0307514_1000517410 274
654 3300031649 Ga0307514_10101389 Ga0307514_101013892 274
655 3300031730 Ga0307516_10023170 Ga0307516_100231703 274
656 3300031730 Ga0307516_10338217 Ga0307516_103382171 274
657 3300031730 Ga0307516_10343482 Ga0307516_103434822 274
658 3300031838 Ga0307518_10230503 Ga0307518_102305032 274
659 3300032002 Ga0307416_100055870 Ga0307416_1000558702 274
660 3300033179 Ga0307507_10000007 Ga0307507_1000000719 274
661 3300041443 Ga0451789_0906811 Ga0451789_0906811_985_1860 274
662 3300042006 Ga0439432_001254 Ga0439432_001254_6643_7506 274
663 3300042007 Ga0439449_0000378 Ga0439449_0000378_5745_6653 274
664 3300042007 Ga0439449_0037996 Ga0439449_0037996_50_943 274
665 3300042157 Ga0439458_0003854 Ga0439458_0003854_1434_2336 274
666 3300042157 Ga0439458_0006900 Ga0439458_0006900_155_1063 274
667 3300044656 Ga0466969_0082058 Ga0466969_0082058_471_1328 274
668 3300044684 Ga0466966_0009910 Ga0466966_0009910_2741_3589 274
669 3300044684 Ga0466966_0068979 Ga0466966_0068979_1135_1992 274
670 3300044684 Ga0466966_0239123 Ga0466966_0239123_186_1034 274
671 3300044693 Ga0466961_0012100 Ga0466961_0012100_3802_4659 274
672 3300044693 Ga0466961_0039268 Ga0466961_0039268_1342_2196 274
673 3300044693 Ga0466961_0126714 Ga0466961_0126714_593_1450 274
674 3300044693 Ga0466961_0172784 Ga0466961_0172784_473_1321 274
675 3300044694 Ga0466963_0041252 Ga0466963_0041252_506_1354 274
676 3300044719 Ga0466971_0006564 Ga0466971_0006564_2789_3637 274
677 3300044719 Ga0466971_0022808 Ga0466971_0022808_1781_2638 274
678 3300044719 Ga0466971_0023476 Ga0466971_0023476_1296_2153 274
679 3300044765 Ga0466970_0009728 Ga0466970_0009728_2414_3271 274
680 3300044765 Ga0466970_0114295 Ga0466970_0114295_602_1450 274
681 3300045049 Ga0466959_0012601 Ga0466959_0012601_2729_3577 274
682 3300045049 Ga0466959_0019241 Ga0466959_0019241_3157_4014 274
683 3300045836 Ga0466958_0020885 Ga0466958_0020885_119_976 274
684 3300045836 Ga0466958_0123481 Ga0466958_0123481_374_1222 274
685 3300046452 Ga0495617_007014 Ga0495617_007014_660_1541 274
686 3300046453 Ga0495627_000042 Ga0495627_000042_78443_79282 274
687 3300046457 Ga0495590_0072797 Ga0495590_0072797_261_1142 274
688 3300046458 Ga0495591_003374 Ga0495591_003374_6626_7507 274
689 3300046458 Ga0495591_016094 Ga0495591_016094_976_1821 274
690 3300046459 Ga0495629_0277115 Ga0495629_0277115_85_1002 274
691 3300046460 Ga0495638_0098673 Ga0495638_0098673_157_1044 274
692 3300046462 Ga0495651_0043595 Ga0495651_0043595_2284_3177 274
693 3300046471 Ga0495650_0001196 Ga0495650_0001196_12494_13375 274
694 3300046474 Ga0495605_0000222 Ga0495605_0000222_38259_39104 274
695 3300046474 Ga0495605_0016761 Ga0495605_0016761_2499_3380 274
696 3300046491 Ga0495584_0009858 Ga0495584_0009858_2917_3798 274
697 3300046492 Ga0495585_0054773 Ga0495585_0054773_29_874 274
698 3300046499 Ga0495594_0049738 Ga0495594_0049738_1321_2208 274
699 3300046501 Ga0495607_0000403 Ga0495607_0000403_21403_22269 274
700 3300046501 Ga0495607_0012756 Ga0495607_0012756_1462_2343 274
701 3300046501 Ga0495607_0023327 Ga0495607_0023327_210_1097 274
702 3300046501 Ga0495607_0049901 Ga0495607_0049901_360_1205 274
703 3300046506 Ga0495583_0001428 Ga0495583_0001428_7390_8271 274
704 3300046506 Ga0495583_0002044 Ga0495583_0002044_11512_12390 274
705 3300046507 Ga0495606_0000094 Ga0495606_0000094_81481_82374 274
706 3300046507 Ga0495606_0000674 Ga0495606_0000674_30832_31713 274
707 3300046507 Ga0495606_0000792 Ga0495606_0000792_35199_36041 274
708 3300046507 Ga0495606_0037720 Ga0495606_0037720_349_1230 274
709 3300046512 Ga0495610_0004252 Ga0495610_0004252_5343_6203 274
710 3300046513 Ga0495616_0022501 Ga0495616_0022501_900_1781 274
711 3300046513 Ga0495616_0135835 Ga0495616_0135835_59_901 274
712 3300046515 Ga0495620_0001367 Ga0495620_0001367_11123_12004 274
713 3300046515 Ga0495620_0001634 Ga0495620_0001634_5523_6383 274
714 3300046518 Ga0495631_0009073 Ga0495631_0009073_1445_2290 274
715 3300046519 Ga0495632_0001504 Ga0495632_0001504_11535_12395 274
716 3300046519 Ga0495632_0028475 Ga0495632_0028475_1397_2278 274
717 3300046519 Ga0495632_0032770 Ga0495632_0032770_745_1626 274
718 3300046519 Ga0495632_0064880 Ga0495632_0064880_28_873 274
719 3300046520 Ga0495637_0000015 Ga0495637_0000015_135246_136127 274
720 3300046520 Ga0495637_0000077 Ga0495637_0000077_28029_28910 274
721 3300046520 Ga0495637_0002223 Ga0495637_0002223_4063_4944 274
722 3300046522 Ga0495643_0009173 Ga0495643_0009173_960_1847 274
723 3300046522 Ga0495643_0013688 Ga0495643_0013688_830_1711 274
724 3300046523 Ga0495644_0000719 Ga0495644_0000719_6824_7705 274
725 3300046524 Ga0495648_0001437 Ga0495648_0001437_17150_17995 274
726 3300046524 Ga0495648_0010818 Ga0495648_0010818_979_1860 274
727 3300046530 Ga0495654_0001350 Ga0495654_0001350_11985_12848 274
728 3300046530 Ga0495654_0019919 Ga0495654_0019919_1597_2460 274
729 3300046538 Ga0495609_0000148 Ga0495609_0000148_55297_56178 274
730 3300046538 Ga0495609_0000162 Ga0495609_0000162_48436_49311 274
731 3300046538 Ga0495609_0004988 Ga0495609_0004988_672_1529 274
732 3300046558 Ga0495633_0139080 Ga0495633_0139080_166_1047 274
733 3300046648 Ga0495611_0001027 Ga0495611_0001027_3652_4533 274
734 3300046660 Ga0495625_0000004 Ga0495625_0000004_318829_319710 274
735 3300046665 Ga0495661_0000006 Ga0495661_0000006_95102_95983 274
736 3300046665 Ga0495661_0032826 Ga0495661_0032826_792_1637 274
737 3300046683 Ga0495658_0044193 Ga0495658_0044193_185_1072 274
738 3300046691 Ga0495670_0007579 Ga0495670_0007579_3245_4132 274
739 3300046691 Ga0495670_0115241 Ga0495670_0115241_113_994 274
740 3300046692 Ga0495671_0008265 Ga0495671_0008265_340_1221 274
741 3300046692 Ga0495671_0037117 Ga0495671_0037117_784_1665 274
742 3300046694 Ga0495649_0172631 Ga0495649_0172631_41_922 274
743 3300046794 Ga0495589_0000005 Ga0495589_0000005_322253_323116 274
744 3300046794 Ga0495589_0000646 Ga0495589_0000646_14417_15277 274
745 3300046810 Ga0495660_0009143 Ga0495660_0009143_3585_4466 274
746 3300046810 Ga0495660_0035217 Ga0495660_0035217_746_1627 274
747 3300047315 Ga0495581_0156784 Ga0495581_0156784_284_1171 274
748 3300047320 Ga0495672_0049161 Ga0495672_0049161_936_1781 274
749 3300047321 Ga0495676_0000004 Ga0495676_0000004_205340_206221 274
750 3300047323 Ga0495683_0015137 Ga0495683_0015137_2592_3473 274
751 3300047323 Ga0495683_0103972 Ga0495683_0103972_223_1110 274
752 3300047443 Ga0495687_010294 Ga0495687_010294_1692_2579 274
753 3300047446 Ga0495679_000308 Ga0495679_000308_12502_13383 274
754 3300047446 Ga0495679_000774 Ga0495679_000774_7743_8603 274
755 3300047447 Ga0495685_000931 Ga0495685_000931_5887_6774 274
756 3300047469 Ga0495673_0000980 Ga0495673_0000980_18301_19182 274
757 3300047469 Ga0495673_0002082 Ga0495673_0002082_10535_11416 274
758 3300047469 Ga0495673_0006802 Ga0495673_0006802_2697_3578 274
759 3300047469 Ga0495673_0018856 Ga0495673_0018856_862_1743 274
760 3300047469 Ga0495673_0032136 Ga0495673_0032136_502_1377 274
761 3300047470 Ga0495681_0002551 Ga0495681_0002551_6891_7751 274
762 3300047470 Ga0495681_0003241 Ga0495681_0003241_1532_2413 274
763 3300047470 Ga0495681_0004262 Ga0495681_0004262_8034_8894 274
764 3300047470 Ga0495681_0034246 Ga0495681_0034246_309_1196 274
765 3300047470 Ga0495681_0057977 Ga0495681_0057977_869_1711 274
766 3300047472 Ga0495686_0000018 Ga0495686_0000018_395484_396368 274
767 3300047472 Ga0495686_0000933 Ga0495686_0000933_2919_3794 274
768 3300047472 Ga0495686_0061992 Ga0495686_0061992_407_1249 274
769 3300048091 Ga0495626_0000012 Ga0495626_0000012_12069_12950 274
770 3300048905 Ga0496102_0060411 Ga0496102_0060411_255_1136 274
771 3300048907 Ga0496104_0000071 Ga0496104_0000071_51993_52841 274
772 3300048911 Ga0496108_0179735 Ga0496108_0179735_487_1344 274
773 3300048912 Ga0496109_0174896 Ga0496109_0174896_607_1464 274
774 3300048917 Ga0496114_0093548 Ga0496114_0093548_1417_2274 274
775 3300048919 Ga0496116_0000015 Ga0496116_0000015_273902_274741 274
776 3300048919 Ga0496116_0033427 Ga0496116_0033427_2587_3468 274
777 3300048920 Ga0496117_0010790 Ga0496117_0010790_1188_2027 274
778 3300048921 Ga0496118_0032947 Ga0496118_0032947_846_1727 274
779 3300048922 Ga0496119_0000481 Ga0496119_0000481_49860_50726 274
780 3300048923 Ga0496120_0002963 Ga0496120_0002963_11410_12276 274
781 3300048924 Ga0496121_0001684 Ga0496121_0001684_3880_4746 274
782 3300048924 Ga0496121_0013603 Ga0496121_0013603_5206_6087 274
783 3300048925 Ga0496122_0014537 Ga0496122_0014537_2459_3325 274
784 3300048925 Ga0496122_0020992 Ga0496122_0020992_3078_3959 274
785 3300048926 Ga0496123_0013325 Ga0496123_0013325_3261_4142 274
786 3300048926 Ga0496123_0047467 Ga0496123_0047467_138_1004 274
787 3300048927 Ga0496124_0000031 Ga0496124_0000031_15300_16145 274
788 3300048927 Ga0496124_0000272 Ga0496124_0000272_91644_92525 274
789 3300048929 Ga0496126_0048937 Ga0496126_0048937_1005_1871 274
790 3300049459 Ga0495678_000052 Ga0495678_000052_155474_156355 274
791 3300049575 Ga0501039_0341311 Ga0501039_0341311_32_910 274
792 3300049586 Ga0501070_0283232 Ga0501070_0283232_49_957 274
793 3300049824 Ga0501045_0281899 Ga0501045_0281899_300_1178 274
794 3300050493 nmdc:mga0k408_1636_c1 nmdc:mga0k408_1636_c1_10615_11448 274
795 3300050507 nmdc:mga05p37_253397_c1 nmdc:mga05p37_253397_c1_1023_1901 274
796 3300050511 nmdc:mga08y16_93223_c1 nmdc:mga08y16_93223_c1_1232_2056 274
797 3300053077 Ga0495601_0012505 Ga0495601_0012505_365_1258 274
798 3300053078 Ga0495612_0039681 Ga0495612_0039681_588_1481 274
799 3300053086 Ga0500578_0192746 Ga0500578_0192746_110_997 274
800 3300053094 Ga0500566_0009242 Ga0500566_0009242_2668_3519 274
801 3300053094 Ga0500566_0033762 Ga0500566_0033762_1959_2831 274
802 3300053095 Ga0500640_000065 Ga0500640_000065_16356_17207 274
803 3300053101 Ga0500553_026081 Ga0500553_026081_298_1215 274
804 3300053102 Ga0500554_000067 Ga0500554_000067_3586_4437 274
805 3300053109 Ga0500569_006115 Ga0500569_006115_128_1015 274
806 3300053111 Ga0500572_002384 Ga0500572_002384_454_1305 274
807 3300053119 Ga0500595_000110 Ga0500595_000110_30312_31163 274
808 3300053120 Ga0500597_064159 Ga0500597_064159_620_1471 274
809 3300053123 Ga0500614_001859 Ga0500614_001859_2392_3309 274
810 3300053134 Ga0500658_0031822 Ga0500658_0031822_263_1150 274
811 3300053136 Ga0500559_0014801 Ga0500559_0014801_206_1057 274
812 3300053137 Ga0500561_0000979 Ga0500561_0000979_128_1015 274
813 3300053143 Ga0500579_099605 Ga0500579_099605_27_914 274
814 3300053149 Ga0500600_0006627 Ga0500600_0006627_726_1613 274
815 3300053153 Ga0500616_0005770 Ga0500616_0005770_6416_7303 274
816 3300053160 Ga0500633_0005241 Ga0500633_0005241_1068_1955 274
817 3300053161 Ga0500634_0011919 Ga0500634_0011919_2086_2973 274
818 3300053178 Ga0500637_0229244 Ga0500637_0229244_15_875 274
819 3300054114 Ga0501084_0123997 Ga0501084_0123997_209_1087 274
820 3300060353 Ga0501082_0031154 Ga0501082_0031154_2822_3700 274
821 iso_pu_bacteria 2600255283 2601624945 274
822 iso_pu_bacteria 2643221714 2644627347 274
823 iso_pu_bacteria 2738541271 2738688468 274
824 iso_pu_bacteria 2738543016 2739264200 274
825 iso_pu_bacteria 2784746763 2785346320 274
826 iso_pu_bacteria 2856741275 2856745028 274
827 iso_pu_bacteria 2862705112 2862707783 274
828 iso_pu_bacteria 2891554331 2891562694 274
829 iso_pu_bacteria 2891562705 2891569223 274
830 iso_pu_bacteria 2945961074 2945964594 274
831 iso_pu_bacteria 2990044586 2990049096 274
832 iso_pu_bacteria 8008485437 8008489897 274
833 iso_pu_bacteria 8025524527 8025529371 274
834 iso_pu_bacteria 8048406513 8048410551 274
835 2162886012 MBSR1b_contig_8798837 MBSR1b_0842.00007760 275
836 3300003322 rootL2_10021303 rootL2_1002130310 275
837 3300003322 rootL2_10043140 rootL2_100431403 275
838 3300005327 Ga0070658_10059294 Ga0070658_100592942 275
839 3300005445 Ga0070708_100065585 Ga0070708_1000655853 275
840 3300005843 Ga0068860_100280636 Ga0068860_1002806362 275
841 3300005937 Ga0081455_10166816 Ga0081455_101668162 275
842 3300006358 Ga0068871_100094214 Ga0068871_1000942142 275
843 3300007265 Ga0099794_10056151 Ga0099794_100561512 275
844 3300013308 Ga0157375_10202376 Ga0157375_102023763 275
845 3300014968 Ga0157379_10014193 Ga0157379_100141932 275
846 3300014969 Ga0157376_10434453 Ga0157376_104344532 275
847 3300025910 Ga0207684_10402667 Ga0207684_104026671 275
848 3300025938 Ga0207704_10167954 Ga0207704_101679542 275
849 3300031616 Ga0307508_10000100 Ga0307508_1000010017 275
850 3300042876 Ga0451577_0142015 Ga0451577_0142015_825_1661 275
851 3300044712 Ga0453684_0000287 Ga0453684_0000287_119188_120024 275
852 3300047319 Ga0495674_0126406 Ga0495674_0126406_1217_2089 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

44

320

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.9739 1 274
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.9684 1 274
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.967 1 274
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.9615 1 274
6uvz-assembly3.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8523 2 274
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9684 1 274 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9615 1 274 3.20.20.140
2ffiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7996 2 275 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7974 1 272 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7904 2 273 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7Y5U2V1-F1-model_v4 Amidohydrolase family protein 0.9971 1 275 GO:0016787
AF-A0A329QWR8-F1-model_v4 Amidohydrolase 0.9937 1 273 GO:0016787
AF-A0A3C0ITN5-F1-model_v4 Amidohydrolase 0.9935 2 78 GO:0016787
AF-A0A7Y5U2V1-F1-model_v4 Amidohydrolase family protein 0.9935 1 275 GO:0016787
AF-X1HHN0-F1-model_v4 Amidohydrolase-related domain-containing protein 0.993 171 275 GO:0016787

Feature Viewer

pLDDT pTM Quality
97.48 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map