F483453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 851 | 427 | 806 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100815857|Ga0068855_1008158573 |
| Length | 167 |
| Sequence | MADRVSIQAADFNLADEIDALRADDKRVGAVCSFVGTVRQGHEGNNGPPVLEMELEHYPGMTEKSIEAMIDEARRRFDIYAARVIHRIGVLQPGDQIVMVAVTSAHRGQSFQACEFLMDYLKTQAPFWKKEHTPEGARWVDARSSDDAAIARWGITAGNAPPVVPDP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 5 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 11 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 12 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 13 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 14 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 15 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 16 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 17 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 18 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 19 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 20 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 21 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 22 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 23 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 24 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 25 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 26 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 27 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 28 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 29 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 30 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 31 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 32 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 33 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 34 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 35 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 36 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 37 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 38 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 39 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 40 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 41 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 42 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 43 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 44 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 45 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 46 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 47 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 48 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 49 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 50 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 51 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 52 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 53 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 54 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 55 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 56 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 57 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 58 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 59 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 60 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 69 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 77 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 125 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 138 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 243 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 244 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 245 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 247 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 248 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 249 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 250 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 257 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 258 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 259 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 260 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 261 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 271 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 272 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 273 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 274 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 275 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 281 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 282 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 283 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 284 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 285 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 286 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 287 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 288 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 289 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 290 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 291 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 292 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 293 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 294 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 295 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 296 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 297 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 298 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 299 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 300 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 301 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 302 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 303 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 304 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 305 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 306 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 307 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 310 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 311 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 312 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 313 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 366 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 367 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 368 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 369 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 371 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 372 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 373 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 374 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 375 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 378 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 388 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 389 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 406 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 412 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 413 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 414 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 415 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 416 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 421 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 422 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 424 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 425 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 426 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 427 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.36 |
| Metatranscriptomes | 0.35 |
| Isolates | 5.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 30.79 |
| Nodule | 0.82 |
| Rhizoplane | 3.17 |
| Rhizosphere | 54.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001445 | 3300001915 | Bacteria | 6805 |
| 2 | JGI24740J21852_10000319 | 3300001979 | Bacteria | 20469 |
| 3 | JGI24740J21852_10007091 | 3300001979 | Bacteria | 4591 |
| 4 | JGI24739J22299_10005364 | 3300001989 | Bacteria | 4881 |
| 5 | JGI25155J39150_1000074 | 3300002704 | Bacteria | 62438 |
| 6 | JGI25156J39149_1000002 | 3300002705 | Bacteria | 343501 |
| 7 | JGI25154J39366_1000010 | 3300002738 | Bacteria | 297985 |
| 8 | JGI25158J39367_1003721 | 3300002739 | Bacteria | 2330 |
| 9 | JGI25157J39369_1000001 | 3300002741 | Bacteria | 363277 |
| 10 | JGI25150J39212_1001101 | 3300002774 | Bacteria | 8146 |
| 11 | JGI25150J39212_1001868 | 3300002774 | Bacteria | 5553 |
| 12 | JGI25150J39212_1009272 | 3300002774 | Bacteria | 1885 |
| 13 | JGI25159J45721_1000465 | 3300002987 | Bacteria | 18688 |
| 14 | JGI25159J45721_1002893 | 3300002987 | Bacteria | 6270 |
| 15 | JGI25159J45721_1017298 | 3300002987 | Bacteria | 1497 |
| 16 | JGI25151J46595_10015217 | 3300003187 | Bacteria | 3401 |
| 17 | rootH2_10194452 | 3300003320 | Bacteria | 2027 |
| 18 | JGI25160J50197_1000192 | 3300003354 | Bacteria | 51376 |
| 19 | JGI25160J50197_1018502 | 3300003354 | Bacteria | 2169 |
| 20 | JGI25160J50197_1059988 | 3300003354 | Bacteria | 764 |
| 21 | JGI25161J50226_1000043 | 3300003374 | Bacteria | 120741 |
| 22 | Ga0055538_1001079 | 3300003751 | Bacteria | 5990 |
| 23 | Ga0055538_1011084 | 3300003751 | Bacteria | 677 |
| 24 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 25 | Ga0055533_1002174 | 3300003756 | Bacteria | 4672 |
| 26 | Ga0055533_1002613 | 3300003756 | Bacteria | 4010 |
| 27 | Ga0055533_1003314 | 3300003756 | Bacteria | 3277 |
| 28 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 29 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 30 | Ga0055525_1000345 | 3300003759 | Bacteria | 33665 |
| 31 | Ga0055542_1001189 | 3300003762 | Bacteria | 14846 |
| 32 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 33 | Ga0055526_1000441 | 3300003771 | Bacteria | 33073 |
| 34 | Ga0055526_1003998 | 3300003771 | Bacteria | 9074 |
| 35 | Ga0055526_1004562 | 3300003771 | Bacteria | 8269 |
| 36 | Ga0055537_1000259 | 3300003773 | Bacteria | 38671 |
| 37 | Ga0055537_1001161 | 3300003773 | Bacteria | 11265 |
| 38 | Ga0055537_1004429 | 3300003773 | Bacteria | 4020 |
| 39 | Ga0055537_1009409 | 3300003773 | Bacteria | 2159 |
| 40 | Ga0055524_1000156 | 3300003775 | Bacteria | 79669 |
| 41 | Ga0055524_1009658 | 3300003775 | Bacteria | 3900 |
| 42 | Ga0055536_1000270 | 3300003781 | Bacteria | 39711 |
| 43 | Ga0055536_1003726 | 3300003781 | Bacteria | 8079 |
| 44 | Ga0055536_1009172 | 3300003781 | Bacteria | 4134 |
| 45 | Ga0055534_1001138 | 3300003784 | Bacteria | 11269 |
| 46 | Ga0055534_1003028 | 3300003784 | Bacteria | 5517 |
| 47 | Ga0055534_1006217 | 3300003784 | Bacteria | 3047 |
| 48 | Ga0055534_1006824 | 3300003784 | Bacteria | 2816 |
| 49 | Ga0055534_1029829 | 3300003784 | Bacteria | 846 |
| 50 | Ga0055528_1008541 | 3300003790 | Bacteria | 4370 |
| 51 | Ga0055528_1020328 | 3300003790 | Bacteria | 2159 |
| 52 | Ga0055530_10000408 | 3300003791 | Bacteria | 38218 |
| 53 | Ga0055530_10003951 | 3300003791 | Bacteria | 8020 |
| 54 | Ga0055530_10009348 | 3300003791 | Bacteria | 3781 |
| 55 | Ga0055530_10033474 | 3300003791 | Bacteria | 1325 |
| 56 | Ga0055540_1000033 | 3300003792 | Bacteria | 172048 |
| 57 | Ga0055540_1003778 | 3300003792 | Bacteria | 7139 |
| 58 | Ga0055540_1004106 | 3300003792 | Bacteria | 6743 |
| 59 | Ga0055540_1004580 | 3300003792 | Bacteria | 6150 |
| 60 | Ga0055540_1073622 | 3300003792 | Bacteria | 664 |
| 61 | Ga0055531_10000273 | 3300003794 | Bacteria | 53570 |
| 62 | Ga0055531_10004865 | 3300003794 | Bacteria | 8006 |
| 63 | Ga0055531_10009016 | 3300003794 | Bacteria | 5158 |
| 64 | Ga0055531_10046577 | 3300003794 | Bacteria | 1190 |
| 65 | Ga0055541_1000208 | 3300003841 | Bacteria | 24817 |
| 66 | Ga0055541_1001170 | 3300003841 | Bacteria | 5863 |
| 67 | Ga0055541_1018967 | 3300003841 | Bacteria | 839 |
| 68 | Ga0055541_1018975 | 3300003841 | Bacteria | 839 |
| 69 | Ga0055543_1000127 | 3300004625 | Bacteria | 63245 |
| 70 | Ga0055543_1003299 | 3300004625 | Bacteria | 4843 |
| 71 | Ga0065165_1028859 | 3300005262 | Bacteria | 1785 |
| 72 | Ga0065165_1067279 | 3300005262 | Bacteria | 961 |
| 73 | Ga0065704_10140698 | 3300005289 | Bacteria | 1521 |
| 74 | Ga0065704_10292894 | 3300005289 | Bacteria | 900 |
| 75 | Ga0070676_10691508 | 3300005328 | Bacteria | 744 |
| 76 | Ga0070670_100587130 | 3300005331 | Bacteria | 996 |
| 77 | Ga0070677_10004622 | 3300005333 | Bacteria | 4502 |
| 78 | Ga0068869_100042886 | 3300005334 | Bacteria | 3246 |
| 79 | Ga0068869_100144770 | 3300005334 | Bacteria | 1838 |
| 80 | Ga0070680_100154059 | 3300005336 | Bacteria | 1930 |
| 81 | Ga0070680_100327448 | 3300005336 | Bacteria | 1301 |
| 82 | Ga0068868_100092735 | 3300005338 | Bacteria | 2434 |
| 83 | Ga0068868_100301613 | 3300005338 | Bacteria | 1361 |
| 84 | Ga0070660_100063427 | 3300005339 | Bacteria | 2873 |
| 85 | Ga0070661_100001595 | 3300005344 | Bacteria | 15734 |
| 86 | Ga0070661_100551136 | 3300005344 | Bacteria | 928 |
| 87 | Ga0070661_101649227 | 3300005344 | Bacteria | 543 |
| 88 | Ga0070668_100436175 | 3300005347 | Bacteria | 1124 |
| 89 | Ga0070669_100049588 | 3300005353 | Bacteria | 3065 |
| 90 | Ga0070675_100000158 | 3300005354 | Bacteria | 41146 |
| 91 | Ga0070675_100048670 | 3300005354 | Bacteria | 3477 |
| 92 | Ga0070671_100004317 | 3300005355 | Bacteria | 11249 |
| 93 | Ga0070671_100213572 | 3300005355 | Bacteria | 1636 |
| 94 | Ga0070674_100011597 | 3300005356 | Bacteria | 5372 |
| 95 | Ga0070674_100157791 | 3300005356 | Bacteria | 1718 |
| 96 | Ga0070673_100041500 | 3300005364 | Bacteria | 3539 |
| 97 | Ga0070673_100046916 | 3300005364 | Bacteria | 3358 |
| 98 | Ga0070659_100018367 | 3300005366 | Bacteria | 5278 |
| 99 | Ga0070667_100015538 | 3300005367 | Bacteria | 6292 |
| 100 | Ga0070667_100068522 | 3300005367 | Bacteria | 3019 |
| 101 | Ga0070667_100174663 | 3300005367 | Bacteria | 1898 |
| 102 | Ga0070714_100375116 | 3300005435 | Bacteria | 1340 |
| 103 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 104 | Ga0070663_100007541 | 3300005455 | Bacteria | 6628 |
| 105 | Ga0070678_100031759 | 3300005456 | Bacteria | 3647 |
| 106 | Ga0070678_100064383 | 3300005456 | Bacteria | 2717 |
| 107 | Ga0070662_100131317 | 3300005457 | Bacteria | 1931 |
| 108 | Ga0068867_100000092 | 3300005459 | Bacteria | 57643 |
| 109 | Ga0068867_100002736 | 3300005459 | Bacteria | 12430 |
| 110 | Ga0068867_100003562 | 3300005459 | Bacteria | 10954 |
| 111 | Ga0068867_100018629 | 3300005459 | Bacteria | 4936 |
| 112 | Ga0068867_100631262 | 3300005459 | Bacteria | 938 |
| 113 | Ga0068853_100099468 | 3300005539 | Bacteria | 2569 |
| 114 | Ga0068853_100232269 | 3300005539 | Bacteria | 1688 |
| 115 | Ga0068853_101853500 | 3300005539 | Bacteria | 585 |
| 116 | Ga0070672_100047628 | 3300005543 | Bacteria | 3327 |
| 117 | Ga0070672_100116863 | 3300005543 | Bacteria | 2180 |
| 118 | Ga0070672_100187081 | 3300005543 | Bacteria | 1727 |
| 119 | Ga0070665_100161485 | 3300005548 | Bacteria | 2243 |
| 120 | Ga0070665_100796843 | 3300005548 | Bacteria | 958 |
| 121 | Ga0070665_101285026 | 3300005548 | Bacteria | 742 |
| 122 | Ga0070665_101285386 | 3300005548 | Bacteria | 742 |
| 123 | Ga0068855_100076757 | 3300005563 | Bacteria | 3876 |
| 124 | Ga0068855_100089079 | 3300005563 | Bacteria | 3563 |
| 125 | Ga0068855_100146314 | 3300005563 | Bacteria | 2689 |
| 126 | Ga0068855_100815857 | 3300005563 | Bacteria | 991 |
| 127 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 128 | Ga0070664_100013869 | 3300005564 | Bacteria | 6570 |
| 129 | Ga0068857_100002038 | 3300005577 | Bacteria | 16379 |
| 130 | Ga0068857_100223425 | 3300005577 | Bacteria | 1721 |
| 131 | Ga0068857_100318117 | 3300005577 | Bacteria | 1437 |
| 132 | Ga0068854_100000052 | 3300005578 | Bacteria | 85499 |
| 133 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 134 | Ga0068856_100439570 | 3300005614 | Bacteria | 1325 |
| 135 | Ga0068852_100148447 | 3300005616 | Bacteria | 2177 |
| 136 | Ga0068852_100168505 | 3300005616 | Bacteria | 2051 |
| 137 | Ga0068851_10092729 | 3300005834 | Bacteria | 1592 |
| 138 | Ga0068862_100068756 | 3300005844 | Bacteria | 3056 |
| 139 | Ga0068862_101290497 | 3300005844 | Bacteria | 731 |
| 140 | Ga0075365_10245891 | 3300006038 | Bacteria | 1256 |
| 141 | Ga0075363_100083557 | 3300006048 | Bacteria | 1749 |
| 142 | Ga0075363_100187166 | 3300006048 | Bacteria | 1180 |
| 143 | Ga0075364_10025580 | 3300006051 | Bacteria | 3758 |
| 144 | Ga0075364_10459791 | 3300006051 | Bacteria | 870 |
| 145 | Ga0075432_10007261 | 3300006058 | Bacteria | 3773 |
| 146 | Ga0075432_10007774 | 3300006058 | Bacteria | 3654 |
| 147 | Ga0075362_10003943 | 3300006177 | Bacteria | 5271 |
| 148 | Ga0075362_10014025 | 3300006177 | Bacteria | 3224 |
| 149 | Ga0075362_10026155 | 3300006177 | Bacteria | 2490 |
| 150 | Ga0075362_10060691 | 3300006177 | Bacteria | 1709 |
| 151 | Ga0075362_10324345 | 3300006177 | Bacteria | 767 |
| 152 | Ga0075362_10611600 | 3300006177 | Bacteria | 564 |
| 153 | Ga0075367_10183859 | 3300006178 | Bacteria | 1303 |
| 154 | Ga0075366_10011492 | 3300006195 | Bacteria | 5001 |
| 155 | Ga0075366_10051211 | 3300006195 | Bacteria | 2453 |
| 156 | Ga0075366_10069431 | 3300006195 | Bacteria | 2097 |
| 157 | Ga0075366_10089703 | 3300006195 | Bacteria | 1841 |
| 158 | Ga0075366_10156187 | 3300006195 | Bacteria | 1382 |
| 159 | Ga0075366_10287610 | 3300006195 | Bacteria | 1005 |
| 160 | Ga0075366_10336508 | 3300006195 | Bacteria | 925 |
| 161 | Ga0075366_10386789 | 3300006195 | Bacteria | 860 |
| 162 | Ga0075366_10590118 | 3300006195 | Bacteria | 689 |
| 163 | Ga0097621_101230416 | 3300006237 | Bacteria | 706 |
| 164 | Ga0097621_101454490 | 3300006237 | Bacteria | 650 |
| 165 | Ga0075370_10000322 | 3300006353 | Bacteria | 17253 |
| 166 | Ga0075370_10000738 | 3300006353 | Bacteria | 13029 |
| 167 | Ga0075370_10046321 | 3300006353 | Bacteria | 2461 |
| 168 | Ga0075370_10107198 | 3300006353 | Bacteria | 1620 |
| 169 | Ga0075370_10173015 | 3300006353 | Bacteria | 1270 |
| 170 | Ga0075370_10197097 | 3300006353 | Bacteria | 1187 |
| 171 | Ga0075370_10501225 | 3300006353 | Bacteria | 733 |
| 172 | Ga0068871_100173810 | 3300006358 | Bacteria | 1848 |
| 173 | Ga0075430_100021936 | 3300006846 | Bacteria | 5427 |
| 174 | Ga0075429_100010391 | 3300006880 | Bacteria | 8056 |
| 175 | Ga0075429_100760561 | 3300006880 | Bacteria | 849 |
| 176 | Ga0079104_1016127 | 3300006946 | Bacteria | 2193 |
| 177 | Ga0079104_1020241 | 3300006946 | Bacteria | 1838 |
| 178 | Ga0079104_1036670 | 3300006946 | Bacteria | 1175 |
| 179 | Ga0099826_10008499 | 3300006948 | Bacteria | 7640 |
| 180 | Ga0099826_10444032 | 3300006948 | Bacteria | 619 |
| 181 | Ga0105244_10003000 | 3300009036 | Bacteria | 12386 |
| 182 | Ga0105244_10326503 | 3300009036 | Bacteria | 708 |
| 183 | Ga0105240_10004043 | 3300009093 | Bacteria | 22563 |
| 184 | Ga0105240_10010244 | 3300009093 | Bacteria | 13194 |
| 185 | Ga0105240_10027063 | 3300009093 | Bacteria | 7516 |
| 186 | Ga0105245_10273025 | 3300009098 | Bacteria | 1650 |
| 187 | Ga0105245_10323309 | 3300009098 | Bacteria | 1520 |
| 188 | Ga0105243_10003757 | 3300009148 | Bacteria | 12169 |
| 189 | Ga0105243_10009638 | 3300009148 | Bacteria | 7353 |
| 190 | Ga0105243_10009706 | 3300009148 | Bacteria | 7329 |
| 191 | Ga0105243_10022421 | 3300009148 | Bacteria | 4799 |
| 192 | Ga0105242_10003000 | 3300009176 | Bacteria | 13209 |
| 193 | Ga0105242_10495201 | 3300009176 | Bacteria | 1161 |
| 194 | Ga0105242_10698787 | 3300009176 | Bacteria | 992 |
| 195 | Ga0105248_11123506 | 3300009177 | Bacteria | 888 |
| 196 | Ga0105237_10000945 | 3300009545 | Bacteria | 39046 |
| 197 | Ga0105237_10124271 | 3300009545 | Bacteria | 2575 |
| 198 | Ga0105237_11003981 | 3300009545 | Bacteria | 841 |
| 199 | Ga0105238_10081095 | 3300009551 | Bacteria | 3234 |
| 200 | Ga0105249_11186873 | 3300009553 | Bacteria | 834 |
| 201 | Ga0105239_10005802 | 3300010375 | Bacteria | 14404 |
| 202 | Ga0105239_10266673 | 3300010375 | Bacteria | 1925 |
| 203 | Ga0105239_11418942 | 3300010375 | Bacteria | 802 |
| 204 | Ga0105246_10035641 | 3300011119 | Bacteria | 3327 |
| 205 | Ga0105246_10913458 | 3300011119 | Bacteria | 788 |
| 206 | Ga0105246_11602204 | 3300011119 | Bacteria | 615 |
| 207 | Ga0157347_1002569 | 3300012502 | Bacteria | 1566 |
| 208 | Ga0157347_1003557 | 3300012502 | Bacteria | 1402 |
| 209 | Ga0157326_1000968 | 3300012513 | Bacteria | 3259 |
| 210 | Ga0157373_10010823 | 3300013100 | Bacteria | 6714 |
| 211 | Ga0157373_10023683 | 3300013100 | Bacteria | 4450 |
| 212 | Ga0157373_10345524 | 3300013100 | Bacteria | 1061 |
| 213 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 214 | Ga0157371_10310855 | 3300013102 | Bacteria | 1142 |
| 215 | Ga0157370_10010316 | 3300013104 | Bacteria | 9854 |
| 216 | Ga0157370_10072460 | 3300013104 | Bacteria | 3250 |
| 217 | Ga0157370_10367712 | 3300013104 | Bacteria | 1325 |
| 218 | Ga0157370_11167749 | 3300013104 | Bacteria | 695 |
| 219 | Ga0157369_10012328 | 3300013105 | Bacteria | 9710 |
| 220 | Ga0157374_11738372 | 3300013296 | Bacteria | 649 |
| 221 | Ga0157378_10076690 | 3300013297 | Bacteria | 3012 |
| 222 | Ga0157378_10298572 | 3300013297 | Bacteria | 1558 |
| 223 | Ga0163162_10165510 | 3300013306 | Bacteria | 2335 |
| 224 | Ga0163162_10707785 | 3300013306 | Bacteria | 1129 |
| 225 | Ga0157372_10000271 | 3300013307 | Bacteria | 57411 |
| 226 | Ga0157375_10298060 | 3300013308 | Bacteria | 1776 |
| 227 | Ga0157375_10598249 | 3300013308 | Bacteria | 1262 |
| 228 | Ga0157375_11140407 | 3300013308 | Bacteria | 913 |
| 229 | Ga0157380_10002034 | 3300014326 | Bacteria | 13517 |
| 230 | Ga0157380_10747942 | 3300014326 | Bacteria | 989 |
| 231 | Ga0182008_10001340 | 3300014497 | Bacteria | 16780 |
| 232 | Ga0182008_10002648 | 3300014497 | Bacteria | 11114 |
| 233 | Ga0182008_10016053 | 3300014497 | Bacteria | 3897 |
| 234 | Ga0182008_10044379 | 3300014497 | Bacteria | 2211 |
| 235 | Ga0182008_10053246 | 3300014497 | Bacteria | 2004 |
| 236 | Ga0157377_10000163 | 3300014745 | Bacteria | 39681 |
| 237 | Ga0157377_10234269 | 3300014745 | Bacteria | 1182 |
| 238 | Ga0157379_10423334 | 3300014968 | Bacteria | 1226 |
| 239 | Ga0157376_10148287 | 3300014969 | Bacteria | 2113 |
| 240 | Ga0157376_10335114 | 3300014969 | Bacteria | 1443 |
| 241 | Ga0157376_11077177 | 3300014969 | Bacteria | 829 |
| 242 | Ga0182006_1001145 | 3300015261 | Bacteria | 16830 |
| 243 | Ga0182006_1012267 | 3300015261 | Bacteria | 3749 |
| 244 | Ga0182006_1029708 | 3300015261 | Bacteria | 2212 |
| 245 | Ga0182006_1147247 | 3300015261 | Bacteria | 800 |
| 246 | Ga0182007_10008474 | 3300015262 | Bacteria | 4222 |
| 247 | Ga0182005_1012041 | 3300015265 | Bacteria | 2450 |
| 248 | Ga0182005_1140321 | 3300015265 | Bacteria | 698 |
| 249 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 250 | Ga0163161_10000166 | 3300017792 | Bacteria | 60327 |
| 251 | Ga0163161_10017700 | 3300017792 | Bacteria | 4993 |
| 252 | Ga0163161_10017854 | 3300017792 | Bacteria | 4971 |
| 253 | Ga0206351_10253009 | 3300020077 | Bacteria | 7729 |
| 254 | Ga0206350_10481412 | 3300020080 | Bacteria | 961 |
| 255 | Ga0154015_1103548 | 3300020610 | Bacteria | 9590 |
| 256 | Ga0213872_10034267 | 3300021361 | Bacteria | 2324 |
| 257 | Ga0213876_10579543 | 3300021384 | Bacteria | 597 |
| 258 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 259 | Ga0209436_103077 | 3300025208 | Bacteria | 4593 |
| 260 | Ga0209436_104293 | 3300025208 | Bacteria | 3548 |
| 261 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 262 | Ga0209784_100482 | 3300025224 | Bacteria | 16070 |
| 263 | Ga0209784_100539 | 3300025224 | Bacteria | 13930 |
| 264 | Ga0209784_101093 | 3300025224 | Bacteria | 4521 |
| 265 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 266 | Ga0209566_100970 | 3300025225 | Bacteria | 12691 |
| 267 | Ga0209566_111096 | 3300025225 | Bacteria | 891 |
| 268 | Ga0209566_111097 | 3300025225 | Bacteria | 891 |
| 269 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 270 | Ga0209674_100229 | 3300025226 | Bacteria | 50211 |
| 271 | Ga0209674_101558 | 3300025226 | Bacteria | 5833 |
| 272 | Ga0209672_100052 | 3300025228 | Bacteria | 231179 |
| 273 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 274 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 275 | Ga0209563_106635 | 3300025230 | Bacteria | 1971 |
| 276 | Ga0209563_111006 | 3300025230 | Bacteria | 1294 |
| 277 | Ga0209563_114368 | 3300025230 | Bacteria | 1018 |
| 278 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 279 | Ga0207425_1000603 | 3300025245 | Bacteria | 20837 |
| 280 | Ga0207425_1001556 | 3300025245 | Bacteria | 9346 |
| 281 | Ga0207425_1002814 | 3300025245 | Bacteria | 5868 |
| 282 | Ga0207425_1010123 | 3300025245 | Bacteria | 2309 |
| 283 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 284 | Ga0209646_1000059 | 3300025246 | Bacteria | 256909 |
| 285 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 286 | Ga0209026_1008832 | 3300025250 | Bacteria | 2052 |
| 287 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 288 | Ga0209677_102838 | 3300025253 | Bacteria | 6123 |
| 289 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 290 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 291 | Ga0209759_1002389 | 3300025256 | Bacteria | 8282 |
| 292 | Ga0209759_1003853 | 3300025256 | Bacteria | 5811 |
| 293 | Ga0209759_1005426 | 3300025256 | Bacteria | 4469 |
| 294 | Ga0209129_1000071 | 3300025258 | Bacteria | 210729 |
| 295 | Ga0209565_1000120 | 3300025263 | Bacteria | 111458 |
| 296 | Ga0209565_1000326 | 3300025263 | Bacteria | 42448 |
| 297 | Ga0209565_1000774 | 3300025263 | Bacteria | 18648 |
| 298 | Ga0209565_1001593 | 3300025263 | Bacteria | 9641 |
| 299 | Ga0209565_1056566 | 3300025263 | Bacteria | 690 |
| 300 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 301 | Ga0209673_1000099 | 3300025273 | Bacteria | 193248 |
| 302 | Ga0209673_1000839 | 3300025273 | Bacteria | 40180 |
| 303 | Ga0209673_1001338 | 3300025273 | Bacteria | 24643 |
| 304 | Ga0209130_1000041 | 3300025284 | Bacteria | 261078 |
| 305 | Ga0209130_1000456 | 3300025284 | Bacteria | 43000 |
| 306 | Ga0209130_1000952 | 3300025284 | Bacteria | 22937 |
| 307 | Ga0209130_1001771 | 3300025284 | Bacteria | 12746 |
| 308 | Ga0209130_1003498 | 3300025284 | Bacteria | 6602 |
| 309 | Ga0209675_1000054 | 3300025291 | Bacteria | 193248 |
| 310 | Ga0209675_1000290 | 3300025291 | Bacteria | 47338 |
| 311 | Ga0209675_1001678 | 3300025291 | Bacteria | 12312 |
| 312 | Ga0209675_1008675 | 3300025291 | Bacteria | 3695 |
| 313 | Ga0209675_1014145 | 3300025291 | Bacteria | 2446 |
| 314 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 315 | Ga0209676_1000054 | 3300025292 | Bacteria | 365890 |
| 316 | Ga0209676_1000260 | 3300025292 | Bacteria | 111683 |
| 317 | Ga0209676_1002320 | 3300025292 | Bacteria | 13793 |
| 318 | Ga0209676_1006861 | 3300025292 | Bacteria | 5513 |
| 319 | Ga0209676_1012219 | 3300025292 | Bacteria | 3396 |
| 320 | Ga0209676_1026508 | 3300025292 | Bacteria | 1839 |
| 321 | Ga0209025_1001409 | 3300025294 | Bacteria | 31873 |
| 322 | Ga0209025_1010783 | 3300025294 | Bacteria | 6140 |
| 323 | Ga0209025_1013211 | 3300025294 | Bacteria | 5211 |
| 324 | Ga0209025_1014966 | 3300025294 | Bacteria | 4722 |
| 325 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 326 | Ga0209564_1000239 | 3300025295 | Bacteria | 119761 |
| 327 | Ga0209564_1000662 | 3300025295 | Bacteria | 50934 |
| 328 | Ga0209564_1000784 | 3300025295 | Bacteria | 44001 |
| 329 | Ga0209564_1000890 | 3300025295 | Bacteria | 39405 |
| 330 | Ga0209758_1000027 | 3300025297 | Bacteria | 549650 |
| 331 | Ga0209758_1010200 | 3300025297 | Bacteria | 5668 |
| 332 | Ga0209758_1050345 | 3300025297 | Bacteria | 1461 |
| 333 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 334 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 335 | Ga0209050_1000954 | 3300025298 | Bacteria | 37580 |
| 336 | Ga0209050_1004569 | 3300025298 | Bacteria | 9285 |
| 337 | Ga0209050_1016241 | 3300025298 | Bacteria | 3060 |
| 338 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 339 | Ga0209256_1000081 | 3300025299 | Bacteria | 222908 |
| 340 | Ga0209256_1024131 | 3300025299 | Bacteria | 1796 |
| 341 | Ga0209256_1059446 | 3300025299 | Bacteria | 895 |
| 342 | Ga0207426_1000027 | 3300025302 | Bacteria | 513176 |
| 343 | Ga0207426_1000061 | 3300025302 | Bacteria | 362507 |
| 344 | Ga0207426_1003593 | 3300025302 | Bacteria | 8238 |
| 345 | Ga0207426_1004649 | 3300025302 | Bacteria | 6602 |
| 346 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 347 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 348 | Ga0209051_1000319 | 3300025303 | Bacteria | 72894 |
| 349 | Ga0209051_1000619 | 3300025303 | Bacteria | 40839 |
| 350 | Ga0209051_1005714 | 3300025303 | Bacteria | 7182 |
| 351 | Ga0209051_1019179 | 3300025303 | Bacteria | 2996 |
| 352 | Ga0209051_1019880 | 3300025303 | Bacteria | 2916 |
| 353 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 354 | Ga0209257_1000873 | 3300025304 | Bacteria | 42738 |
| 355 | Ga0209257_1007556 | 3300025304 | Bacteria | 6522 |
| 356 | Ga0209257_1007934 | 3300025304 | Bacteria | 6227 |
| 357 | Ga0209257_1008583 | 3300025304 | Bacteria | 5754 |
| 358 | Ga0209257_1011066 | 3300025304 | Bacteria | 4422 |
| 359 | Ga0207697_10108593 | 3300025315 | Bacteria | 1187 |
| 360 | Ga0207656_10032769 | 3300025321 | Bacteria | 2160 |
| 361 | Ga0207655_1001368 | 3300025728 | Bacteria | 22829 |
| 362 | Ga0207682_10001652 | 3300025893 | Bacteria | 10224 |
| 363 | Ga0207682_10099945 | 3300025893 | Bacteria | 1267 |
| 364 | Ga0207688_10038678 | 3300025901 | Bacteria | 2648 |
| 365 | Ga0207680_10417892 | 3300025903 | Bacteria | 949 |
| 366 | Ga0207647_10254573 | 3300025904 | Bacteria | 1006 |
| 367 | Ga0207645_10055100 | 3300025907 | Bacteria | 2539 |
| 368 | Ga0207645_10063693 | 3300025907 | Bacteria | 2356 |
| 369 | Ga0207645_10446080 | 3300025907 | Bacteria | 873 |
| 370 | Ga0207705_10299096 | 3300025909 | Bacteria | 1234 |
| 371 | Ga0207695_10001909 | 3300025913 | Bacteria | 32457 |
| 372 | Ga0207695_10004148 | 3300025913 | Bacteria | 19891 |
| 373 | Ga0207695_10125685 | 3300025913 | Bacteria | 2527 |
| 374 | Ga0207695_10630993 | 3300025913 | Bacteria | 953 |
| 375 | Ga0207671_10123849 | 3300025914 | Bacteria | 1978 |
| 376 | Ga0207660_10038245 | 3300025917 | Bacteria | 3349 |
| 377 | Ga0207660_10311643 | 3300025917 | Bacteria | 1255 |
| 378 | Ga0207649_10001269 | 3300025920 | Bacteria | 15079 |
| 379 | Ga0207649_11270916 | 3300025920 | Bacteria | 582 |
| 380 | Ga0207681_10014932 | 3300025923 | Bacteria | 4837 |
| 381 | Ga0207694_10061134 | 3300025924 | Bacteria | 2932 |
| 382 | Ga0207694_10197807 | 3300025924 | Bacteria | 1634 |
| 383 | Ga0207650_10001711 | 3300025925 | Bacteria | 15569 |
| 384 | Ga0207659_10001143 | 3300025926 | Bacteria | 15778 |
| 385 | Ga0207659_10168409 | 3300025926 | Bacteria | 1726 |
| 386 | Ga0207687_10043205 | 3300025927 | Bacteria | 3104 |
| 387 | Ga0207687_10087175 | 3300025927 | Bacteria | 2268 |
| 388 | Ga0207664_11081393 | 3300025929 | Bacteria | 717 |
| 389 | Ga0207644_10003362 | 3300025931 | Bacteria | 10322 |
| 390 | Ga0207690_10014545 | 3300025932 | Bacteria | 4753 |
| 391 | Ga0207706_10017147 | 3300025933 | Bacteria | 6531 |
| 392 | Ga0207706_10918481 | 3300025933 | Bacteria | 739 |
| 393 | Ga0207709_10000230 | 3300025935 | Bacteria | 70768 |
| 394 | Ga0207709_10002452 | 3300025935 | Bacteria | 11648 |
| 395 | Ga0207709_10022627 | 3300025935 | Bacteria | 3566 |
| 396 | Ga0207669_10003638 | 3300025937 | Bacteria | 6692 |
| 397 | Ga0207669_10617448 | 3300025937 | Bacteria | 883 |
| 398 | Ga0207704_10162483 | 3300025938 | Bacteria | 1591 |
| 399 | Ga0207704_11228983 | 3300025938 | Bacteria | 639 |
| 400 | Ga0207691_10055060 | 3300025940 | Bacteria | 3627 |
| 401 | Ga0207691_10056335 | 3300025940 | Bacteria | 3580 |
| 402 | Ga0207691_10151133 | 3300025940 | Bacteria | 2041 |
| 403 | Ga0207691_10826383 | 3300025940 | Bacteria | 778 |
| 404 | Ga0207711_10463975 | 3300025941 | Bacteria | 1179 |
| 405 | Ga0207689_10025300 | 3300025942 | Bacteria | 4974 |
| 406 | Ga0207689_10285070 | 3300025942 | Bacteria | 1368 |
| 407 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 408 | Ga0207679_10008899 | 3300025945 | Bacteria | 6407 |
| 409 | Ga0207667_10088447 | 3300025949 | Bacteria | 3204 |
| 410 | Ga0207667_10224669 | 3300025949 | Bacteria | 1924 |
| 411 | Ga0207667_10479044 | 3300025949 | Bacteria | 1263 |
| 412 | Ga0207667_10663985 | 3300025949 | Bacteria | 1047 |
| 413 | Ga0207651_10008073 | 3300025960 | Bacteria | 5653 |
| 414 | Ga0207651_10346029 | 3300025960 | Bacteria | 1250 |
| 415 | Ga0207640_10000035 | 3300025981 | Bacteria | 111369 |
| 416 | Ga0207640_10315862 | 3300025981 | Bacteria | 1242 |
| 417 | Ga0207658_10000754 | 3300025986 | Bacteria | 27858 |
| 418 | Ga0207658_10060529 | 3300025986 | Bacteria | 2826 |
| 419 | Ga0207658_10178315 | 3300025986 | Bacteria | 1756 |
| 420 | Ga0207677_10072405 | 3300026023 | Bacteria | 2436 |
| 421 | Ga0207677_10196868 | 3300026023 | Bacteria | 1598 |
| 422 | Ga0207639_10350464 | 3300026041 | Bacteria | 1318 |
| 423 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 424 | Ga0207678_10002368 | 3300026067 | Bacteria | 17095 |
| 425 | Ga0207702_10008078 | 3300026078 | Bacteria | 8901 |
| 426 | Ga0207702_10541109 | 3300026078 | Bacteria | 1138 |
| 427 | Ga0207641_10151496 | 3300026088 | Bacteria | 2101 |
| 428 | Ga0207648_10001232 | 3300026089 | Bacteria | 28719 |
| 429 | Ga0207648_10005724 | 3300026089 | Bacteria | 12451 |
| 430 | Ga0207648_10027075 | 3300026089 | Bacteria | 5092 |
| 431 | Ga0207648_10038520 | 3300026089 | Bacteria | 4206 |
| 432 | Ga0207648_10271507 | 3300026089 | Bacteria | 1515 |
| 433 | Ga0207674_10012396 | 3300026116 | Bacteria | 9531 |
| 434 | Ga0207674_10250557 | 3300026116 | Bacteria | 1718 |
| 435 | Ga0207674_10353949 | 3300026116 | Bacteria | 1419 |
| 436 | Ga0207683_10014615 | 3300026121 | Bacteria | 6686 |
| 437 | Ga0207683_10070721 | 3300026121 | Bacteria | 3083 |
| 438 | Ga0207683_10071124 | 3300026121 | Bacteria | 3075 |
| 439 | Ga0207683_10221142 | 3300026121 | Bacteria | 1725 |
| 440 | Ga0207698_10060310 | 3300026142 | Bacteria | 2950 |
| 441 | Ga0207698_10099871 | 3300026142 | Bacteria | 2402 |
| 442 | Ga0207698_10326422 | 3300026142 | Bacteria | 1440 |
| 443 | Ga0209282_1000133 | 3300027666 | Bacteria | 44707 |
| 444 | Ga0209813_10164718 | 3300027866 | Bacteria | 802 |
| 445 | Ga0209974_10014445 | 3300027876 | Bacteria | 2628 |
| 446 | Ga0207428_10248181 | 3300027907 | Bacteria | 1328 |
| 447 | Ga0268266_10014251 | 3300028379 | Bacteria | 6837 |
| 448 | Ga0268266_10487016 | 3300028379 | Bacteria | 1176 |
| 449 | Ga0268266_11102064 | 3300028379 | Bacteria | 768 |
| 450 | Ga0268265_10042673 | 3300028380 | Bacteria | 3367 |
| 451 | Ga0307515_10001286 | 3300028794 | Bacteria | 56985 |
| 452 | Ga0307515_10001485 | 3300028794 | Bacteria | 52672 |
| 453 | Ga0307515_10026348 | 3300028794 | Bacteria | 10014 |
| 454 | Ga0307515_10046408 | 3300028794 | Bacteria | 6641 |
| 455 | Ga0307515_10172925 | 3300028794 | Bacteria | 2144 |
| 456 | Ga0307512_10068145 | 3300030522 | Bacteria | 2672 |
| 457 | Ga0314311_1134334 | 3300030733 | Bacteria | 4782 |
| 458 | Ga0316182_1071470 | 3300030745 | Bacteria | 1692 |
| 459 | Ga0265327_10002745 | 3300031251 | Bacteria | 17906 |
| 460 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 461 | Ga0307513_10000285 | 3300031456 | Bacteria | 73356 |
| 462 | Ga0307513_10061834 | 3300031456 | Bacteria | 3961 |
| 463 | Ga0307513_10131485 | 3300031456 | Bacteria | 2448 |
| 464 | Ga0307509_10032544 | 3300031507 | Bacteria | 5745 |
| 465 | Ga0307509_10034762 | 3300031507 | Bacteria | 5536 |
| 466 | Ga0307509_10061068 | 3300031507 | Bacteria | 3981 |
| 467 | Ga0307509_10361881 | 3300031507 | Bacteria | 1170 |
| 468 | Ga0307408_100000079 | 3300031548 | Bacteria | 108053 |
| 469 | Ga0307408_100022449 | 3300031548 | Bacteria | 4288 |
| 470 | Ga0307408_100037053 | 3300031548 | Bacteria | 3432 |
| 471 | Ga0307408_100060612 | 3300031548 | Bacteria | 2758 |
| 472 | Ga0307408_100101444 | 3300031548 | Bacteria | 2193 |
| 473 | Ga0307408_100344212 | 3300031548 | Bacteria | 1263 |
| 474 | Ga0307408_100515197 | 3300031548 | Bacteria | 1049 |
| 475 | Ga0307508_10000094 | 3300031616 | Bacteria | 104107 |
| 476 | Ga0307508_10176342 | 3300031616 | Bacteria | 1741 |
| 477 | Ga0307508_10440890 | 3300031616 | Bacteria | 894 |
| 478 | Ga0307514_10078672 | 3300031649 | Bacteria | 2448 |
| 479 | Ga0265314_10147622 | 3300031711 | Bacteria | 1446 |
| 480 | Ga0307516_10000525 | 3300031730 | Bacteria | 51244 |
| 481 | Ga0307516_10004265 | 3300031730 | Bacteria | 17778 |
| 482 | Ga0307516_10022750 | 3300031730 | Bacteria | 6434 |
| 483 | Ga0307516_10458109 | 3300031730 | Bacteria | 931 |
| 484 | Ga0307405_10265904 | 3300031731 | Bacteria | 1283 |
| 485 | Ga0307405_10328907 | 3300031731 | Bacteria | 1170 |
| 486 | Ga0307405_10596852 | 3300031731 | Bacteria | 900 |
| 487 | Ga0307405_10893644 | 3300031731 | Bacteria | 751 |
| 488 | Ga0307406_10000927 | 3300031901 | Bacteria | 16394 |
| 489 | Ga0307406_10009555 | 3300031901 | Bacteria | 5445 |
| 490 | Ga0307406_10074343 | 3300031901 | Bacteria | 2237 |
| 491 | Ga0307406_10534627 | 3300031901 | Bacteria | 956 |
| 492 | Ga0307412_10035354 | 3300031911 | Bacteria | 3191 |
| 493 | Ga0307412_10045864 | 3300031911 | Bacteria | 2860 |
| 494 | Ga0307412_10058510 | 3300031911 | Bacteria | 2578 |
| 495 | Ga0307412_10096532 | 3300031911 | Bacteria | 2080 |
| 496 | Ga0307412_10119539 | 3300031911 | Bacteria | 1895 |
| 497 | Ga0307412_10143813 | 3300031911 | Bacteria | 1750 |
| 498 | Ga0307412_10641112 | 3300031911 | Bacteria | 905 |
| 499 | Ga0307416_100044749 | 3300032002 | Bacteria | 3479 |
| 500 | Ga0307416_100089287 | 3300032002 | Bacteria | 2638 |
| 501 | Ga0307416_100200115 | 3300032002 | Bacteria | 1894 |
| 502 | Ga0307416_101286618 | 3300032002 | Bacteria | 837 |
| 503 | Ga0307416_101651287 | 3300032002 | Bacteria | 746 |
| 504 | Ga0307414_10405799 | 3300032004 | Bacteria | 1185 |
| 505 | Ga0307414_10411971 | 3300032004 | Bacteria | 1177 |
| 506 | Ga0307414_11509865 | 3300032004 | Bacteria | 625 |
| 507 | Ga0307411_10414179 | 3300032005 | Bacteria | 1117 |
| 508 | Ga0307411_11633047 | 3300032005 | Bacteria | 595 |
| 509 | Ga0307507_10096639 | 3300033179 | Bacteria | 2497 |
| 510 | Ga0307510_10054117 | 3300033180 | Bacteria | 4210 |
| 511 | Ga0307510_10108768 | 3300033180 | Bacteria | 2524 |
| 512 | Ga0373959_0042364 | 3300034820 | Bacteria | 959 |
| 513 | Ga0373931_0315990 | 3300035691 | Bacteria | 969 |
| 514 | Ga0373925_0824834 | 3300037068 | Bacteria | 764 |
| 515 | Ga0395899_0000344 | 3300037312 | Bacteria | 57423 |
| 516 | Ga0395899_0079887 | 3300037312 | Bacteria | 2382 |
| 517 | Ga0395900_0019446 | 3300037418 | Bacteria | 6924 |
| 518 | Ga0395900_0109112 | 3300037418 | Bacteria | 2843 |
| 519 | Ga0395898_0174190 | 3300037466 | Bacteria | 2057 |
| 520 | Ga0395905_0022085 | 3300037471 | Bacteria | 6019 |
| 521 | Ga0395905_0037501 | 3300037471 | Bacteria | 4550 |
| 522 | Ga0395905_0038248 | 3300037471 | Bacteria | 4502 |
| 523 | Ga0395905_0083297 | 3300037471 | Bacteria | 2996 |
| 524 | Ga0395905_0158898 | 3300037471 | Bacteria | 2125 |
| 525 | Ga0395901_0127946 | 3300038443 | Bacteria | 2670 |
| 526 | Ga0395901_0131188 | 3300038443 | Bacteria | 2633 |
| 527 | Ga0395901_0373732 | 3300038443 | Bacteria | 1468 |
| 528 | Ga0436365_1619585 | 3300039437 | Bacteria | 758 |
| 529 | Ga0436365_1868038 | 3300039437 | Bacteria | 716 |
| 530 | Ga0436361_0268202 | 3300039447 | Bacteria | 49775 |
| 531 | Ga0439436_0001379 | 3300041404 | Bacteria | 7004 |
| 532 | Ga0439436_0006229 | 3300041404 | Bacteria | 3662 |
| 533 | Ga0439439_0005352 | 3300041406 | Bacteria | 2928 |
| 534 | Ga0439439_0005369 | 3300041406 | Bacteria | 2924 |
| 535 | Ga0439439_0009655 | 3300041406 | Bacteria | 2299 |
| 536 | Ga0439461_0050938 | 3300041410 | Bacteria | 918 |
| 537 | Ga0439465_0000697 | 3300041413 | Bacteria | 10311 |
| 538 | Ga0451789_0337724 | 3300041443 | Bacteria | 560 |
| 539 | Ga0451791_1603068 | 3300041451 | Bacteria | 645 |
| 540 | Ga0451793_0018749 | 3300041452 | Bacteria | 1350 |
| 541 | Ga0451793_1463256 | 3300041452 | Bacteria | 564 |
| 542 | Ga0451800_0610257 | 3300041459 | Bacteria | 1592 |
| 543 | Ga0451807_0067919 | 3300041486 | Bacteria | 744 |
| 544 | Ga0451837_1700856 | 3300041494 | Bacteria | 756 |
| 545 | Ga0451841_1340995 | 3300041498 | Bacteria | 728 |
| 546 | Ga0451853_0112802 | 3300041512 | Bacteria | 1741 |
| 547 | Ga0451853_3547166 | 3300041512 | Bacteria | 654 |
| 548 | Ga0439431_0000916 | 3300041997 | Bacteria | 6385 |
| 549 | Ga0439431_0007247 | 3300041997 | Bacteria | 2470 |
| 550 | Ga0439433_0000360 | 3300041999 | Bacteria | 8072 |
| 551 | Ga0439442_009609 | 3300042002 | Bacteria | 1955 |
| 552 | Ga0439442_016402 | 3300042002 | Bacteria | 1527 |
| 553 | Ga0439445_0000835 | 3300042004 | Bacteria | 6503 |
| 554 | Ga0439432_003052 | 3300042006 | Bacteria | 6232 |
| 555 | Ga0439432_012101 | 3300042006 | Bacteria | 2960 |
| 556 | Ga0439432_095902 | 3300042006 | Bacteria | 890 |
| 557 | Ga0439449_0001800 | 3300042007 | Bacteria | 8435 |
| 558 | Ga0439449_0002084 | 3300042007 | Bacteria | 7861 |
| 559 | Ga0439449_0003898 | 3300042007 | Bacteria | 5783 |
| 560 | Ga0439449_0017753 | 3300042007 | Bacteria | 2671 |
| 561 | Ga0439452_006051 | 3300042010 | Bacteria | 3826 |
| 562 | Ga0439452_022075 | 3300042010 | Bacteria | 1651 |
| 563 | Ga0439457_008504 | 3300042014 | Bacteria | 2417 |
| 564 | Ga0439462_0004954 | 3300042015 | Bacteria | 3266 |
| 565 | Ga0439462_0008200 | 3300042015 | Bacteria | 2629 |
| 566 | Ga0439462_0012214 | 3300042015 | Bacteria | 2193 |
| 567 | Ga0450911_014976 | 3300042115 | Bacteria | 1028 |
| 568 | Ga0450920_022302 | 3300042122 | Bacteria | 1226 |
| 569 | Ga0450888_020205 | 3300042126 | Bacteria | 844 |
| 570 | Ga0450898_007204 | 3300042134 | Bacteria | 1728 |
| 571 | Ga0450906_002698 | 3300042145 | Bacteria | 3863 |
| 572 | Ga0450906_011020 | 3300042145 | Bacteria | 1698 |
| 573 | Ga0450907_034411 | 3300042146 | Bacteria | 864 |
| 574 | Ga0450910_015188 | 3300042147 | Bacteria | 1132 |
| 575 | Ga0450909_006505 | 3300042185 | Bacteria | 1684 |
| 576 | Ga0439434_0000980 | 3300042435 | Bacteria | 8236 |
| 577 | Ga0439434_0008390 | 3300042435 | Bacteria | 3029 |
| 578 | Ga0439434_0010643 | 3300042435 | Bacteria | 2712 |
| 579 | Ga0439434_0092514 | 3300042435 | Bacteria | 968 |
| 580 | Ga0450893_0008574 | 3300042532 | Bacteria | 1664 |
| 581 | Ga0466986_0061755 | 3300044650 | Bacteria | 2594 |
| 582 | Ga0466977_0153091 | 3300044666 | Bacteria | 1492 |
| 583 | Ga0466978_0022614 | 3300044671 | Bacteria | 3737 |
| 584 | Ga0466965_0006416 | 3300044683 | Bacteria | 5340 |
| 585 | Ga0466961_0004849 | 3300044693 | Bacteria | 8463 |
| 586 | Ga0466961_0036663 | 3300044693 | Bacteria | 3147 |
| 587 | Ga0466964_0006122 | 3300044706 | Bacteria | 4485 |
| 588 | Ga0466964_0040101 | 3300044706 | Bacteria | 1890 |
| 589 | Ga0453684_0000606 | 3300044712 | Bacteria | 132056 |
| 590 | Ga0453684_0029039 | 3300044712 | Bacteria | 7868 |
| 591 | Ga0466971_0077704 | 3300044719 | Bacteria | 1511 |
| 592 | Ga0466968_0005280 | 3300044735 | Bacteria | 4838 |
| 593 | Ga0466970_0006124 | 3300044765 | Bacteria | 5991 |
| 594 | Ga0466970_0059958 | 3300044765 | Bacteria | 2038 |
| 595 | Ga0466957_0580074 | 3300044842 | Bacteria | 784 |
| 596 | Ga0466960_0054582 | 3300044901 | Bacteria | 1940 |
| 597 | Ga0466959_0008819 | 3300045049 | Bacteria | 7145 |
| 598 | Ga0466959_0027997 | 3300045049 | Bacteria | 4179 |
| 599 | Ga0451576_0013321 | 3300045051 | Bacteria | 9202 |
| 600 | Ga0466967_0009266 | 3300045976 | Bacteria | 7293 |
| 601 | Ga0466967_0237002 | 3300045976 | Bacteria | 1739 |
| 602 | Ga0495617_000303 | 3300046452 | Bacteria | 27779 |
| 603 | Ga0495627_008497 | 3300046453 | Bacteria | 3845 |
| 604 | Ga0495627_088232 | 3300046453 | Bacteria | 893 |
| 605 | Ga0495590_0064769 | 3300046457 | Bacteria | 1279 |
| 606 | Ga0495638_0028214 | 3300046460 | Bacteria | 3626 |
| 607 | Ga0495651_0145428 | 3300046462 | Bacteria | 1715 |
| 608 | Ga0495605_0000168 | 3300046474 | Bacteria | 82889 |
| 609 | Ga0495639_0022262 | 3300046475 | Bacteria | 2779 |
| 610 | Ga0495584_0002376 | 3300046491 | Bacteria | 10696 |
| 611 | Ga0495584_0005922 | 3300046491 | Bacteria | 6440 |
| 612 | Ga0495584_0039758 | 3300046491 | Bacteria | 2376 |
| 613 | Ga0495585_0000193 | 3300046492 | Bacteria | 63937 |
| 614 | Ga0495585_0004816 | 3300046492 | Bacteria | 8669 |
| 615 | Ga0495596_0003328 | 3300046500 | Bacteria | 8183 |
| 616 | Ga0495607_0000941 | 3300046501 | Bacteria | 27027 |
| 617 | Ga0495583_0000525 | 3300046506 | Bacteria | 54370 |
| 618 | Ga0495583_0018518 | 3300046506 | Bacteria | 3663 |
| 619 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 620 | Ga0495606_0035562 | 3300046507 | Bacteria | 3403 |
| 621 | Ga0495606_0143507 | 3300046507 | Bacteria | 1408 |
| 622 | Ga0495610_0005043 | 3300046512 | Bacteria | 9536 |
| 623 | Ga0495610_0018746 | 3300046512 | Bacteria | 3894 |
| 624 | Ga0495616_0000526 | 3300046513 | Bacteria | 28964 |
| 625 | Ga0495616_0007518 | 3300046513 | Bacteria | 6521 |
| 626 | Ga0495616_0008947 | 3300046513 | Bacteria | 5884 |
| 627 | Ga0495616_0014603 | 3300046513 | Bacteria | 4391 |
| 628 | Ga0495631_0004184 | 3300046518 | Bacteria | 7719 |
| 629 | Ga0495637_0006045 | 3300046520 | Bacteria | 6111 |
| 630 | Ga0495648_0000109 | 3300046524 | Bacteria | 101519 |
| 631 | Ga0495663_0128016 | 3300046525 | Bacteria | 854 |
| 632 | Ga0495654_0003435 | 3300046530 | Bacteria | 9711 |
| 633 | Ga0495654_0046196 | 3300046530 | Bacteria | 2146 |
| 634 | Ga0495654_0062093 | 3300046530 | Bacteria | 1792 |
| 635 | Ga0495654_0182136 | 3300046530 | Bacteria | 909 |
| 636 | Ga0495609_0000346 | 3300046538 | Bacteria | 40425 |
| 637 | Ga0495609_0050548 | 3300046538 | Bacteria | 1853 |
| 638 | Ga0495621_0010000 | 3300046539 | Bacteria | 2894 |
| 639 | Ga0495621_0011585 | 3300046539 | Bacteria | 2733 |
| 640 | Ga0495597_0004057 | 3300046542 | Bacteria | 8196 |
| 641 | Ga0495597_0271549 | 3300046542 | Bacteria | 662 |
| 642 | Ga0495633_0006530 | 3300046558 | Bacteria | 6893 |
| 643 | Ga0495633_0012623 | 3300046558 | Bacteria | 4483 |
| 644 | Ga0495656_0003255 | 3300046615 | Bacteria | 5478 |
| 645 | Ga0495656_0666815 | 3300046615 | Bacteria | 559 |
| 646 | Ga0495668_0000095 | 3300046616 | Bacteria | 141321 |
| 647 | Ga0495668_0002235 | 3300046616 | Bacteria | 16399 |
| 648 | Ga0495668_0052017 | 3300046616 | Bacteria | 2267 |
| 649 | Ga0495668_0063099 | 3300046616 | Bacteria | 2041 |
| 650 | Ga0495668_0118188 | 3300046616 | Bacteria | 1450 |
| 651 | Ga0495625_0000896 | 3300046660 | Bacteria | 40225 |
| 652 | Ga0495625_0090482 | 3300046660 | Bacteria | 2116 |
| 653 | Ga0495625_0128104 | 3300046660 | Bacteria | 1721 |
| 654 | Ga0495625_0344619 | 3300046660 | Bacteria | 943 |
| 655 | Ga0495659_0013477 | 3300046664 | Bacteria | 2663 |
| 656 | Ga0495661_0069382 | 3300046665 | Bacteria | 2065 |
| 657 | Ga0495661_0140755 | 3300046665 | Bacteria | 1313 |
| 658 | Ga0495588_0019546 | 3300046674 | Bacteria | 3319 |
| 659 | Ga0495588_0033592 | 3300046674 | Bacteria | 2591 |
| 660 | Ga0495588_0252663 | 3300046674 | Bacteria | 929 |
| 661 | Ga0495657_0060967 | 3300046675 | Bacteria | 2497 |
| 662 | Ga0495599_0187568 | 3300046678 | Bacteria | 1273 |
| 663 | Ga0495669_0045637 | 3300046684 | Bacteria | 1954 |
| 664 | Ga0495670_0267388 | 3300046691 | Bacteria | 913 |
| 665 | Ga0495671_0009212 | 3300046692 | Bacteria | 5519 |
| 666 | Ga0495671_0030047 | 3300046692 | Bacteria | 2786 |
| 667 | Ga0495649_0007050 | 3300046694 | Bacteria | 6917 |
| 668 | Ga0495589_0311139 | 3300046794 | Bacteria | 729 |
| 669 | Ga0495600_0188319 | 3300046809 | Bacteria | 1328 |
| 670 | Ga0495636_0027504 | 3300047318 | Bacteria | 2316 |
| 671 | Ga0495683_0000144 | 3300047323 | Bacteria | 69959 |
| 672 | Ga0495683_0454240 | 3300047323 | Bacteria | 525 |
| 673 | Ga0495687_007289 | 3300047443 | Bacteria | 6552 |
| 674 | Ga0495677_0016382 | 3300047445 | Bacteria | 2689 |
| 675 | Ga0495685_006498 | 3300047447 | Bacteria | 3829 |
| 676 | Ga0495685_017529 | 3300047447 | Bacteria | 2453 |
| 677 | Ga0495681_0009923 | 3300047470 | Bacteria | 5815 |
| 678 | Ga0495614_0310627 | 3300048089 | Bacteria | 730 |
| 679 | Ga0495626_0041067 | 3300048091 | Bacteria | 2182 |
| 680 | Ga0496100_0007340 | 3300048903 | Bacteria | 6072 |
| 681 | Ga0496101_0018273 | 3300048904 | Bacteria | 4766 |
| 682 | Ga0496102_0000707 | 3300048905 | Bacteria | 33079 |
| 683 | Ga0496102_0042793 | 3300048905 | Bacteria | 4105 |
| 684 | Ga0496104_0020850 | 3300048907 | Bacteria | 6010 |
| 685 | Ga0496104_0635886 | 3300048907 | Bacteria | 976 |
| 686 | Ga0496106_0020141 | 3300048909 | Bacteria | 4948 |
| 687 | Ga0496106_0134694 | 3300048909 | Bacteria | 1939 |
| 688 | Ga0496107_0452486 | 3300048910 | Bacteria | 954 |
| 689 | Ga0496107_0873698 | 3300048910 | Bacteria | 656 |
| 690 | Ga0496109_0130274 | 3300048912 | Bacteria | 2347 |
| 691 | Ga0496110_0035381 | 3300048913 | Bacteria | 4332 |
| 692 | Ga0496110_0144587 | 3300048913 | Bacteria | 2150 |
| 693 | Ga0496111_0029616 | 3300048914 | Bacteria | 3889 |
| 694 | Ga0496111_0087357 | 3300048914 | Bacteria | 2282 |
| 695 | Ga0496113_0073271 | 3300048916 | Bacteria | 2609 |
| 696 | Ga0496114_0703367 | 3300048917 | Bacteria | 886 |
| 697 | Ga0496116_0035499 | 3300048919 | Bacteria | 3501 |
| 698 | Ga0496118_0010125 | 3300048921 | Bacteria | 9371 |
| 699 | Ga0496118_0030038 | 3300048921 | Bacteria | 4545 |
| 700 | Ga0496121_0042948 | 3300048924 | Bacteria | 3922 |
| 701 | Ga0496121_0190509 | 3300048924 | Bacteria | 1471 |
| 702 | Ga0496121_0197772 | 3300048924 | Bacteria | 1435 |
| 703 | Ga0496121_0506526 | 3300048924 | Bacteria | 765 |
| 704 | Ga0496122_0003984 | 3300048925 | Bacteria | 18836 |
| 705 | Ga0496122_0064753 | 3300048925 | Bacteria | 2657 |
| 706 | Ga0496123_0000235 | 3300048926 | Bacteria | 111823 |
| 707 | Ga0496123_0061997 | 3300048926 | Bacteria | 2399 |
| 708 | Ga0496123_0136762 | 3300048926 | Bacteria | 1347 |
| 709 | Ga0496124_0451518 | 3300048927 | Bacteria | 876 |
| 710 | Ga0496125_0020173 | 3300048928 | Bacteria | 6264 |
| 711 | Ga0496125_0026915 | 3300048928 | Bacteria | 5223 |
| 712 | Ga0496125_0091422 | 3300048928 | Bacteria | 2280 |
| 713 | Ga0496125_0158785 | 3300048928 | Bacteria | 1540 |
| 714 | Ga0496125_0325321 | 3300048928 | Bacteria | 930 |
| 715 | Ga0496126_0805841 | 3300048929 | Bacteria | 720 |
| 716 | Ga0495682_0073699 | 3300049460 | Bacteria | 1228 |
| 717 | Ga0501034_0548052 | 3300049571 | Bacteria | 1066 |
| 718 | Ga0501037_0010551 | 3300049573 | Bacteria | 6785 |
| 719 | Ga0501046_0085905 | 3300049580 | Bacteria | 2426 |
| 720 | Ga0501225_0013794 | 3300049705 | Bacteria | 2259 |
| 721 | Ga0501262_000153 | 3300049759 | Bacteria | 8442 |
| 722 | Ga0501266_001605 | 3300049763 | Bacteria | 2884 |
| 723 | Ga0501269_063195 | 3300049766 | Bacteria | 527 |
| 724 | Ga0501281_15192 | 3300049777 | Bacteria | 567 |
| 725 | nmdc:mga03683_10250_c1 | 3300050489 | Bacteria | 3358 |
| 726 | nmdc:mga03683_209216_c1 | 3300050489 | Bacteria | 897 |
| 727 | nmdc:mga03683_224231_c1 | 3300050489 | Bacteria | 868 |
| 728 | nmdc:mga03683_36119_c1 | 3300050489 | Bacteria | 2008 |
| 729 | nmdc:mga03683_406129_c1 | 3300050489 | Bacteria | 651 |
| 730 | nmdc:mga03683_439257_c1 | 3300050489 | Bacteria | 627 |
| 731 | nmdc:mga03n38_10203_c1 | 3300050490 | Bacteria | 3447 |
| 732 | nmdc:mga03n38_25159_c1 | 3300050490 | Bacteria | 2441 |
| 733 | nmdc:mga03n38_25218_c1 | 3300050490 | Bacteria | 2439 |
| 734 | nmdc:mga03n38_369277_c1 | 3300050490 | Bacteria | 784 |
| 735 | nmdc:mga00v17_21047_c2 | 3300050491 | Bacteria | 2596 |
| 736 | nmdc:mga00v17_359062_c1 | 3300050491 | Bacteria | 947 |
| 737 | nmdc:mga00v17_53639_c1 | 3300050491 | Bacteria | 2458 |
| 738 | nmdc:mga0yw44_28385_c1 | 3300050492 | Bacteria | 3218 |
| 739 | nmdc:mga0yw44_58591_c1 | 3300050492 | Bacteria | 2353 |
| 740 | nmdc:mga0k408_127897_c1 | 3300050493 | Bacteria | 1507 |
| 741 | nmdc:mga0k408_132105_c1 | 3300050493 | Bacteria | 1482 |
| 742 | nmdc:mga0k408_197323_c1 | 3300050493 | Bacteria | 1201 |
| 743 | nmdc:mga0k408_265279_c1 | 3300050493 | Bacteria | 1025 |
| 744 | nmdc:mga0k408_289323_c1 | 3300050493 | Bacteria | 978 |
| 745 | nmdc:mga0k408_36012_c1 | 3300050493 | Bacteria | 2839 |
| 746 | nmdc:mga0k408_403132_c1 | 3300050493 | Bacteria | 814 |
| 747 | nmdc:mga0k408_41811_c1 | 3300050493 | Bacteria | 2639 |
| 748 | nmdc:mga0k408_4603_c1 | 3300050493 | Bacteria | 7317 |
| 749 | nmdc:mga0k408_513833_c1 | 3300050493 | Bacteria | 709 |
| 750 | nmdc:mga0k408_52519_c1 | 3300050493 | Bacteria | 2362 |
| 751 | nmdc:mga06z11_277517_c1 | 3300050494 | Bacteria | 992 |
| 752 | nmdc:mga06z11_738697_c1 | 3300050494 | Bacteria | 600 |
| 753 | nmdc:mga04h51_139923_c1 | 3300050495 | Bacteria | 917 |
| 754 | nmdc:mga07m45_100184_c1 | 3300050496 | Bacteria | 1664 |
| 755 | nmdc:mga07m45_174148_c1 | 3300050496 | Bacteria | 1251 |
| 756 | nmdc:mga07m45_1973_c1 | 3300050496 | Bacteria | 9501 |
| 757 | nmdc:mga07m45_21686_c1 | 3300050496 | Bacteria | 3500 |
| 758 | nmdc:mga07m45_224527_c1 | 3300050496 | Bacteria | 1093 |
| 759 | nmdc:mga07m45_345113_c1 | 3300050496 | Bacteria | 865 |
| 760 | nmdc:mga07m45_8907_c1 | 3300050496 | Bacteria | 5182 |
| 761 | nmdc:mga09592_239398_c1 | 3300050508 | Bacteria | 1572 |
| 762 | nmdc:mga09592_5962_c1 | 3300050508 | Bacteria | 9932 |
| 763 | nmdc:mga0qj67_17296_c1 | 3300050509 | Bacteria | 5481 |
| 764 | Ga0500610_0006176 | 3300053079 | Bacteria | 5000 |
| 765 | Ga0500610_0013178 | 3300053079 | Bacteria | 3837 |
| 766 | Ga0500578_0039951 | 3300053086 | Bacteria | 3015 |
| 767 | Ga0500643_055693 | 3300053087 | Bacteria | 1119 |
| 768 | Ga0500644_0002098 | 3300053088 | Bacteria | 5060 |
| 769 | Ga0500651_0027085 | 3300053093 | Bacteria | 3604 |
| 770 | Ga0500651_0299293 | 3300053093 | Bacteria | 923 |
| 771 | Ga0500641_0061010 | 3300053096 | Bacteria | 1570 |
| 772 | Ga0500641_0120501 | 3300053096 | Bacteria | 1131 |
| 773 | Ga0500650_0093654 | 3300053098 | Bacteria | 1406 |
| 774 | Ga0500572_020849 | 3300053111 | Bacteria | 1730 |
| 775 | Ga0500592_012805 | 3300053116 | Bacteria | 1342 |
| 776 | Ga0500593_003907 | 3300053117 | Bacteria | 5717 |
| 777 | Ga0500593_008376 | 3300053117 | Bacteria | 4245 |
| 778 | Ga0500594_0003689 | 3300053118 | Bacteria | 3376 |
| 779 | Ga0500607_004990 | 3300053121 | Bacteria | 8825 |
| 780 | Ga0500607_216595 | 3300053121 | Bacteria | 803 |
| 781 | Ga0500608_004926 | 3300053122 | Bacteria | 5233 |
| 782 | Ga0500608_043313 | 3300053122 | Bacteria | 2161 |
| 783 | Ga0500618_020979 | 3300053125 | Bacteria | 1598 |
| 784 | Ga0500655_000523 | 3300053133 | Bacteria | 7736 |
| 785 | Ga0500658_0001924 | 3300053134 | Bacteria | 8127 |
| 786 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 787 | Ga0500559_0005307 | 3300053136 | Bacteria | 5936 |
| 788 | Ga0500568_0006491 | 3300053139 | Bacteria | 5865 |
| 789 | Ga0500568_0306157 | 3300053139 | Bacteria | 577 |
| 790 | Ga0500616_0143992 | 3300053153 | Bacteria | 1110 |
| 791 | Ga0500616_0164096 | 3300053153 | Bacteria | 1016 |
| 792 | Ga0500616_0309782 | 3300053153 | Bacteria | 653 |
| 793 | Ga0500622_0055210 | 3300053156 | Bacteria | 2035 |
| 794 | Ga0500622_0155426 | 3300053156 | Bacteria | 1077 |
| 795 | Ga0500624_026386 | 3300053157 | Bacteria | 972 |
| 796 | Ga0500627_0006722 | 3300053158 | Bacteria | 3944 |
| 797 | Ga0500627_0225857 | 3300053158 | Bacteria | 834 |
| 798 | Ga0500634_0006145 | 3300053161 | Bacteria | 5783 |
| 799 | Ga0500638_003903 | 3300053162 | Bacteria | 5628 |
| 800 | Ga0500625_070542 | 3300053729 | Bacteria | 1556 |
| 801 | Ga0500645_002856 | 3300053730 | Bacteria | 7416 |
| 802 | Ga0500645_015872 | 3300053730 | Bacteria | 2380 |
| 803 | Ga0500645_017528 | 3300053730 | Bacteria | 2243 |
| 804 | Ga0500645_163810 | 3300053730 | Bacteria | 609 |
| 805 | Ga0466962_0006446 | 3300061719 | Bacteria | 5634 |
| 806 | Ga0466962_0010759 | 3300061719 | Bacteria | 4397 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003771 | Ga0055526_1000441 | Ga0055526_100044115 | 149 |
| 2 | 3300025295 | Ga0209564_1000009 | Ga0209564_1000009148 | 149 |
| 3 | 3300044842 | Ga0466957_0580074 | Ga0466957_0580074_158_613 | 149 |
| 4 | 3300046474 | Ga0495605_0000168 | Ga0495605_0000168_32052_32510 | 149 |
| 5 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_26419_26877 | 149 |
| 6 | 3300046512 | Ga0495610_0005043 | Ga0495610_0005043_4225_4683 | 149 |
| 7 | 3300046558 | Ga0495633_0006530 | Ga0495633_0006530_1243_1701 | 149 |
| 8 | 3300046616 | Ga0495668_0000095 | Ga0495668_0000095_124112_124570 | 149 |
| 9 | 3300005347 | Ga0070668_100436175 | Ga0070668_1004361753 | 150 |
| 10 | 3300009176 | Ga0105242_10698787 | Ga0105242_106987872 | 150 |
| 11 | 3300014326 | Ga0157380_10002034 | Ga0157380_100020345 | 150 |
| 12 | 3300014969 | Ga0157376_11077177 | Ga0157376_110771772 | 150 |
| 13 | 3300046491 | Ga0495584_0005922 | Ga0495584_0005922_5291_5743 | 150 |
| 14 | 3300046501 | Ga0495607_0000941 | Ga0495607_0000941_25710_26162 | 150 |
| 15 | 3300046506 | Ga0495583_0018518 | Ga0495583_0018518_1644_2096 | 150 |
| 16 | 3300046513 | Ga0495616_0014603 | Ga0495616_0014603_1999_2451 | 150 |
| 17 | 3300046538 | Ga0495609_0000346 | Ga0495609_0000346_15386_15838 | 150 |
| 18 | 3300046615 | Ga0495656_0666815 | Ga0495656_0666815_59_511 | 150 |
| 19 | 3300046616 | Ga0495668_0052017 | Ga0495668_0052017_990_1442 | 150 |
| 20 | 3300046660 | Ga0495625_0128104 | Ga0495625_0128104_317_769 | 150 |
| 21 | 3300046664 | Ga0495659_0013477 | Ga0495659_0013477_935_1387 | 150 |
| 22 | 3300046665 | Ga0495661_0069382 | Ga0495661_0069382_338_790 | 150 |
| 23 | 3300046684 | Ga0495669_0045637 | Ga0495669_0045637_1273_1725 | 150 |
| 24 | 3300046692 | Ga0495671_0030047 | Ga0495671_0030047_1509_1961 | 150 |
| 25 | 3300046694 | Ga0495649_0007050 | Ga0495649_0007050_4653_5105 | 150 |
| 26 | 3300046794 | Ga0495589_0311139 | Ga0495589_0311139_37_489 | 150 |
| 27 | 3300047318 | Ga0495636_0027504 | Ga0495636_0027504_882_1334 | 150 |
| 28 | 3300047443 | Ga0495687_007289 | Ga0495687_007289_1568_2020 | 150 |
| 29 | 3300047445 | Ga0495677_0016382 | Ga0495677_0016382_88_540 | 150 |
| 30 | 3300047447 | Ga0495685_006498 | Ga0495685_006498_2229_2681 | 150 |
| 31 | 3300047470 | Ga0495681_0009923 | Ga0495681_0009923_3537_3989 | 150 |
| 32 | 3300005548 | Ga0070665_101285386 | Ga0070665_1012853862 | 151 |
| 33 | 3300046452 | Ga0495617_000303 | Ga0495617_000303_2841_3299 | 151 |
| 34 | 3300046457 | Ga0495590_0064769 | Ga0495590_0064769_396_854 | 151 |
| 35 | 3300046460 | Ga0495638_0028214 | Ga0495638_0028214_2010_2480 | 151 |
| 36 | 3300046491 | Ga0495584_0002376 | Ga0495584_0002376_4092_4550 | 151 |
| 37 | 3300046491 | Ga0495584_0039758 | Ga0495584_0039758_20_478 | 151 |
| 38 | 3300046492 | Ga0495585_0000193 | Ga0495585_0000193_22085_22543 | 151 |
| 39 | 3300046492 | Ga0495585_0004816 | Ga0495585_0004816_2668_3126 | 151 |
| 40 | 3300046500 | Ga0495596_0003328 | Ga0495596_0003328_2848_3306 | 151 |
| 41 | 3300046506 | Ga0495583_0000525 | Ga0495583_0000525_41674_42132 | 151 |
| 42 | 3300046507 | Ga0495606_0035562 | Ga0495606_0035562_1491_1949 | 151 |
| 43 | 3300046507 | Ga0495606_0143507 | Ga0495606_0143507_242_700 | 151 |
| 44 | 3300046513 | Ga0495616_0000526 | Ga0495616_0000526_20634_21092 | 151 |
| 45 | 3300046513 | Ga0495616_0008947 | Ga0495616_0008947_2642_3100 | 151 |
| 46 | 3300046524 | Ga0495648_0000109 | Ga0495648_0000109_64084_64542 | 151 |
| 47 | 3300046525 | Ga0495663_0128016 | Ga0495663_0128016_137_595 | 151 |
| 48 | 3300046542 | Ga0495597_0271549 | Ga0495597_0271549_169_639 | 151 |
| 49 | 3300046558 | Ga0495633_0012623 | Ga0495633_0012623_2784_3242 | 151 |
| 50 | 3300046616 | Ga0495668_0002235 | Ga0495668_0002235_13756_14214 | 151 |
| 51 | 3300046674 | Ga0495588_0019546 | Ga0495588_0019546_2471_2929 | 151 |
| 52 | 3300047323 | Ga0495683_0000144 | Ga0495683_0000144_63274_63732 | 151 |
| 53 | 3300047323 | Ga0495683_0454240 | Ga0495683_0454240_28_486 | 151 |
| 54 | 3300047447 | Ga0495685_017529 | Ga0495685_017529_1226_1684 | 151 |
| 55 | 3300048091 | Ga0495626_0041067 | Ga0495626_0041067_707_1165 | 151 |
| 56 | 3300048905 | Ga0496102_0000707 | Ga0496102_0000707_5828_6286 | 151 |
| 57 | 3300048910 | Ga0496107_0873698 | Ga0496107_0873698_39_497 | 151 |
| 58 | 3300049460 | Ga0495682_0073699 | Ga0495682_0073699_512_970 | 151 |
| 59 | 3300041459 | Ga0451800_0610257 | Ga0451800_0610257_706_1164 | 152 |
| 60 | 3300041512 | Ga0451853_0112802 | Ga0451853_0112802_683_1141 | 152 |
| 61 | iso_pu_bacteria | 2547132374 | 2548500009 | 152 |
| 62 | 3300041451 | Ga0451791_1603068 | Ga0451791_1603068_108_569 | 153 |
| 63 | 3300041452 | Ga0451793_0018749 | Ga0451793_0018749_157_618 | 153 |
| 64 | 3300049573 | Ga0501037_0010551 | Ga0501037_0010551_153_626 | 153 |
| 65 | iso_pu_bacteria | 2511231002 | 2511244316 | 153 |
| 66 | iso_pu_bacteria | 2513020051 | 2513227977 | 153 |
| 67 | iso_pu_bacteria | 2599185214 | 2599624056 | 153 |
| 68 | iso_pu_bacteria | 2599185226 | 2599672067 | 153 |
| 69 | iso_pu_bacteria | 2599185227 | 2599681851 | 153 |
| 70 | iso_pu_bacteria | 2599185229 | 2599693864 | 153 |
| 71 | iso_pu_bacteria | 2643221570 | 2643868245 | 153 |
| 72 | iso_pu_bacteria | 2643221596 | 2643993761 | 153 |
| 73 | iso_pu_bacteria | 2643221652 | 2644293849 | 153 |
| 74 | iso_pu_bacteria | 2643221660 | 2644339985 | 153 |
| 75 | iso_pu_bacteria | 2643221672 | 2644397969 | 153 |
| 76 | iso_pu_bacteria | 2643221717 | 2644644672 | 153 |
| 77 | iso_pu_bacteria | 2738541277 | 2738719919 | 153 |
| 78 | iso_pu_bacteria | 2738541307 | 2738879669 | 153 |
| 79 | iso_pu_bacteria | 2738543019 | 2739279118 | 153 |
| 80 | iso_pu_bacteria | 2831265667 | 2831269543 | 153 |
| 81 | iso_pu_bacteria | 2838054893 | 2838060034 | 153 |
| 82 | iso_pu_bacteria | 2842677519 | 2842681905 | 153 |
| 83 | iso_pu_bacteria | 2842733646 | 2842734700 | 153 |
| 84 | iso_pu_bacteria | 2842747753 | 2842748535 | 153 |
| 85 | iso_pu_bacteria | 2885192300 | 2885195586 | 153 |
| 86 | iso_pu_bacteria | 2885198086 | 2885199215 | 153 |
| 87 | iso_pu_bacteria | 2885211737 | 2885212866 | 153 |
| 88 | iso_pu_bacteria | 2904449895 | 2904450086 | 153 |
| 89 | iso_pu_bacteria | 2904456579 | 2904457091 | 153 |
| 90 | iso_pu_bacteria | 2919462493 | 2919464981 | 153 |
| 91 | iso_pu_bacteria | 2919704043 | 2919704621 | 153 |
| 92 | iso_pu_bacteria | 2928070936 | 2928076738 | 153 |
| 93 | iso_pu_bacteria | 2928084124 | 2928090512 | 153 |
| 94 | iso_pu_bacteria | 2928115317 | 2928117338 | 153 |
| 95 | iso_pu_bacteria | 2929520902 | 2929525376 | 153 |
| 96 | iso_pu_bacteria | 2945909444 | 2945913120 | 153 |
| 97 | iso_pu_bacteria | 2945945610 | 2945948746 | 153 |
| 98 | iso_pu_bacteria | 2945972063 | 2945972866 | 153 |
| 99 | iso_pu_bacteria | 2945984333 | 2945984610 | 153 |
| 100 | iso_pu_bacteria | 2954767861 | 2954772886 | 153 |
| 101 | iso_pu_bacteria | 2990710928 | 2990713395 | 153 |
| 102 | 3300014497 | Ga0182008_10002648 | Ga0182008_1000264810 | 154 |
| 103 | 3300021384 | Ga0213876_10579543 | Ga0213876_105795431 | 154 |
| 104 | 3300028794 | Ga0307515_10026348 | Ga0307515_100263489 | 154 |
| 105 | 3300039437 | Ga0436365_1619585 | Ga0436365_1619585_200_667 | 154 |
| 106 | 3300041406 | Ga0439439_0005352 | Ga0439439_0005352_517_1074 | 154 |
| 107 | 3300041443 | Ga0451789_0337724 | Ga0451789_0337724_67_543 | 154 |
| 108 | 3300042006 | Ga0439432_095902 | Ga0439432_095902_41_598 | 154 |
| 109 | 3300042007 | Ga0439449_0001800 | Ga0439449_0001800_3537_4094 | 154 |
| 110 | 3300042015 | Ga0439462_0012214 | Ga0439462_0012214_336_893 | 154 |
| 111 | 3300044712 | Ga0453684_0000606 | Ga0453684_0000606_7159_7653 | 154 |
| 112 | 3300045051 | Ga0451576_0013321 | Ga0451576_0013321_4141_4635 | 154 |
| 113 | 3300049580 | Ga0501046_0085905 | Ga0501046_0085905_1812_2288 | 154 |
| 114 | 3300053157 | Ga0500624_026386 | Ga0500624_026386_455_946 | 154 |
| 115 | iso_pu_bacteria | 2904541872 | 2904543933 | 154 |
| 116 | iso_pu_bacteria | 2929160207 | 2929162508 | 154 |
| 117 | 3300001989 | JGI24739J22299_10005364 | JGI24739J22299_100053644 | 155 |
| 118 | 3300002739 | JGI25158J39367_1003721 | JGI25158J39367_10037211 | 155 |
| 119 | 3300002774 | JGI25150J39212_1001101 | JGI25150J39212_10011017 | 155 |
| 120 | 3300002774 | JGI25150J39212_1001868 | JGI25150J39212_10018686 | 155 |
| 121 | 3300002774 | JGI25150J39212_1009272 | JGI25150J39212_10092722 | 155 |
| 122 | 3300002987 | JGI25159J45721_1000465 | JGI25159J45721_10004658 | 155 |
| 123 | 3300002987 | JGI25159J45721_1002893 | JGI25159J45721_10028932 | 155 |
| 124 | 3300003187 | JGI25151J46595_10015217 | JGI25151J46595_100152172 | 155 |
| 125 | 3300003354 | JGI25160J50197_1000192 | JGI25160J50197_10001929 | 155 |
| 126 | 3300003354 | JGI25160J50197_1018502 | JGI25160J50197_10185022 | 155 |
| 127 | 3300003354 | JGI25160J50197_1059988 | JGI25160J50197_10599881 | 155 |
| 128 | 3300003374 | JGI25161J50226_1000043 | JGI25161J50226_10000434 | 155 |
| 129 | 3300003771 | Ga0055526_1003998 | Ga0055526_10039986 | 155 |
| 130 | 3300003771 | Ga0055526_1004562 | Ga0055526_10045626 | 155 |
| 131 | 3300003773 | Ga0055537_1000259 | Ga0055537_10002596 | 155 |
| 132 | 3300003773 | Ga0055537_1001161 | Ga0055537_10011613 | 155 |
| 133 | 3300003773 | Ga0055537_1004429 | Ga0055537_10044295 | 155 |
| 134 | 3300003773 | Ga0055537_1009409 | Ga0055537_10094092 | 155 |
| 135 | 3300003775 | Ga0055524_1000156 | Ga0055524_100015674 | 155 |
| 136 | 3300003775 | Ga0055524_1009658 | Ga0055524_10096582 | 155 |
| 137 | 3300003781 | Ga0055536_1000270 | Ga0055536_100027039 | 155 |
| 138 | 3300003781 | Ga0055536_1009172 | Ga0055536_10091725 | 155 |
| 139 | 3300003784 | Ga0055534_1001138 | Ga0055534_100113810 | 155 |
| 140 | 3300003784 | Ga0055534_1003028 | Ga0055534_10030285 | 155 |
| 141 | 3300003784 | Ga0055534_1006217 | Ga0055534_10062173 | 155 |
| 142 | 3300003784 | Ga0055534_1029829 | Ga0055534_10298291 | 155 |
| 143 | 3300003790 | Ga0055528_1008541 | Ga0055528_10085412 | 155 |
| 144 | 3300003790 | Ga0055528_1020328 | Ga0055528_10203282 | 155 |
| 145 | 3300003791 | Ga0055530_10000408 | Ga0055530_1000040838 | 155 |
| 146 | 3300003791 | Ga0055530_10003951 | Ga0055530_100039517 | 155 |
| 147 | 3300003791 | Ga0055530_10009348 | Ga0055530_100093482 | 155 |
| 148 | 3300003791 | Ga0055530_10033474 | Ga0055530_100334742 | 155 |
| 149 | 3300003792 | Ga0055540_1000033 | Ga0055540_1000033141 | 155 |
| 150 | 3300003792 | Ga0055540_1003778 | Ga0055540_10037786 | 155 |
| 151 | 3300003792 | Ga0055540_1004106 | Ga0055540_10041066 | 155 |
| 152 | 3300003794 | Ga0055531_10000273 | Ga0055531_1000027354 | 155 |
| 153 | 3300003794 | Ga0055531_10004865 | Ga0055531_100048653 | 155 |
| 154 | 3300003794 | Ga0055531_10009016 | Ga0055531_100090166 | 155 |
| 155 | 3300004625 | Ga0055543_1000127 | Ga0055543_100012751 | 155 |
| 156 | 3300004625 | Ga0055543_1003299 | Ga0055543_10032996 | 155 |
| 157 | 3300005262 | Ga0065165_1028859 | Ga0065165_10288592 | 155 |
| 158 | 3300005262 | Ga0065165_1067279 | Ga0065165_10672792 | 155 |
| 159 | 3300005289 | Ga0065704_10140698 | Ga0065704_101406982 | 155 |
| 160 | 3300005289 | Ga0065704_10292894 | Ga0065704_102928942 | 155 |
| 161 | 3300005334 | Ga0068869_100144770 | Ga0068869_1001447703 | 155 |
| 162 | 3300005336 | Ga0070680_100154059 | Ga0070680_1001540592 | 155 |
| 163 | 3300005336 | Ga0070680_100327448 | Ga0070680_1003274482 | 155 |
| 164 | 3300005338 | Ga0068868_100092735 | Ga0068868_1000927353 | 155 |
| 165 | 3300005338 | Ga0068868_100301613 | Ga0068868_1003016133 | 155 |
| 166 | 3300005339 | Ga0070660_100063427 | Ga0070660_1000634273 | 155 |
| 167 | 3300005344 | Ga0070661_100551136 | Ga0070661_1005511361 | 155 |
| 168 | 3300005356 | Ga0070674_100157791 | Ga0070674_1001577911 | 155 |
| 169 | 3300005366 | Ga0070659_100018367 | Ga0070659_1000183673 | 155 |
| 170 | 3300005435 | Ga0070714_100375116 | Ga0070714_1003751162 | 155 |
| 171 | 3300005456 | Ga0070678_100064383 | Ga0070678_1000643834 | 155 |
| 172 | 3300005457 | Ga0070662_100131317 | Ga0070662_1001313171 | 155 |
| 173 | 3300005539 | Ga0068853_100099468 | Ga0068853_1000994682 | 155 |
| 174 | 3300005539 | Ga0068853_100232269 | Ga0068853_1002322692 | 155 |
| 175 | 3300005543 | Ga0070672_100116863 | Ga0070672_1001168632 | 155 |
| 176 | 3300005548 | Ga0070665_100796843 | Ga0070665_1007968432 | 155 |
| 177 | 3300005563 | Ga0068855_100076757 | Ga0068855_1000767575 | 155 |
| 178 | 3300005563 | Ga0068855_100089079 | Ga0068855_1000890792 | 155 |
| 179 | 3300005563 | Ga0068855_100146314 | Ga0068855_1001463144 | 155 |
| 180 | 3300005564 | Ga0070664_100013869 | Ga0070664_1000138696 | 155 |
| 181 | 3300005577 | Ga0068857_100318117 | Ga0068857_1003181173 | 155 |
| 182 | 3300005614 | Ga0068856_100439570 | Ga0068856_1004395701 | 155 |
| 183 | 3300005616 | Ga0068852_100148447 | Ga0068852_1001484472 | 155 |
| 184 | 3300005844 | Ga0068862_100068756 | Ga0068862_1000687563 | 155 |
| 185 | 3300006038 | Ga0075365_10245891 | Ga0075365_102458913 | 155 |
| 186 | 3300006048 | Ga0075363_100083557 | Ga0075363_1000835572 | 155 |
| 187 | 3300006051 | Ga0075364_10025580 | Ga0075364_100255802 | 155 |
| 188 | 3300006051 | Ga0075364_10459791 | Ga0075364_104597912 | 155 |
| 189 | 3300006058 | Ga0075432_10007261 | Ga0075432_100072612 | 155 |
| 190 | 3300006058 | Ga0075432_10007774 | Ga0075432_100077742 | 155 |
| 191 | 3300006177 | Ga0075362_10003943 | Ga0075362_100039435 | 155 |
| 192 | 3300006177 | Ga0075362_10014025 | Ga0075362_100140252 | 155 |
| 193 | 3300006177 | Ga0075362_10026155 | Ga0075362_100261552 | 155 |
| 194 | 3300006177 | Ga0075362_10060691 | Ga0075362_100606913 | 155 |
| 195 | 3300006177 | Ga0075362_10324345 | Ga0075362_103243451 | 155 |
| 196 | 3300006177 | Ga0075362_10611600 | Ga0075362_106116001 | 155 |
| 197 | 3300006178 | Ga0075367_10183859 | Ga0075367_101838591 | 155 |
| 198 | 3300006195 | Ga0075366_10051211 | Ga0075366_100512113 | 155 |
| 199 | 3300006195 | Ga0075366_10089703 | Ga0075366_100897032 | 155 |
| 200 | 3300006195 | Ga0075366_10336508 | Ga0075366_103365081 | 155 |
| 201 | 3300006195 | Ga0075366_10386789 | Ga0075366_103867891 | 155 |
| 202 | 3300006195 | Ga0075366_10590118 | Ga0075366_105901181 | 155 |
| 203 | 3300006237 | Ga0097621_101454490 | Ga0097621_1014544902 | 155 |
| 204 | 3300006353 | Ga0075370_10000322 | Ga0075370_100003229 | 155 |
| 205 | 3300006353 | Ga0075370_10000738 | Ga0075370_100007382 | 155 |
| 206 | 3300006353 | Ga0075370_10046321 | Ga0075370_100463212 | 155 |
| 207 | 3300006353 | Ga0075370_10107198 | Ga0075370_101071982 | 155 |
| 208 | 3300006353 | Ga0075370_10173015 | Ga0075370_101730152 | 155 |
| 209 | 3300006353 | Ga0075370_10197097 | Ga0075370_101970973 | 155 |
| 210 | 3300006358 | Ga0068871_100173810 | Ga0068871_1001738102 | 155 |
| 211 | 3300006946 | Ga0079104_1020241 | Ga0079104_10202412 | 155 |
| 212 | 3300006946 | Ga0079104_1036670 | Ga0079104_10366702 | 155 |
| 213 | 3300006948 | Ga0099826_10008499 | Ga0099826_100084997 | 155 |
| 214 | 3300006948 | Ga0099826_10444032 | Ga0099826_104440321 | 155 |
| 215 | 3300009036 | Ga0105244_10003000 | Ga0105244_1000300011 | 155 |
| 216 | 3300009093 | Ga0105240_10004043 | Ga0105240_1000404324 | 155 |
| 217 | 3300009098 | Ga0105245_10273025 | Ga0105245_102730253 | 155 |
| 218 | 3300009148 | Ga0105243_10003757 | Ga0105243_100037573 | 155 |
| 219 | 3300009148 | Ga0105243_10022421 | Ga0105243_100224216 | 155 |
| 220 | 3300009176 | Ga0105242_10495201 | Ga0105242_104952011 | 155 |
| 221 | 3300009545 | Ga0105237_10124271 | Ga0105237_101242713 | 155 |
| 222 | 3300009553 | Ga0105249_11186873 | Ga0105249_111868732 | 155 |
| 223 | 3300010375 | Ga0105239_10266673 | Ga0105239_102666731 | 155 |
| 224 | 3300010375 | Ga0105239_11418942 | Ga0105239_114189422 | 155 |
| 225 | 3300011119 | Ga0105246_10035641 | Ga0105246_100356414 | 155 |
| 226 | 3300011119 | Ga0105246_10913458 | Ga0105246_109134582 | 155 |
| 227 | 3300012502 | Ga0157347_1002569 | Ga0157347_10025691 | 155 |
| 228 | 3300012502 | Ga0157347_1003557 | Ga0157347_10035572 | 155 |
| 229 | 3300012513 | Ga0157326_1000968 | Ga0157326_10009685 | 155 |
| 230 | 3300013100 | Ga0157373_10023683 | Ga0157373_100236833 | 155 |
| 231 | 3300013100 | Ga0157373_10345524 | Ga0157373_103455242 | 155 |
| 232 | 3300013102 | Ga0157371_10310855 | Ga0157371_103108552 | 155 |
| 233 | 3300013104 | Ga0157370_10072460 | Ga0157370_100724602 | 155 |
| 234 | 3300013104 | Ga0157370_11167749 | Ga0157370_111677491 | 155 |
| 235 | 3300013105 | Ga0157369_10012328 | Ga0157369_100123286 | 155 |
| 236 | 3300013296 | Ga0157374_11738372 | Ga0157374_117383721 | 155 |
| 237 | 3300013297 | Ga0157378_10076690 | Ga0157378_100766903 | 155 |
| 238 | 3300013308 | Ga0157375_10598249 | Ga0157375_105982491 | 155 |
| 239 | 3300014497 | Ga0182008_10001340 | Ga0182008_1000134019 | 155 |
| 240 | 3300014497 | Ga0182008_10016053 | Ga0182008_100160534 | 155 |
| 241 | 3300014497 | Ga0182008_10044379 | Ga0182008_100443793 | 155 |
| 242 | 3300014497 | Ga0182008_10053246 | Ga0182008_100532463 | 155 |
| 243 | 3300014969 | Ga0157376_10148287 | Ga0157376_101482872 | 155 |
| 244 | 3300015261 | Ga0182006_1001145 | Ga0182006_100114519 | 155 |
| 245 | 3300015261 | Ga0182006_1029708 | Ga0182006_10297082 | 155 |
| 246 | 3300015262 | Ga0182007_10008474 | Ga0182007_100084743 | 155 |
| 247 | 3300015265 | Ga0182005_1012041 | Ga0182005_10120412 | 155 |
| 248 | 3300015683 | Ga0183362_10001 | Ga0183362_10001630 | 155 |
| 249 | 3300017792 | Ga0163161_10000166 | Ga0163161_1000016610 | 155 |
| 250 | 3300017792 | Ga0163161_10017854 | Ga0163161_100178543 | 155 |
| 251 | 3300021361 | Ga0213872_10034267 | Ga0213872_100342672 | 155 |
| 252 | 3300025208 | Ga0209436_103077 | Ga0209436_1030777 | 155 |
| 253 | 3300025208 | Ga0209436_104293 | Ga0209436_1042932 | 155 |
| 254 | 3300025245 | Ga0207425_1000603 | Ga0207425_10006037 | 155 |
| 255 | 3300025245 | Ga0207425_1001556 | Ga0207425_10015564 | 155 |
| 256 | 3300025245 | Ga0207425_1002814 | Ga0207425_10028142 | 155 |
| 257 | 3300025245 | Ga0207425_1010123 | Ga0207425_10101232 | 155 |
| 258 | 3300025258 | Ga0209129_1000071 | Ga0209129_1000071179 | 155 |
| 259 | 3300025263 | Ga0209565_1000120 | Ga0209565_1000120109 | 155 |
| 260 | 3300025263 | Ga0209565_1000326 | Ga0209565_100032643 | 155 |
| 261 | 3300025263 | Ga0209565_1000774 | Ga0209565_10007742 | 155 |
| 262 | 3300025263 | Ga0209565_1001593 | Ga0209565_10015938 | 155 |
| 263 | 3300025263 | Ga0209565_1056566 | Ga0209565_10565661 | 155 |
| 264 | 3300025273 | Ga0209673_1000099 | Ga0209673_100009992 | 155 |
| 265 | 3300025273 | Ga0209673_1000839 | Ga0209673_100083940 | 155 |
| 266 | 3300025273 | Ga0209673_1001338 | Ga0209673_100133821 | 155 |
| 267 | 3300025284 | Ga0209130_1000041 | Ga0209130_100004175 | 155 |
| 268 | 3300025284 | Ga0209130_1000456 | Ga0209130_10004567 | 155 |
| 269 | 3300025284 | Ga0209130_1001771 | Ga0209130_10017719 | 155 |
| 270 | 3300025284 | Ga0209130_1003498 | Ga0209130_10034986 | 155 |
| 271 | 3300025291 | Ga0209675_1000054 | Ga0209675_100005492 | 155 |
| 272 | 3300025291 | Ga0209675_1001678 | Ga0209675_10016786 | 155 |
| 273 | 3300025291 | Ga0209675_1008675 | Ga0209675_10086752 | 155 |
| 274 | 3300025291 | Ga0209675_1014145 | Ga0209675_10141453 | 155 |
| 275 | 3300025292 | Ga0209676_1000005 | Ga0209676_10000056 | 155 |
| 276 | 3300025292 | Ga0209676_1000054 | Ga0209676_1000054293 | 155 |
| 277 | 3300025292 | Ga0209676_1002320 | Ga0209676_10023203 | 155 |
| 278 | 3300025292 | Ga0209676_1012219 | Ga0209676_10122195 | 155 |
| 279 | 3300025292 | Ga0209676_1026508 | Ga0209676_10265082 | 155 |
| 280 | 3300025294 | Ga0209025_1001409 | Ga0209025_10014095 | 155 |
| 281 | 3300025294 | Ga0209025_1010783 | Ga0209025_10107833 | 155 |
| 282 | 3300025294 | Ga0209025_1013211 | Ga0209025_10132112 | 155 |
| 283 | 3300025294 | Ga0209025_1014966 | Ga0209025_10149662 | 155 |
| 284 | 3300025295 | Ga0209564_1000239 | Ga0209564_1000239102 | 155 |
| 285 | 3300025295 | Ga0209564_1000662 | Ga0209564_100066250 | 155 |
| 286 | 3300025295 | Ga0209564_1000784 | Ga0209564_10007846 | 155 |
| 287 | 3300025295 | Ga0209564_1000890 | Ga0209564_100089039 | 155 |
| 288 | 3300025297 | Ga0209758_1000027 | Ga0209758_1000027330 | 155 |
| 289 | 3300025297 | Ga0209758_1010200 | Ga0209758_10102003 | 155 |
| 290 | 3300025297 | Ga0209758_1050345 | Ga0209758_10503452 | 155 |
| 291 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000036 | 155 |
| 292 | 3300025298 | Ga0209050_1000007 | Ga0209050_10000071092 | 155 |
| 293 | 3300025298 | Ga0209050_1000954 | Ga0209050_10009547 | 155 |
| 294 | 3300025298 | Ga0209050_1004569 | Ga0209050_100456910 | 155 |
| 295 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000016 | 155 |
| 296 | 3300025299 | Ga0209256_1000081 | Ga0209256_1000081179 | 155 |
| 297 | 3300025299 | Ga0209256_1024131 | Ga0209256_10241312 | 155 |
| 298 | 3300025299 | Ga0209256_1059446 | Ga0209256_10594461 | 155 |
| 299 | 3300025302 | Ga0207426_1000027 | Ga0207426_1000027295 | 155 |
| 300 | 3300025302 | Ga0207426_1000061 | Ga0207426_1000061166 | 155 |
| 301 | 3300025302 | Ga0207426_1003593 | Ga0207426_10035936 | 155 |
| 302 | 3300025302 | Ga0207426_1004649 | Ga0207426_10046493 | 155 |
| 303 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000036 | 155 |
| 304 | 3300025303 | Ga0209051_1000009 | Ga0209051_10000096 | 155 |
| 305 | 3300025303 | Ga0209051_1000619 | Ga0209051_100061934 | 155 |
| 306 | 3300025303 | Ga0209051_1005714 | Ga0209051_10057143 | 155 |
| 307 | 3300025303 | Ga0209051_1019880 | Ga0209051_10198805 | 155 |
| 308 | 3300025304 | Ga0209257_1000018 | Ga0209257_10000186 | 155 |
| 309 | 3300025304 | Ga0209257_1000873 | Ga0209257_100087332 | 155 |
| 310 | 3300025304 | Ga0209257_1007556 | Ga0209257_10075566 | 155 |
| 311 | 3300025304 | Ga0209257_1007934 | Ga0209257_10079344 | 155 |
| 312 | 3300025728 | Ga0207655_1001368 | Ga0207655_10013683 | 155 |
| 313 | 3300025903 | Ga0207680_10417892 | Ga0207680_104178922 | 155 |
| 314 | 3300025904 | Ga0207647_10254573 | Ga0207647_102545732 | 155 |
| 315 | 3300025913 | Ga0207695_10125685 | Ga0207695_101256853 | 155 |
| 316 | 3300025913 | Ga0207695_10630993 | Ga0207695_106309932 | 155 |
| 317 | 3300025917 | Ga0207660_10038245 | Ga0207660_100382451 | 155 |
| 318 | 3300025917 | Ga0207660_10311643 | Ga0207660_103116432 | 155 |
| 319 | 3300025924 | Ga0207694_10197807 | Ga0207694_101978073 | 155 |
| 320 | 3300025927 | Ga0207687_10043205 | Ga0207687_100432054 | 155 |
| 321 | 3300025929 | Ga0207664_11081393 | Ga0207664_110813931 | 155 |
| 322 | 3300025932 | Ga0207690_10014545 | Ga0207690_100145455 | 155 |
| 323 | 3300025933 | Ga0207706_10017147 | Ga0207706_100171473 | 155 |
| 324 | 3300025933 | Ga0207706_10918481 | Ga0207706_109184811 | 155 |
| 325 | 3300025935 | Ga0207709_10000230 | Ga0207709_1000023071 | 155 |
| 326 | 3300025938 | Ga0207704_10162483 | Ga0207704_101624831 | 155 |
| 327 | 3300025938 | Ga0207704_11228983 | Ga0207704_112289831 | 155 |
| 328 | 3300025940 | Ga0207691_10151133 | Ga0207691_101511332 | 155 |
| 329 | 3300025941 | Ga0207711_10463975 | Ga0207711_104639752 | 155 |
| 330 | 3300025942 | Ga0207689_10285070 | Ga0207689_102850702 | 155 |
| 331 | 3300025945 | Ga0207679_10008899 | Ga0207679_100088993 | 155 |
| 332 | 3300025949 | Ga0207667_10088447 | Ga0207667_100884473 | 155 |
| 333 | 3300025949 | Ga0207667_10224669 | Ga0207667_102246692 | 155 |
| 334 | 3300025949 | Ga0207667_10479044 | Ga0207667_104790443 | 155 |
| 335 | 3300025949 | Ga0207667_10663985 | Ga0207667_106639852 | 155 |
| 336 | 3300025981 | Ga0207640_10315862 | Ga0207640_103158622 | 155 |
| 337 | 3300026023 | Ga0207677_10072405 | Ga0207677_100724053 | 155 |
| 338 | 3300026023 | Ga0207677_10196868 | Ga0207677_101968683 | 155 |
| 339 | 3300026041 | Ga0207639_10350464 | Ga0207639_103504642 | 155 |
| 340 | 3300026078 | Ga0207702_10541109 | Ga0207702_105411093 | 155 |
| 341 | 3300026088 | Ga0207641_10151496 | Ga0207641_101514963 | 155 |
| 342 | 3300026116 | Ga0207674_10250557 | Ga0207674_102505573 | 155 |
| 343 | 3300026116 | Ga0207674_10353949 | Ga0207674_103539491 | 155 |
| 344 | 3300026121 | Ga0207683_10070721 | Ga0207683_100707212 | 155 |
| 345 | 3300026142 | Ga0207698_10099871 | Ga0207698_100998712 | 155 |
| 346 | 3300027666 | Ga0209282_1000133 | Ga0209282_100013343 | 155 |
| 347 | 3300027866 | Ga0209813_10164718 | Ga0209813_101647182 | 155 |
| 348 | 3300027876 | Ga0209974_10014445 | Ga0209974_100144455 | 155 |
| 349 | 3300027907 | Ga0207428_10248181 | Ga0207428_102481812 | 155 |
| 350 | 3300028379 | Ga0268266_10014251 | Ga0268266_100142516 | 155 |
| 351 | 3300028380 | Ga0268265_10042673 | Ga0268265_100426732 | 155 |
| 352 | 3300028794 | Ga0307515_10001286 | Ga0307515_100012867 | 155 |
| 353 | 3300028794 | Ga0307515_10172925 | Ga0307515_101729253 | 155 |
| 354 | 3300030733 | Ga0314311_1134334 | Ga0314311_11343342 | 155 |
| 355 | 3300030745 | Ga0316182_1071470 | Ga0316182_10714702 | 155 |
| 356 | 3300031456 | Ga0307513_10000012 | Ga0307513_10000012149 | 155 |
| 357 | 3300031456 | Ga0307513_10000285 | Ga0307513_1000028521 | 155 |
| 358 | 3300031456 | Ga0307513_10131485 | Ga0307513_101314852 | 155 |
| 359 | 3300031548 | Ga0307408_100000079 | Ga0307408_10000007983 | 155 |
| 360 | 3300031548 | Ga0307408_100022449 | Ga0307408_1000224495 | 155 |
| 361 | 3300031548 | Ga0307408_100037053 | Ga0307408_1000370533 | 155 |
| 362 | 3300031548 | Ga0307408_100060612 | Ga0307408_1000606123 | 155 |
| 363 | 3300031548 | Ga0307408_100101444 | Ga0307408_1001014443 | 155 |
| 364 | 3300031548 | Ga0307408_100344212 | Ga0307408_1003442123 | 155 |
| 365 | 3300031548 | Ga0307408_100515197 | Ga0307408_1005151972 | 155 |
| 366 | 3300031711 | Ga0265314_10147622 | Ga0265314_101476223 | 155 |
| 367 | 3300031730 | Ga0307516_10004265 | Ga0307516_1000426517 | 155 |
| 368 | 3300031731 | Ga0307405_10328907 | Ga0307405_103289072 | 155 |
| 369 | 3300031731 | Ga0307405_10893644 | Ga0307405_108936441 | 155 |
| 370 | 3300031901 | Ga0307406_10000927 | Ga0307406_1000092717 | 155 |
| 371 | 3300031901 | Ga0307406_10009555 | Ga0307406_100095555 | 155 |
| 372 | 3300031901 | Ga0307406_10074343 | Ga0307406_100743433 | 155 |
| 373 | 3300031901 | Ga0307406_10534627 | Ga0307406_105346271 | 155 |
| 374 | 3300031911 | Ga0307412_10035354 | Ga0307412_100353543 | 155 |
| 375 | 3300031911 | Ga0307412_10045864 | Ga0307412_100458642 | 155 |
| 376 | 3300031911 | Ga0307412_10058510 | Ga0307412_100585103 | 155 |
| 377 | 3300031911 | Ga0307412_10096532 | Ga0307412_100965322 | 155 |
| 378 | 3300031911 | Ga0307412_10119539 | Ga0307412_101195393 | 155 |
| 379 | 3300031911 | Ga0307412_10143813 | Ga0307412_101438132 | 155 |
| 380 | 3300031911 | Ga0307412_10641112 | Ga0307412_106411122 | 155 |
| 381 | 3300032002 | Ga0307416_100089287 | Ga0307416_1000892872 | 155 |
| 382 | 3300032002 | Ga0307416_100200115 | Ga0307416_1002001152 | 155 |
| 383 | 3300032002 | Ga0307416_101286618 | Ga0307416_1012866181 | 155 |
| 384 | 3300032002 | Ga0307416_101651287 | Ga0307416_1016512871 | 155 |
| 385 | 3300032004 | Ga0307414_10411971 | Ga0307414_104119713 | 155 |
| 386 | 3300032004 | Ga0307414_11509865 | Ga0307414_115098652 | 155 |
| 387 | 3300032005 | Ga0307411_10414179 | Ga0307411_104141791 | 155 |
| 388 | 3300037466 | Ga0395898_0174190 | Ga0395898_0174190_1049_1516 | 155 |
| 389 | 3300037471 | Ga0395905_0037501 | Ga0395905_0037501_1961_2428 | 155 |
| 390 | 3300038443 | Ga0395901_0127946 | Ga0395901_0127946_482_949 | 155 |
| 391 | 3300039447 | Ga0436361_0268202 | Ga0436361_0268202_17539_18036 | 155 |
| 392 | 3300041404 | Ga0439436_0001379 | Ga0439436_0001379_2216_2773 | 155 |
| 393 | 3300041404 | Ga0439436_0006229 | Ga0439436_0006229_1072_1635 | 155 |
| 394 | 3300041406 | Ga0439439_0005369 | Ga0439439_0005369_815_1372 | 155 |
| 395 | 3300041406 | Ga0439439_0009655 | Ga0439439_0009655_1282_1845 | 155 |
| 396 | 3300041410 | Ga0439461_0050938 | Ga0439461_0050938_335_811 | 155 |
| 397 | 3300041413 | Ga0439465_0000697 | Ga0439465_0000697_6995_7552 | 155 |
| 398 | 3300041452 | Ga0451793_1463256 | Ga0451793_1463256_11_487 | 155 |
| 399 | 3300041486 | Ga0451807_0067919 | Ga0451807_0067919_207_698 | 155 |
| 400 | 3300041498 | Ga0451841_1340995 | Ga0451841_1340995_137_613 | 155 |
| 401 | 3300041512 | Ga0451853_3547166 | Ga0451853_3547166_144_635 | 155 |
| 402 | 3300041997 | Ga0439431_0000916 | Ga0439431_0000916_3783_4340 | 155 |
| 403 | 3300041997 | Ga0439431_0007247 | Ga0439431_0007247_1335_1811 | 155 |
| 404 | 3300041999 | Ga0439433_0000360 | Ga0439433_0000360_1998_2555 | 155 |
| 405 | 3300042002 | Ga0439442_009609 | Ga0439442_009609_256_732 | 155 |
| 406 | 3300042002 | Ga0439442_016402 | Ga0439442_016402_1009_1485 | 155 |
| 407 | 3300042004 | Ga0439445_0000835 | Ga0439445_0000835_1628_2185 | 155 |
| 408 | 3300042006 | Ga0439432_003052 | Ga0439432_003052_2923_3480 | 155 |
| 409 | 3300042006 | Ga0439432_012101 | Ga0439432_012101_1282_1758 | 155 |
| 410 | 3300042007 | Ga0439449_0002084 | Ga0439449_0002084_6402_6959 | 155 |
| 411 | 3300042007 | Ga0439449_0003898 | Ga0439449_0003898_3790_4266 | 155 |
| 412 | 3300042007 | Ga0439449_0017753 | Ga0439449_0017753_1057_1620 | 155 |
| 413 | 3300042010 | Ga0439452_006051 | Ga0439452_006051_1284_1841 | 155 |
| 414 | 3300042010 | Ga0439452_022075 | Ga0439452_022075_943_1419 | 155 |
| 415 | 3300042014 | Ga0439457_008504 | Ga0439457_008504_825_1382 | 155 |
| 416 | 3300042015 | Ga0439462_0004954 | Ga0439462_0004954_362_871 | 155 |
| 417 | 3300042015 | Ga0439462_0008200 | Ga0439462_0008200_824_1381 | 155 |
| 418 | 3300042115 | Ga0450911_014976 | Ga0450911_014976_316_792 | 155 |
| 419 | 3300042122 | Ga0450920_022302 | Ga0450920_022302_455_931 | 155 |
| 420 | 3300042126 | Ga0450888_020205 | Ga0450888_020205_213_701 | 155 |
| 421 | 3300042134 | Ga0450898_007204 | Ga0450898_007204_637_1113 | 155 |
| 422 | 3300042145 | Ga0450906_002698 | Ga0450906_002698_256_732 | 155 |
| 423 | 3300042145 | Ga0450906_011020 | Ga0450906_011020_795_1271 | 155 |
| 424 | 3300042146 | Ga0450907_034411 | Ga0450907_034411_29_505 | 155 |
| 425 | 3300042147 | Ga0450910_015188 | Ga0450910_015188_128_691 | 155 |
| 426 | 3300042185 | Ga0450909_006505 | Ga0450909_006505_18_581 | 155 |
| 427 | 3300042435 | Ga0439434_0000980 | Ga0439434_0000980_74_550 | 155 |
| 428 | 3300042435 | Ga0439434_0008390 | Ga0439434_0008390_1441_1917 | 155 |
| 429 | 3300042435 | Ga0439434_0010643 | Ga0439434_0010643_1882_2358 | 155 |
| 430 | 3300042435 | Ga0439434_0092514 | Ga0439434_0092514_110_583 | 155 |
| 431 | 3300042532 | Ga0450893_0008574 | Ga0450893_0008574_1060_1548 | 155 |
| 432 | 3300046453 | Ga0495627_008497 | Ga0495627_008497_2816_3292 | 155 |
| 433 | 3300046453 | Ga0495627_088232 | Ga0495627_088232_47_523 | 155 |
| 434 | 3300046512 | Ga0495610_0018746 | Ga0495610_0018746_1538_2014 | 155 |
| 435 | 3300046513 | Ga0495616_0007518 | Ga0495616_0007518_1977_2453 | 155 |
| 436 | 3300046518 | Ga0495631_0004184 | Ga0495631_0004184_1948_2424 | 155 |
| 437 | 3300046520 | Ga0495637_0006045 | Ga0495637_0006045_5190_5666 | 155 |
| 438 | 3300046530 | Ga0495654_0046196 | Ga0495654_0046196_802_1278 | 155 |
| 439 | 3300046530 | Ga0495654_0062093 | Ga0495654_0062093_751_1227 | 155 |
| 440 | 3300046530 | Ga0495654_0182136 | Ga0495654_0182136_211_687 | 155 |
| 441 | 3300046538 | Ga0495609_0050548 | Ga0495609_0050548_509_985 | 155 |
| 442 | 3300046539 | Ga0495621_0010000 | Ga0495621_0010000_2333_2809 | 155 |
| 443 | 3300046539 | Ga0495621_0011585 | Ga0495621_0011585_867_1343 | 155 |
| 444 | 3300046542 | Ga0495597_0004057 | Ga0495597_0004057_1052_1549 | 155 |
| 445 | 3300046615 | Ga0495656_0003255 | Ga0495656_0003255_2494_2970 | 155 |
| 446 | 3300046616 | Ga0495668_0063099 | Ga0495668_0063099_1277_1753 | 155 |
| 447 | 3300046616 | Ga0495668_0118188 | Ga0495668_0118188_343_819 | 155 |
| 448 | 3300046660 | Ga0495625_0000896 | Ga0495625_0000896_34529_35005 | 155 |
| 449 | 3300046660 | Ga0495625_0090482 | Ga0495625_0090482_1145_1621 | 155 |
| 450 | 3300046660 | Ga0495625_0344619 | Ga0495625_0344619_214_690 | 155 |
| 451 | 3300046665 | Ga0495661_0140755 | Ga0495661_0140755_746_1222 | 155 |
| 452 | 3300046674 | Ga0495588_0033592 | Ga0495588_0033592_2039_2515 | 155 |
| 453 | 3300046674 | Ga0495588_0252663 | Ga0495588_0252663_20_496 | 155 |
| 454 | 3300046691 | Ga0495670_0267388 | Ga0495670_0267388_154_630 | 155 |
| 455 | 3300046692 | Ga0495671_0009212 | Ga0495671_0009212_3048_3524 | 155 |
| 456 | 3300048919 | Ga0496116_0035499 | Ga0496116_0035499_1350_1826 | 155 |
| 457 | 3300048921 | Ga0496118_0010125 | Ga0496118_0010125_993_1469 | 155 |
| 458 | 3300048921 | Ga0496118_0030038 | Ga0496118_0030038_1720_2196 | 155 |
| 459 | 3300048924 | Ga0496121_0042948 | Ga0496121_0042948_2969_3445 | 155 |
| 460 | 3300048924 | Ga0496121_0197772 | Ga0496121_0197772_185_661 | 155 |
| 461 | 3300048924 | Ga0496121_0506526 | Ga0496121_0506526_59_535 | 155 |
| 462 | 3300048925 | Ga0496122_0003984 | Ga0496122_0003984_15216_15692 | 155 |
| 463 | 3300048925 | Ga0496122_0064753 | Ga0496122_0064753_739_1215 | 155 |
| 464 | 3300048926 | Ga0496123_0000235 | Ga0496123_0000235_19614_20090 | 155 |
| 465 | 3300048926 | Ga0496123_0061997 | Ga0496123_0061997_1194_1670 | 155 |
| 466 | 3300048926 | Ga0496123_0136762 | Ga0496123_0136762_54_530 | 155 |
| 467 | 3300048927 | Ga0496124_0451518 | Ga0496124_0451518_64_540 | 155 |
| 468 | 3300048928 | Ga0496125_0020173 | Ga0496125_0020173_2456_2932 | 155 |
| 469 | 3300048928 | Ga0496125_0091422 | Ga0496125_0091422_1113_1589 | 155 |
| 470 | 3300048928 | Ga0496125_0325321 | Ga0496125_0325321_211_687 | 155 |
| 471 | 3300048929 | Ga0496126_0805841 | Ga0496126_0805841_208_684 | 155 |
| 472 | 3300049705 | Ga0501225_0013794 | Ga0501225_0013794_644_1120 | 155 |
| 473 | 3300049759 | Ga0501262_000153 | Ga0501262_000153_3215_3691 | 155 |
| 474 | 3300049763 | Ga0501266_001605 | Ga0501266_001605_531_1007 | 155 |
| 475 | 3300049766 | Ga0501269_063195 | Ga0501269_063195_27_503 | 155 |
| 476 | 3300050489 | nmdc:mga03683_10250_c1 | nmdc:mga03683_10250_c1_1442_1918 | 155 |
| 477 | 3300050489 | nmdc:mga03683_209216_c1 | nmdc:mga03683_209216_c1_74_565 | 155 |
| 478 | 3300050489 | nmdc:mga03683_224231_c1 | nmdc:mga03683_224231_c1_359_835 | 155 |
| 479 | 3300050489 | nmdc:mga03683_36119_c1 | nmdc:mga03683_36119_c1_828_1304 | 155 |
| 480 | 3300050489 | nmdc:mga03683_406129_c1 | nmdc:mga03683_406129_c1_63_548 | 155 |
| 481 | 3300050489 | nmdc:mga03683_439257_c1 | nmdc:mga03683_439257_c1_35_520 | 155 |
| 482 | 3300050490 | nmdc:mga03n38_10203_c1 | nmdc:mga03n38_10203_c1_651_1394 | 155 |
| 483 | 3300050490 | nmdc:mga03n38_25159_c1 | nmdc:mga03n38_25159_c1_1448_1924 | 155 |
| 484 | 3300050490 | nmdc:mga03n38_25218_c1 | nmdc:mga03n38_25218_c1_249_728 | 155 |
| 485 | 3300050490 | nmdc:mga03n38_369277_c1 | nmdc:mga03n38_369277_c1_171_662 | 155 |
| 486 | 3300050491 | nmdc:mga00v17_21047_c2 | nmdc:mga00v17_21047_c2_1626_2135 | 155 |
| 487 | 3300050491 | nmdc:mga00v17_359062_c1 | nmdc:mga00v17_359062_c1_80_556 | 155 |
| 488 | 3300050491 | nmdc:mga00v17_53639_c1 | nmdc:mga00v17_53639_c1_256_732 | 155 |
| 489 | 3300050492 | nmdc:mga0yw44_28385_c1 | nmdc:mga0yw44_28385_c1_667_1143 | 155 |
| 490 | 3300050492 | nmdc:mga0yw44_58591_c1 | nmdc:mga0yw44_58591_c1_152_643 | 155 |
| 491 | 3300050493 | nmdc:mga0k408_127897_c1 | nmdc:mga0k408_127897_c1_26_502 | 155 |
| 492 | 3300050493 | nmdc:mga0k408_132105_c1 | nmdc:mga0k408_132105_c1_187_663 | 155 |
| 493 | 3300050493 | nmdc:mga0k408_197323_c1 | nmdc:mga0k408_197323_c1_84_575 | 155 |
| 494 | 3300050493 | nmdc:mga0k408_265279_c1 | nmdc:mga0k408_265279_c1_198_674 | 155 |
| 495 | 3300050493 | nmdc:mga0k408_36012_c1 | nmdc:mga0k408_36012_c1_386_862 | 155 |
| 496 | 3300050493 | nmdc:mga0k408_403132_c1 | nmdc:mga0k408_403132_c1_310_792 | 155 |
| 497 | 3300050493 | nmdc:mga0k408_41811_c1 | nmdc:mga0k408_41811_c1_172_648 | 155 |
| 498 | 3300050493 | nmdc:mga0k408_513833_c1 | nmdc:mga0k408_513833_c1_50_526 | 155 |
| 499 | 3300050494 | nmdc:mga06z11_277517_c1 | nmdc:mga06z11_277517_c1_86_577 | 155 |
| 500 | 3300050494 | nmdc:mga06z11_738697_c1 | nmdc:mga06z11_738697_c1_29_502 | 155 |
| 501 | 3300050495 | nmdc:mga04h51_139923_c1 | nmdc:mga04h51_139923_c1_88_579 | 155 |
| 502 | 3300050496 | nmdc:mga07m45_100184_c1 | nmdc:mga07m45_100184_c1_1060_1536 | 155 |
| 503 | 3300050496 | nmdc:mga07m45_174148_c1 | nmdc:mga07m45_174148_c1_570_1046 | 155 |
| 504 | 3300050496 | nmdc:mga07m45_1973_c1 | nmdc:mga07m45_1973_c1_8635_9111 | 155 |
| 505 | 3300050496 | nmdc:mga07m45_21686_c1 | nmdc:mga07m45_21686_c1_40_516 | 155 |
| 506 | 3300050496 | nmdc:mga07m45_224527_c1 | nmdc:mga07m45_224527_c1_297_776 | 155 |
| 507 | 3300050496 | nmdc:mga07m45_8907_c1 | nmdc:mga07m45_8907_c1_1180_1656 | 155 |
| 508 | 3300053079 | Ga0500610_0006176 | Ga0500610_0006176_428_904 | 155 |
| 509 | 3300053079 | Ga0500610_0013178 | Ga0500610_0013178_881_1357 | 155 |
| 510 | 3300053087 | Ga0500643_055693 | Ga0500643_055693_214_690 | 155 |
| 511 | 3300053088 | Ga0500644_0002098 | Ga0500644_0002098_688_1164 | 155 |
| 512 | 3300053093 | Ga0500651_0027085 | Ga0500651_0027085_757_1269 | 155 |
| 513 | 3300053096 | Ga0500641_0061010 | Ga0500641_0061010_839_1315 | 155 |
| 514 | 3300053098 | Ga0500650_0093654 | Ga0500650_0093654_307_783 | 155 |
| 515 | 3300053111 | Ga0500572_020849 | Ga0500572_020849_570_1046 | 155 |
| 516 | 3300053116 | Ga0500592_012805 | Ga0500592_012805_206_682 | 155 |
| 517 | 3300053117 | Ga0500593_003907 | Ga0500593_003907_1243_1719 | 155 |
| 518 | 3300053117 | Ga0500593_008376 | Ga0500593_008376_2274_2750 | 155 |
| 519 | 3300053118 | Ga0500594_0003689 | Ga0500594_0003689_2755_3231 | 155 |
| 520 | 3300053121 | Ga0500607_004990 | Ga0500607_004990_2343_2819 | 155 |
| 521 | 3300053122 | Ga0500608_004926 | Ga0500608_004926_3471_3947 | 155 |
| 522 | 3300053122 | Ga0500608_043313 | Ga0500608_043313_224_700 | 155 |
| 523 | 3300053125 | Ga0500618_020979 | Ga0500618_020979_695_1171 | 155 |
| 524 | 3300053133 | Ga0500655_000523 | Ga0500655_000523_2071_2547 | 155 |
| 525 | 3300053134 | Ga0500658_0001924 | Ga0500658_0001924_4735_5211 | 155 |
| 526 | 3300053136 | Ga0500559_0005307 | Ga0500559_0005307_1727_2203 | 155 |
| 527 | 3300053139 | Ga0500568_0006491 | Ga0500568_0006491_1391_1867 | 155 |
| 528 | 3300053153 | Ga0500616_0143992 | Ga0500616_0143992_68_544 | 155 |
| 529 | 3300053153 | Ga0500616_0164096 | Ga0500616_0164096_213_689 | 155 |
| 530 | 3300053156 | Ga0500622_0155426 | Ga0500622_0155426_108_584 | 155 |
| 531 | 3300053158 | Ga0500627_0006722 | Ga0500627_0006722_2881_3357 | 155 |
| 532 | 3300053158 | Ga0500627_0225857 | Ga0500627_0225857_298_774 | 155 |
| 533 | 3300053161 | Ga0500634_0006145 | Ga0500634_0006145_2034_2510 | 155 |
| 534 | 3300053162 | Ga0500638_003903 | Ga0500638_003903_998_1474 | 155 |
| 535 | 3300053729 | Ga0500625_070542 | Ga0500625_070542_111_587 | 155 |
| 536 | 3300053730 | Ga0500645_002856 | Ga0500645_002856_5588_6070 | 155 |
| 537 | 3300053730 | Ga0500645_015872 | Ga0500645_015872_1663_2142 | 155 |
| 538 | 3300053730 | Ga0500645_163810 | Ga0500645_163810_34_510 | 155 |
| 539 | 3300005367 | Ga0070667_100068522 | Ga0070667_1000685222 | 156 |
| 540 | 3300005548 | Ga0070665_101285026 | Ga0070665_1012850261 | 156 |
| 541 | 3300009177 | Ga0105248_11123506 | Ga0105248_111235061 | 156 |
| 542 | 3300013104 | Ga0157370_10367712 | Ga0157370_103677122 | 156 |
| 543 | 3300013306 | Ga0163162_10165510 | Ga0163162_101655102 | 156 |
| 544 | 3300013306 | Ga0163162_10707785 | Ga0163162_107077852 | 156 |
| 545 | 3300013308 | Ga0157375_11140407 | Ga0157375_111404071 | 156 |
| 546 | 3300014968 | Ga0157379_10423334 | Ga0157379_104233342 | 156 |
| 547 | 3300015261 | Ga0182006_1147247 | Ga0182006_11472471 | 156 |
| 548 | 3300015265 | Ga0182005_1140321 | Ga0182005_11403212 | 156 |
| 549 | 3300017792 | Ga0163161_10017700 | Ga0163161_100177003 | 156 |
| 550 | 3300025940 | Ga0207691_10826383 | Ga0207691_108263832 | 156 |
| 551 | 3300025986 | Ga0207658_10060529 | Ga0207658_100605293 | 156 |
| 552 | 3300026121 | Ga0207683_10221142 | Ga0207683_102211422 | 156 |
| 553 | 3300028379 | Ga0268266_11102064 | Ga0268266_111020641 | 156 |
| 554 | 3300031251 | Ga0265327_10002745 | Ga0265327_100027455 | 156 |
| 555 | 3300031616 | Ga0307508_10176342 | Ga0307508_101763423 | 156 |
| 556 | 3300037471 | Ga0395905_0083297 | Ga0395905_0083297_423_908 | 156 |
| 557 | 3300038443 | Ga0395901_0131188 | Ga0395901_0131188_1207_1683 | 156 |
| 558 | 3300038443 | Ga0395901_0373732 | Ga0395901_0373732_962_1447 | 156 |
| 559 | 3300039437 | Ga0436365_1868038 | Ga0436365_1868038_51_536 | 156 |
| 560 | 3300041494 | Ga0451837_1700856 | Ga0451837_1700856_210_689 | 156 |
| 561 | 3300044693 | Ga0466961_0036663 | Ga0466961_0036663_2332_2817 | 156 |
| 562 | 3300044706 | Ga0466964_0040101 | Ga0466964_0040101_1055_1540 | 156 |
| 563 | 3300044719 | Ga0466971_0077704 | Ga0466971_0077704_861_1346 | 156 |
| 564 | 3300046462 | Ga0495651_0145428 | Ga0495651_0145428_806_1285 | 156 |
| 565 | 3300046475 | Ga0495639_0022262 | Ga0495639_0022262_437_916 | 156 |
| 566 | 3300046675 | Ga0495657_0060967 | Ga0495657_0060967_1617_2096 | 156 |
| 567 | 3300046678 | Ga0495599_0187568 | Ga0495599_0187568_782_1261 | 156 |
| 568 | 3300046809 | Ga0495600_0188319 | Ga0495600_0188319_697_1176 | 156 |
| 569 | 3300048089 | Ga0495614_0310627 | Ga0495614_0310627_234_713 | 156 |
| 570 | 3300048903 | Ga0496100_0007340 | Ga0496100_0007340_1186_1665 | 156 |
| 571 | 3300048904 | Ga0496101_0018273 | Ga0496101_0018273_1189_1668 | 156 |
| 572 | 3300048905 | Ga0496102_0042793 | Ga0496102_0042793_1209_1688 | 156 |
| 573 | 3300048907 | Ga0496104_0020850 | Ga0496104_0020850_1303_1782 | 156 |
| 574 | 3300048907 | Ga0496104_0635886 | Ga0496104_0635886_218_697 | 156 |
| 575 | 3300048909 | Ga0496106_0020141 | Ga0496106_0020141_1693_2172 | 156 |
| 576 | 3300048910 | Ga0496107_0452486 | Ga0496107_0452486_234_713 | 156 |
| 577 | 3300048912 | Ga0496109_0130274 | Ga0496109_0130274_145_624 | 156 |
| 578 | 3300048913 | Ga0496110_0035381 | Ga0496110_0035381_704_1255 | 156 |
| 579 | 3300048913 | Ga0496110_0144587 | Ga0496110_0144587_1200_1679 | 156 |
| 580 | 3300048914 | Ga0496111_0029616 | Ga0496111_0029616_692_1171 | 156 |
| 581 | 3300048914 | Ga0496111_0087357 | Ga0496111_0087357_892_1371 | 156 |
| 582 | 3300048916 | Ga0496113_0073271 | Ga0496113_0073271_1240_1719 | 156 |
| 583 | 3300048917 | Ga0496114_0703367 | Ga0496114_0703367_195_677 | 156 |
| 584 | 3300061719 | Ga0466962_0010759 | Ga0466962_0010759_1557_2042 | 156 |
| 585 | 3300003781 | Ga0055536_1003726 | Ga0055536_10037266 | 157 |
| 586 | 3300003792 | Ga0055540_1004580 | Ga0055540_10045804 | 157 |
| 587 | 3300003794 | Ga0055531_10046577 | Ga0055531_100465772 | 157 |
| 588 | 3300005455 | Ga0070663_100007541 | Ga0070663_1000075414 | 157 |
| 589 | 3300005459 | Ga0068867_100000092 | Ga0068867_10000009247 | 157 |
| 590 | 3300005616 | Ga0068852_100168505 | Ga0068852_1001685052 | 157 |
| 591 | 3300006048 | Ga0075363_100187166 | Ga0075363_1001871662 | 157 |
| 592 | 3300006195 | Ga0075366_10011492 | Ga0075366_100114923 | 157 |
| 593 | 3300006195 | Ga0075366_10069431 | Ga0075366_100694313 | 157 |
| 594 | 3300006846 | Ga0075430_100021936 | Ga0075430_1000219362 | 157 |
| 595 | 3300006880 | Ga0075429_100010391 | Ga0075429_1000103915 | 157 |
| 596 | 3300006880 | Ga0075429_100760561 | Ga0075429_1007605612 | 157 |
| 597 | 3300009148 | Ga0105243_10009638 | Ga0105243_100096388 | 157 |
| 598 | 3300009148 | Ga0105243_10009706 | Ga0105243_100097066 | 157 |
| 599 | 3300014745 | Ga0157377_10000163 | Ga0157377_100001638 | 157 |
| 600 | 3300025292 | Ga0209676_1000260 | Ga0209676_100026091 | 157 |
| 601 | 3300025303 | Ga0209051_1000319 | Ga0209051_100031951 | 157 |
| 602 | 3300025304 | Ga0209257_1008583 | Ga0209257_10085832 | 157 |
| 603 | 3300025935 | Ga0207709_10002452 | Ga0207709_100024524 | 157 |
| 604 | 3300025935 | Ga0207709_10022627 | Ga0207709_100226273 | 157 |
| 605 | 3300026067 | Ga0207678_10002368 | Ga0207678_1000236812 | 157 |
| 606 | 3300026089 | Ga0207648_10001232 | Ga0207648_100012328 | 157 |
| 607 | 3300026142 | Ga0207698_10060310 | Ga0207698_100603104 | 157 |
| 608 | 3300028794 | Ga0307515_10001485 | Ga0307515_1000148544 | 157 |
| 609 | 3300031730 | Ga0307516_10000525 | Ga0307516_1000052533 | 157 |
| 610 | 3300031731 | Ga0307405_10265904 | Ga0307405_102659042 | 157 |
| 611 | 3300031731 | Ga0307405_10596852 | Ga0307405_105968522 | 157 |
| 612 | 3300032002 | Ga0307416_100044749 | Ga0307416_1000447491 | 157 |
| 613 | 3300032005 | Ga0307411_11633047 | Ga0307411_116330471 | 157 |
| 614 | 3300034820 | Ga0373959_0042364 | Ga0373959_0042364_171_653 | 157 |
| 615 | 3300037471 | Ga0395905_0022085 | Ga0395905_0022085_3907_4398 | 157 |
| 616 | 3300046530 | Ga0495654_0003435 | Ga0495654_0003435_511_1032 | 157 |
| 617 | 3300049777 | Ga0501281_15192 | Ga0501281_15192_31_516 | 157 |
| 618 | 3300050493 | nmdc:mga0k408_4603_c1 | nmdc:mga0k408_4603_c1_2857_3339 | 157 |
| 619 | 3300050508 | nmdc:mga09592_239398_c1 | nmdc:mga09592_239398_c1_47_532 | 157 |
| 620 | 3300050508 | nmdc:mga09592_5962_c1 | nmdc:mga09592_5962_c1_5096_5581 | 157 |
| 621 | 3300050509 | nmdc:mga0qj67_17296_c1 | nmdc:mga0qj67_17296_c1_4633_5118 | 157 |
| 622 | 3300002704 | JGI25155J39150_1000074 | JGI25155J39150_10000746 | 158 |
| 623 | 3300002705 | JGI25156J39149_1000002 | JGI25156J39149_1000002260 | 158 |
| 624 | 3300002738 | JGI25154J39366_1000010 | JGI25154J39366_100001058 | 158 |
| 625 | 3300002741 | JGI25157J39369_1000001 | JGI25157J39369_1000001281 | 158 |
| 626 | 3300002987 | JGI25159J45721_1017298 | JGI25159J45721_10172981 | 158 |
| 627 | 3300003784 | Ga0055534_1006824 | Ga0055534_10068243 | 158 |
| 628 | 3300003792 | Ga0055540_1073622 | Ga0055540_10736221 | 158 |
| 629 | 3300005539 | Ga0068853_101853500 | Ga0068853_1018535001 | 158 |
| 630 | 3300006946 | Ga0079104_1016127 | Ga0079104_10161272 | 158 |
| 631 | 3300009036 | Ga0105244_10326503 | Ga0105244_103265032 | 158 |
| 632 | 3300009093 | Ga0105240_10027063 | Ga0105240_100270636 | 158 |
| 633 | 3300009176 | Ga0105242_10003000 | Ga0105242_100030003 | 158 |
| 634 | 3300009545 | Ga0105237_10000945 | Ga0105237_100009453 | 158 |
| 635 | 3300009545 | Ga0105237_11003981 | Ga0105237_110039811 | 158 |
| 636 | 3300009551 | Ga0105238_10081095 | Ga0105238_100810953 | 158 |
| 637 | 3300010375 | Ga0105239_10005802 | Ga0105239_100058029 | 158 |
| 638 | 3300011119 | Ga0105246_11602204 | Ga0105246_116022041 | 158 |
| 639 | 3300025206 | Ga0209435_100001 | Ga0209435_1000011038 | 158 |
| 640 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011407 | 158 |
| 641 | 3300025250 | Ga0209026_1000001 | Ga0209026_100000159 | 158 |
| 642 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011038 | 158 |
| 643 | 3300025284 | Ga0209130_1000952 | Ga0209130_100095211 | 158 |
| 644 | 3300025291 | Ga0209675_1000290 | Ga0209675_100029023 | 158 |
| 645 | 3300025292 | Ga0209676_1006861 | Ga0209676_10068612 | 158 |
| 646 | 3300025298 | Ga0209050_1016241 | Ga0209050_10162412 | 158 |
| 647 | 3300025303 | Ga0209051_1019179 | Ga0209051_10191793 | 158 |
| 648 | 3300025304 | Ga0209257_1011066 | Ga0209257_10110663 | 158 |
| 649 | 3300025913 | Ga0207695_10004148 | Ga0207695_100041487 | 158 |
| 650 | 3300025914 | Ga0207671_10123849 | Ga0207671_101238493 | 158 |
| 651 | 3300025924 | Ga0207694_10061134 | Ga0207694_100611342 | 158 |
| 652 | 3300048928 | Ga0496125_0158785 | Ga0496125_0158785_187_669 | 158 |
| 653 | 3300053121 | Ga0500607_216595 | Ga0500607_216595_236_721 | 158 |
| 654 | iso_pu_bacteria | 2643221654 | 2644304803 | 158 |
| 655 | 3300003320 | rootH2_10194452 | rootH2_101944523 | 159 |
| 656 | 3300005367 | Ga0070667_100015538 | Ga0070667_1000155385 | 159 |
| 657 | 3300025986 | Ga0207658_10000754 | Ga0207658_100007546 | 159 |
| 658 | 3300037068 | Ga0373925_0824834 | Ga0373925_0824834_201_689 | 159 |
| 659 | 3300037312 | Ga0395899_0000344 | Ga0395899_0000344_5037_5516 | 159 |
| 660 | 3300037418 | Ga0395900_0109112 | Ga0395900_0109112_679_1158 | 159 |
| 661 | 3300037471 | Ga0395905_0038248 | Ga0395905_0038248_3570_4049 | 159 |
| 662 | 3300044765 | Ga0466970_0059958 | Ga0466970_0059958_444_938 | 159 |
| 663 | 3300044901 | Ga0466960_0054582 | Ga0466960_0054582_507_1001 | 159 |
| 664 | 3300045049 | Ga0466959_0027997 | Ga0466959_0027997_3228_3707 | 159 |
| 665 | 3300050493 | nmdc:mga0k408_289323_c1 | nmdc:mga0k408_289323_c1_102_590 | 159 |
| 666 | 3300005328 | Ga0070676_10691508 | Ga0070676_106915082 | 160 |
| 667 | 3300005459 | Ga0068867_100631262 | Ga0068867_1006312621 | 160 |
| 668 | 3300005577 | Ga0068857_100223425 | Ga0068857_1002234252 | 160 |
| 669 | 3300025907 | Ga0207645_10446080 | Ga0207645_104460802 | 160 |
| 670 | 3300025937 | Ga0207669_10617448 | Ga0207669_106174482 | 160 |
| 671 | 3300028794 | Ga0307515_10046408 | Ga0307515_100464086 | 160 |
| 672 | 3300031507 | Ga0307509_10032544 | Ga0307509_100325443 | 160 |
| 673 | 3300031507 | Ga0307509_10361881 | Ga0307509_103618812 | 160 |
| 674 | 3300044712 | Ga0453684_0029039 | Ga0453684_0029039_3577_4068 | 160 |
| 675 | 3300053096 | Ga0500641_0120501 | Ga0500641_0120501_435_929 | 161 |
| 676 | 3300005334 | Ga0068869_100042886 | Ga0068869_1000428862 | 162 |
| 677 | 3300005344 | Ga0070661_101649227 | Ga0070661_1016492271 | 162 |
| 678 | 3300005354 | Ga0070675_100048670 | Ga0070675_1000486704 | 162 |
| 679 | 3300005355 | Ga0070671_100213572 | Ga0070671_1002135721 | 162 |
| 680 | 3300005364 | Ga0070673_100041500 | Ga0070673_1000415002 | 162 |
| 681 | 3300005459 | Ga0068867_100018629 | Ga0068867_1000186293 | 162 |
| 682 | 3300005543 | Ga0070672_100187081 | Ga0070672_1001870812 | 162 |
| 683 | 3300005563 | Ga0068855_100815857 | Ga0068855_1008158573 | 162 |
| 684 | 3300005844 | Ga0068862_101290497 | Ga0068862_1012904971 | 162 |
| 685 | 3300006195 | Ga0075366_10156187 | Ga0075366_101561872 | 162 |
| 686 | 3300006237 | Ga0097621_101230416 | Ga0097621_1012304162 | 162 |
| 687 | 3300009098 | Ga0105245_10323309 | Ga0105245_103233092 | 162 |
| 688 | 3300014745 | Ga0157377_10234269 | Ga0157377_102342692 | 162 |
| 689 | 3300025907 | Ga0207645_10063693 | Ga0207645_100636932 | 162 |
| 690 | 3300025920 | Ga0207649_11270916 | Ga0207649_112709161 | 162 |
| 691 | 3300025926 | Ga0207659_10168409 | Ga0207659_101684092 | 162 |
| 692 | 3300025927 | Ga0207687_10087175 | Ga0207687_100871752 | 162 |
| 693 | 3300025940 | Ga0207691_10055060 | Ga0207691_100550604 | 162 |
| 694 | 3300025942 | Ga0207689_10025300 | Ga0207689_100253003 | 162 |
| 695 | 3300025960 | Ga0207651_10346029 | Ga0207651_103460292 | 162 |
| 696 | 3300026089 | Ga0207648_10027075 | Ga0207648_100270752 | 162 |
| 697 | 3300030522 | Ga0307512_10068145 | Ga0307512_100681453 | 162 |
| 698 | 3300031456 | Ga0307513_10061834 | Ga0307513_100618342 | 162 |
| 699 | 3300031507 | Ga0307509_10034762 | Ga0307509_100347624 | 162 |
| 700 | 3300031616 | Ga0307508_10000094 | Ga0307508_100000942 | 162 |
| 701 | 3300031616 | Ga0307508_10440890 | Ga0307508_104408903 | 162 |
| 702 | 3300031649 | Ga0307514_10078672 | Ga0307514_100786721 | 162 |
| 703 | 3300032004 | Ga0307414_10405799 | Ga0307414_104057992 | 162 |
| 704 | 3300033180 | Ga0307510_10054117 | Ga0307510_100541174 | 162 |
| 705 | 3300033180 | Ga0307510_10108768 | Ga0307510_101087683 | 162 |
| 706 | 3300035691 | Ga0373931_0315990 | Ga0373931_0315990_427_924 | 162 |
| 707 | 3300050493 | nmdc:mga0k408_52519_c1 | nmdc:mga0k408_52519_c1_765_1262 | 162 |
| 708 | 3300053093 | Ga0500651_0299293 | Ga0500651_0299293_95_592 | 162 |
| 709 | 3300053136 | Ga0500559_0000011 | Ga0500559_0000011_5542_6039 | 162 |
| 710 | 3300053153 | Ga0500616_0309782 | Ga0500616_0309782_132_629 | 162 |
| 711 | 3300053156 | Ga0500622_0055210 | Ga0500622_0055210_63_560 | 162 |
| 712 | iso_pu_bacteria | 2858688981 | 2858693128 | 162 |
| 713 | 3300006353 | Ga0075370_10501225 | Ga0075370_105012251 | 163 |
| 714 | 3300025893 | Ga0207682_10099945 | Ga0207682_100999452 | 163 |
| 715 | 3300026121 | Ga0207683_10071124 | Ga0207683_100711244 | 163 |
| 716 | 3300049571 | Ga0501034_0548052 | Ga0501034_0548052_413_919 | 163 |
| 717 | 3300050496 | nmdc:mga07m45_345113_c1 | nmdc:mga07m45_345113_c1_240_743 | 163 |
| 718 | 3300005333 | Ga0070677_10004622 | Ga0070677_100046225 | 164 |
| 719 | 3300005353 | Ga0070669_100049588 | Ga0070669_1000495883 | 164 |
| 720 | 3300005354 | Ga0070675_100000158 | Ga0070675_10000015821 | 164 |
| 721 | 3300005355 | Ga0070671_100004317 | Ga0070671_1000043176 | 164 |
| 722 | 3300005356 | Ga0070674_100011597 | Ga0070674_1000115973 | 164 |
| 723 | 3300005364 | Ga0070673_100046916 | Ga0070673_1000469162 | 164 |
| 724 | 3300005367 | Ga0070667_100174663 | Ga0070667_1001746631 | 164 |
| 725 | 3300005456 | Ga0070678_100031759 | Ga0070678_1000317593 | 164 |
| 726 | 3300005459 | Ga0068867_100002736 | Ga0068867_1000027365 | 164 |
| 727 | 3300005543 | Ga0070672_100047628 | Ga0070672_1000476284 | 164 |
| 728 | 3300005548 | Ga0070665_100161485 | Ga0070665_1001614853 | 164 |
| 729 | 3300005834 | Ga0068851_10092729 | Ga0068851_100927292 | 164 |
| 730 | 3300013308 | Ga0157375_10298060 | Ga0157375_102980602 | 164 |
| 731 | 3300014969 | Ga0157376_10335114 | Ga0157376_103351143 | 164 |
| 732 | 3300025315 | Ga0207697_10108593 | Ga0207697_101085932 | 164 |
| 733 | 3300025321 | Ga0207656_10032769 | Ga0207656_100327693 | 164 |
| 734 | 3300025893 | Ga0207682_10001652 | Ga0207682_100016526 | 164 |
| 735 | 3300025901 | Ga0207688_10038678 | Ga0207688_100386783 | 164 |
| 736 | 3300025909 | Ga0207705_10299096 | Ga0207705_102990963 | 164 |
| 737 | 3300025923 | Ga0207681_10014932 | Ga0207681_100149325 | 164 |
| 738 | 3300025925 | Ga0207650_10001711 | Ga0207650_1000171111 | 164 |
| 739 | 3300025926 | Ga0207659_10001143 | Ga0207659_100011439 | 164 |
| 740 | 3300025931 | Ga0207644_10003362 | Ga0207644_100033627 | 164 |
| 741 | 3300025937 | Ga0207669_10003638 | Ga0207669_100036386 | 164 |
| 742 | 3300025940 | Ga0207691_10056335 | Ga0207691_100563354 | 164 |
| 743 | 3300025960 | Ga0207651_10008073 | Ga0207651_100080737 | 164 |
| 744 | 3300025986 | Ga0207658_10178315 | Ga0207658_101783153 | 164 |
| 745 | 3300026089 | Ga0207648_10005724 | Ga0207648_1000572411 | 164 |
| 746 | 3300026121 | Ga0207683_10014615 | Ga0207683_100146153 | 164 |
| 747 | 3300028379 | Ga0268266_10487016 | Ga0268266_104870162 | 164 |
| 748 | 3300053139 | Ga0500568_0306157 | Ga0500568_0306157_12_515 | 164 |
| 749 | 3300031507 | Ga0307509_10061068 | Ga0307509_100610682 | 165 |
| 750 | 3300033179 | Ga0307507_10096639 | Ga0307507_100966392 | 165 |
| 751 | 3300014326 | Ga0157380_10747942 | Ga0157380_107479423 | 166 |
| 752 | 3300031730 | Ga0307516_10022750 | Ga0307516_100227506 | 166 |
| 753 | 3300031730 | Ga0307516_10458109 | Ga0307516_104581092 | 166 |
| 754 | 3300048909 | Ga0496106_0134694 | Ga0496106_0134694_442_951 | 166 |
| 755 | 3300048924 | Ga0496121_0190509 | Ga0496121_0190509_941_1450 | 166 |
| 756 | 3300053086 | Ga0500578_0039951 | Ga0500578_0039951_1994_2503 | 166 |
| 757 | 3300053730 | Ga0500645_017528 | Ga0500645_017528_1361_1870 | 166 |
| 758 | 3300006195 | Ga0075366_10287610 | Ga0075366_102876102 | 167 |
| 759 | 3300001979 | JGI24740J21852_10000319 | JGI24740J21852_100003195 | 169 |
| 760 | 3300003751 | Ga0055538_1011084 | Ga0055538_10110841 | 169 |
| 761 | 3300003756 | Ga0055533_1002174 | Ga0055533_10021743 | 169 |
| 762 | 3300003762 | Ga0055542_1001189 | Ga0055542_10011897 | 169 |
| 763 | 3300003841 | Ga0055541_1000208 | Ga0055541_100020818 | 169 |
| 764 | 3300025224 | Ga0209784_100539 | Ga0209784_1005391 | 169 |
| 765 | 3300025225 | Ga0209566_100970 | Ga0209566_1009705 | 169 |
| 766 | 3300025226 | Ga0209674_100229 | Ga0209674_1002294 | 169 |
| 767 | 3300025230 | Ga0209563_106635 | Ga0209563_1066352 | 169 |
| 768 | 3300025246 | Ga0209646_1000059 | Ga0209646_100005986 | 169 |
| 769 | 3300025250 | Ga0209026_1008832 | Ga0209026_10088322 | 169 |
| 770 | 3300025253 | Ga0209677_102838 | Ga0209677_1028383 | 169 |
| 771 | 3300025254 | Ga0209148_1000021 | Ga0209148_1000021213 | 169 |
| 772 | 3300025256 | Ga0209759_1002389 | Ga0209759_10023895 | 169 |
| 773 | 3300037471 | Ga0395905_0158898 | Ga0395905_0158898_1120_1629 | 169 |
| 774 | 3300044666 | Ga0466977_0153091 | Ga0466977_0153091_829_1359 | 169 |
| 775 | 3300044671 | Ga0466978_0022614 | Ga0466978_0022614_2261_2791 | 169 |
| 776 | 3300044683 | Ga0466965_0006416 | Ga0466965_0006416_2448_2978 | 169 |
| 777 | 3300044693 | Ga0466961_0004849 | Ga0466961_0004849_4863_5393 | 169 |
| 778 | 3300044706 | Ga0466964_0006122 | Ga0466964_0006122_2571_3101 | 169 |
| 779 | 3300044735 | Ga0466968_0005280 | Ga0466968_0005280_3079_3609 | 169 |
| 780 | 3300044765 | Ga0466970_0006124 | Ga0466970_0006124_2963_3493 | 169 |
| 781 | 3300045049 | Ga0466959_0008819 | Ga0466959_0008819_4131_4661 | 169 |
| 782 | 3300045976 | Ga0466967_0009266 | Ga0466967_0009266_4112_4642 | 169 |
| 783 | 3300061719 | Ga0466962_0006446 | Ga0466962_0006446_4050_4580 | 169 |
| 784 | iso_pu_bacteria | 2596583598 | 2597028588 | 169 |
| 785 | iso_pu_bacteria | 2599185178 | 2599445274 | 169 |
| 786 | iso_pu_bacteria | 2900577576 | 2900580230 | 169 |
| 787 | 3300005331 | Ga0070670_100587130 | Ga0070670_1005871302 | 171 |
| 788 | 3300005459 | Ga0068867_100003562 | Ga0068867_1000035624 | 171 |
| 789 | 3300013297 | Ga0157378_10298572 | Ga0157378_102985723 | 171 |
| 790 | 3300025907 | Ga0207645_10055100 | Ga0207645_100551004 | 171 |
| 791 | 3300026089 | Ga0207648_10038520 | Ga0207648_100385204 | 171 |
| 792 | 3300026089 | Ga0207648_10271507 | Ga0207648_102715072 | 171 |
| 793 | 3300026142 | Ga0207698_10326422 | Ga0207698_103264223 | 171 |
| 794 | 3300001915 | JGI24741J21665_1001445 | JGI24741J21665_10014454 | 173 |
| 795 | 3300001979 | JGI24740J21852_10007091 | JGI24740J21852_100070915 | 173 |
| 796 | 3300003751 | Ga0055538_1001079 | Ga0055538_10010794 | 173 |
| 797 | 3300003752 | Ga0055539_1000123 | Ga0055539_100012334 | 173 |
| 798 | 3300003756 | Ga0055533_1002613 | Ga0055533_10026133 | 173 |
| 799 | 3300003756 | Ga0055533_1003314 | Ga0055533_10033143 | 173 |
| 800 | 3300003758 | Ga0055532_1000002 | Ga0055532_10000024 | 173 |
| 801 | 3300003758 | Ga0055532_1000029 | Ga0055532_100002951 | 173 |
| 802 | 3300003759 | Ga0055525_1000345 | Ga0055525_100034523 | 173 |
| 803 | 3300003763 | Ga0055529_1000062 | Ga0055529_100006220 | 173 |
| 804 | 3300003841 | Ga0055541_1001170 | Ga0055541_10011705 | 173 |
| 805 | 3300003841 | Ga0055541_1018967 | Ga0055541_10189671 | 173 |
| 806 | 3300003841 | Ga0055541_1018975 | Ga0055541_10189751 | 173 |
| 807 | 3300005344 | Ga0070661_100001595 | Ga0070661_10000159510 | 173 |
| 808 | 3300005455 | Ga0070663_100000011 | Ga0070663_100000011103 | 173 |
| 809 | 3300005564 | Ga0070664_100000008 | Ga0070664_10000000847 | 173 |
| 810 | 3300005577 | Ga0068857_100002038 | Ga0068857_1000020387 | 173 |
| 811 | 3300005578 | Ga0068854_100000052 | Ga0068854_100000052103 | 173 |
| 812 | 3300005614 | Ga0068856_100000009 | Ga0068856_10000000980 | 173 |
| 813 | 3300009093 | Ga0105240_10010244 | Ga0105240_100102446 | 173 |
| 814 | 3300013100 | Ga0157373_10010823 | Ga0157373_100108235 | 173 |
| 815 | 3300013102 | Ga0157371_10000068 | Ga0157371_1000006884 | 173 |
| 816 | 3300013104 | Ga0157370_10010316 | Ga0157370_100103165 | 173 |
| 817 | 3300013307 | Ga0157372_10000271 | Ga0157372_1000027155 | 173 |
| 818 | 3300015261 | Ga0182006_1012267 | Ga0182006_10122674 | 173 |
| 819 | 3300020077 | Ga0206351_10253009 | Ga0206351_102530094 | 173 |
| 820 | 3300020080 | Ga0206350_10481412 | Ga0206350_104814122 | 173 |
| 821 | 3300020610 | Ga0154015_1103548 | Ga0154015_11035485 | 173 |
| 822 | 3300025224 | Ga0209784_100003 | Ga0209784_100003874 | 173 |
| 823 | 3300025224 | Ga0209784_100482 | Ga0209784_1004827 | 173 |
| 824 | 3300025224 | Ga0209784_101093 | Ga0209784_1010933 | 173 |
| 825 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021828 | 173 |
| 826 | 3300025225 | Ga0209566_111096 | Ga0209566_1110962 | 173 |
| 827 | 3300025225 | Ga0209566_111097 | Ga0209566_1110972 | 173 |
| 828 | 3300025226 | Ga0209674_100008 | Ga0209674_100008358 | 173 |
| 829 | 3300025226 | Ga0209674_101558 | Ga0209674_1015583 | 173 |
| 830 | 3300025228 | Ga0209672_100052 | Ga0209672_1000522 | 173 |
| 831 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021537 | 173 |
| 832 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041245 | 173 |
| 833 | 3300025230 | Ga0209563_111006 | Ga0209563_1110061 | 173 |
| 834 | 3300025230 | Ga0209563_114368 | Ga0209563_1143681 | 173 |
| 835 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021537 | 173 |
| 836 | 3300025253 | Ga0209677_100009 | Ga0209677_100009388 | 173 |
| 837 | 3300025256 | Ga0209759_1003853 | Ga0209759_10038534 | 173 |
| 838 | 3300025256 | Ga0209759_1005426 | Ga0209759_10054263 | 173 |
| 839 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021124 | 173 |
| 840 | 3300025913 | Ga0207695_10001909 | Ga0207695_100019096 | 173 |
| 841 | 3300025920 | Ga0207649_10001269 | Ga0207649_100012695 | 173 |
| 842 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001130 | 173 |
| 843 | 3300025981 | Ga0207640_10000035 | Ga0207640_100000355 | 173 |
| 844 | 3300026067 | Ga0207678_10000001 | Ga0207678_10000001303 | 173 |
| 845 | 3300026078 | Ga0207702_10008078 | Ga0207702_100080785 | 173 |
| 846 | 3300026116 | Ga0207674_10012396 | Ga0207674_100123964 | 173 |
| 847 | 3300037312 | Ga0395899_0079887 | Ga0395899_0079887_1199_1720 | 173 |
| 848 | 3300037418 | Ga0395900_0019446 | Ga0395900_0019446_4855_5376 | 173 |
| 849 | 3300044650 | Ga0466986_0061755 | Ga0466986_0061755_1433_1954 | 173 |
| 850 | 3300045976 | Ga0466967_0237002 | Ga0466967_0237002_148_669 | 173 |
| 851 | 3300048928 | Ga0496125_0026915 | Ga0496125_0026915_2401_2922 | 173 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.9668 | 2 | 124 |
| 1nvj-assembly3.cif.gz_E | deletion mutant (delta 141) of molybdopterin synthase | 0.9588 | 2 | 123 |
| 1nvj-assembly1.cif.gz_B | deletion mutant (delta 141) of molybdopterin synthase | 0.9549 | 2 | 124 |
| 1nvj-assembly2.cif.gz_C | deletion mutant (delta 141) of molybdopterin synthase | 0.9506 | 2 | 124 |
| 4ap8-assembly1.cif.gz_A | crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) | 0.9437 | 3 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9506 | 2 | 124 | 3.90.1170.40 |
| 5mpoC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9385 | 3 | 126 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9364 | 2 | 148 | 3.90.1170.40 |
| af_Q6AY59_40_191_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9248 | 3 | 136 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9112 | 2 | 148 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A832E1U9-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9799 | 22 | 135 |
GO:0006777
|
| AF-A0A7J4PD46-F1-model_v4 | Molybdenum cofactor biosynthesis protein MoaE | 0.9795 | 25 | 117 |
GO:0006777
|
| AF-A0A2D5PE05-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9758 | 3 | 148 |
GO:0006777
GO:0030366 |
| AF-A0A2S6SUQ3-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9702 | 2 | 139 |
GO:0006777
GO:0030366 |
| AF-A0A1C6QU64-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9694 | 3 | 155 |
GO:0006777
GO:0030366 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar