F483453

General Info

Members Datasets Scaffolds Average Seq Length
851 427 806 162

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100815857|Ga0068855_1008158573
Length 167
Sequence MADRVSIQAADFNLADEIDALRADDKRVGAVCSFVGTVRQGHEGNNGPPVLEMELEHYPGMTEKSIEAMIDEARRRFDIYAARVIHRIGVLQPGDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEHTPEGARWVDARSSDDAAIARWGITAGNAPPVVPDP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
5 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221660 Methylibium sp. Root1272 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2738541277 Variovorax sp. GV051 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2738543019 Variovorax sp. GV040 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2842677519 Variovorax sp. R-72495 Isolate Unclassified
23 2842733646 Variovorax sp. R-72446 Isolate Unclassified
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
26 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
30 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
31 2904456579 Variovorax sp. 2002 Isolate Unclassified
32 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
33 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
34 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
35 2928070936 Variovorax gossypii 1167 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
38 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
39 2929520902 Variovorax beijingensis 502 Isolate Unclassified
40 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
41 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
42 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
43 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
44 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
45 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
46 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
50 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
51 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
52 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
53 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
59 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
60 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
61 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
62 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
63 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
64 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
65 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
66 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
67 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
68 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
69 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
70 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
71 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
72 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
95 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
98 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
99 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
138 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
155 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
156 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
164 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
173 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
174 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
243 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
244 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
250 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
260 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
261 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
271 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
272 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
273 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
276 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
277 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
278 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
279 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
280 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
281 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
282 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
283 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
284 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
285 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
288 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
289 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
290 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
291 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
292 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
293 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
294 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
295 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
296 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
297 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
298 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
299 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
300 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
301 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
302 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
303 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
304 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
305 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
306 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
307 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
310 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
311 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
312 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
318 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
319 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
325 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
332 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
333 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
336 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
337 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
338 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
339 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
350 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
360 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
361 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
362 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
369 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
370 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
371 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
372 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
373 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
374 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
375 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
378 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
387 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
388 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
389 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
390 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
394 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
402 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
408 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
409 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
410 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
411 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
412 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
413 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
414 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
415 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
416 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
421 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
422 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
423 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
424 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
425 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
426 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
427 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.36
Metatranscriptomes 0.35
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.79
Nodule 0.82
Rhizoplane 3.17
Rhizosphere 54.41
Stem 0
Stem Tuber 0
Unclassified 10.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001445 3300001915 Bacteria 6805
2 JGI24740J21852_10000319 3300001979 Bacteria 20469
3 JGI24740J21852_10007091 3300001979 Bacteria 4591
4 JGI24739J22299_10005364 3300001989 Bacteria 4881
5 JGI25155J39150_1000074 3300002704 Bacteria 62438
6 JGI25156J39149_1000002 3300002705 Bacteria 343501
7 JGI25154J39366_1000010 3300002738 Bacteria 297985
8 JGI25158J39367_1003721 3300002739 Bacteria 2330
9 JGI25157J39369_1000001 3300002741 Bacteria 363277
10 JGI25150J39212_1001101 3300002774 Bacteria 8146
11 JGI25150J39212_1001868 3300002774 Bacteria 5553
12 JGI25150J39212_1009272 3300002774 Bacteria 1885
13 JGI25159J45721_1000465 3300002987 Bacteria 18688
14 JGI25159J45721_1002893 3300002987 Bacteria 6270
15 JGI25159J45721_1017298 3300002987 Bacteria 1497
16 JGI25151J46595_10015217 3300003187 Bacteria 3401
17 rootH2_10194452 3300003320 Bacteria 2027
18 JGI25160J50197_1000192 3300003354 Bacteria 51376
19 JGI25160J50197_1018502 3300003354 Bacteria 2169
20 JGI25160J50197_1059988 3300003354 Bacteria 764
21 JGI25161J50226_1000043 3300003374 Bacteria 120741
22 Ga0055538_1001079 3300003751 Bacteria 5990
23 Ga0055538_1011084 3300003751 Bacteria 677
24 Ga0055539_1000123 3300003752 Bacteria 83036
25 Ga0055533_1002174 3300003756 Bacteria 4672
26 Ga0055533_1002613 3300003756 Bacteria 4010
27 Ga0055533_1003314 3300003756 Bacteria 3277
28 Ga0055532_1000002 3300003758 Bacteria 576000
29 Ga0055532_1000029 3300003758 Bacteria 232900
30 Ga0055525_1000345 3300003759 Bacteria 33665
31 Ga0055542_1001189 3300003762 Bacteria 14846
32 Ga0055529_1000062 3300003763 Bacteria 183782
33 Ga0055526_1000441 3300003771 Bacteria 33073
34 Ga0055526_1003998 3300003771 Bacteria 9074
35 Ga0055526_1004562 3300003771 Bacteria 8269
36 Ga0055537_1000259 3300003773 Bacteria 38671
37 Ga0055537_1001161 3300003773 Bacteria 11265
38 Ga0055537_1004429 3300003773 Bacteria 4020
39 Ga0055537_1009409 3300003773 Bacteria 2159
40 Ga0055524_1000156 3300003775 Bacteria 79669
41 Ga0055524_1009658 3300003775 Bacteria 3900
42 Ga0055536_1000270 3300003781 Bacteria 39711
43 Ga0055536_1003726 3300003781 Bacteria 8079
44 Ga0055536_1009172 3300003781 Bacteria 4134
45 Ga0055534_1001138 3300003784 Bacteria 11269
46 Ga0055534_1003028 3300003784 Bacteria 5517
47 Ga0055534_1006217 3300003784 Bacteria 3047
48 Ga0055534_1006824 3300003784 Bacteria 2816
49 Ga0055534_1029829 3300003784 Bacteria 846
50 Ga0055528_1008541 3300003790 Bacteria 4370
51 Ga0055528_1020328 3300003790 Bacteria 2159
52 Ga0055530_10000408 3300003791 Bacteria 38218
53 Ga0055530_10003951 3300003791 Bacteria 8020
54 Ga0055530_10009348 3300003791 Bacteria 3781
55 Ga0055530_10033474 3300003791 Bacteria 1325
56 Ga0055540_1000033 3300003792 Bacteria 172048
57 Ga0055540_1003778 3300003792 Bacteria 7139
58 Ga0055540_1004106 3300003792 Bacteria 6743
59 Ga0055540_1004580 3300003792 Bacteria 6150
60 Ga0055540_1073622 3300003792 Bacteria 664
61 Ga0055531_10000273 3300003794 Bacteria 53570
62 Ga0055531_10004865 3300003794 Bacteria 8006
63 Ga0055531_10009016 3300003794 Bacteria 5158
64 Ga0055531_10046577 3300003794 Bacteria 1190
65 Ga0055541_1000208 3300003841 Bacteria 24817
66 Ga0055541_1001170 3300003841 Bacteria 5863
67 Ga0055541_1018967 3300003841 Bacteria 839
68 Ga0055541_1018975 3300003841 Bacteria 839
69 Ga0055543_1000127 3300004625 Bacteria 63245
70 Ga0055543_1003299 3300004625 Bacteria 4843
71 Ga0065165_1028859 3300005262 Bacteria 1785
72 Ga0065165_1067279 3300005262 Bacteria 961
73 Ga0065704_10140698 3300005289 Bacteria 1521
74 Ga0065704_10292894 3300005289 Bacteria 900
75 Ga0070676_10691508 3300005328 Bacteria 744
76 Ga0070670_100587130 3300005331 Bacteria 996
77 Ga0070677_10004622 3300005333 Bacteria 4502
78 Ga0068869_100042886 3300005334 Bacteria 3246
79 Ga0068869_100144770 3300005334 Bacteria 1838
80 Ga0070680_100154059 3300005336 Bacteria 1930
81 Ga0070680_100327448 3300005336 Bacteria 1301
82 Ga0068868_100092735 3300005338 Bacteria 2434
83 Ga0068868_100301613 3300005338 Bacteria 1361
84 Ga0070660_100063427 3300005339 Bacteria 2873
85 Ga0070661_100001595 3300005344 Bacteria 15734
86 Ga0070661_100551136 3300005344 Bacteria 928
87 Ga0070661_101649227 3300005344 Bacteria 543
88 Ga0070668_100436175 3300005347 Bacteria 1124
89 Ga0070669_100049588 3300005353 Bacteria 3065
90 Ga0070675_100000158 3300005354 Bacteria 41146
91 Ga0070675_100048670 3300005354 Bacteria 3477
92 Ga0070671_100004317 3300005355 Bacteria 11249
93 Ga0070671_100213572 3300005355 Bacteria 1636
94 Ga0070674_100011597 3300005356 Bacteria 5372
95 Ga0070674_100157791 3300005356 Bacteria 1718
96 Ga0070673_100041500 3300005364 Bacteria 3539
97 Ga0070673_100046916 3300005364 Bacteria 3358
98 Ga0070659_100018367 3300005366 Bacteria 5278
99 Ga0070667_100015538 3300005367 Bacteria 6292
100 Ga0070667_100068522 3300005367 Bacteria 3019
101 Ga0070667_100174663 3300005367 Bacteria 1898
102 Ga0070714_100375116 3300005435 Bacteria 1340
103 Ga0070663_100000011 3300005455 Bacteria 146097
104 Ga0070663_100007541 3300005455 Bacteria 6628
105 Ga0070678_100031759 3300005456 Bacteria 3647
106 Ga0070678_100064383 3300005456 Bacteria 2717
107 Ga0070662_100131317 3300005457 Bacteria 1931
108 Ga0068867_100000092 3300005459 Bacteria 57643
109 Ga0068867_100002736 3300005459 Bacteria 12430
110 Ga0068867_100003562 3300005459 Bacteria 10954
111 Ga0068867_100018629 3300005459 Bacteria 4936
112 Ga0068867_100631262 3300005459 Bacteria 938
113 Ga0068853_100099468 3300005539 Bacteria 2569
114 Ga0068853_100232269 3300005539 Bacteria 1688
115 Ga0068853_101853500 3300005539 Bacteria 585
116 Ga0070672_100047628 3300005543 Bacteria 3327
117 Ga0070672_100116863 3300005543 Bacteria 2180
118 Ga0070672_100187081 3300005543 Bacteria 1727
119 Ga0070665_100161485 3300005548 Bacteria 2243
120 Ga0070665_100796843 3300005548 Bacteria 958
121 Ga0070665_101285026 3300005548 Bacteria 742
122 Ga0070665_101285386 3300005548 Bacteria 742
123 Ga0068855_100076757 3300005563 Bacteria 3876
124 Ga0068855_100089079 3300005563 Bacteria 3563
125 Ga0068855_100146314 3300005563 Bacteria 2689
126 Ga0068855_100815857 3300005563 Bacteria 991
127 Ga0070664_100000008 3300005564 Bacteria 173734
128 Ga0070664_100013869 3300005564 Bacteria 6570
129 Ga0068857_100002038 3300005577 Bacteria 16379
130 Ga0068857_100223425 3300005577 Bacteria 1721
131 Ga0068857_100318117 3300005577 Bacteria 1437
132 Ga0068854_100000052 3300005578 Bacteria 85499
133 Ga0068856_100000009 3300005614 Bacteria 181448
134 Ga0068856_100439570 3300005614 Bacteria 1325
135 Ga0068852_100148447 3300005616 Bacteria 2177
136 Ga0068852_100168505 3300005616 Bacteria 2051
137 Ga0068851_10092729 3300005834 Bacteria 1592
138 Ga0068862_100068756 3300005844 Bacteria 3056
139 Ga0068862_101290497 3300005844 Bacteria 731
140 Ga0075365_10245891 3300006038 Bacteria 1256
141 Ga0075363_100083557 3300006048 Bacteria 1749
142 Ga0075363_100187166 3300006048 Bacteria 1180
143 Ga0075364_10025580 3300006051 Bacteria 3758
144 Ga0075364_10459791 3300006051 Bacteria 870
145 Ga0075432_10007261 3300006058 Bacteria 3773
146 Ga0075432_10007774 3300006058 Bacteria 3654
147 Ga0075362_10003943 3300006177 Bacteria 5271
148 Ga0075362_10014025 3300006177 Bacteria 3224
149 Ga0075362_10026155 3300006177 Bacteria 2490
150 Ga0075362_10060691 3300006177 Bacteria 1709
151 Ga0075362_10324345 3300006177 Bacteria 767
152 Ga0075362_10611600 3300006177 Bacteria 564
153 Ga0075367_10183859 3300006178 Bacteria 1303
154 Ga0075366_10011492 3300006195 Bacteria 5001
155 Ga0075366_10051211 3300006195 Bacteria 2453
156 Ga0075366_10069431 3300006195 Bacteria 2097
157 Ga0075366_10089703 3300006195 Bacteria 1841
158 Ga0075366_10156187 3300006195 Bacteria 1382
159 Ga0075366_10287610 3300006195 Bacteria 1005
160 Ga0075366_10336508 3300006195 Bacteria 925
161 Ga0075366_10386789 3300006195 Bacteria 860
162 Ga0075366_10590118 3300006195 Bacteria 689
163 Ga0097621_101230416 3300006237 Bacteria 706
164 Ga0097621_101454490 3300006237 Bacteria 650
165 Ga0075370_10000322 3300006353 Bacteria 17253
166 Ga0075370_10000738 3300006353 Bacteria 13029
167 Ga0075370_10046321 3300006353 Bacteria 2461
168 Ga0075370_10107198 3300006353 Bacteria 1620
169 Ga0075370_10173015 3300006353 Bacteria 1270
170 Ga0075370_10197097 3300006353 Bacteria 1187
171 Ga0075370_10501225 3300006353 Bacteria 733
172 Ga0068871_100173810 3300006358 Bacteria 1848
173 Ga0075430_100021936 3300006846 Bacteria 5427
174 Ga0075429_100010391 3300006880 Bacteria 8056
175 Ga0075429_100760561 3300006880 Bacteria 849
176 Ga0079104_1016127 3300006946 Bacteria 2193
177 Ga0079104_1020241 3300006946 Bacteria 1838
178 Ga0079104_1036670 3300006946 Bacteria 1175
179 Ga0099826_10008499 3300006948 Bacteria 7640
180 Ga0099826_10444032 3300006948 Bacteria 619
181 Ga0105244_10003000 3300009036 Bacteria 12386
182 Ga0105244_10326503 3300009036 Bacteria 708
183 Ga0105240_10004043 3300009093 Bacteria 22563
184 Ga0105240_10010244 3300009093 Bacteria 13194
185 Ga0105240_10027063 3300009093 Bacteria 7516
186 Ga0105245_10273025 3300009098 Bacteria 1650
187 Ga0105245_10323309 3300009098 Bacteria 1520
188 Ga0105243_10003757 3300009148 Bacteria 12169
189 Ga0105243_10009638 3300009148 Bacteria 7353
190 Ga0105243_10009706 3300009148 Bacteria 7329
191 Ga0105243_10022421 3300009148 Bacteria 4799
192 Ga0105242_10003000 3300009176 Bacteria 13209
193 Ga0105242_10495201 3300009176 Bacteria 1161
194 Ga0105242_10698787 3300009176 Bacteria 992
195 Ga0105248_11123506 3300009177 Bacteria 888
196 Ga0105237_10000945 3300009545 Bacteria 39046
197 Ga0105237_10124271 3300009545 Bacteria 2575
198 Ga0105237_11003981 3300009545 Bacteria 841
199 Ga0105238_10081095 3300009551 Bacteria 3234
200 Ga0105249_11186873 3300009553 Bacteria 834
201 Ga0105239_10005802 3300010375 Bacteria 14404
202 Ga0105239_10266673 3300010375 Bacteria 1925
203 Ga0105239_11418942 3300010375 Bacteria 802
204 Ga0105246_10035641 3300011119 Bacteria 3327
205 Ga0105246_10913458 3300011119 Bacteria 788
206 Ga0105246_11602204 3300011119 Bacteria 615
207 Ga0157347_1002569 3300012502 Bacteria 1566
208 Ga0157347_1003557 3300012502 Bacteria 1402
209 Ga0157326_1000968 3300012513 Bacteria 3259
210 Ga0157373_10010823 3300013100 Bacteria 6714
211 Ga0157373_10023683 3300013100 Bacteria 4450
212 Ga0157373_10345524 3300013100 Bacteria 1061
213 Ga0157371_10000068 3300013102 Bacteria 168110
214 Ga0157371_10310855 3300013102 Bacteria 1142
215 Ga0157370_10010316 3300013104 Bacteria 9854
216 Ga0157370_10072460 3300013104 Bacteria 3250
217 Ga0157370_10367712 3300013104 Bacteria 1325
218 Ga0157370_11167749 3300013104 Bacteria 695
219 Ga0157369_10012328 3300013105 Bacteria 9710
220 Ga0157374_11738372 3300013296 Bacteria 649
221 Ga0157378_10076690 3300013297 Bacteria 3012
222 Ga0157378_10298572 3300013297 Bacteria 1558
223 Ga0163162_10165510 3300013306 Bacteria 2335
224 Ga0163162_10707785 3300013306 Bacteria 1129
225 Ga0157372_10000271 3300013307 Bacteria 57411
226 Ga0157375_10298060 3300013308 Bacteria 1776
227 Ga0157375_10598249 3300013308 Bacteria 1262
228 Ga0157375_11140407 3300013308 Bacteria 913
229 Ga0157380_10002034 3300014326 Bacteria 13517
230 Ga0157380_10747942 3300014326 Bacteria 989
231 Ga0182008_10001340 3300014497 Bacteria 16780
232 Ga0182008_10002648 3300014497 Bacteria 11114
233 Ga0182008_10016053 3300014497 Bacteria 3897
234 Ga0182008_10044379 3300014497 Bacteria 2211
235 Ga0182008_10053246 3300014497 Bacteria 2004
236 Ga0157377_10000163 3300014745 Bacteria 39681
237 Ga0157377_10234269 3300014745 Bacteria 1182
238 Ga0157379_10423334 3300014968 Bacteria 1226
239 Ga0157376_10148287 3300014969 Bacteria 2113
240 Ga0157376_10335114 3300014969 Bacteria 1443
241 Ga0157376_11077177 3300014969 Bacteria 829
242 Ga0182006_1001145 3300015261 Bacteria 16830
243 Ga0182006_1012267 3300015261 Bacteria 3749
244 Ga0182006_1029708 3300015261 Bacteria 2212
245 Ga0182006_1147247 3300015261 Bacteria 800
246 Ga0182007_10008474 3300015262 Bacteria 4222
247 Ga0182005_1012041 3300015265 Bacteria 2450
248 Ga0182005_1140321 3300015265 Bacteria 698
249 Ga0183362_10001 3300015683 Bacteria 2046624
250 Ga0163161_10000166 3300017792 Bacteria 60327
251 Ga0163161_10017700 3300017792 Bacteria 4993
252 Ga0163161_10017854 3300017792 Bacteria 4971
253 Ga0206351_10253009 3300020077 Bacteria 7729
254 Ga0206350_10481412 3300020080 Bacteria 961
255 Ga0154015_1103548 3300020610 Bacteria 9590
256 Ga0213872_10034267 3300021361 Bacteria 2324
257 Ga0213876_10579543 3300021384 Bacteria 597
258 Ga0209435_100001 3300025206 Bacteria 1424171
259 Ga0209436_103077 3300025208 Bacteria 4593
260 Ga0209436_104293 3300025208 Bacteria 3548
261 Ga0209784_100003 3300025224 Bacteria 1379451
262 Ga0209784_100482 3300025224 Bacteria 16070
263 Ga0209784_100539 3300025224 Bacteria 13930
264 Ga0209784_101093 3300025224 Bacteria 4521
265 Ga0209566_100002 3300025225 Bacteria 2614868
266 Ga0209566_100970 3300025225 Bacteria 12691
267 Ga0209566_111096 3300025225 Bacteria 891
268 Ga0209566_111097 3300025225 Bacteria 891
269 Ga0209674_100008 3300025226 Bacteria 1076909
270 Ga0209674_100229 3300025226 Bacteria 50211
271 Ga0209674_101558 3300025226 Bacteria 5833
272 Ga0209672_100052 3300025228 Bacteria 231179
273 Ga0209147_100002 3300025229 Bacteria 2158988
274 Ga0209563_100004 3300025230 Bacteria 1814108
275 Ga0209563_106635 3300025230 Bacteria 1971
276 Ga0209563_111006 3300025230 Bacteria 1294
277 Ga0209563_114368 3300025230 Bacteria 1018
278 Ga0209258_100002 3300025242 Bacteria 2158988
279 Ga0207425_1000603 3300025245 Bacteria 20837
280 Ga0207425_1001556 3300025245 Bacteria 9346
281 Ga0207425_1002814 3300025245 Bacteria 5868
282 Ga0207425_1010123 3300025245 Bacteria 2309
283 Ga0209646_1000001 3300025246 Bacteria 3092932
284 Ga0209646_1000059 3300025246 Bacteria 256909
285 Ga0209026_1000001 3300025250 Bacteria 1228671
286 Ga0209026_1008832 3300025250 Bacteria 2052
287 Ga0209677_100009 3300025253 Bacteria 749530
288 Ga0209677_102838 3300025253 Bacteria 6123
289 Ga0209148_1000021 3300025254 Bacteria 714645
290 Ga0209759_1000001 3300025256 Bacteria 2799452
291 Ga0209759_1002389 3300025256 Bacteria 8282
292 Ga0209759_1003853 3300025256 Bacteria 5811
293 Ga0209759_1005426 3300025256 Bacteria 4469
294 Ga0209129_1000071 3300025258 Bacteria 210729
295 Ga0209565_1000120 3300025263 Bacteria 111458
296 Ga0209565_1000326 3300025263 Bacteria 42448
297 Ga0209565_1000774 3300025263 Bacteria 18648
298 Ga0209565_1001593 3300025263 Bacteria 9641
299 Ga0209565_1056566 3300025263 Bacteria 690
300 Ga0209455_1000021 3300025272 Bacteria 699993
301 Ga0209673_1000099 3300025273 Bacteria 193248
302 Ga0209673_1000839 3300025273 Bacteria 40180
303 Ga0209673_1001338 3300025273 Bacteria 24643
304 Ga0209130_1000041 3300025284 Bacteria 261078
305 Ga0209130_1000456 3300025284 Bacteria 43000
306 Ga0209130_1000952 3300025284 Bacteria 22937
307 Ga0209130_1001771 3300025284 Bacteria 12746
308 Ga0209130_1003498 3300025284 Bacteria 6602
309 Ga0209675_1000054 3300025291 Bacteria 193248
310 Ga0209675_1000290 3300025291 Bacteria 47338
311 Ga0209675_1001678 3300025291 Bacteria 12312
312 Ga0209675_1008675 3300025291 Bacteria 3695
313 Ga0209675_1014145 3300025291 Bacteria 2446
314 Ga0209676_1000005 3300025292 Bacteria 1076001
315 Ga0209676_1000054 3300025292 Bacteria 365890
316 Ga0209676_1000260 3300025292 Bacteria 111683
317 Ga0209676_1002320 3300025292 Bacteria 13793
318 Ga0209676_1006861 3300025292 Bacteria 5513
319 Ga0209676_1012219 3300025292 Bacteria 3396
320 Ga0209676_1026508 3300025292 Bacteria 1839
321 Ga0209025_1001409 3300025294 Bacteria 31873
322 Ga0209025_1010783 3300025294 Bacteria 6140
323 Ga0209025_1013211 3300025294 Bacteria 5211
324 Ga0209025_1014966 3300025294 Bacteria 4722
325 Ga0209564_1000009 3300025295 Bacteria 950196
326 Ga0209564_1000239 3300025295 Bacteria 119761
327 Ga0209564_1000662 3300025295 Bacteria 50934
328 Ga0209564_1000784 3300025295 Bacteria 44001
329 Ga0209564_1000890 3300025295 Bacteria 39405
330 Ga0209758_1000027 3300025297 Bacteria 549650
331 Ga0209758_1010200 3300025297 Bacteria 5668
332 Ga0209758_1050345 3300025297 Bacteria 1461
333 Ga0209050_1000003 3300025298 Bacteria 1609245
334 Ga0209050_1000007 3300025298 Bacteria 1187891
335 Ga0209050_1000954 3300025298 Bacteria 37580
336 Ga0209050_1004569 3300025298 Bacteria 9285
337 Ga0209050_1016241 3300025298 Bacteria 3060
338 Ga0209256_1000001 3300025299 Bacteria 2166974
339 Ga0209256_1000081 3300025299 Bacteria 222908
340 Ga0209256_1024131 3300025299 Bacteria 1796
341 Ga0209256_1059446 3300025299 Bacteria 895
342 Ga0207426_1000027 3300025302 Bacteria 513176
343 Ga0207426_1000061 3300025302 Bacteria 362507
344 Ga0207426_1003593 3300025302 Bacteria 8238
345 Ga0207426_1004649 3300025302 Bacteria 6602
346 Ga0209051_1000003 3300025303 Bacteria 1609245
347 Ga0209051_1000009 3300025303 Bacteria 706778
348 Ga0209051_1000319 3300025303 Bacteria 72894
349 Ga0209051_1000619 3300025303 Bacteria 40839
350 Ga0209051_1005714 3300025303 Bacteria 7182
351 Ga0209051_1019179 3300025303 Bacteria 2996
352 Ga0209051_1019880 3300025303 Bacteria 2916
353 Ga0209257_1000018 3300025304 Bacteria 836016
354 Ga0209257_1000873 3300025304 Bacteria 42738
355 Ga0209257_1007556 3300025304 Bacteria 6522
356 Ga0209257_1007934 3300025304 Bacteria 6227
357 Ga0209257_1008583 3300025304 Bacteria 5754
358 Ga0209257_1011066 3300025304 Bacteria 4422
359 Ga0207697_10108593 3300025315 Bacteria 1187
360 Ga0207656_10032769 3300025321 Bacteria 2160
361 Ga0207655_1001368 3300025728 Bacteria 22829
362 Ga0207682_10001652 3300025893 Bacteria 10224
363 Ga0207682_10099945 3300025893 Bacteria 1267
364 Ga0207688_10038678 3300025901 Bacteria 2648
365 Ga0207680_10417892 3300025903 Bacteria 949
366 Ga0207647_10254573 3300025904 Bacteria 1006
367 Ga0207645_10055100 3300025907 Bacteria 2539
368 Ga0207645_10063693 3300025907 Bacteria 2356
369 Ga0207645_10446080 3300025907 Bacteria 873
370 Ga0207705_10299096 3300025909 Bacteria 1234
371 Ga0207695_10001909 3300025913 Bacteria 32457
372 Ga0207695_10004148 3300025913 Bacteria 19891
373 Ga0207695_10125685 3300025913 Bacteria 2527
374 Ga0207695_10630993 3300025913 Bacteria 953
375 Ga0207671_10123849 3300025914 Bacteria 1978
376 Ga0207660_10038245 3300025917 Bacteria 3349
377 Ga0207660_10311643 3300025917 Bacteria 1255
378 Ga0207649_10001269 3300025920 Bacteria 15079
379 Ga0207649_11270916 3300025920 Bacteria 582
380 Ga0207681_10014932 3300025923 Bacteria 4837
381 Ga0207694_10061134 3300025924 Bacteria 2932
382 Ga0207694_10197807 3300025924 Bacteria 1634
383 Ga0207650_10001711 3300025925 Bacteria 15569
384 Ga0207659_10001143 3300025926 Bacteria 15778
385 Ga0207659_10168409 3300025926 Bacteria 1726
386 Ga0207687_10043205 3300025927 Bacteria 3104
387 Ga0207687_10087175 3300025927 Bacteria 2268
388 Ga0207664_11081393 3300025929 Bacteria 717
389 Ga0207644_10003362 3300025931 Bacteria 10322
390 Ga0207690_10014545 3300025932 Bacteria 4753
391 Ga0207706_10017147 3300025933 Bacteria 6531
392 Ga0207706_10918481 3300025933 Bacteria 739
393 Ga0207709_10000230 3300025935 Bacteria 70768
394 Ga0207709_10002452 3300025935 Bacteria 11648
395 Ga0207709_10022627 3300025935 Bacteria 3566
396 Ga0207669_10003638 3300025937 Bacteria 6692
397 Ga0207669_10617448 3300025937 Bacteria 883
398 Ga0207704_10162483 3300025938 Bacteria 1591
399 Ga0207704_11228983 3300025938 Bacteria 639
400 Ga0207691_10055060 3300025940 Bacteria 3627
401 Ga0207691_10056335 3300025940 Bacteria 3580
402 Ga0207691_10151133 3300025940 Bacteria 2041
403 Ga0207691_10826383 3300025940 Bacteria 778
404 Ga0207711_10463975 3300025941 Bacteria 1179
405 Ga0207689_10025300 3300025942 Bacteria 4974
406 Ga0207689_10285070 3300025942 Bacteria 1368
407 Ga0207679_10000001 3300025945 Bacteria 777444
408 Ga0207679_10008899 3300025945 Bacteria 6407
409 Ga0207667_10088447 3300025949 Bacteria 3204
410 Ga0207667_10224669 3300025949 Bacteria 1924
411 Ga0207667_10479044 3300025949 Bacteria 1263
412 Ga0207667_10663985 3300025949 Bacteria 1047
413 Ga0207651_10008073 3300025960 Bacteria 5653
414 Ga0207651_10346029 3300025960 Bacteria 1250
415 Ga0207640_10000035 3300025981 Bacteria 111369
416 Ga0207640_10315862 3300025981 Bacteria 1242
417 Ga0207658_10000754 3300025986 Bacteria 27858
418 Ga0207658_10060529 3300025986 Bacteria 2826
419 Ga0207658_10178315 3300025986 Bacteria 1756
420 Ga0207677_10072405 3300026023 Bacteria 2436
421 Ga0207677_10196868 3300026023 Bacteria 1598
422 Ga0207639_10350464 3300026041 Bacteria 1318
423 Ga0207678_10000001 3300026067 Bacteria 433184
424 Ga0207678_10002368 3300026067 Bacteria 17095
425 Ga0207702_10008078 3300026078 Bacteria 8901
426 Ga0207702_10541109 3300026078 Bacteria 1138
427 Ga0207641_10151496 3300026088 Bacteria 2101
428 Ga0207648_10001232 3300026089 Bacteria 28719
429 Ga0207648_10005724 3300026089 Bacteria 12451
430 Ga0207648_10027075 3300026089 Bacteria 5092
431 Ga0207648_10038520 3300026089 Bacteria 4206
432 Ga0207648_10271507 3300026089 Bacteria 1515
433 Ga0207674_10012396 3300026116 Bacteria 9531
434 Ga0207674_10250557 3300026116 Bacteria 1718
435 Ga0207674_10353949 3300026116 Bacteria 1419
436 Ga0207683_10014615 3300026121 Bacteria 6686
437 Ga0207683_10070721 3300026121 Bacteria 3083
438 Ga0207683_10071124 3300026121 Bacteria 3075
439 Ga0207683_10221142 3300026121 Bacteria 1725
440 Ga0207698_10060310 3300026142 Bacteria 2950
441 Ga0207698_10099871 3300026142 Bacteria 2402
442 Ga0207698_10326422 3300026142 Bacteria 1440
443 Ga0209282_1000133 3300027666 Bacteria 44707
444 Ga0209813_10164718 3300027866 Bacteria 802
445 Ga0209974_10014445 3300027876 Bacteria 2628
446 Ga0207428_10248181 3300027907 Bacteria 1328
447 Ga0268266_10014251 3300028379 Bacteria 6837
448 Ga0268266_10487016 3300028379 Bacteria 1176
449 Ga0268266_11102064 3300028379 Bacteria 768
450 Ga0268265_10042673 3300028380 Bacteria 3367
451 Ga0307515_10001286 3300028794 Bacteria 56985
452 Ga0307515_10001485 3300028794 Bacteria 52672
453 Ga0307515_10026348 3300028794 Bacteria 10014
454 Ga0307515_10046408 3300028794 Bacteria 6641
455 Ga0307515_10172925 3300028794 Bacteria 2144
456 Ga0307512_10068145 3300030522 Bacteria 2672
457 Ga0314311_1134334 3300030733 Bacteria 4782
458 Ga0316182_1071470 3300030745 Bacteria 1692
459 Ga0265327_10002745 3300031251 Bacteria 17906
460 Ga0307513_10000012 3300031456 Bacteria 328865
461 Ga0307513_10000285 3300031456 Bacteria 73356
462 Ga0307513_10061834 3300031456 Bacteria 3961
463 Ga0307513_10131485 3300031456 Bacteria 2448
464 Ga0307509_10032544 3300031507 Bacteria 5745
465 Ga0307509_10034762 3300031507 Bacteria 5536
466 Ga0307509_10061068 3300031507 Bacteria 3981
467 Ga0307509_10361881 3300031507 Bacteria 1170
468 Ga0307408_100000079 3300031548 Bacteria 108053
469 Ga0307408_100022449 3300031548 Bacteria 4288
470 Ga0307408_100037053 3300031548 Bacteria 3432
471 Ga0307408_100060612 3300031548 Bacteria 2758
472 Ga0307408_100101444 3300031548 Bacteria 2193
473 Ga0307408_100344212 3300031548 Bacteria 1263
474 Ga0307408_100515197 3300031548 Bacteria 1049
475 Ga0307508_10000094 3300031616 Bacteria 104107
476 Ga0307508_10176342 3300031616 Bacteria 1741
477 Ga0307508_10440890 3300031616 Bacteria 894
478 Ga0307514_10078672 3300031649 Bacteria 2448
479 Ga0265314_10147622 3300031711 Bacteria 1446
480 Ga0307516_10000525 3300031730 Bacteria 51244
481 Ga0307516_10004265 3300031730 Bacteria 17778
482 Ga0307516_10022750 3300031730 Bacteria 6434
483 Ga0307516_10458109 3300031730 Bacteria 931
484 Ga0307405_10265904 3300031731 Bacteria 1283
485 Ga0307405_10328907 3300031731 Bacteria 1170
486 Ga0307405_10596852 3300031731 Bacteria 900
487 Ga0307405_10893644 3300031731 Bacteria 751
488 Ga0307406_10000927 3300031901 Bacteria 16394
489 Ga0307406_10009555 3300031901 Bacteria 5445
490 Ga0307406_10074343 3300031901 Bacteria 2237
491 Ga0307406_10534627 3300031901 Bacteria 956
492 Ga0307412_10035354 3300031911 Bacteria 3191
493 Ga0307412_10045864 3300031911 Bacteria 2860
494 Ga0307412_10058510 3300031911 Bacteria 2578
495 Ga0307412_10096532 3300031911 Bacteria 2080
496 Ga0307412_10119539 3300031911 Bacteria 1895
497 Ga0307412_10143813 3300031911 Bacteria 1750
498 Ga0307412_10641112 3300031911 Bacteria 905
499 Ga0307416_100044749 3300032002 Bacteria 3479
500 Ga0307416_100089287 3300032002 Bacteria 2638
501 Ga0307416_100200115 3300032002 Bacteria 1894
502 Ga0307416_101286618 3300032002 Bacteria 837
503 Ga0307416_101651287 3300032002 Bacteria 746
504 Ga0307414_10405799 3300032004 Bacteria 1185
505 Ga0307414_10411971 3300032004 Bacteria 1177
506 Ga0307414_11509865 3300032004 Bacteria 625
507 Ga0307411_10414179 3300032005 Bacteria 1117
508 Ga0307411_11633047 3300032005 Bacteria 595
509 Ga0307507_10096639 3300033179 Bacteria 2497
510 Ga0307510_10054117 3300033180 Bacteria 4210
511 Ga0307510_10108768 3300033180 Bacteria 2524
512 Ga0373959_0042364 3300034820 Bacteria 959
513 Ga0373931_0315990 3300035691 Bacteria 969
514 Ga0373925_0824834 3300037068 Bacteria 764
515 Ga0395899_0000344 3300037312 Bacteria 57423
516 Ga0395899_0079887 3300037312 Bacteria 2382
517 Ga0395900_0019446 3300037418 Bacteria 6924
518 Ga0395900_0109112 3300037418 Bacteria 2843
519 Ga0395898_0174190 3300037466 Bacteria 2057
520 Ga0395905_0022085 3300037471 Bacteria 6019
521 Ga0395905_0037501 3300037471 Bacteria 4550
522 Ga0395905_0038248 3300037471 Bacteria 4502
523 Ga0395905_0083297 3300037471 Bacteria 2996
524 Ga0395905_0158898 3300037471 Bacteria 2125
525 Ga0395901_0127946 3300038443 Bacteria 2670
526 Ga0395901_0131188 3300038443 Bacteria 2633
527 Ga0395901_0373732 3300038443 Bacteria 1468
528 Ga0436365_1619585 3300039437 Bacteria 758
529 Ga0436365_1868038 3300039437 Bacteria 716
530 Ga0436361_0268202 3300039447 Bacteria 49775
531 Ga0439436_0001379 3300041404 Bacteria 7004
532 Ga0439436_0006229 3300041404 Bacteria 3662
533 Ga0439439_0005352 3300041406 Bacteria 2928
534 Ga0439439_0005369 3300041406 Bacteria 2924
535 Ga0439439_0009655 3300041406 Bacteria 2299
536 Ga0439461_0050938 3300041410 Bacteria 918
537 Ga0439465_0000697 3300041413 Bacteria 10311
538 Ga0451789_0337724 3300041443 Bacteria 560
539 Ga0451791_1603068 3300041451 Bacteria 645
540 Ga0451793_0018749 3300041452 Bacteria 1350
541 Ga0451793_1463256 3300041452 Bacteria 564
542 Ga0451800_0610257 3300041459 Bacteria 1592
543 Ga0451807_0067919 3300041486 Bacteria 744
544 Ga0451837_1700856 3300041494 Bacteria 756
545 Ga0451841_1340995 3300041498 Bacteria 728
546 Ga0451853_0112802 3300041512 Bacteria 1741
547 Ga0451853_3547166 3300041512 Bacteria 654
548 Ga0439431_0000916 3300041997 Bacteria 6385
549 Ga0439431_0007247 3300041997 Bacteria 2470
550 Ga0439433_0000360 3300041999 Bacteria 8072
551 Ga0439442_009609 3300042002 Bacteria 1955
552 Ga0439442_016402 3300042002 Bacteria 1527
553 Ga0439445_0000835 3300042004 Bacteria 6503
554 Ga0439432_003052 3300042006 Bacteria 6232
555 Ga0439432_012101 3300042006 Bacteria 2960
556 Ga0439432_095902 3300042006 Bacteria 890
557 Ga0439449_0001800 3300042007 Bacteria 8435
558 Ga0439449_0002084 3300042007 Bacteria 7861
559 Ga0439449_0003898 3300042007 Bacteria 5783
560 Ga0439449_0017753 3300042007 Bacteria 2671
561 Ga0439452_006051 3300042010 Bacteria 3826
562 Ga0439452_022075 3300042010 Bacteria 1651
563 Ga0439457_008504 3300042014 Bacteria 2417
564 Ga0439462_0004954 3300042015 Bacteria 3266
565 Ga0439462_0008200 3300042015 Bacteria 2629
566 Ga0439462_0012214 3300042015 Bacteria 2193
567 Ga0450911_014976 3300042115 Bacteria 1028
568 Ga0450920_022302 3300042122 Bacteria 1226
569 Ga0450888_020205 3300042126 Bacteria 844
570 Ga0450898_007204 3300042134 Bacteria 1728
571 Ga0450906_002698 3300042145 Bacteria 3863
572 Ga0450906_011020 3300042145 Bacteria 1698
573 Ga0450907_034411 3300042146 Bacteria 864
574 Ga0450910_015188 3300042147 Bacteria 1132
575 Ga0450909_006505 3300042185 Bacteria 1684
576 Ga0439434_0000980 3300042435 Bacteria 8236
577 Ga0439434_0008390 3300042435 Bacteria 3029
578 Ga0439434_0010643 3300042435 Bacteria 2712
579 Ga0439434_0092514 3300042435 Bacteria 968
580 Ga0450893_0008574 3300042532 Bacteria 1664
581 Ga0466986_0061755 3300044650 Bacteria 2594
582 Ga0466977_0153091 3300044666 Bacteria 1492
583 Ga0466978_0022614 3300044671 Bacteria 3737
584 Ga0466965_0006416 3300044683 Bacteria 5340
585 Ga0466961_0004849 3300044693 Bacteria 8463
586 Ga0466961_0036663 3300044693 Bacteria 3147
587 Ga0466964_0006122 3300044706 Bacteria 4485
588 Ga0466964_0040101 3300044706 Bacteria 1890
589 Ga0453684_0000606 3300044712 Bacteria 132056
590 Ga0453684_0029039 3300044712 Bacteria 7868
591 Ga0466971_0077704 3300044719 Bacteria 1511
592 Ga0466968_0005280 3300044735 Bacteria 4838
593 Ga0466970_0006124 3300044765 Bacteria 5991
594 Ga0466970_0059958 3300044765 Bacteria 2038
595 Ga0466957_0580074 3300044842 Bacteria 784
596 Ga0466960_0054582 3300044901 Bacteria 1940
597 Ga0466959_0008819 3300045049 Bacteria 7145
598 Ga0466959_0027997 3300045049 Bacteria 4179
599 Ga0451576_0013321 3300045051 Bacteria 9202
600 Ga0466967_0009266 3300045976 Bacteria 7293
601 Ga0466967_0237002 3300045976 Bacteria 1739
602 Ga0495617_000303 3300046452 Bacteria 27779
603 Ga0495627_008497 3300046453 Bacteria 3845
604 Ga0495627_088232 3300046453 Bacteria 893
605 Ga0495590_0064769 3300046457 Bacteria 1279
606 Ga0495638_0028214 3300046460 Bacteria 3626
607 Ga0495651_0145428 3300046462 Bacteria 1715
608 Ga0495605_0000168 3300046474 Bacteria 82889
609 Ga0495639_0022262 3300046475 Bacteria 2779
610 Ga0495584_0002376 3300046491 Bacteria 10696
611 Ga0495584_0005922 3300046491 Bacteria 6440
612 Ga0495584_0039758 3300046491 Bacteria 2376
613 Ga0495585_0000193 3300046492 Bacteria 63937
614 Ga0495585_0004816 3300046492 Bacteria 8669
615 Ga0495596_0003328 3300046500 Bacteria 8183
616 Ga0495607_0000941 3300046501 Bacteria 27027
617 Ga0495583_0000525 3300046506 Bacteria 54370
618 Ga0495583_0018518 3300046506 Bacteria 3663
619 Ga0495606_0000001 3300046507 Bacteria 592123
620 Ga0495606_0035562 3300046507 Bacteria 3403
621 Ga0495606_0143507 3300046507 Bacteria 1408
622 Ga0495610_0005043 3300046512 Bacteria 9536
623 Ga0495610_0018746 3300046512 Bacteria 3894
624 Ga0495616_0000526 3300046513 Bacteria 28964
625 Ga0495616_0007518 3300046513 Bacteria 6521
626 Ga0495616_0008947 3300046513 Bacteria 5884
627 Ga0495616_0014603 3300046513 Bacteria 4391
628 Ga0495631_0004184 3300046518 Bacteria 7719
629 Ga0495637_0006045 3300046520 Bacteria 6111
630 Ga0495648_0000109 3300046524 Bacteria 101519
631 Ga0495663_0128016 3300046525 Bacteria 854
632 Ga0495654_0003435 3300046530 Bacteria 9711
633 Ga0495654_0046196 3300046530 Bacteria 2146
634 Ga0495654_0062093 3300046530 Bacteria 1792
635 Ga0495654_0182136 3300046530 Bacteria 909
636 Ga0495609_0000346 3300046538 Bacteria 40425
637 Ga0495609_0050548 3300046538 Bacteria 1853
638 Ga0495621_0010000 3300046539 Bacteria 2894
639 Ga0495621_0011585 3300046539 Bacteria 2733
640 Ga0495597_0004057 3300046542 Bacteria 8196
641 Ga0495597_0271549 3300046542 Bacteria 662
642 Ga0495633_0006530 3300046558 Bacteria 6893
643 Ga0495633_0012623 3300046558 Bacteria 4483
644 Ga0495656_0003255 3300046615 Bacteria 5478
645 Ga0495656_0666815 3300046615 Bacteria 559
646 Ga0495668_0000095 3300046616 Bacteria 141321
647 Ga0495668_0002235 3300046616 Bacteria 16399
648 Ga0495668_0052017 3300046616 Bacteria 2267
649 Ga0495668_0063099 3300046616 Bacteria 2041
650 Ga0495668_0118188 3300046616 Bacteria 1450
651 Ga0495625_0000896 3300046660 Bacteria 40225
652 Ga0495625_0090482 3300046660 Bacteria 2116
653 Ga0495625_0128104 3300046660 Bacteria 1721
654 Ga0495625_0344619 3300046660 Bacteria 943
655 Ga0495659_0013477 3300046664 Bacteria 2663
656 Ga0495661_0069382 3300046665 Bacteria 2065
657 Ga0495661_0140755 3300046665 Bacteria 1313
658 Ga0495588_0019546 3300046674 Bacteria 3319
659 Ga0495588_0033592 3300046674 Bacteria 2591
660 Ga0495588_0252663 3300046674 Bacteria 929
661 Ga0495657_0060967 3300046675 Bacteria 2497
662 Ga0495599_0187568 3300046678 Bacteria 1273
663 Ga0495669_0045637 3300046684 Bacteria 1954
664 Ga0495670_0267388 3300046691 Bacteria 913
665 Ga0495671_0009212 3300046692 Bacteria 5519
666 Ga0495671_0030047 3300046692 Bacteria 2786
667 Ga0495649_0007050 3300046694 Bacteria 6917
668 Ga0495589_0311139 3300046794 Bacteria 729
669 Ga0495600_0188319 3300046809 Bacteria 1328
670 Ga0495636_0027504 3300047318 Bacteria 2316
671 Ga0495683_0000144 3300047323 Bacteria 69959
672 Ga0495683_0454240 3300047323 Bacteria 525
673 Ga0495687_007289 3300047443 Bacteria 6552
674 Ga0495677_0016382 3300047445 Bacteria 2689
675 Ga0495685_006498 3300047447 Bacteria 3829
676 Ga0495685_017529 3300047447 Bacteria 2453
677 Ga0495681_0009923 3300047470 Bacteria 5815
678 Ga0495614_0310627 3300048089 Bacteria 730
679 Ga0495626_0041067 3300048091 Bacteria 2182
680 Ga0496100_0007340 3300048903 Bacteria 6072
681 Ga0496101_0018273 3300048904 Bacteria 4766
682 Ga0496102_0000707 3300048905 Bacteria 33079
683 Ga0496102_0042793 3300048905 Bacteria 4105
684 Ga0496104_0020850 3300048907 Bacteria 6010
685 Ga0496104_0635886 3300048907 Bacteria 976
686 Ga0496106_0020141 3300048909 Bacteria 4948
687 Ga0496106_0134694 3300048909 Bacteria 1939
688 Ga0496107_0452486 3300048910 Bacteria 954
689 Ga0496107_0873698 3300048910 Bacteria 656
690 Ga0496109_0130274 3300048912 Bacteria 2347
691 Ga0496110_0035381 3300048913 Bacteria 4332
692 Ga0496110_0144587 3300048913 Bacteria 2150
693 Ga0496111_0029616 3300048914 Bacteria 3889
694 Ga0496111_0087357 3300048914 Bacteria 2282
695 Ga0496113_0073271 3300048916 Bacteria 2609
696 Ga0496114_0703367 3300048917 Bacteria 886
697 Ga0496116_0035499 3300048919 Bacteria 3501
698 Ga0496118_0010125 3300048921 Bacteria 9371
699 Ga0496118_0030038 3300048921 Bacteria 4545
700 Ga0496121_0042948 3300048924 Bacteria 3922
701 Ga0496121_0190509 3300048924 Bacteria 1471
702 Ga0496121_0197772 3300048924 Bacteria 1435
703 Ga0496121_0506526 3300048924 Bacteria 765
704 Ga0496122_0003984 3300048925 Bacteria 18836
705 Ga0496122_0064753 3300048925 Bacteria 2657
706 Ga0496123_0000235 3300048926 Bacteria 111823
707 Ga0496123_0061997 3300048926 Bacteria 2399
708 Ga0496123_0136762 3300048926 Bacteria 1347
709 Ga0496124_0451518 3300048927 Bacteria 876
710 Ga0496125_0020173 3300048928 Bacteria 6264
711 Ga0496125_0026915 3300048928 Bacteria 5223
712 Ga0496125_0091422 3300048928 Bacteria 2280
713 Ga0496125_0158785 3300048928 Bacteria 1540
714 Ga0496125_0325321 3300048928 Bacteria 930
715 Ga0496126_0805841 3300048929 Bacteria 720
716 Ga0495682_0073699 3300049460 Bacteria 1228
717 Ga0501034_0548052 3300049571 Bacteria 1066
718 Ga0501037_0010551 3300049573 Bacteria 6785
719 Ga0501046_0085905 3300049580 Bacteria 2426
720 Ga0501225_0013794 3300049705 Bacteria 2259
721 Ga0501262_000153 3300049759 Bacteria 8442
722 Ga0501266_001605 3300049763 Bacteria 2884
723 Ga0501269_063195 3300049766 Bacteria 527
724 Ga0501281_15192 3300049777 Bacteria 567
725 nmdc:mga03683_10250_c1 3300050489 Bacteria 3358
726 nmdc:mga03683_209216_c1 3300050489 Bacteria 897
727 nmdc:mga03683_224231_c1 3300050489 Bacteria 868
728 nmdc:mga03683_36119_c1 3300050489 Bacteria 2008
729 nmdc:mga03683_406129_c1 3300050489 Bacteria 651
730 nmdc:mga03683_439257_c1 3300050489 Bacteria 627
731 nmdc:mga03n38_10203_c1 3300050490 Bacteria 3447
732 nmdc:mga03n38_25159_c1 3300050490 Bacteria 2441
733 nmdc:mga03n38_25218_c1 3300050490 Bacteria 2439
734 nmdc:mga03n38_369277_c1 3300050490 Bacteria 784
735 nmdc:mga00v17_21047_c2 3300050491 Bacteria 2596
736 nmdc:mga00v17_359062_c1 3300050491 Bacteria 947
737 nmdc:mga00v17_53639_c1 3300050491 Bacteria 2458
738 nmdc:mga0yw44_28385_c1 3300050492 Bacteria 3218
739 nmdc:mga0yw44_58591_c1 3300050492 Bacteria 2353
740 nmdc:mga0k408_127897_c1 3300050493 Bacteria 1507
741 nmdc:mga0k408_132105_c1 3300050493 Bacteria 1482
742 nmdc:mga0k408_197323_c1 3300050493 Bacteria 1201
743 nmdc:mga0k408_265279_c1 3300050493 Bacteria 1025
744 nmdc:mga0k408_289323_c1 3300050493 Bacteria 978
745 nmdc:mga0k408_36012_c1 3300050493 Bacteria 2839
746 nmdc:mga0k408_403132_c1 3300050493 Bacteria 814
747 nmdc:mga0k408_41811_c1 3300050493 Bacteria 2639
748 nmdc:mga0k408_4603_c1 3300050493 Bacteria 7317
749 nmdc:mga0k408_513833_c1 3300050493 Bacteria 709
750 nmdc:mga0k408_52519_c1 3300050493 Bacteria 2362
751 nmdc:mga06z11_277517_c1 3300050494 Bacteria 992
752 nmdc:mga06z11_738697_c1 3300050494 Bacteria 600
753 nmdc:mga04h51_139923_c1 3300050495 Bacteria 917
754 nmdc:mga07m45_100184_c1 3300050496 Bacteria 1664
755 nmdc:mga07m45_174148_c1 3300050496 Bacteria 1251
756 nmdc:mga07m45_1973_c1 3300050496 Bacteria 9501
757 nmdc:mga07m45_21686_c1 3300050496 Bacteria 3500
758 nmdc:mga07m45_224527_c1 3300050496 Bacteria 1093
759 nmdc:mga07m45_345113_c1 3300050496 Bacteria 865
760 nmdc:mga07m45_8907_c1 3300050496 Bacteria 5182
761 nmdc:mga09592_239398_c1 3300050508 Bacteria 1572
762 nmdc:mga09592_5962_c1 3300050508 Bacteria 9932
763 nmdc:mga0qj67_17296_c1 3300050509 Bacteria 5481
764 Ga0500610_0006176 3300053079 Bacteria 5000
765 Ga0500610_0013178 3300053079 Bacteria 3837
766 Ga0500578_0039951 3300053086 Bacteria 3015
767 Ga0500643_055693 3300053087 Bacteria 1119
768 Ga0500644_0002098 3300053088 Bacteria 5060
769 Ga0500651_0027085 3300053093 Bacteria 3604
770 Ga0500651_0299293 3300053093 Bacteria 923
771 Ga0500641_0061010 3300053096 Bacteria 1570
772 Ga0500641_0120501 3300053096 Bacteria 1131
773 Ga0500650_0093654 3300053098 Bacteria 1406
774 Ga0500572_020849 3300053111 Bacteria 1730
775 Ga0500592_012805 3300053116 Bacteria 1342
776 Ga0500593_003907 3300053117 Bacteria 5717
777 Ga0500593_008376 3300053117 Bacteria 4245
778 Ga0500594_0003689 3300053118 Bacteria 3376
779 Ga0500607_004990 3300053121 Bacteria 8825
780 Ga0500607_216595 3300053121 Bacteria 803
781 Ga0500608_004926 3300053122 Bacteria 5233
782 Ga0500608_043313 3300053122 Bacteria 2161
783 Ga0500618_020979 3300053125 Bacteria 1598
784 Ga0500655_000523 3300053133 Bacteria 7736
785 Ga0500658_0001924 3300053134 Bacteria 8127
786 Ga0500559_0000011 3300053136 Bacteria 164751
787 Ga0500559_0005307 3300053136 Bacteria 5936
788 Ga0500568_0006491 3300053139 Bacteria 5865
789 Ga0500568_0306157 3300053139 Bacteria 577
790 Ga0500616_0143992 3300053153 Bacteria 1110
791 Ga0500616_0164096 3300053153 Bacteria 1016
792 Ga0500616_0309782 3300053153 Bacteria 653
793 Ga0500622_0055210 3300053156 Bacteria 2035
794 Ga0500622_0155426 3300053156 Bacteria 1077
795 Ga0500624_026386 3300053157 Bacteria 972
796 Ga0500627_0006722 3300053158 Bacteria 3944
797 Ga0500627_0225857 3300053158 Bacteria 834
798 Ga0500634_0006145 3300053161 Bacteria 5783
799 Ga0500638_003903 3300053162 Bacteria 5628
800 Ga0500625_070542 3300053729 Bacteria 1556
801 Ga0500645_002856 3300053730 Bacteria 7416
802 Ga0500645_015872 3300053730 Bacteria 2380
803 Ga0500645_017528 3300053730 Bacteria 2243
804 Ga0500645_163810 3300053730 Bacteria 609
805 Ga0466962_0006446 3300061719 Bacteria 5634
806 Ga0466962_0010759 3300061719 Bacteria 4397

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1000441 Ga0055526_100044115 149
2 3300025295 Ga0209564_1000009 Ga0209564_1000009148 149
3 3300044842 Ga0466957_0580074 Ga0466957_0580074_158_613 149
4 3300046474 Ga0495605_0000168 Ga0495605_0000168_32052_32510 149
5 3300046507 Ga0495606_0000001 Ga0495606_0000001_26419_26877 149
6 3300046512 Ga0495610_0005043 Ga0495610_0005043_4225_4683 149
7 3300046558 Ga0495633_0006530 Ga0495633_0006530_1243_1701 149
8 3300046616 Ga0495668_0000095 Ga0495668_0000095_124112_124570 149
9 3300005347 Ga0070668_100436175 Ga0070668_1004361753 150
10 3300009176 Ga0105242_10698787 Ga0105242_106987872 150
11 3300014326 Ga0157380_10002034 Ga0157380_100020345 150
12 3300014969 Ga0157376_11077177 Ga0157376_110771772 150
13 3300046491 Ga0495584_0005922 Ga0495584_0005922_5291_5743 150
14 3300046501 Ga0495607_0000941 Ga0495607_0000941_25710_26162 150
15 3300046506 Ga0495583_0018518 Ga0495583_0018518_1644_2096 150
16 3300046513 Ga0495616_0014603 Ga0495616_0014603_1999_2451 150
17 3300046538 Ga0495609_0000346 Ga0495609_0000346_15386_15838 150
18 3300046615 Ga0495656_0666815 Ga0495656_0666815_59_511 150
19 3300046616 Ga0495668_0052017 Ga0495668_0052017_990_1442 150
20 3300046660 Ga0495625_0128104 Ga0495625_0128104_317_769 150
21 3300046664 Ga0495659_0013477 Ga0495659_0013477_935_1387 150
22 3300046665 Ga0495661_0069382 Ga0495661_0069382_338_790 150
23 3300046684 Ga0495669_0045637 Ga0495669_0045637_1273_1725 150
24 3300046692 Ga0495671_0030047 Ga0495671_0030047_1509_1961 150
25 3300046694 Ga0495649_0007050 Ga0495649_0007050_4653_5105 150
26 3300046794 Ga0495589_0311139 Ga0495589_0311139_37_489 150
27 3300047318 Ga0495636_0027504 Ga0495636_0027504_882_1334 150
28 3300047443 Ga0495687_007289 Ga0495687_007289_1568_2020 150
29 3300047445 Ga0495677_0016382 Ga0495677_0016382_88_540 150
30 3300047447 Ga0495685_006498 Ga0495685_006498_2229_2681 150
31 3300047470 Ga0495681_0009923 Ga0495681_0009923_3537_3989 150
32 3300005548 Ga0070665_101285386 Ga0070665_1012853862 151
33 3300046452 Ga0495617_000303 Ga0495617_000303_2841_3299 151
34 3300046457 Ga0495590_0064769 Ga0495590_0064769_396_854 151
35 3300046460 Ga0495638_0028214 Ga0495638_0028214_2010_2480 151
36 3300046491 Ga0495584_0002376 Ga0495584_0002376_4092_4550 151
37 3300046491 Ga0495584_0039758 Ga0495584_0039758_20_478 151
38 3300046492 Ga0495585_0000193 Ga0495585_0000193_22085_22543 151
39 3300046492 Ga0495585_0004816 Ga0495585_0004816_2668_3126 151
40 3300046500 Ga0495596_0003328 Ga0495596_0003328_2848_3306 151
41 3300046506 Ga0495583_0000525 Ga0495583_0000525_41674_42132 151
42 3300046507 Ga0495606_0035562 Ga0495606_0035562_1491_1949 151
43 3300046507 Ga0495606_0143507 Ga0495606_0143507_242_700 151
44 3300046513 Ga0495616_0000526 Ga0495616_0000526_20634_21092 151
45 3300046513 Ga0495616_0008947 Ga0495616_0008947_2642_3100 151
46 3300046524 Ga0495648_0000109 Ga0495648_0000109_64084_64542 151
47 3300046525 Ga0495663_0128016 Ga0495663_0128016_137_595 151
48 3300046542 Ga0495597_0271549 Ga0495597_0271549_169_639 151
49 3300046558 Ga0495633_0012623 Ga0495633_0012623_2784_3242 151
50 3300046616 Ga0495668_0002235 Ga0495668_0002235_13756_14214 151
51 3300046674 Ga0495588_0019546 Ga0495588_0019546_2471_2929 151
52 3300047323 Ga0495683_0000144 Ga0495683_0000144_63274_63732 151
53 3300047323 Ga0495683_0454240 Ga0495683_0454240_28_486 151
54 3300047447 Ga0495685_017529 Ga0495685_017529_1226_1684 151
55 3300048091 Ga0495626_0041067 Ga0495626_0041067_707_1165 151
56 3300048905 Ga0496102_0000707 Ga0496102_0000707_5828_6286 151
57 3300048910 Ga0496107_0873698 Ga0496107_0873698_39_497 151
58 3300049460 Ga0495682_0073699 Ga0495682_0073699_512_970 151
59 3300041459 Ga0451800_0610257 Ga0451800_0610257_706_1164 152
60 3300041512 Ga0451853_0112802 Ga0451853_0112802_683_1141 152
61 iso_pu_bacteria 2547132374 2548500009 152
62 3300041451 Ga0451791_1603068 Ga0451791_1603068_108_569 153
63 3300041452 Ga0451793_0018749 Ga0451793_0018749_157_618 153
64 3300049573 Ga0501037_0010551 Ga0501037_0010551_153_626 153
65 iso_pu_bacteria 2511231002 2511244316 153
66 iso_pu_bacteria 2513020051 2513227977 153
67 iso_pu_bacteria 2599185214 2599624056 153
68 iso_pu_bacteria 2599185226 2599672067 153
69 iso_pu_bacteria 2599185227 2599681851 153
70 iso_pu_bacteria 2599185229 2599693864 153
71 iso_pu_bacteria 2643221570 2643868245 153
72 iso_pu_bacteria 2643221596 2643993761 153
73 iso_pu_bacteria 2643221652 2644293849 153
74 iso_pu_bacteria 2643221660 2644339985 153
75 iso_pu_bacteria 2643221672 2644397969 153
76 iso_pu_bacteria 2643221717 2644644672 153
77 iso_pu_bacteria 2738541277 2738719919 153
78 iso_pu_bacteria 2738541307 2738879669 153
79 iso_pu_bacteria 2738543019 2739279118 153
80 iso_pu_bacteria 2831265667 2831269543 153
81 iso_pu_bacteria 2838054893 2838060034 153
82 iso_pu_bacteria 2842677519 2842681905 153
83 iso_pu_bacteria 2842733646 2842734700 153
84 iso_pu_bacteria 2842747753 2842748535 153
85 iso_pu_bacteria 2885192300 2885195586 153
86 iso_pu_bacteria 2885198086 2885199215 153
87 iso_pu_bacteria 2885211737 2885212866 153
88 iso_pu_bacteria 2904449895 2904450086 153
89 iso_pu_bacteria 2904456579 2904457091 153
90 iso_pu_bacteria 2919462493 2919464981 153
91 iso_pu_bacteria 2919704043 2919704621 153
92 iso_pu_bacteria 2928070936 2928076738 153
93 iso_pu_bacteria 2928084124 2928090512 153
94 iso_pu_bacteria 2928115317 2928117338 153
95 iso_pu_bacteria 2929520902 2929525376 153
96 iso_pu_bacteria 2945909444 2945913120 153
97 iso_pu_bacteria 2945945610 2945948746 153
98 iso_pu_bacteria 2945972063 2945972866 153
99 iso_pu_bacteria 2945984333 2945984610 153
100 iso_pu_bacteria 2954767861 2954772886 153
101 iso_pu_bacteria 2990710928 2990713395 153
102 3300014497 Ga0182008_10002648 Ga0182008_1000264810 154
103 3300021384 Ga0213876_10579543 Ga0213876_105795431 154
104 3300028794 Ga0307515_10026348 Ga0307515_100263489 154
105 3300039437 Ga0436365_1619585 Ga0436365_1619585_200_667 154
106 3300041406 Ga0439439_0005352 Ga0439439_0005352_517_1074 154
107 3300041443 Ga0451789_0337724 Ga0451789_0337724_67_543 154
108 3300042006 Ga0439432_095902 Ga0439432_095902_41_598 154
109 3300042007 Ga0439449_0001800 Ga0439449_0001800_3537_4094 154
110 3300042015 Ga0439462_0012214 Ga0439462_0012214_336_893 154
111 3300044712 Ga0453684_0000606 Ga0453684_0000606_7159_7653 154
112 3300045051 Ga0451576_0013321 Ga0451576_0013321_4141_4635 154
113 3300049580 Ga0501046_0085905 Ga0501046_0085905_1812_2288 154
114 3300053157 Ga0500624_026386 Ga0500624_026386_455_946 154
115 iso_pu_bacteria 2904541872 2904543933 154
116 iso_pu_bacteria 2929160207 2929162508 154
117 3300001989 JGI24739J22299_10005364 JGI24739J22299_100053644 155
118 3300002739 JGI25158J39367_1003721 JGI25158J39367_10037211 155
119 3300002774 JGI25150J39212_1001101 JGI25150J39212_10011017 155
120 3300002774 JGI25150J39212_1001868 JGI25150J39212_10018686 155
121 3300002774 JGI25150J39212_1009272 JGI25150J39212_10092722 155
122 3300002987 JGI25159J45721_1000465 JGI25159J45721_10004658 155
123 3300002987 JGI25159J45721_1002893 JGI25159J45721_10028932 155
124 3300003187 JGI25151J46595_10015217 JGI25151J46595_100152172 155
125 3300003354 JGI25160J50197_1000192 JGI25160J50197_10001929 155
126 3300003354 JGI25160J50197_1018502 JGI25160J50197_10185022 155
127 3300003354 JGI25160J50197_1059988 JGI25160J50197_10599881 155
128 3300003374 JGI25161J50226_1000043 JGI25161J50226_10000434 155
129 3300003771 Ga0055526_1003998 Ga0055526_10039986 155
130 3300003771 Ga0055526_1004562 Ga0055526_10045626 155
131 3300003773 Ga0055537_1000259 Ga0055537_10002596 155
132 3300003773 Ga0055537_1001161 Ga0055537_10011613 155
133 3300003773 Ga0055537_1004429 Ga0055537_10044295 155
134 3300003773 Ga0055537_1009409 Ga0055537_10094092 155
135 3300003775 Ga0055524_1000156 Ga0055524_100015674 155
136 3300003775 Ga0055524_1009658 Ga0055524_10096582 155
137 3300003781 Ga0055536_1000270 Ga0055536_100027039 155
138 3300003781 Ga0055536_1009172 Ga0055536_10091725 155
139 3300003784 Ga0055534_1001138 Ga0055534_100113810 155
140 3300003784 Ga0055534_1003028 Ga0055534_10030285 155
141 3300003784 Ga0055534_1006217 Ga0055534_10062173 155
142 3300003784 Ga0055534_1029829 Ga0055534_10298291 155
143 3300003790 Ga0055528_1008541 Ga0055528_10085412 155
144 3300003790 Ga0055528_1020328 Ga0055528_10203282 155
145 3300003791 Ga0055530_10000408 Ga0055530_1000040838 155
146 3300003791 Ga0055530_10003951 Ga0055530_100039517 155
147 3300003791 Ga0055530_10009348 Ga0055530_100093482 155
148 3300003791 Ga0055530_10033474 Ga0055530_100334742 155
149 3300003792 Ga0055540_1000033 Ga0055540_1000033141 155
150 3300003792 Ga0055540_1003778 Ga0055540_10037786 155
151 3300003792 Ga0055540_1004106 Ga0055540_10041066 155
152 3300003794 Ga0055531_10000273 Ga0055531_1000027354 155
153 3300003794 Ga0055531_10004865 Ga0055531_100048653 155
154 3300003794 Ga0055531_10009016 Ga0055531_100090166 155
155 3300004625 Ga0055543_1000127 Ga0055543_100012751 155
156 3300004625 Ga0055543_1003299 Ga0055543_10032996 155
157 3300005262 Ga0065165_1028859 Ga0065165_10288592 155
158 3300005262 Ga0065165_1067279 Ga0065165_10672792 155
159 3300005289 Ga0065704_10140698 Ga0065704_101406982 155
160 3300005289 Ga0065704_10292894 Ga0065704_102928942 155
161 3300005334 Ga0068869_100144770 Ga0068869_1001447703 155
162 3300005336 Ga0070680_100154059 Ga0070680_1001540592 155
163 3300005336 Ga0070680_100327448 Ga0070680_1003274482 155
164 3300005338 Ga0068868_100092735 Ga0068868_1000927353 155
165 3300005338 Ga0068868_100301613 Ga0068868_1003016133 155
166 3300005339 Ga0070660_100063427 Ga0070660_1000634273 155
167 3300005344 Ga0070661_100551136 Ga0070661_1005511361 155
168 3300005356 Ga0070674_100157791 Ga0070674_1001577911 155
169 3300005366 Ga0070659_100018367 Ga0070659_1000183673 155
170 3300005435 Ga0070714_100375116 Ga0070714_1003751162 155
171 3300005456 Ga0070678_100064383 Ga0070678_1000643834 155
172 3300005457 Ga0070662_100131317 Ga0070662_1001313171 155
173 3300005539 Ga0068853_100099468 Ga0068853_1000994682 155
174 3300005539 Ga0068853_100232269 Ga0068853_1002322692 155
175 3300005543 Ga0070672_100116863 Ga0070672_1001168632 155
176 3300005548 Ga0070665_100796843 Ga0070665_1007968432 155
177 3300005563 Ga0068855_100076757 Ga0068855_1000767575 155
178 3300005563 Ga0068855_100089079 Ga0068855_1000890792 155
179 3300005563 Ga0068855_100146314 Ga0068855_1001463144 155
180 3300005564 Ga0070664_100013869 Ga0070664_1000138696 155
181 3300005577 Ga0068857_100318117 Ga0068857_1003181173 155
182 3300005614 Ga0068856_100439570 Ga0068856_1004395701 155
183 3300005616 Ga0068852_100148447 Ga0068852_1001484472 155
184 3300005844 Ga0068862_100068756 Ga0068862_1000687563 155
185 3300006038 Ga0075365_10245891 Ga0075365_102458913 155
186 3300006048 Ga0075363_100083557 Ga0075363_1000835572 155
187 3300006051 Ga0075364_10025580 Ga0075364_100255802 155
188 3300006051 Ga0075364_10459791 Ga0075364_104597912 155
189 3300006058 Ga0075432_10007261 Ga0075432_100072612 155
190 3300006058 Ga0075432_10007774 Ga0075432_100077742 155
191 3300006177 Ga0075362_10003943 Ga0075362_100039435 155
192 3300006177 Ga0075362_10014025 Ga0075362_100140252 155
193 3300006177 Ga0075362_10026155 Ga0075362_100261552 155
194 3300006177 Ga0075362_10060691 Ga0075362_100606913 155
195 3300006177 Ga0075362_10324345 Ga0075362_103243451 155
196 3300006177 Ga0075362_10611600 Ga0075362_106116001 155
197 3300006178 Ga0075367_10183859 Ga0075367_101838591 155
198 3300006195 Ga0075366_10051211 Ga0075366_100512113 155
199 3300006195 Ga0075366_10089703 Ga0075366_100897032 155
200 3300006195 Ga0075366_10336508 Ga0075366_103365081 155
201 3300006195 Ga0075366_10386789 Ga0075366_103867891 155
202 3300006195 Ga0075366_10590118 Ga0075366_105901181 155
203 3300006237 Ga0097621_101454490 Ga0097621_1014544902 155
204 3300006353 Ga0075370_10000322 Ga0075370_100003229 155
205 3300006353 Ga0075370_10000738 Ga0075370_100007382 155
206 3300006353 Ga0075370_10046321 Ga0075370_100463212 155
207 3300006353 Ga0075370_10107198 Ga0075370_101071982 155
208 3300006353 Ga0075370_10173015 Ga0075370_101730152 155
209 3300006353 Ga0075370_10197097 Ga0075370_101970973 155
210 3300006358 Ga0068871_100173810 Ga0068871_1001738102 155
211 3300006946 Ga0079104_1020241 Ga0079104_10202412 155
212 3300006946 Ga0079104_1036670 Ga0079104_10366702 155
213 3300006948 Ga0099826_10008499 Ga0099826_100084997 155
214 3300006948 Ga0099826_10444032 Ga0099826_104440321 155
215 3300009036 Ga0105244_10003000 Ga0105244_1000300011 155
216 3300009093 Ga0105240_10004043 Ga0105240_1000404324 155
217 3300009098 Ga0105245_10273025 Ga0105245_102730253 155
218 3300009148 Ga0105243_10003757 Ga0105243_100037573 155
219 3300009148 Ga0105243_10022421 Ga0105243_100224216 155
220 3300009176 Ga0105242_10495201 Ga0105242_104952011 155
221 3300009545 Ga0105237_10124271 Ga0105237_101242713 155
222 3300009553 Ga0105249_11186873 Ga0105249_111868732 155
223 3300010375 Ga0105239_10266673 Ga0105239_102666731 155
224 3300010375 Ga0105239_11418942 Ga0105239_114189422 155
225 3300011119 Ga0105246_10035641 Ga0105246_100356414 155
226 3300011119 Ga0105246_10913458 Ga0105246_109134582 155
227 3300012502 Ga0157347_1002569 Ga0157347_10025691 155
228 3300012502 Ga0157347_1003557 Ga0157347_10035572 155
229 3300012513 Ga0157326_1000968 Ga0157326_10009685 155
230 3300013100 Ga0157373_10023683 Ga0157373_100236833 155
231 3300013100 Ga0157373_10345524 Ga0157373_103455242 155
232 3300013102 Ga0157371_10310855 Ga0157371_103108552 155
233 3300013104 Ga0157370_10072460 Ga0157370_100724602 155
234 3300013104 Ga0157370_11167749 Ga0157370_111677491 155
235 3300013105 Ga0157369_10012328 Ga0157369_100123286 155
236 3300013296 Ga0157374_11738372 Ga0157374_117383721 155
237 3300013297 Ga0157378_10076690 Ga0157378_100766903 155
238 3300013308 Ga0157375_10598249 Ga0157375_105982491 155
239 3300014497 Ga0182008_10001340 Ga0182008_1000134019 155
240 3300014497 Ga0182008_10016053 Ga0182008_100160534 155
241 3300014497 Ga0182008_10044379 Ga0182008_100443793 155
242 3300014497 Ga0182008_10053246 Ga0182008_100532463 155
243 3300014969 Ga0157376_10148287 Ga0157376_101482872 155
244 3300015261 Ga0182006_1001145 Ga0182006_100114519 155
245 3300015261 Ga0182006_1029708 Ga0182006_10297082 155
246 3300015262 Ga0182007_10008474 Ga0182007_100084743 155
247 3300015265 Ga0182005_1012041 Ga0182005_10120412 155
248 3300015683 Ga0183362_10001 Ga0183362_10001630 155
249 3300017792 Ga0163161_10000166 Ga0163161_1000016610 155
250 3300017792 Ga0163161_10017854 Ga0163161_100178543 155
251 3300021361 Ga0213872_10034267 Ga0213872_100342672 155
252 3300025208 Ga0209436_103077 Ga0209436_1030777 155
253 3300025208 Ga0209436_104293 Ga0209436_1042932 155
254 3300025245 Ga0207425_1000603 Ga0207425_10006037 155
255 3300025245 Ga0207425_1001556 Ga0207425_10015564 155
256 3300025245 Ga0207425_1002814 Ga0207425_10028142 155
257 3300025245 Ga0207425_1010123 Ga0207425_10101232 155
258 3300025258 Ga0209129_1000071 Ga0209129_1000071179 155
259 3300025263 Ga0209565_1000120 Ga0209565_1000120109 155
260 3300025263 Ga0209565_1000326 Ga0209565_100032643 155
261 3300025263 Ga0209565_1000774 Ga0209565_10007742 155
262 3300025263 Ga0209565_1001593 Ga0209565_10015938 155
263 3300025263 Ga0209565_1056566 Ga0209565_10565661 155
264 3300025273 Ga0209673_1000099 Ga0209673_100009992 155
265 3300025273 Ga0209673_1000839 Ga0209673_100083940 155
266 3300025273 Ga0209673_1001338 Ga0209673_100133821 155
267 3300025284 Ga0209130_1000041 Ga0209130_100004175 155
268 3300025284 Ga0209130_1000456 Ga0209130_10004567 155
269 3300025284 Ga0209130_1001771 Ga0209130_10017719 155
270 3300025284 Ga0209130_1003498 Ga0209130_10034986 155
271 3300025291 Ga0209675_1000054 Ga0209675_100005492 155
272 3300025291 Ga0209675_1001678 Ga0209675_10016786 155
273 3300025291 Ga0209675_1008675 Ga0209675_10086752 155
274 3300025291 Ga0209675_1014145 Ga0209675_10141453 155
275 3300025292 Ga0209676_1000005 Ga0209676_10000056 155
276 3300025292 Ga0209676_1000054 Ga0209676_1000054293 155
277 3300025292 Ga0209676_1002320 Ga0209676_10023203 155
278 3300025292 Ga0209676_1012219 Ga0209676_10122195 155
279 3300025292 Ga0209676_1026508 Ga0209676_10265082 155
280 3300025294 Ga0209025_1001409 Ga0209025_10014095 155
281 3300025294 Ga0209025_1010783 Ga0209025_10107833 155
282 3300025294 Ga0209025_1013211 Ga0209025_10132112 155
283 3300025294 Ga0209025_1014966 Ga0209025_10149662 155
284 3300025295 Ga0209564_1000239 Ga0209564_1000239102 155
285 3300025295 Ga0209564_1000662 Ga0209564_100066250 155
286 3300025295 Ga0209564_1000784 Ga0209564_10007846 155
287 3300025295 Ga0209564_1000890 Ga0209564_100089039 155
288 3300025297 Ga0209758_1000027 Ga0209758_1000027330 155
289 3300025297 Ga0209758_1010200 Ga0209758_10102003 155
290 3300025297 Ga0209758_1050345 Ga0209758_10503452 155
291 3300025298 Ga0209050_1000003 Ga0209050_10000036 155
292 3300025298 Ga0209050_1000007 Ga0209050_10000071092 155
293 3300025298 Ga0209050_1000954 Ga0209050_10009547 155
294 3300025298 Ga0209050_1004569 Ga0209050_100456910 155
295 3300025299 Ga0209256_1000001 Ga0209256_10000016 155
296 3300025299 Ga0209256_1000081 Ga0209256_1000081179 155
297 3300025299 Ga0209256_1024131 Ga0209256_10241312 155
298 3300025299 Ga0209256_1059446 Ga0209256_10594461 155
299 3300025302 Ga0207426_1000027 Ga0207426_1000027295 155
300 3300025302 Ga0207426_1000061 Ga0207426_1000061166 155
301 3300025302 Ga0207426_1003593 Ga0207426_10035936 155
302 3300025302 Ga0207426_1004649 Ga0207426_10046493 155
303 3300025303 Ga0209051_1000003 Ga0209051_10000036 155
304 3300025303 Ga0209051_1000009 Ga0209051_10000096 155
305 3300025303 Ga0209051_1000619 Ga0209051_100061934 155
306 3300025303 Ga0209051_1005714 Ga0209051_10057143 155
307 3300025303 Ga0209051_1019880 Ga0209051_10198805 155
308 3300025304 Ga0209257_1000018 Ga0209257_10000186 155
309 3300025304 Ga0209257_1000873 Ga0209257_100087332 155
310 3300025304 Ga0209257_1007556 Ga0209257_10075566 155
311 3300025304 Ga0209257_1007934 Ga0209257_10079344 155
312 3300025728 Ga0207655_1001368 Ga0207655_10013683 155
313 3300025903 Ga0207680_10417892 Ga0207680_104178922 155
314 3300025904 Ga0207647_10254573 Ga0207647_102545732 155
315 3300025913 Ga0207695_10125685 Ga0207695_101256853 155
316 3300025913 Ga0207695_10630993 Ga0207695_106309932 155
317 3300025917 Ga0207660_10038245 Ga0207660_100382451 155
318 3300025917 Ga0207660_10311643 Ga0207660_103116432 155
319 3300025924 Ga0207694_10197807 Ga0207694_101978073 155
320 3300025927 Ga0207687_10043205 Ga0207687_100432054 155
321 3300025929 Ga0207664_11081393 Ga0207664_110813931 155
322 3300025932 Ga0207690_10014545 Ga0207690_100145455 155
323 3300025933 Ga0207706_10017147 Ga0207706_100171473 155
324 3300025933 Ga0207706_10918481 Ga0207706_109184811 155
325 3300025935 Ga0207709_10000230 Ga0207709_1000023071 155
326 3300025938 Ga0207704_10162483 Ga0207704_101624831 155
327 3300025938 Ga0207704_11228983 Ga0207704_112289831 155
328 3300025940 Ga0207691_10151133 Ga0207691_101511332 155
329 3300025941 Ga0207711_10463975 Ga0207711_104639752 155
330 3300025942 Ga0207689_10285070 Ga0207689_102850702 155
331 3300025945 Ga0207679_10008899 Ga0207679_100088993 155
332 3300025949 Ga0207667_10088447 Ga0207667_100884473 155
333 3300025949 Ga0207667_10224669 Ga0207667_102246692 155
334 3300025949 Ga0207667_10479044 Ga0207667_104790443 155
335 3300025949 Ga0207667_10663985 Ga0207667_106639852 155
336 3300025981 Ga0207640_10315862 Ga0207640_103158622 155
337 3300026023 Ga0207677_10072405 Ga0207677_100724053 155
338 3300026023 Ga0207677_10196868 Ga0207677_101968683 155
339 3300026041 Ga0207639_10350464 Ga0207639_103504642 155
340 3300026078 Ga0207702_10541109 Ga0207702_105411093 155
341 3300026088 Ga0207641_10151496 Ga0207641_101514963 155
342 3300026116 Ga0207674_10250557 Ga0207674_102505573 155
343 3300026116 Ga0207674_10353949 Ga0207674_103539491 155
344 3300026121 Ga0207683_10070721 Ga0207683_100707212 155
345 3300026142 Ga0207698_10099871 Ga0207698_100998712 155
346 3300027666 Ga0209282_1000133 Ga0209282_100013343 155
347 3300027866 Ga0209813_10164718 Ga0209813_101647182 155
348 3300027876 Ga0209974_10014445 Ga0209974_100144455 155
349 3300027907 Ga0207428_10248181 Ga0207428_102481812 155
350 3300028379 Ga0268266_10014251 Ga0268266_100142516 155
351 3300028380 Ga0268265_10042673 Ga0268265_100426732 155
352 3300028794 Ga0307515_10001286 Ga0307515_100012867 155
353 3300028794 Ga0307515_10172925 Ga0307515_101729253 155
354 3300030733 Ga0314311_1134334 Ga0314311_11343342 155
355 3300030745 Ga0316182_1071470 Ga0316182_10714702 155
356 3300031456 Ga0307513_10000012 Ga0307513_10000012149 155
357 3300031456 Ga0307513_10000285 Ga0307513_1000028521 155
358 3300031456 Ga0307513_10131485 Ga0307513_101314852 155
359 3300031548 Ga0307408_100000079 Ga0307408_10000007983 155
360 3300031548 Ga0307408_100022449 Ga0307408_1000224495 155
361 3300031548 Ga0307408_100037053 Ga0307408_1000370533 155
362 3300031548 Ga0307408_100060612 Ga0307408_1000606123 155
363 3300031548 Ga0307408_100101444 Ga0307408_1001014443 155
364 3300031548 Ga0307408_100344212 Ga0307408_1003442123 155
365 3300031548 Ga0307408_100515197 Ga0307408_1005151972 155
366 3300031711 Ga0265314_10147622 Ga0265314_101476223 155
367 3300031730 Ga0307516_10004265 Ga0307516_1000426517 155
368 3300031731 Ga0307405_10328907 Ga0307405_103289072 155
369 3300031731 Ga0307405_10893644 Ga0307405_108936441 155
370 3300031901 Ga0307406_10000927 Ga0307406_1000092717 155
371 3300031901 Ga0307406_10009555 Ga0307406_100095555 155
372 3300031901 Ga0307406_10074343 Ga0307406_100743433 155
373 3300031901 Ga0307406_10534627 Ga0307406_105346271 155
374 3300031911 Ga0307412_10035354 Ga0307412_100353543 155
375 3300031911 Ga0307412_10045864 Ga0307412_100458642 155
376 3300031911 Ga0307412_10058510 Ga0307412_100585103 155
377 3300031911 Ga0307412_10096532 Ga0307412_100965322 155
378 3300031911 Ga0307412_10119539 Ga0307412_101195393 155
379 3300031911 Ga0307412_10143813 Ga0307412_101438132 155
380 3300031911 Ga0307412_10641112 Ga0307412_106411122 155
381 3300032002 Ga0307416_100089287 Ga0307416_1000892872 155
382 3300032002 Ga0307416_100200115 Ga0307416_1002001152 155
383 3300032002 Ga0307416_101286618 Ga0307416_1012866181 155
384 3300032002 Ga0307416_101651287 Ga0307416_1016512871 155
385 3300032004 Ga0307414_10411971 Ga0307414_104119713 155
386 3300032004 Ga0307414_11509865 Ga0307414_115098652 155
387 3300032005 Ga0307411_10414179 Ga0307411_104141791 155
388 3300037466 Ga0395898_0174190 Ga0395898_0174190_1049_1516 155
389 3300037471 Ga0395905_0037501 Ga0395905_0037501_1961_2428 155
390 3300038443 Ga0395901_0127946 Ga0395901_0127946_482_949 155
391 3300039447 Ga0436361_0268202 Ga0436361_0268202_17539_18036 155
392 3300041404 Ga0439436_0001379 Ga0439436_0001379_2216_2773 155
393 3300041404 Ga0439436_0006229 Ga0439436_0006229_1072_1635 155
394 3300041406 Ga0439439_0005369 Ga0439439_0005369_815_1372 155
395 3300041406 Ga0439439_0009655 Ga0439439_0009655_1282_1845 155
396 3300041410 Ga0439461_0050938 Ga0439461_0050938_335_811 155
397 3300041413 Ga0439465_0000697 Ga0439465_0000697_6995_7552 155
398 3300041452 Ga0451793_1463256 Ga0451793_1463256_11_487 155
399 3300041486 Ga0451807_0067919 Ga0451807_0067919_207_698 155
400 3300041498 Ga0451841_1340995 Ga0451841_1340995_137_613 155
401 3300041512 Ga0451853_3547166 Ga0451853_3547166_144_635 155
402 3300041997 Ga0439431_0000916 Ga0439431_0000916_3783_4340 155
403 3300041997 Ga0439431_0007247 Ga0439431_0007247_1335_1811 155
404 3300041999 Ga0439433_0000360 Ga0439433_0000360_1998_2555 155
405 3300042002 Ga0439442_009609 Ga0439442_009609_256_732 155
406 3300042002 Ga0439442_016402 Ga0439442_016402_1009_1485 155
407 3300042004 Ga0439445_0000835 Ga0439445_0000835_1628_2185 155
408 3300042006 Ga0439432_003052 Ga0439432_003052_2923_3480 155
409 3300042006 Ga0439432_012101 Ga0439432_012101_1282_1758 155
410 3300042007 Ga0439449_0002084 Ga0439449_0002084_6402_6959 155
411 3300042007 Ga0439449_0003898 Ga0439449_0003898_3790_4266 155
412 3300042007 Ga0439449_0017753 Ga0439449_0017753_1057_1620 155
413 3300042010 Ga0439452_006051 Ga0439452_006051_1284_1841 155
414 3300042010 Ga0439452_022075 Ga0439452_022075_943_1419 155
415 3300042014 Ga0439457_008504 Ga0439457_008504_825_1382 155
416 3300042015 Ga0439462_0004954 Ga0439462_0004954_362_871 155
417 3300042015 Ga0439462_0008200 Ga0439462_0008200_824_1381 155
418 3300042115 Ga0450911_014976 Ga0450911_014976_316_792 155
419 3300042122 Ga0450920_022302 Ga0450920_022302_455_931 155
420 3300042126 Ga0450888_020205 Ga0450888_020205_213_701 155
421 3300042134 Ga0450898_007204 Ga0450898_007204_637_1113 155
422 3300042145 Ga0450906_002698 Ga0450906_002698_256_732 155
423 3300042145 Ga0450906_011020 Ga0450906_011020_795_1271 155
424 3300042146 Ga0450907_034411 Ga0450907_034411_29_505 155
425 3300042147 Ga0450910_015188 Ga0450910_015188_128_691 155
426 3300042185 Ga0450909_006505 Ga0450909_006505_18_581 155
427 3300042435 Ga0439434_0000980 Ga0439434_0000980_74_550 155
428 3300042435 Ga0439434_0008390 Ga0439434_0008390_1441_1917 155
429 3300042435 Ga0439434_0010643 Ga0439434_0010643_1882_2358 155
430 3300042435 Ga0439434_0092514 Ga0439434_0092514_110_583 155
431 3300042532 Ga0450893_0008574 Ga0450893_0008574_1060_1548 155
432 3300046453 Ga0495627_008497 Ga0495627_008497_2816_3292 155
433 3300046453 Ga0495627_088232 Ga0495627_088232_47_523 155
434 3300046512 Ga0495610_0018746 Ga0495610_0018746_1538_2014 155
435 3300046513 Ga0495616_0007518 Ga0495616_0007518_1977_2453 155
436 3300046518 Ga0495631_0004184 Ga0495631_0004184_1948_2424 155
437 3300046520 Ga0495637_0006045 Ga0495637_0006045_5190_5666 155
438 3300046530 Ga0495654_0046196 Ga0495654_0046196_802_1278 155
439 3300046530 Ga0495654_0062093 Ga0495654_0062093_751_1227 155
440 3300046530 Ga0495654_0182136 Ga0495654_0182136_211_687 155
441 3300046538 Ga0495609_0050548 Ga0495609_0050548_509_985 155
442 3300046539 Ga0495621_0010000 Ga0495621_0010000_2333_2809 155
443 3300046539 Ga0495621_0011585 Ga0495621_0011585_867_1343 155
444 3300046542 Ga0495597_0004057 Ga0495597_0004057_1052_1549 155
445 3300046615 Ga0495656_0003255 Ga0495656_0003255_2494_2970 155
446 3300046616 Ga0495668_0063099 Ga0495668_0063099_1277_1753 155
447 3300046616 Ga0495668_0118188 Ga0495668_0118188_343_819 155
448 3300046660 Ga0495625_0000896 Ga0495625_0000896_34529_35005 155
449 3300046660 Ga0495625_0090482 Ga0495625_0090482_1145_1621 155
450 3300046660 Ga0495625_0344619 Ga0495625_0344619_214_690 155
451 3300046665 Ga0495661_0140755 Ga0495661_0140755_746_1222 155
452 3300046674 Ga0495588_0033592 Ga0495588_0033592_2039_2515 155
453 3300046674 Ga0495588_0252663 Ga0495588_0252663_20_496 155
454 3300046691 Ga0495670_0267388 Ga0495670_0267388_154_630 155
455 3300046692 Ga0495671_0009212 Ga0495671_0009212_3048_3524 155
456 3300048919 Ga0496116_0035499 Ga0496116_0035499_1350_1826 155
457 3300048921 Ga0496118_0010125 Ga0496118_0010125_993_1469 155
458 3300048921 Ga0496118_0030038 Ga0496118_0030038_1720_2196 155
459 3300048924 Ga0496121_0042948 Ga0496121_0042948_2969_3445 155
460 3300048924 Ga0496121_0197772 Ga0496121_0197772_185_661 155
461 3300048924 Ga0496121_0506526 Ga0496121_0506526_59_535 155
462 3300048925 Ga0496122_0003984 Ga0496122_0003984_15216_15692 155
463 3300048925 Ga0496122_0064753 Ga0496122_0064753_739_1215 155
464 3300048926 Ga0496123_0000235 Ga0496123_0000235_19614_20090 155
465 3300048926 Ga0496123_0061997 Ga0496123_0061997_1194_1670 155
466 3300048926 Ga0496123_0136762 Ga0496123_0136762_54_530 155
467 3300048927 Ga0496124_0451518 Ga0496124_0451518_64_540 155
468 3300048928 Ga0496125_0020173 Ga0496125_0020173_2456_2932 155
469 3300048928 Ga0496125_0091422 Ga0496125_0091422_1113_1589 155
470 3300048928 Ga0496125_0325321 Ga0496125_0325321_211_687 155
471 3300048929 Ga0496126_0805841 Ga0496126_0805841_208_684 155
472 3300049705 Ga0501225_0013794 Ga0501225_0013794_644_1120 155
473 3300049759 Ga0501262_000153 Ga0501262_000153_3215_3691 155
474 3300049763 Ga0501266_001605 Ga0501266_001605_531_1007 155
475 3300049766 Ga0501269_063195 Ga0501269_063195_27_503 155
476 3300050489 nmdc:mga03683_10250_c1 nmdc:mga03683_10250_c1_1442_1918 155
477 3300050489 nmdc:mga03683_209216_c1 nmdc:mga03683_209216_c1_74_565 155
478 3300050489 nmdc:mga03683_224231_c1 nmdc:mga03683_224231_c1_359_835 155
479 3300050489 nmdc:mga03683_36119_c1 nmdc:mga03683_36119_c1_828_1304 155
480 3300050489 nmdc:mga03683_406129_c1 nmdc:mga03683_406129_c1_63_548 155
481 3300050489 nmdc:mga03683_439257_c1 nmdc:mga03683_439257_c1_35_520 155
482 3300050490 nmdc:mga03n38_10203_c1 nmdc:mga03n38_10203_c1_651_1394 155
483 3300050490 nmdc:mga03n38_25159_c1 nmdc:mga03n38_25159_c1_1448_1924 155
484 3300050490 nmdc:mga03n38_25218_c1 nmdc:mga03n38_25218_c1_249_728 155
485 3300050490 nmdc:mga03n38_369277_c1 nmdc:mga03n38_369277_c1_171_662 155
486 3300050491 nmdc:mga00v17_21047_c2 nmdc:mga00v17_21047_c2_1626_2135 155
487 3300050491 nmdc:mga00v17_359062_c1 nmdc:mga00v17_359062_c1_80_556 155
488 3300050491 nmdc:mga00v17_53639_c1 nmdc:mga00v17_53639_c1_256_732 155
489 3300050492 nmdc:mga0yw44_28385_c1 nmdc:mga0yw44_28385_c1_667_1143 155
490 3300050492 nmdc:mga0yw44_58591_c1 nmdc:mga0yw44_58591_c1_152_643 155
491 3300050493 nmdc:mga0k408_127897_c1 nmdc:mga0k408_127897_c1_26_502 155
492 3300050493 nmdc:mga0k408_132105_c1 nmdc:mga0k408_132105_c1_187_663 155
493 3300050493 nmdc:mga0k408_197323_c1 nmdc:mga0k408_197323_c1_84_575 155
494 3300050493 nmdc:mga0k408_265279_c1 nmdc:mga0k408_265279_c1_198_674 155
495 3300050493 nmdc:mga0k408_36012_c1 nmdc:mga0k408_36012_c1_386_862 155
496 3300050493 nmdc:mga0k408_403132_c1 nmdc:mga0k408_403132_c1_310_792 155
497 3300050493 nmdc:mga0k408_41811_c1 nmdc:mga0k408_41811_c1_172_648 155
498 3300050493 nmdc:mga0k408_513833_c1 nmdc:mga0k408_513833_c1_50_526 155
499 3300050494 nmdc:mga06z11_277517_c1 nmdc:mga06z11_277517_c1_86_577 155
500 3300050494 nmdc:mga06z11_738697_c1 nmdc:mga06z11_738697_c1_29_502 155
501 3300050495 nmdc:mga04h51_139923_c1 nmdc:mga04h51_139923_c1_88_579 155
502 3300050496 nmdc:mga07m45_100184_c1 nmdc:mga07m45_100184_c1_1060_1536 155
503 3300050496 nmdc:mga07m45_174148_c1 nmdc:mga07m45_174148_c1_570_1046 155
504 3300050496 nmdc:mga07m45_1973_c1 nmdc:mga07m45_1973_c1_8635_9111 155
505 3300050496 nmdc:mga07m45_21686_c1 nmdc:mga07m45_21686_c1_40_516 155
506 3300050496 nmdc:mga07m45_224527_c1 nmdc:mga07m45_224527_c1_297_776 155
507 3300050496 nmdc:mga07m45_8907_c1 nmdc:mga07m45_8907_c1_1180_1656 155
508 3300053079 Ga0500610_0006176 Ga0500610_0006176_428_904 155
509 3300053079 Ga0500610_0013178 Ga0500610_0013178_881_1357 155
510 3300053087 Ga0500643_055693 Ga0500643_055693_214_690 155
511 3300053088 Ga0500644_0002098 Ga0500644_0002098_688_1164 155
512 3300053093 Ga0500651_0027085 Ga0500651_0027085_757_1269 155
513 3300053096 Ga0500641_0061010 Ga0500641_0061010_839_1315 155
514 3300053098 Ga0500650_0093654 Ga0500650_0093654_307_783 155
515 3300053111 Ga0500572_020849 Ga0500572_020849_570_1046 155
516 3300053116 Ga0500592_012805 Ga0500592_012805_206_682 155
517 3300053117 Ga0500593_003907 Ga0500593_003907_1243_1719 155
518 3300053117 Ga0500593_008376 Ga0500593_008376_2274_2750 155
519 3300053118 Ga0500594_0003689 Ga0500594_0003689_2755_3231 155
520 3300053121 Ga0500607_004990 Ga0500607_004990_2343_2819 155
521 3300053122 Ga0500608_004926 Ga0500608_004926_3471_3947 155
522 3300053122 Ga0500608_043313 Ga0500608_043313_224_700 155
523 3300053125 Ga0500618_020979 Ga0500618_020979_695_1171 155
524 3300053133 Ga0500655_000523 Ga0500655_000523_2071_2547 155
525 3300053134 Ga0500658_0001924 Ga0500658_0001924_4735_5211 155
526 3300053136 Ga0500559_0005307 Ga0500559_0005307_1727_2203 155
527 3300053139 Ga0500568_0006491 Ga0500568_0006491_1391_1867 155
528 3300053153 Ga0500616_0143992 Ga0500616_0143992_68_544 155
529 3300053153 Ga0500616_0164096 Ga0500616_0164096_213_689 155
530 3300053156 Ga0500622_0155426 Ga0500622_0155426_108_584 155
531 3300053158 Ga0500627_0006722 Ga0500627_0006722_2881_3357 155
532 3300053158 Ga0500627_0225857 Ga0500627_0225857_298_774 155
533 3300053161 Ga0500634_0006145 Ga0500634_0006145_2034_2510 155
534 3300053162 Ga0500638_003903 Ga0500638_003903_998_1474 155
535 3300053729 Ga0500625_070542 Ga0500625_070542_111_587 155
536 3300053730 Ga0500645_002856 Ga0500645_002856_5588_6070 155
537 3300053730 Ga0500645_015872 Ga0500645_015872_1663_2142 155
538 3300053730 Ga0500645_163810 Ga0500645_163810_34_510 155
539 3300005367 Ga0070667_100068522 Ga0070667_1000685222 156
540 3300005548 Ga0070665_101285026 Ga0070665_1012850261 156
541 3300009177 Ga0105248_11123506 Ga0105248_111235061 156
542 3300013104 Ga0157370_10367712 Ga0157370_103677122 156
543 3300013306 Ga0163162_10165510 Ga0163162_101655102 156
544 3300013306 Ga0163162_10707785 Ga0163162_107077852 156
545 3300013308 Ga0157375_11140407 Ga0157375_111404071 156
546 3300014968 Ga0157379_10423334 Ga0157379_104233342 156
547 3300015261 Ga0182006_1147247 Ga0182006_11472471 156
548 3300015265 Ga0182005_1140321 Ga0182005_11403212 156
549 3300017792 Ga0163161_10017700 Ga0163161_100177003 156
550 3300025940 Ga0207691_10826383 Ga0207691_108263832 156
551 3300025986 Ga0207658_10060529 Ga0207658_100605293 156
552 3300026121 Ga0207683_10221142 Ga0207683_102211422 156
553 3300028379 Ga0268266_11102064 Ga0268266_111020641 156
554 3300031251 Ga0265327_10002745 Ga0265327_100027455 156
555 3300031616 Ga0307508_10176342 Ga0307508_101763423 156
556 3300037471 Ga0395905_0083297 Ga0395905_0083297_423_908 156
557 3300038443 Ga0395901_0131188 Ga0395901_0131188_1207_1683 156
558 3300038443 Ga0395901_0373732 Ga0395901_0373732_962_1447 156
559 3300039437 Ga0436365_1868038 Ga0436365_1868038_51_536 156
560 3300041494 Ga0451837_1700856 Ga0451837_1700856_210_689 156
561 3300044693 Ga0466961_0036663 Ga0466961_0036663_2332_2817 156
562 3300044706 Ga0466964_0040101 Ga0466964_0040101_1055_1540 156
563 3300044719 Ga0466971_0077704 Ga0466971_0077704_861_1346 156
564 3300046462 Ga0495651_0145428 Ga0495651_0145428_806_1285 156
565 3300046475 Ga0495639_0022262 Ga0495639_0022262_437_916 156
566 3300046675 Ga0495657_0060967 Ga0495657_0060967_1617_2096 156
567 3300046678 Ga0495599_0187568 Ga0495599_0187568_782_1261 156
568 3300046809 Ga0495600_0188319 Ga0495600_0188319_697_1176 156
569 3300048089 Ga0495614_0310627 Ga0495614_0310627_234_713 156
570 3300048903 Ga0496100_0007340 Ga0496100_0007340_1186_1665 156
571 3300048904 Ga0496101_0018273 Ga0496101_0018273_1189_1668 156
572 3300048905 Ga0496102_0042793 Ga0496102_0042793_1209_1688 156
573 3300048907 Ga0496104_0020850 Ga0496104_0020850_1303_1782 156
574 3300048907 Ga0496104_0635886 Ga0496104_0635886_218_697 156
575 3300048909 Ga0496106_0020141 Ga0496106_0020141_1693_2172 156
576 3300048910 Ga0496107_0452486 Ga0496107_0452486_234_713 156
577 3300048912 Ga0496109_0130274 Ga0496109_0130274_145_624 156
578 3300048913 Ga0496110_0035381 Ga0496110_0035381_704_1255 156
579 3300048913 Ga0496110_0144587 Ga0496110_0144587_1200_1679 156
580 3300048914 Ga0496111_0029616 Ga0496111_0029616_692_1171 156
581 3300048914 Ga0496111_0087357 Ga0496111_0087357_892_1371 156
582 3300048916 Ga0496113_0073271 Ga0496113_0073271_1240_1719 156
583 3300048917 Ga0496114_0703367 Ga0496114_0703367_195_677 156
584 3300061719 Ga0466962_0010759 Ga0466962_0010759_1557_2042 156
585 3300003781 Ga0055536_1003726 Ga0055536_10037266 157
586 3300003792 Ga0055540_1004580 Ga0055540_10045804 157
587 3300003794 Ga0055531_10046577 Ga0055531_100465772 157
588 3300005455 Ga0070663_100007541 Ga0070663_1000075414 157
589 3300005459 Ga0068867_100000092 Ga0068867_10000009247 157
590 3300005616 Ga0068852_100168505 Ga0068852_1001685052 157
591 3300006048 Ga0075363_100187166 Ga0075363_1001871662 157
592 3300006195 Ga0075366_10011492 Ga0075366_100114923 157
593 3300006195 Ga0075366_10069431 Ga0075366_100694313 157
594 3300006846 Ga0075430_100021936 Ga0075430_1000219362 157
595 3300006880 Ga0075429_100010391 Ga0075429_1000103915 157
596 3300006880 Ga0075429_100760561 Ga0075429_1007605612 157
597 3300009148 Ga0105243_10009638 Ga0105243_100096388 157
598 3300009148 Ga0105243_10009706 Ga0105243_100097066 157
599 3300014745 Ga0157377_10000163 Ga0157377_100001638 157
600 3300025292 Ga0209676_1000260 Ga0209676_100026091 157
601 3300025303 Ga0209051_1000319 Ga0209051_100031951 157
602 3300025304 Ga0209257_1008583 Ga0209257_10085832 157
603 3300025935 Ga0207709_10002452 Ga0207709_100024524 157
604 3300025935 Ga0207709_10022627 Ga0207709_100226273 157
605 3300026067 Ga0207678_10002368 Ga0207678_1000236812 157
606 3300026089 Ga0207648_10001232 Ga0207648_100012328 157
607 3300026142 Ga0207698_10060310 Ga0207698_100603104 157
608 3300028794 Ga0307515_10001485 Ga0307515_1000148544 157
609 3300031730 Ga0307516_10000525 Ga0307516_1000052533 157
610 3300031731 Ga0307405_10265904 Ga0307405_102659042 157
611 3300031731 Ga0307405_10596852 Ga0307405_105968522 157
612 3300032002 Ga0307416_100044749 Ga0307416_1000447491 157
613 3300032005 Ga0307411_11633047 Ga0307411_116330471 157
614 3300034820 Ga0373959_0042364 Ga0373959_0042364_171_653 157
615 3300037471 Ga0395905_0022085 Ga0395905_0022085_3907_4398 157
616 3300046530 Ga0495654_0003435 Ga0495654_0003435_511_1032 157
617 3300049777 Ga0501281_15192 Ga0501281_15192_31_516 157
618 3300050493 nmdc:mga0k408_4603_c1 nmdc:mga0k408_4603_c1_2857_3339 157
619 3300050508 nmdc:mga09592_239398_c1 nmdc:mga09592_239398_c1_47_532 157
620 3300050508 nmdc:mga09592_5962_c1 nmdc:mga09592_5962_c1_5096_5581 157
621 3300050509 nmdc:mga0qj67_17296_c1 nmdc:mga0qj67_17296_c1_4633_5118 157
622 3300002704 JGI25155J39150_1000074 JGI25155J39150_10000746 158
623 3300002705 JGI25156J39149_1000002 JGI25156J39149_1000002260 158
624 3300002738 JGI25154J39366_1000010 JGI25154J39366_100001058 158
625 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001281 158
626 3300002987 JGI25159J45721_1017298 JGI25159J45721_10172981 158
627 3300003784 Ga0055534_1006824 Ga0055534_10068243 158
628 3300003792 Ga0055540_1073622 Ga0055540_10736221 158
629 3300005539 Ga0068853_101853500 Ga0068853_1018535001 158
630 3300006946 Ga0079104_1016127 Ga0079104_10161272 158
631 3300009036 Ga0105244_10326503 Ga0105244_103265032 158
632 3300009093 Ga0105240_10027063 Ga0105240_100270636 158
633 3300009176 Ga0105242_10003000 Ga0105242_100030003 158
634 3300009545 Ga0105237_10000945 Ga0105237_100009453 158
635 3300009545 Ga0105237_11003981 Ga0105237_110039811 158
636 3300009551 Ga0105238_10081095 Ga0105238_100810953 158
637 3300010375 Ga0105239_10005802 Ga0105239_100058029 158
638 3300011119 Ga0105246_11602204 Ga0105246_116022041 158
639 3300025206 Ga0209435_100001 Ga0209435_1000011038 158
640 3300025246 Ga0209646_1000001 Ga0209646_10000011407 158
641 3300025250 Ga0209026_1000001 Ga0209026_100000159 158
642 3300025256 Ga0209759_1000001 Ga0209759_10000011038 158
643 3300025284 Ga0209130_1000952 Ga0209130_100095211 158
644 3300025291 Ga0209675_1000290 Ga0209675_100029023 158
645 3300025292 Ga0209676_1006861 Ga0209676_10068612 158
646 3300025298 Ga0209050_1016241 Ga0209050_10162412 158
647 3300025303 Ga0209051_1019179 Ga0209051_10191793 158
648 3300025304 Ga0209257_1011066 Ga0209257_10110663 158
649 3300025913 Ga0207695_10004148 Ga0207695_100041487 158
650 3300025914 Ga0207671_10123849 Ga0207671_101238493 158
651 3300025924 Ga0207694_10061134 Ga0207694_100611342 158
652 3300048928 Ga0496125_0158785 Ga0496125_0158785_187_669 158
653 3300053121 Ga0500607_216595 Ga0500607_216595_236_721 158
654 iso_pu_bacteria 2643221654 2644304803 158
655 3300003320 rootH2_10194452 rootH2_101944523 159
656 3300005367 Ga0070667_100015538 Ga0070667_1000155385 159
657 3300025986 Ga0207658_10000754 Ga0207658_100007546 159
658 3300037068 Ga0373925_0824834 Ga0373925_0824834_201_689 159
659 3300037312 Ga0395899_0000344 Ga0395899_0000344_5037_5516 159
660 3300037418 Ga0395900_0109112 Ga0395900_0109112_679_1158 159
661 3300037471 Ga0395905_0038248 Ga0395905_0038248_3570_4049 159
662 3300044765 Ga0466970_0059958 Ga0466970_0059958_444_938 159
663 3300044901 Ga0466960_0054582 Ga0466960_0054582_507_1001 159
664 3300045049 Ga0466959_0027997 Ga0466959_0027997_3228_3707 159
665 3300050493 nmdc:mga0k408_289323_c1 nmdc:mga0k408_289323_c1_102_590 159
666 3300005328 Ga0070676_10691508 Ga0070676_106915082 160
667 3300005459 Ga0068867_100631262 Ga0068867_1006312621 160
668 3300005577 Ga0068857_100223425 Ga0068857_1002234252 160
669 3300025907 Ga0207645_10446080 Ga0207645_104460802 160
670 3300025937 Ga0207669_10617448 Ga0207669_106174482 160
671 3300028794 Ga0307515_10046408 Ga0307515_100464086 160
672 3300031507 Ga0307509_10032544 Ga0307509_100325443 160
673 3300031507 Ga0307509_10361881 Ga0307509_103618812 160
674 3300044712 Ga0453684_0029039 Ga0453684_0029039_3577_4068 160
675 3300053096 Ga0500641_0120501 Ga0500641_0120501_435_929 161
676 3300005334 Ga0068869_100042886 Ga0068869_1000428862 162
677 3300005344 Ga0070661_101649227 Ga0070661_1016492271 162
678 3300005354 Ga0070675_100048670 Ga0070675_1000486704 162
679 3300005355 Ga0070671_100213572 Ga0070671_1002135721 162
680 3300005364 Ga0070673_100041500 Ga0070673_1000415002 162
681 3300005459 Ga0068867_100018629 Ga0068867_1000186293 162
682 3300005543 Ga0070672_100187081 Ga0070672_1001870812 162
683 3300005563 Ga0068855_100815857 Ga0068855_1008158573 162
684 3300005844 Ga0068862_101290497 Ga0068862_1012904971 162
685 3300006195 Ga0075366_10156187 Ga0075366_101561872 162
686 3300006237 Ga0097621_101230416 Ga0097621_1012304162 162
687 3300009098 Ga0105245_10323309 Ga0105245_103233092 162
688 3300014745 Ga0157377_10234269 Ga0157377_102342692 162
689 3300025907 Ga0207645_10063693 Ga0207645_100636932 162
690 3300025920 Ga0207649_11270916 Ga0207649_112709161 162
691 3300025926 Ga0207659_10168409 Ga0207659_101684092 162
692 3300025927 Ga0207687_10087175 Ga0207687_100871752 162
693 3300025940 Ga0207691_10055060 Ga0207691_100550604 162
694 3300025942 Ga0207689_10025300 Ga0207689_100253003 162
695 3300025960 Ga0207651_10346029 Ga0207651_103460292 162
696 3300026089 Ga0207648_10027075 Ga0207648_100270752 162
697 3300030522 Ga0307512_10068145 Ga0307512_100681453 162
698 3300031456 Ga0307513_10061834 Ga0307513_100618342 162
699 3300031507 Ga0307509_10034762 Ga0307509_100347624 162
700 3300031616 Ga0307508_10000094 Ga0307508_100000942 162
701 3300031616 Ga0307508_10440890 Ga0307508_104408903 162
702 3300031649 Ga0307514_10078672 Ga0307514_100786721 162
703 3300032004 Ga0307414_10405799 Ga0307414_104057992 162
704 3300033180 Ga0307510_10054117 Ga0307510_100541174 162
705 3300033180 Ga0307510_10108768 Ga0307510_101087683 162
706 3300035691 Ga0373931_0315990 Ga0373931_0315990_427_924 162
707 3300050493 nmdc:mga0k408_52519_c1 nmdc:mga0k408_52519_c1_765_1262 162
708 3300053093 Ga0500651_0299293 Ga0500651_0299293_95_592 162
709 3300053136 Ga0500559_0000011 Ga0500559_0000011_5542_6039 162
710 3300053153 Ga0500616_0309782 Ga0500616_0309782_132_629 162
711 3300053156 Ga0500622_0055210 Ga0500622_0055210_63_560 162
712 iso_pu_bacteria 2858688981 2858693128 162
713 3300006353 Ga0075370_10501225 Ga0075370_105012251 163
714 3300025893 Ga0207682_10099945 Ga0207682_100999452 163
715 3300026121 Ga0207683_10071124 Ga0207683_100711244 163
716 3300049571 Ga0501034_0548052 Ga0501034_0548052_413_919 163
717 3300050496 nmdc:mga07m45_345113_c1 nmdc:mga07m45_345113_c1_240_743 163
718 3300005333 Ga0070677_10004622 Ga0070677_100046225 164
719 3300005353 Ga0070669_100049588 Ga0070669_1000495883 164
720 3300005354 Ga0070675_100000158 Ga0070675_10000015821 164
721 3300005355 Ga0070671_100004317 Ga0070671_1000043176 164
722 3300005356 Ga0070674_100011597 Ga0070674_1000115973 164
723 3300005364 Ga0070673_100046916 Ga0070673_1000469162 164
724 3300005367 Ga0070667_100174663 Ga0070667_1001746631 164
725 3300005456 Ga0070678_100031759 Ga0070678_1000317593 164
726 3300005459 Ga0068867_100002736 Ga0068867_1000027365 164
727 3300005543 Ga0070672_100047628 Ga0070672_1000476284 164
728 3300005548 Ga0070665_100161485 Ga0070665_1001614853 164
729 3300005834 Ga0068851_10092729 Ga0068851_100927292 164
730 3300013308 Ga0157375_10298060 Ga0157375_102980602 164
731 3300014969 Ga0157376_10335114 Ga0157376_103351143 164
732 3300025315 Ga0207697_10108593 Ga0207697_101085932 164
733 3300025321 Ga0207656_10032769 Ga0207656_100327693 164
734 3300025893 Ga0207682_10001652 Ga0207682_100016526 164
735 3300025901 Ga0207688_10038678 Ga0207688_100386783 164
736 3300025909 Ga0207705_10299096 Ga0207705_102990963 164
737 3300025923 Ga0207681_10014932 Ga0207681_100149325 164
738 3300025925 Ga0207650_10001711 Ga0207650_1000171111 164
739 3300025926 Ga0207659_10001143 Ga0207659_100011439 164
740 3300025931 Ga0207644_10003362 Ga0207644_100033627 164
741 3300025937 Ga0207669_10003638 Ga0207669_100036386 164
742 3300025940 Ga0207691_10056335 Ga0207691_100563354 164
743 3300025960 Ga0207651_10008073 Ga0207651_100080737 164
744 3300025986 Ga0207658_10178315 Ga0207658_101783153 164
745 3300026089 Ga0207648_10005724 Ga0207648_1000572411 164
746 3300026121 Ga0207683_10014615 Ga0207683_100146153 164
747 3300028379 Ga0268266_10487016 Ga0268266_104870162 164
748 3300053139 Ga0500568_0306157 Ga0500568_0306157_12_515 164
749 3300031507 Ga0307509_10061068 Ga0307509_100610682 165
750 3300033179 Ga0307507_10096639 Ga0307507_100966392 165
751 3300014326 Ga0157380_10747942 Ga0157380_107479423 166
752 3300031730 Ga0307516_10022750 Ga0307516_100227506 166
753 3300031730 Ga0307516_10458109 Ga0307516_104581092 166
754 3300048909 Ga0496106_0134694 Ga0496106_0134694_442_951 166
755 3300048924 Ga0496121_0190509 Ga0496121_0190509_941_1450 166
756 3300053086 Ga0500578_0039951 Ga0500578_0039951_1994_2503 166
757 3300053730 Ga0500645_017528 Ga0500645_017528_1361_1870 166
758 3300006195 Ga0075366_10287610 Ga0075366_102876102 167
759 3300001979 JGI24740J21852_10000319 JGI24740J21852_100003195 169
760 3300003751 Ga0055538_1011084 Ga0055538_10110841 169
761 3300003756 Ga0055533_1002174 Ga0055533_10021743 169
762 3300003762 Ga0055542_1001189 Ga0055542_10011897 169
763 3300003841 Ga0055541_1000208 Ga0055541_100020818 169
764 3300025224 Ga0209784_100539 Ga0209784_1005391 169
765 3300025225 Ga0209566_100970 Ga0209566_1009705 169
766 3300025226 Ga0209674_100229 Ga0209674_1002294 169
767 3300025230 Ga0209563_106635 Ga0209563_1066352 169
768 3300025246 Ga0209646_1000059 Ga0209646_100005986 169
769 3300025250 Ga0209026_1008832 Ga0209026_10088322 169
770 3300025253 Ga0209677_102838 Ga0209677_1028383 169
771 3300025254 Ga0209148_1000021 Ga0209148_1000021213 169
772 3300025256 Ga0209759_1002389 Ga0209759_10023895 169
773 3300037471 Ga0395905_0158898 Ga0395905_0158898_1120_1629 169
774 3300044666 Ga0466977_0153091 Ga0466977_0153091_829_1359 169
775 3300044671 Ga0466978_0022614 Ga0466978_0022614_2261_2791 169
776 3300044683 Ga0466965_0006416 Ga0466965_0006416_2448_2978 169
777 3300044693 Ga0466961_0004849 Ga0466961_0004849_4863_5393 169
778 3300044706 Ga0466964_0006122 Ga0466964_0006122_2571_3101 169
779 3300044735 Ga0466968_0005280 Ga0466968_0005280_3079_3609 169
780 3300044765 Ga0466970_0006124 Ga0466970_0006124_2963_3493 169
781 3300045049 Ga0466959_0008819 Ga0466959_0008819_4131_4661 169
782 3300045976 Ga0466967_0009266 Ga0466967_0009266_4112_4642 169
783 3300061719 Ga0466962_0006446 Ga0466962_0006446_4050_4580 169
784 iso_pu_bacteria 2596583598 2597028588 169
785 iso_pu_bacteria 2599185178 2599445274 169
786 iso_pu_bacteria 2900577576 2900580230 169
787 3300005331 Ga0070670_100587130 Ga0070670_1005871302 171
788 3300005459 Ga0068867_100003562 Ga0068867_1000035624 171
789 3300013297 Ga0157378_10298572 Ga0157378_102985723 171
790 3300025907 Ga0207645_10055100 Ga0207645_100551004 171
791 3300026089 Ga0207648_10038520 Ga0207648_100385204 171
792 3300026089 Ga0207648_10271507 Ga0207648_102715072 171
793 3300026142 Ga0207698_10326422 Ga0207698_103264223 171
794 3300001915 JGI24741J21665_1001445 JGI24741J21665_10014454 173
795 3300001979 JGI24740J21852_10007091 JGI24740J21852_100070915 173
796 3300003751 Ga0055538_1001079 Ga0055538_10010794 173
797 3300003752 Ga0055539_1000123 Ga0055539_100012334 173
798 3300003756 Ga0055533_1002613 Ga0055533_10026133 173
799 3300003756 Ga0055533_1003314 Ga0055533_10033143 173
800 3300003758 Ga0055532_1000002 Ga0055532_10000024 173
801 3300003758 Ga0055532_1000029 Ga0055532_100002951 173
802 3300003759 Ga0055525_1000345 Ga0055525_100034523 173
803 3300003763 Ga0055529_1000062 Ga0055529_100006220 173
804 3300003841 Ga0055541_1001170 Ga0055541_10011705 173
805 3300003841 Ga0055541_1018967 Ga0055541_10189671 173
806 3300003841 Ga0055541_1018975 Ga0055541_10189751 173
807 3300005344 Ga0070661_100001595 Ga0070661_10000159510 173
808 3300005455 Ga0070663_100000011 Ga0070663_100000011103 173
809 3300005564 Ga0070664_100000008 Ga0070664_10000000847 173
810 3300005577 Ga0068857_100002038 Ga0068857_1000020387 173
811 3300005578 Ga0068854_100000052 Ga0068854_100000052103 173
812 3300005614 Ga0068856_100000009 Ga0068856_10000000980 173
813 3300009093 Ga0105240_10010244 Ga0105240_100102446 173
814 3300013100 Ga0157373_10010823 Ga0157373_100108235 173
815 3300013102 Ga0157371_10000068 Ga0157371_1000006884 173
816 3300013104 Ga0157370_10010316 Ga0157370_100103165 173
817 3300013307 Ga0157372_10000271 Ga0157372_1000027155 173
818 3300015261 Ga0182006_1012267 Ga0182006_10122674 173
819 3300020077 Ga0206351_10253009 Ga0206351_102530094 173
820 3300020080 Ga0206350_10481412 Ga0206350_104814122 173
821 3300020610 Ga0154015_1103548 Ga0154015_11035485 173
822 3300025224 Ga0209784_100003 Ga0209784_100003874 173
823 3300025224 Ga0209784_100482 Ga0209784_1004827 173
824 3300025224 Ga0209784_101093 Ga0209784_1010933 173
825 3300025225 Ga0209566_100002 Ga0209566_1000021828 173
826 3300025225 Ga0209566_111096 Ga0209566_1110962 173
827 3300025225 Ga0209566_111097 Ga0209566_1110972 173
828 3300025226 Ga0209674_100008 Ga0209674_100008358 173
829 3300025226 Ga0209674_101558 Ga0209674_1015583 173
830 3300025228 Ga0209672_100052 Ga0209672_1000522 173
831 3300025229 Ga0209147_100002 Ga0209147_1000021537 173
832 3300025230 Ga0209563_100004 Ga0209563_1000041245 173
833 3300025230 Ga0209563_111006 Ga0209563_1110061 173
834 3300025230 Ga0209563_114368 Ga0209563_1143681 173
835 3300025242 Ga0209258_100002 Ga0209258_1000021537 173
836 3300025253 Ga0209677_100009 Ga0209677_100009388 173
837 3300025256 Ga0209759_1003853 Ga0209759_10038534 173
838 3300025256 Ga0209759_1005426 Ga0209759_10054263 173
839 3300025272 Ga0209455_1000021 Ga0209455_1000021124 173
840 3300025913 Ga0207695_10001909 Ga0207695_100019096 173
841 3300025920 Ga0207649_10001269 Ga0207649_100012695 173
842 3300025945 Ga0207679_10000001 Ga0207679_10000001130 173
843 3300025981 Ga0207640_10000035 Ga0207640_100000355 173
844 3300026067 Ga0207678_10000001 Ga0207678_10000001303 173
845 3300026078 Ga0207702_10008078 Ga0207702_100080785 173
846 3300026116 Ga0207674_10012396 Ga0207674_100123964 173
847 3300037312 Ga0395899_0079887 Ga0395899_0079887_1199_1720 173
848 3300037418 Ga0395900_0019446 Ga0395900_0019446_4855_5376 173
849 3300044650 Ga0466986_0061755 Ga0466986_0061755_1433_1954 173
850 3300045976 Ga0466967_0237002 Ga0466967_0237002_148_669 173
851 3300048928 Ga0496125_0026915 Ga0496125_0026915_2401_2922 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

7

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9668 2 124
1nvj-assembly3.cif.gz_E deletion mutant (delta 141) of molybdopterin synthase 0.9588 2 123
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.9549 2 124
1nvj-assembly2.cif.gz_C deletion mutant (delta 141) of molybdopterin synthase 0.9506 2 124
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9437 3 126
ID Description Score Start End Superfamily
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9506 2 124 3.90.1170.40
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9385 3 126 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9364 2 148 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9248 3 136 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9112 2 148 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A832E1U9-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9799 22 135 GO:0006777
AF-A0A7J4PD46-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9795 25 117 GO:0006777
AF-A0A2D5PE05-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9758 3 148 GO:0006777
GO:0030366
AF-A0A2S6SUQ3-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9702 2 139 GO:0006777
GO:0030366
AF-A0A1C6QU64-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9694 3 155 GO:0006777
GO:0030366

Feature Viewer

pLDDT pTM Quality
83.35 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map