F483332

General Info

Members Datasets Scaffolds Average Seq Length
847 411 1694 160

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10046369|Ga0207671_100463694
Length 153
Sequence MSLEIRRARPAETGLVLSLIRELAEYEKLSHEVDATEAMIGAALFADHPRLFCEIAEWSGEPAGFAIWFINFSTFSGRSGIYLEDLFVRPAYRGKGIGKALLARLAGECLNNGWSRLQPSIEFYKSLGAVLMDEWTVCRVSGPALATLAEGAR

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
179 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
180 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
231 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
236 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
253 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
294 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
311 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
314 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
374 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
378 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
383 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
384 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
387 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
391 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
394 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
395 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
396 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
397 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
398 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
399 2791355199
400 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
401 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
402 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
403 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
404 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
405 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
406 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
407 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
408 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
409 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
410 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
411 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 1.42
Rhizoplane 7.91
Rhizosphere 76.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10046369 3300025914 Bacteria 3215
2 JGI25153J46596_10000738 3300003215 Bacteria 20026
3 JGI25404J52841_10034065 3300003659 Bacteria 1085
4 JGI25404J52841_10045997 3300003659 Bacteria 920
5 Ga0070658_10204841 3300005327 Bacteria 1665
6 Ga0070658_11232997 3300005327 Bacteria 650
7 Ga0070683_100046407 3300005329 Bacteria 4013
8 Ga0070683_100085825 3300005329 Bacteria 2951
9 Ga0070683_100711428 3300005329 Bacteria 962
10 Ga0070690_100013883 3300005330 Bacteria 4774
11 Ga0070690_100167770 3300005330 Bacteria 1509
12 Ga0068869_100111564 3300005334 Bacteria 2081
13 Ga0068869_100140009 3300005334 Bacteria 1867
14 Ga0068869_100678915 3300005334 Bacteria 877
15 Ga0070680_100041234 3300005336 Bacteria 3742
16 Ga0070680_100097113 3300005336 Bacteria 2443
17 Ga0070682_100081625 3300005337 Bacteria 2094
18 Ga0070682_100166454 3300005337 Bacteria 1528
19 Ga0068868_100105245 3300005338 Bacteria 2287
20 Ga0068868_100840835 3300005338 Bacteria 831
21 Ga0070660_100045219 3300005339 Bacteria 3369
22 Ga0070660_100723886 3300005339 Bacteria 835
23 Ga0070689_100087788 3300005340 Bacteria 2447
24 Ga0070689_100386224 3300005340 Bacteria 1181
25 Ga0070691_10017425 3300005341 Bacteria 3305
26 Ga0070691_10687710 3300005341 Bacteria 613
27 Ga0070661_100106092 3300005344 Bacteria 2095
28 Ga0070661_100155180 3300005344 Bacteria 1732
29 Ga0070668_100108937 3300005347 Bacteria 2203
30 Ga0070668_100384927 3300005347 Bacteria 1194
31 Ga0070668_100776887 3300005347 Bacteria 849
32 Ga0070671_100216516 3300005355 Bacteria 1625
33 Ga0070671_100270463 3300005355 Bacteria 1444
34 Ga0070674_100035143 3300005356 Bacteria 3354
35 Ga0070674_100606462 3300005356 Bacteria 925
36 Ga0070673_100112844 3300005364 Bacteria 2256
37 Ga0070688_100636508 3300005365 Bacteria 820
38 Ga0070659_100306833 3300005366 Bacteria 1325
39 Ga0070667_100818892 3300005367 Bacteria 865
40 Ga0070709_10006702 3300005434 Bacteria 6287
41 Ga0070709_10056857 3300005434 Bacteria 2476
42 Ga0070714_100038279 3300005435 Bacteria 4032
43 Ga0070713_100000639 3300005436 Bacteria 22363
44 Ga0070713_100162001 3300005436 Bacteria 1998
45 Ga0070713_100186503 3300005436 Bacteria 1867
46 Ga0070713_100437271 3300005436 Bacteria 1227
47 Ga0070713_101666109 3300005436 Bacteria 619
48 Ga0070710_10000587 3300005437 Bacteria 17296
49 Ga0070710_10011649 3300005437 Bacteria 4349
50 Ga0070710_10365614 3300005437 Bacteria 959
51 Ga0070711_100002894 3300005439 Bacteria 9893
52 Ga0070711_100010862 3300005439 Bacteria 5645
53 Ga0070711_100056134 3300005439 Bacteria 2722
54 Ga0070711_100504301 3300005439 Bacteria 998
55 Ga0070700_100402497 3300005441 Bacteria 1029
56 Ga0070694_100282225 3300005444 Bacteria 1266
57 Ga0070663_100047725 3300005455 Bacteria 3033
58 Ga0070663_100136230 3300005455 Bacteria 1870
59 Ga0070663_100342347 3300005455 Bacteria 1209
60 Ga0070663_100419404 3300005455 Bacteria 1097
61 Ga0070663_101191428 3300005455 Bacteria 669
62 Ga0070678_100007967 3300005456 Bacteria 6315
63 Ga0070678_100035283 3300005456 Bacteria 3490
64 Ga0070678_100039559 3300005456 Bacteria 3328
65 Ga0070678_100182435 3300005456 Bacteria 1719
66 Ga0070678_100667614 3300005456 Bacteria 934
67 Ga0070678_100949599 3300005456 Bacteria 788
68 Ga0070678_101210350 3300005456 Bacteria 701
69 Ga0070662_101085215 3300005457 Bacteria 687
70 Ga0070662_101308940 3300005457 Bacteria 624
71 Ga0070681_10243335 3300005458 Bacteria 1712
72 Ga0070681_10326740 3300005458 Bacteria 1443
73 Ga0070681_10616512 3300005458 Bacteria 999
74 Ga0068867_100427323 3300005459 Bacteria 1124
75 Ga0070706_100295436 3300005467 Bacteria 1512
76 Ga0070706_100686722 3300005467 Bacteria 950
77 Ga0070698_100446026 3300005471 Bacteria 1229
78 Ga0070699_100401973 3300005518 Bacteria 1238
79 Ga0070679_100037593 3300005530 Bacteria 4810
80 Ga0070679_100121452 3300005530 Bacteria 2597
81 Ga0070684_100048506 3300005535 Bacteria 3685
82 Ga0070684_100071583 3300005535 Bacteria 3051
83 Ga0070697_100661171 3300005536 Bacteria 920
84 Ga0068853_100022775 3300005539 Bacteria 5236
85 Ga0068853_101513461 3300005539 Bacteria 650
86 Ga0070672_100173630 3300005543 Bacteria 1793
87 Ga0070672_100249753 3300005543 Bacteria 1494
88 Ga0070672_100433265 3300005543 Bacteria 1130
89 Ga0070672_100985026 3300005543 Bacteria 747
90 Ga0070695_100997145 3300005545 Bacteria 681
91 Ga0070665_100020950 3300005548 Bacteria 6570
92 Ga0070665_100141030 3300005548 Bacteria 2413
93 Ga0070665_101145853 3300005548 Bacteria 789
94 Ga0070704_100139027 3300005549 Bacteria 1894
95 Ga0068855_100037992 3300005563 Bacteria 5723
96 Ga0068855_100978600 3300005563 Bacteria 890
97 Ga0068857_100096949 3300005577 Bacteria 2643
98 Ga0068854_100115871 3300005578 Bacteria 2027
99 Ga0068854_101587808 3300005578 Bacteria 596
100 Ga0068856_100305264 3300005614 Bacteria 1609
101 Ga0068852_100045466 3300005616 Bacteria 3734
102 Ga0068852_100103442 3300005616 Bacteria 2576
103 Ga0068852_100121441 3300005616 Bacteria 2393
104 Ga0068859_100067475 3300005617 Bacteria 3611
105 Ga0068859_101145404 3300005617 Bacteria 856
106 Ga0068866_10088106 3300005718 Bacteria 1684
107 Ga0068866_10249820 3300005718 Bacteria 1084
108 Ga0068861_100184644 3300005719 Bacteria 1738
109 Ga0068861_100428231 3300005719 Bacteria 1180
110 Ga0068861_100478419 3300005719 Bacteria 1121
111 Ga0068861_100727947 3300005719 Bacteria 924
112 Ga0068861_100728080 3300005719 Bacteria 924
113 Ga0068861_100860445 3300005719 Bacteria 855
114 Ga0068851_10020777 3300005834 Bacteria 3183
115 Ga0068870_10648718 3300005840 Bacteria 723
116 Ga0068863_100441310 3300005841 Bacteria 1276
117 Ga0068863_100487712 3300005841 Bacteria 1213
118 Ga0068863_101117319 3300005841 Bacteria 793
119 Ga0068863_101234951 3300005841 Bacteria 753
120 Ga0068858_100647625 3300005842 Bacteria 1027
121 Ga0068858_100650875 3300005842 Bacteria 1024
122 Ga0068858_100790473 3300005842 Bacteria 926
123 Ga0068860_100272452 3300005843 Bacteria 1652
124 Ga0068860_100297484 3300005843 Bacteria 1580
125 Ga0068860_100688221 3300005843 Bacteria 1032
126 Ga0068862_100197996 3300005844 Bacteria 1810
127 Ga0068862_100345724 3300005844 Bacteria 1379
128 Ga0068862_100674795 3300005844 Bacteria 999
129 Ga0068862_100890268 3300005844 Bacteria 874
130 Ga0081540_1000996 3300005983 Bacteria 25476
131 Ga0081540_1008013 3300005983 Bacteria 7435
132 Ga0081540_1010852 3300005983 Bacteria 6123
133 Ga0081540_1028988 3300005983 Bacteria 3094
134 Ga0081540_1070603 3300005983 Bacteria 1617
135 Ga0081540_1084170 3300005983 Bacteria 1420
136 Ga0070717_10014303 3300006028 Bacteria 6103
137 Ga0070717_10016137 3300006028 Bacteria 5786
138 Ga0070717_10652728 3300006028 Bacteria 955
139 Ga0070717_10768691 3300006028 Bacteria 876
140 Ga0075365_10018424 3300006038 Bacteria 4293
141 Ga0075365_10081134 3300006038 Bacteria 2197
142 Ga0075365_10192006 3300006038 Bacteria 1429
143 Ga0075368_10075758 3300006042 Bacteria 1364
144 Ga0075368_10122459 3300006042 Bacteria 1078
145 Ga0075363_100019054 3300006048 Bacteria 3426
146 Ga0075363_100123081 3300006048 Bacteria 1450
147 Ga0075363_100219492 3300006048 Bacteria 1089
148 Ga0075364_10022187 3300006051 Bacteria 4007
149 Ga0075364_10024862 3300006051 Bacteria 3808
150 Ga0075432_10117063 3300006058 Bacteria 998
151 Ga0070715_10000260 3300006163 Bacteria 12808
152 Ga0070715_10152161 3300006163 Bacteria 1135
153 Ga0070715_10180972 3300006163 Bacteria 1057
154 Ga0070715_10784804 3300006163 Bacteria 577
155 Ga0070716_100000213 3300006173 Bacteria 23132
156 Ga0070716_100788485 3300006173 Bacteria 735
157 Ga0070712_100016528 3300006175 Bacteria 4768
158 Ga0070712_100030454 3300006175 Bacteria 3626
159 Ga0070712_100307522 3300006175 Bacteria 1285
160 Ga0070712_100596097 3300006175 Bacteria 935
161 Ga0070712_101200732 3300006175 Bacteria 660
162 Ga0075362_10008950 3300006177 Bacteria 3850
163 Ga0075362_10017105 3300006177 Bacteria 2982
164 Ga0075367_10081513 3300006178 Bacteria 1958
165 Ga0075367_10220969 3300006178 Bacteria 1186
166 Ga0075367_10394915 3300006178 Bacteria 874
167 Ga0075369_10026249 3300006186 Bacteria 2427
168 Ga0075369_10190453 3300006186 Bacteria 945
169 Ga0075369_10225014 3300006186 Bacteria 869
170 Ga0075366_10074726 3300006195 Bacteria 2021
171 Ga0075366_10159577 3300006195 Bacteria 1366
172 Ga0075366_10307885 3300006195 Bacteria 970
173 Ga0075366_10330866 3300006195 Bacteria 934
174 Ga0075366_10334142 3300006195 Bacteria 929
175 Ga0097621_100146155 3300006237 Bacteria 2024
176 Ga0097621_100468823 3300006237 Bacteria 1137
177 Ga0097621_100610753 3300006237 Bacteria 998
178 Ga0075370_10092808 3300006353 Bacteria 1742
179 Ga0075370_10148475 3300006353 Bacteria 1373
180 Ga0075370_10180483 3300006353 Bacteria 1242
181 Ga0075370_10241932 3300006353 Bacteria 1069
182 Ga0068871_100220538 3300006358 Bacteria 1643
183 Ga0068871_100239002 3300006358 Bacteria 1578
184 Ga0068871_100343989 3300006358 Bacteria 1318
185 Ga0068871_100616684 3300006358 Bacteria 988
186 Ga0075428_100220390 3300006844 Bacteria 2049
187 Ga0075434_100357445 3300006871 Bacteria 1481
188 Ga0075434_100422251 3300006871 Bacteria 1354
189 Ga0075434_101885805 3300006871 Bacteria 604
190 Ga0075429_101026858 3300006880 Bacteria 721
191 Ga0068865_100035745 3300006881 Bacteria 3344
192 Ga0068865_100094453 3300006881 Bacteria 2176
193 Ga0068865_100686260 3300006881 Bacteria 874
194 Ga0097620_100067486 3300006931 Bacteria 3611
195 Ga0097620_101145396 3300006931 Bacteria 856
196 Ga0099794_10607846 3300007265 Bacteria 579
197 Ga0105250_10229701 3300009092 Bacteria 789
198 Ga0105240_10023381 3300009093 Bacteria 8174
199 Ga0111539_10089698 3300009094 Bacteria 3613
200 Ga0111539_10335277 3300009094 Bacteria 1760
201 Ga0111539_10654197 3300009094 Bacteria 1224
202 Ga0105245_10699423 3300009098 Bacteria 1047
203 Ga0105247_10196299 3300009101 Bacteria 1354
204 Ga0105247_10377793 3300009101 Bacteria 1004
205 Ga0105247_10423711 3300009101 Bacteria 954
206 Ga0105247_10510664 3300009101 Bacteria 877
207 Ga0105247_10526546 3300009101 Bacteria 865
208 Ga0114129_10345513 3300009147 Bacteria 1972
209 Ga0114129_12095665 3300009147 Bacteria 682
210 Ga0105243_10421131 3300009148 Bacteria 1246
211 Ga0105241_10148258 3300009174 Bacteria 1917
212 Ga0105242_10136248 3300009176 Bacteria 2125
213 Ga0105242_10380007 3300009176 Bacteria 1313
214 Ga0105248_10186176 3300009177 Bacteria 2339
215 Ga0105248_11246741 3300009177 Bacteria 841
216 Ga0105248_11534024 3300009177 Bacteria 754
217 Ga0105248_11800019 3300009177 Bacteria 695
218 Ga0105248_12412611 3300009177 Bacteria 599
219 Ga0105237_10005728 3300009545 Bacteria 13958
220 Ga0105237_10022378 3300009545 Bacteria 6485
221 Ga0105237_10210020 3300009545 Bacteria 1947
222 Ga0105237_10377248 3300009545 Bacteria 1423
223 Ga0105237_10501099 3300009545 Bacteria 1221
224 Ga0105237_10512303 3300009545 Bacteria 1206
225 Ga0105238_10008040 3300009551 Bacteria 10550
226 Ga0105238_10273510 3300009551 Bacteria 1670
227 Ga0105238_10766484 3300009551 Bacteria 979
228 Ga0105249_10215265 3300009553 Bacteria 1888
229 Ga0105249_10548053 3300009553 Bacteria 1207
230 Ga0105249_10577928 3300009553 Bacteria 1177
231 Ga0105249_11118552 3300009553 Bacteria 858
232 Ga0099796_10076649 3300010159 Bacteria 1218
233 Ga0105239_10024893 3300010375 Bacteria 6592
234 Ga0105239_10175718 3300010375 Bacteria 2395
235 Ga0105246_10409631 3300011119 Bacteria 1128
236 Ga0105246_11009239 3300011119 Bacteria 754
237 Ga0157370_10573190 3300013104 Bacteria 1034
238 Ga0157370_10591335 3300013104 Bacteria 1016
239 Ga0157369_10005591 3300013105 Bacteria 14600
240 Ga0157369_10058666 3300013105 Bacteria 4151
241 Ga0157369_10139062 3300013105 Bacteria 2570
242 Ga0157369_11403379 3300013105 Bacteria 711
243 Ga0157374_10430092 3300013296 Bacteria 1320
244 Ga0157374_10795978 3300013296 Bacteria 961
245 Ga0157378_10336043 3300013297 Bacteria 1472
246 Ga0163162_10463681 3300013306 Bacteria 1398
247 Ga0163162_10643681 3300013306 Bacteria 1184
248 Ga0163162_11002550 3300013306 Bacteria 944
249 Ga0163162_12084648 3300013306 Bacteria 650
250 Ga0163162_12124838 3300013306 Bacteria 644
251 Ga0157375_10022963 3300013308 Bacteria 5749
252 Ga0157375_10370365 3300013308 Bacteria 1599
253 Ga0157375_10726273 3300013308 Bacteria 1146
254 Ga0157375_10748276 3300013308 Bacteria 1129
255 Ga0163163_10250536 3300014325 Bacteria 1821
256 Ga0163163_10386048 3300014325 Bacteria 1458
257 Ga0157380_10181760 3300014326 Bacteria 1848
258 Ga0157380_10280804 3300014326 Bacteria 1523
259 Ga0157380_10469416 3300014326 Bacteria 1214
260 Ga0182008_10309086 3300014497 Bacteria 829
261 Ga0157377_10388553 3300014745 Bacteria 947
262 Ga0157379_10218455 3300014968 Bacteria 1727
263 Ga0157379_12579359 3300014968 Bacteria 509
264 Ga0182007_10163807 3300015262 Bacteria 761
265 Ga0163161_10292705 3300017792 Bacteria 1280
266 Ga0213873_10021246 3300021358 Bacteria 1525
267 Ga0213876_10021664 3300021384 Bacteria 3398
268 Ga0213875_10013237 3300021388 Bacteria 4057
269 Ga0209758_1037278 3300025297 Bacteria 1881
270 Ga0207697_10042990 3300025315 Bacteria 1858
271 Ga0207697_10067325 3300025315 Bacteria 1497
272 Ga0207656_10021724 3300025321 Bacteria 2567
273 Ga0207692_10000295 3300025898 Bacteria 17307
274 Ga0207692_10013187 3300025898 Bacteria 3578
275 Ga0207692_10238312 3300025898 Bacteria 1085
276 Ga0207692_10276885 3300025898 Bacteria 1014
277 Ga0207642_10070349 3300025899 Bacteria 1663
278 Ga0207642_10149150 3300025899 Bacteria 1242
279 Ga0207710_10219092 3300025900 Bacteria 944
280 Ga0207688_10056972 3300025901 Bacteria 2196
281 Ga0207688_10078530 3300025901 Bacteria 1881
282 Ga0207647_10403377 3300025904 Bacteria 770
283 Ga0207685_10052993 3300025905 Bacteria 1574
284 Ga0207685_10077989 3300025905 Bacteria 1363
285 Ga0207699_10007555 3300025906 Bacteria 5320
286 Ga0207699_10023406 3300025906 Bacteria 3362
287 Ga0207645_10061625 3300025907 Bacteria 2396
288 Ga0207705_10263517 3300025909 Bacteria 1316
289 Ga0207684_10197578 3300025910 Bacteria 1735
290 Ga0207707_10000455 3300025912 Bacteria 42610
291 Ga0207707_10468889 3300025912 Bacteria 1076
292 Ga0207695_10126008 3300025913 Bacteria 2523
293 Ga0207671_10138314 3300025914 Bacteria 1874
294 Ga0207671_10296442 3300025914 Bacteria 1277
295 Ga0207671_10310201 3300025914 Bacteria 1247
296 Ga0207671_10381600 3300025914 Bacteria 1120
297 Ga0207693_10000674 3300025915 Bacteria 30670
298 Ga0207693_10001851 3300025915 Bacteria 18534
299 Ga0207693_10015809 3300025915 Bacteria 6046
300 Ga0207693_10050083 3300025915 Bacteria 3280
301 Ga0207693_10067664 3300025915 Bacteria 2797
302 Ga0207663_10001588 3300025916 Bacteria 10673
303 Ga0207663_10009598 3300025916 Bacteria 5122
304 Ga0207663_10042485 3300025916 Bacteria 2777
305 Ga0207660_10065575 3300025917 Bacteria 2625
306 Ga0207660_11010440 3300025917 Bacteria 678
307 Ga0207657_10001360 3300025919 Bacteria 26055
308 Ga0207652_10001894 3300025921 Bacteria 18100
309 Ga0207652_10093384 3300025921 Bacteria 2648
310 Ga0207694_10039433 3300025924 Bacteria 3635
311 Ga0207694_10993350 3300025924 Bacteria 710
312 Ga0207687_10489152 3300025927 Bacteria 1026
313 Ga0207700_10007259 3300025928 Bacteria 6760
314 Ga0207700_10012187 3300025928 Bacteria 5531
315 Ga0207700_10074150 3300025928 Bacteria 2631
316 Ga0207700_10430378 3300025928 Bacteria 1160
317 Ga0207700_11255226 3300025928 Bacteria 661
318 Ga0207664_10037043 3300025929 Bacteria 3772
319 Ga0207664_10055294 3300025929 Bacteria 3149
320 Ga0207664_10229713 3300025929 Bacteria 1612
321 Ga0207644_10977860 3300025931 Bacteria 710
322 Ga0207644_11049904 3300025931 Bacteria 684
323 Ga0207690_10605731 3300025932 Bacteria 894
324 Ga0207706_10265785 3300025933 Bacteria 1497
325 Ga0207686_10164109 3300025934 Bacteria 1560
326 Ga0207686_10293278 3300025934 Bacteria 1205
327 Ga0207686_10553192 3300025934 Bacteria 900
328 Ga0207709_10129363 3300025935 Bacteria 1718
329 Ga0207670_10162598 3300025936 Bacteria 1668
330 Ga0207669_10010625 3300025937 Bacteria 4438
331 Ga0207669_10018303 3300025937 Bacteria 3618
332 Ga0207704_10029068 3300025938 Bacteria 3076
333 Ga0207704_10078158 3300025938 Bacteria 2127
334 Ga0207704_10280412 3300025938 Bacteria 1266
335 Ga0207704_10450085 3300025938 Bacteria 1027
336 Ga0207704_10876513 3300025938 Bacteria 754
337 Ga0207665_10000214 3300025939 Bacteria 39213
338 Ga0207665_10033322 3300025939 Bacteria 3413
339 Ga0207665_10096749 3300025939 Bacteria 2054
340 Ga0207691_10065199 3300025940 Bacteria 3298
341 Ga0207691_10258482 3300025940 Bacteria 1501
342 Ga0207691_10339415 3300025940 Bacteria 1286
343 Ga0207711_10040565 3300025941 Bacteria 3961
344 Ga0207711_10955443 3300025941 Bacteria 796
345 Ga0207689_10121032 3300025942 Bacteria 2153
346 Ga0207689_10479860 3300025942 Bacteria 1041
347 Ga0207661_10002719 3300025944 Bacteria 12172
348 Ga0207661_10294037 3300025944 Bacteria 1454
349 Ga0207661_10931377 3300025944 Bacteria 800
350 Ga0207679_10193770 3300025945 Bacteria 1692
351 Ga0207679_10284023 3300025945 Bacteria 1420
352 Ga0207667_10023687 3300025949 Bacteria 6758
353 Ga0207667_10154277 3300025949 Bacteria 2363
354 Ga0207651_10394540 3300025960 Bacteria 1176
355 Ga0207651_10505896 3300025960 Bacteria 1045
356 Ga0207712_10151232 3300025961 Bacteria 1793
357 Ga0207712_10280574 3300025961 Bacteria 1360
358 Ga0207712_10315584 3300025961 Bacteria 1288
359 Ga0207712_10555030 3300025961 Bacteria 988
360 Ga0207712_10639570 3300025961 Bacteria 923
361 Ga0207712_10708308 3300025961 Bacteria 879
362 Ga0207668_10047201 3300025972 Bacteria 2947
363 Ga0207668_10300481 3300025972 Bacteria 1324
364 Ga0207668_10747410 3300025972 Bacteria 863
365 Ga0207640_10203072 3300025981 Bacteria 1504
366 Ga0207658_10851444 3300025986 Bacteria 829
367 Ga0207677_10297427 3300026023 Bacteria 1332
368 Ga0207677_10669261 3300026023 Bacteria 918
369 Ga0207703_10391072 3300026035 Bacteria 1288
370 Ga0207703_10429766 3300026035 Bacteria 1230
371 Ga0207703_10632625 3300026035 Bacteria 1014
372 Ga0207703_11135097 3300026035 Bacteria 751
373 Ga0207639_10016673 3300026041 Bacteria 5203
374 Ga0207639_10143069 3300026041 Bacteria 1995
375 Ga0207639_10274317 3300026041 Bacteria 1480
376 Ga0207678_10029610 3300026067 Bacteria 4780
377 Ga0207678_10035630 3300026067 Bacteria 4332
378 Ga0207678_10071503 3300026067 Bacteria 2975
379 Ga0207678_10187503 3300026067 Bacteria 1767
380 Ga0207678_10212330 3300026067 Bacteria 1656
381 Ga0207678_10229302 3300026067 Bacteria 1590
382 Ga0207678_10332732 3300026067 Bacteria 1308
383 Ga0207708_10290076 3300026075 Bacteria 1328
384 Ga0207641_10186159 3300026088 Bacteria 1905
385 Ga0207641_10720666 3300026088 Bacteria 983
386 Ga0207641_10745576 3300026088 Bacteria 966
387 Ga0207648_10166283 3300026089 Bacteria 1949
388 Ga0207676_12052619 3300026095 Bacteria 570
389 Ga0207674_10043139 3300026116 Bacteria 4652
390 Ga0207675_100144538 3300026118 Bacteria 2261
391 Ga0207675_100208285 3300026118 Bacteria 1880
392 Ga0207675_100281521 3300026118 Bacteria 1616
393 Ga0207675_100304369 3300026118 Bacteria 1553
394 Ga0207675_100308354 3300026118 Bacteria 1543
395 Ga0207683_10038663 3300026121 Bacteria 4161
396 Ga0207683_10185005 3300026121 Bacteria 1890
397 Ga0207683_10195445 3300026121 Bacteria 1838
398 Ga0207683_10218970 3300026121 Bacteria 1734
399 Ga0207683_10348917 3300026121 Bacteria 1358
400 Ga0207683_10857372 3300026121 Bacteria 843
401 Ga0207698_10016150 3300026142 Bacteria 5023
402 Ga0207698_10418598 3300026142 Bacteria 1285
403 Ga0209813_10213110 3300027866 Bacteria 720
404 Ga0207428_10062077 3300027907 Bacteria 2956
405 Ga0268266_10013121 3300028379 Bacteria 7144
406 Ga0268266_10016287 3300028379 Bacteria 6355
407 Ga0268266_10430651 3300028379 Bacteria 1251
408 Ga0268265_10082483 3300028380 Bacteria 2542
409 Ga0268265_10404034 3300028380 Bacteria 1263
410 Ga0268264_10281335 3300028381 Bacteria 1558
411 Ga0268264_10295862 3300028381 Bacteria 1522
412 Ga0268264_10547334 3300028381 Bacteria 1135
413 Ga0268264_11101328 3300028381 Bacteria 803
414 Ga0265337_1081691 3300028556 Bacteria 884
415 Ga0265326_10040065 3300028558 Bacteria 1330
416 Ga0265319_1044016 3300028563 Bacteria 1497
417 Ga0265334_10027999 3300028573 Bacteria 2267
418 Ga0265323_10003068 3300028653 Bacteria 7438
419 Ga0265322_10167050 3300028654 Bacteria 629
420 Ga0265336_10000859 3300028666 Bacteria 15784
421 Ga0307517_10247537 3300028786 Bacteria 1050
422 Ga0265338_10000013 3300028800 Bacteria 379065
423 Ga0265324_10074979 3300029957 Bacteria 1151
424 Ga0265339_10013486 3300031249 Bacteria 4950
425 Ga0307513_10028716 3300031456 Bacteria 6354
426 Ga0307509_10165469 3300031507 Bacteria 2101
427 Ga0307509_10439273 3300031507 Bacteria 1001
428 Ga0307509_10482178 3300031507 Bacteria 928
429 Ga0307508_10000034 3300031616 Bacteria 160115
430 Ga0307516_10025519 3300031730 Bacteria 6017
431 Ga0307516_10025796 3300031730 Bacteria 5978
432 Ga0307405_10323080 3300031731 Bacteria 1180
433 Ga0307405_11486689 3300031731 Bacteria 595
434 Ga0307405_11584876 3300031731 Bacteria 577
435 Ga0307406_10083660 3300031901 Bacteria 2129
436 Ga0307406_10459534 3300031901 Bacteria 1023
437 Ga0307406_10536560 3300031901 Bacteria 955
438 Ga0307406_10612986 3300031901 Bacteria 899
439 Ga0307412_10103281 3300031911 Bacteria 2020
440 Ga0307412_10198455 3300031911 Bacteria 1522
441 Ga0307409_101046979 3300031995 Bacteria 836
442 Ga0307416_100868086 3300032002 Bacteria 1001
443 Ga0307414_10290685 3300032004 Bacteria 1378
444 Ga0307414_10619343 3300032004 Bacteria 973
445 Ga0307411_11316122 3300032005 Bacteria 659
446 Ga0307510_10009700 3300033180 Bacteria 11458
447 Ga0307510_10019525 3300033180 Bacteria 7947
448 Ga0373930_0021715 3300034816 Bacteria 1263
449 Ga0373938_0095645 3300034957 Bacteria 740
450 Ga0373952_0030864 3300035092 Bacteria 1189
451 Ga0373923_0011318 3300035111 Bacteria 3269
452 Ga0373932_0005334 3300035112 Bacteria 3024
453 Ga0373932_0190672 3300035112 Bacteria 724
454 Ga0373941_0125165 3300035115 Bacteria 920
455 Ga0373945_0023726 3300035116 Bacteria 2121
456 Ga0373954_0046188 3300035118 Bacteria 2035
457 Ga0373960_0026103 3300035121 Bacteria 1594
458 Ga0373960_0239337 3300035121 Bacteria 656
459 Ga0373943_0026562 3300035170 Bacteria 2713
460 Ga0373946_0186293 3300035171 Bacteria 987
461 Ga0373955_0011011 3300035172 Bacteria 4294
462 Ga0373955_0030328 3300035172 Bacteria 2822
463 Ga0373955_0067511 3300035172 Bacteria 1991
464 Ga0373955_0110258 3300035172 Bacteria 1591
465 Ga0373942_0075522 3300035207 Bacteria 992
466 Ga0373924_0033016 3300035410 Bacteria 2087
467 Ga0373924_0041591 3300035410 Bacteria 1883
468 Ga0373931_0001895 3300035691 Bacteria 9143
469 Ga0373931_0519099 3300035691 Bacteria 771
470 Ga0373931_0527053 3300035691 Bacteria 765
471 Ga0373935_0003068 3300035692 Bacteria 9628
472 Ga0373927_0004108 3300035695 Bacteria 10256
473 Ga0373927_0023382 3300035695 Bacteria 4047
474 Ga0373927_0035091 3300035695 Bacteria 3261
475 Ga0373927_0084258 3300035695 Bacteria 2062
476 Ga0373933_0061032 3300035724 Bacteria 2274
477 Ga0373933_0329103 3300035724 Bacteria 991
478 Ga0373947_0006080 3300035725 Bacteria 7033
479 Ga0373937_0045613 3300036401 Bacteria 4006
480 Ga0373937_0388974 3300036401 Bacteria 1323
481 Ga0373937_0713768 3300036401 Bacteria 949
482 Ga0373925_0028943 3300037068 Bacteria 4061
483 Ga0373925_0405153 3300037068 Bacteria 1113
484 Ga0373925_0454881 3300037068 Bacteria 1049
485 Ga0395900_0085903 3300037418 Bacteria 3233
486 Ga0395898_0025898 3300037466 Bacteria 5906
487 Ga0395905_0100628 3300037471 Bacteria 2714
488 Ga0395905_0108120 3300037471 Bacteria 2611
489 Ga0395905_1155520 3300037471 Bacteria 678
490 Ga0436364_0636868 3300037853 Bacteria 13608
491 Ga0395901_0751093 3300038443 Bacteria 969
492 Ga0436365_0239398 3300039437 Bacteria 574
493 Ga0436365_1782545 3300039437 Bacteria 4773
494 Ga0436360_0024377 3300039438 Bacteria 2054
495 Ga0436360_0920934 3300039438 Bacteria 1012
496 Ga0436361_0024877 3300039447 Bacteria 1381
497 Ga0436361_0289886 3300039447 Bacteria 3340
498 Ga0436361_0536600 3300039447 Bacteria 702
499 Ga0436361_0928467 3300039447 Bacteria 995
500 Ga0436363_1080177 3300039450 Bacteria 2718
501 Ga0436362_0128160 3300039453 Bacteria 8388
502 Ga0436362_0771524 3300039453 Bacteria 599
503 Ga0439465_0118292 3300041413 Bacteria 927
504 Ga0439465_0211306 3300041413 Bacteria 709
505 Ga0451795_1468814 3300041456 Bacteria 643
506 Ga0451798_0995831 3300041458 Bacteria 574
507 Ga0451802_2150413 3300041460 Bacteria 1368
508 Ga0451835_1106034 3300041492 Bacteria 808
509 Ga0451853_3631163 3300041512 Bacteria 914
510 Ga0439454_004785 3300042011 Bacteria 1582
511 Ga0439459_0164150 3300042438 Bacteria 588
512 Ga0439464_0186938 3300042439 Bacteria 658
513 Ga0466963_0115955 3300044694 Bacteria 1841
514 Ga0466968_0197809 3300044735 Bacteria 940
515 Ga0466970_0334568 3300044765 Bacteria 857
516 Ga0466959_0013508 3300045049 Bacteria 5918
517 Ga0466967_0716561 3300045976 Bacteria 991
518 Ga0495617_006940 3300046452 Bacteria 3953
519 Ga0495617_030440 3300046452 Bacteria 1814
520 Ga0495617_108255 3300046452 Bacteria 900
521 Ga0495627_119528 3300046453 Bacteria 745
522 Ga0495592_0006658 3300046454 Bacteria 8614
523 Ga0495603_0000064 3300046455 Bacteria 46716
524 Ga0495603_0029475 3300046455 Bacteria 3308
525 Ga0495603_0029732 3300046455 Bacteria 3294
526 Ga0495603_0049543 3300046455 Bacteria 2500
527 Ga0495629_0001385 3300046459 Bacteria 19116
528 Ga0495629_0095759 3300046459 Bacteria 2071
529 Ga0495629_0353411 3300046459 Bacteria 1002
530 Ga0495638_0045785 3300046460 Bacteria 2751
531 Ga0495638_0161249 3300046460 Bacteria 1293
532 Ga0495638_0208667 3300046460 Bacteria 1098
533 Ga0495641_0005307 3300046461 Bacteria 8752
534 Ga0495641_0184280 3300046461 Bacteria 935
535 Ga0495651_0056086 3300046462 Bacteria 3026
536 Ga0495651_0541574 3300046462 Bacteria 741
537 Ga0495653_0290916 3300046463 Bacteria 1068
538 Ga0495650_0063228 3300046471 Bacteria 1477
539 Ga0495650_0222336 3300046471 Bacteria 650
540 Ga0495580_0006847 3300046472 Bacteria 9227
541 Ga0495582_0000173 3300046473 Bacteria 35208
542 Ga0495582_0072963 3300046473 Bacteria 1900
543 Ga0495605_0090050 3300046474 Bacteria 1423
544 Ga0495639_0000218 3300046475 Bacteria 29492
545 Ga0495639_0070181 3300046475 Bacteria 1617
546 Ga0495662_0013475 3300046476 Bacteria 3979
547 Ga0495664_0041556 3300046477 Bacteria 2721
548 Ga0495664_0045785 3300046477 Bacteria 2595
549 Ga0495584_0063161 3300046491 Bacteria 1861
550 Ga0495585_0029264 3300046492 Bacteria 3136
551 Ga0495594_0000590 3300046499 Bacteria 18674
552 Ga0495594_0030720 3300046499 Bacteria 2909
553 Ga0495594_0053484 3300046499 Bacteria 2224
554 Ga0495596_0093823 3300046500 Bacteria 1165
555 Ga0495596_0164633 3300046500 Bacteria 862
556 Ga0495607_0388423 3300046501 Bacteria 637
557 Ga0495606_0314867 3300046507 Bacteria 843
558 Ga0495606_0355611 3300046507 Bacteria 776
559 Ga0495610_0150886 3300046512 Bacteria 991
560 Ga0495610_0215605 3300046512 Bacteria 778
561 Ga0495610_0232949 3300046512 Bacteria 738
562 Ga0495616_0105913 3300046513 Bacteria 1312
563 Ga0495618_0241763 3300046514 Bacteria 1134
564 Ga0495628_0092922 3300046516 Bacteria 2333
565 Ga0495630_0000613 3300046517 Bacteria 25849
566 Ga0495632_0061385 3300046519 Bacteria 1824
567 Ga0495632_0090578 3300046519 Bacteria 1450
568 Ga0495632_0097751 3300046519 Bacteria 1385
569 Ga0495643_0183790 3300046522 Bacteria 1014
570 Ga0495644_0087385 3300046523 Bacteria 1175
571 Ga0495644_0176917 3300046523 Bacteria 820
572 Ga0495644_0258925 3300046523 Bacteria 676
573 Ga0495663_0063068 3300046525 Bacteria 1168
574 Ga0495666_0015057 3300046526 Bacteria 3849
575 Ga0495652_0050312 3300046529 Bacteria 3563
576 Ga0495652_0247135 3300046529 Bacteria 1324
577 Ga0495652_0386301 3300046529 Bacteria 994
578 Ga0495665_0000531 3300046531 Bacteria 19287
579 Ga0495640_0001572 3300046533 Bacteria 17991
580 Ga0495586_0210931 3300046535 Bacteria 1102
581 Ga0495586_0268524 3300046535 Bacteria 975
582 Ga0495587_0176942 3300046536 Bacteria 1210
583 Ga0495587_0472786 3300046536 Bacteria 694
584 Ga0495598_0026127 3300046537 Bacteria 1598
585 Ga0495598_0027478 3300046537 Bacteria 1570
586 Ga0495621_0134804 3300046539 Bacteria 963
587 Ga0495621_0226074 3300046539 Bacteria 759
588 Ga0495597_0360420 3300046542 Bacteria 557
589 Ga0495645_0091766 3300046543 Bacteria 2169
590 Ga0495622_0004472 3300046557 Bacteria 6485
591 Ga0495622_0078533 3300046557 Bacteria 1520
592 Ga0495633_0038360 3300046558 Bacteria 2288
593 Ga0495633_0275321 3300046558 Bacteria 766
594 Ga0495667_0275820 3300046559 Bacteria 1068
595 Ga0495667_0353769 3300046559 Bacteria 928
596 Ga0495656_0005268 3300046615 Bacteria 4455
597 Ga0495656_0056879 3300046615 Bacteria 1691
598 Ga0495656_0082041 3300046615 Bacteria 1457
599 Ga0495656_0089573 3300046615 Bacteria 1404
600 Ga0495656_0108972 3300046615 Bacteria 1292
601 Ga0495656_0110573 3300046615 Bacteria 1284
602 Ga0495668_0044002 3300046616 Bacteria 2481
603 Ga0495634_0005581 3300046642 Bacteria 9654
604 Ga0495625_0148756 3300046660 Bacteria 1575
605 Ga0495635_0021824 3300046663 Bacteria 4463
606 Ga0495635_0125225 3300046663 Bacteria 1752
607 Ga0495635_0126515 3300046663 Bacteria 1743
608 Ga0495659_0006815 3300046664 Bacteria 3610
609 Ga0495661_0103488 3300046665 Bacteria 1598
610 Ga0495661_0552032 3300046665 Bacteria 545
611 Ga0495588_0022423 3300046674 Bacteria 3121
612 Ga0495588_0025243 3300046674 Bacteria 2959
613 Ga0495657_0067110 3300046675 Bacteria 2355
614 Ga0495599_0427853 3300046678 Bacteria 786
615 Ga0495623_0039786 3300046679 Bacteria 3003
616 Ga0495623_0183506 3300046679 Bacteria 1214
617 Ga0495623_0494395 3300046679 Bacteria 646
618 Ga0495646_0007737 3300046680 Bacteria 6829
619 Ga0495647_0001441 3300046681 Bacteria 7369
620 Ga0495647_0014634 3300046681 Bacteria 2737
621 Ga0495658_0001201 3300046683 Bacteria 13610
622 Ga0495669_0000675 3300046684 Bacteria 14839
623 Ga0495669_0104914 3300046684 Bacteria 1315
624 Ga0495669_0207424 3300046684 Bacteria 938
625 Ga0495613_0004213 3300046689 Bacteria 10767
626 Ga0495624_0005853 3300046690 Bacteria 8795
627 Ga0495624_0164859 3300046690 Bacteria 1353
628 Ga0495624_0370334 3300046690 Bacteria 861
629 Ga0495670_0012092 3300046691 Bacteria 4246
630 Ga0495670_0235856 3300046691 Bacteria 973
631 Ga0495671_0105081 3300046692 Bacteria 1379
632 Ga0495671_0233148 3300046692 Bacteria 890
633 Ga0495671_0468364 3300046692 Bacteria 602
634 Ga0495589_0087665 3300046794 Bacteria 1511
635 Ga0495589_0330599 3300046794 Bacteria 703
636 Ga0495600_0159162 3300046809 Bacteria 1460
637 Ga0495600_0183566 3300046809 Bacteria 1348
638 Ga0495581_0000015 3300047315 Bacteria 59214
639 Ga0495581_0297782 3300047315 Bacteria 943
640 Ga0495581_0687951 3300047315 Bacteria 590
641 Ga0495604_0129080 3300047317 Bacteria 1819
642 Ga0495604_0262333 3300047317 Bacteria 1174
643 Ga0495636_0040926 3300047318 Bacteria 1922
644 Ga0495636_0183268 3300047318 Bacteria 951
645 Ga0495674_0285389 3300047319 Bacteria 1351
646 Ga0495674_0331709 3300047319 Bacteria 1238
647 Ga0495674_0388136 3300047319 Bacteria 1129
648 Ga0495672_0236902 3300047320 Bacteria 893
649 Ga0495672_0246398 3300047320 Bacteria 870
650 Ga0495676_0010028 3300047321 Bacteria 8605
651 Ga0495676_0068201 3300047321 Bacteria 2749
652 Ga0495680_0028809 3300047322 Bacteria 4551
653 Ga0495680_0287239 3300047322 Bacteria 1158
654 Ga0495683_0341062 3300047323 Bacteria 634
655 Ga0495673_0011722 3300047469 Bacteria 4694
656 Ga0495673_0102385 3300047469 Bacteria 1156
657 Ga0495673_0251120 3300047469 Bacteria 646
658 Ga0495681_0081927 3300047470 Bacteria 1439
659 Ga0495684_0020248 3300047471 Bacteria 5125
660 Ga0495684_0142254 3300047471 Bacteria 1798
661 Ga0495593_0000053 3300047673 Bacteria 47697
662 Ga0495593_0229582 3300047673 Bacteria 931
663 Ga0495602_0174049 3300048088 Bacteria 1668
664 Ga0495602_0553794 3300048088 Bacteria 797
665 Ga0495602_0709517 3300048088 Bacteria 682
666 Ga0495614_0013513 3300048089 Bacteria 3580
667 Ga0495615_0059280 3300048090 Bacteria 1006
668 Ga0496100_0001613 3300048903 Bacteria 11146
669 Ga0496100_0157079 3300048903 Bacteria 1627
670 Ga0496100_0164416 3300048903 Bacteria 1593
671 Ga0496100_0767428 3300048903 Bacteria 755
672 Ga0496101_0004421 3300048904 Bacteria 8844
673 Ga0496101_0059329 3300048904 Bacteria 2773
674 Ga0496101_0092016 3300048904 Bacteria 2257
675 Ga0496101_0191351 3300048904 Bacteria 1579
676 Ga0496102_0010509 3300048905 Bacteria 7970
677 Ga0496102_0012054 3300048905 Bacteria 7470
678 Ga0496102_0142359 3300048905 Bacteria 2249
679 Ga0496102_0177578 3300048905 Bacteria 2005
680 Ga0496102_0195854 3300048905 Bacteria 1904
681 Ga0496103_0018374 3300048906 Bacteria 4193
682 Ga0496103_0028159 3300048906 Bacteria 3408
683 Ga0496103_0060299 3300048906 Bacteria 2358
684 Ga0496104_0018347 3300048907 Bacteria 6384
685 Ga0496104_0081042 3300048907 Bacteria 3094
686 Ga0496104_0156129 3300048907 Bacteria 2189
687 Ga0496105_0004722 3300048908 Bacteria 10282
688 Ga0496105_0031311 3300048908 Bacteria 4361
689 Ga0496105_0258662 3300048908 Bacteria 1408
690 Ga0496106_0040286 3300048909 Bacteria 3498
691 Ga0496106_0128796 3300048909 Bacteria 1983
692 Ga0496106_0175618 3300048909 Bacteria 1699
693 Ga0496106_0380327 3300048909 Bacteria 1134
694 Ga0496106_0506692 3300048909 Bacteria 969
695 Ga0496106_0929778 3300048909 Bacteria 686
696 Ga0496107_0004750 3300048910 Bacteria 9230
697 Ga0496107_0010483 3300048910 Bacteria 6442
698 Ga0496107_0135756 3300048910 Bacteria 1817
699 Ga0496107_0450600 3300048910 Bacteria 956
700 Ga0496107_0833083 3300048910 Bacteria 674
701 Ga0496108_0027428 3300048911 Bacteria 4703
702 Ga0496108_0067242 3300048911 Bacteria 3022
703 Ga0496108_0162530 3300048911 Bacteria 1930
704 Ga0496109_0007688 3300048912 Bacteria 9135
705 Ga0496109_0010512 3300048912 Bacteria 7909
706 Ga0496109_0063721 3300048912 Bacteria 3372
707 Ga0496109_0372800 3300048912 Bacteria 1348
708 Ga0496110_0007695 3300048913 Bacteria 8620
709 Ga0496110_0018621 3300048913 Bacteria 5824
710 Ga0496110_0028880 3300048913 Bacteria 4767
711 Ga0496110_0163974 3300048913 Bacteria 2015
712 Ga0496111_0003597 3300048914 Bacteria 9607
713 Ga0496111_0082770 3300048914 Bacteria 2344
714 Ga0496111_0127639 3300048914 Bacteria 1881
715 Ga0496112_0021305 3300048915 Bacteria 6162
716 Ga0496112_0025430 3300048915 Bacteria 5685
717 Ga0496112_0028407 3300048915 Bacteria 5399
718 Ga0496112_0070372 3300048915 Bacteria 3457
719 Ga0496113_0005354 3300048916 Bacteria 7996
720 Ga0496113_0006480 3300048916 Bacteria 7425
721 Ga0496113_0084714 3300048916 Bacteria 2434
722 Ga0496114_0004664 3300048917 Bacteria 10654
723 Ga0496114_0008103 3300048917 Bacteria 8322
724 Ga0496114_0110348 3300048917 Bacteria 2356
725 Ga0496114_1358833 3300048917 Bacteria 598
726 Ga0496115_0005898 3300048918 Bacteria 8932
727 Ga0496115_0018787 3300048918 Bacteria 5313
728 Ga0496115_0036422 3300048918 Bacteria 3896
729 Ga0496115_0266100 3300048918 Bacteria 1409
730 Ga0496115_0330665 3300048918 Bacteria 1245
731 Ga0496115_0689995 3300048918 Bacteria 804
732 Ga0496117_0163140 3300048920 Bacteria 1303
733 Ga0496119_0033029 3300048922 Bacteria 3440
734 Ga0496119_0407421 3300048922 Bacteria 648
735 Ga0496120_0125166 3300048923 Bacteria 1324
736 Ga0496120_0140607 3300048923 Bacteria 1226
737 Ga0496121_0115654 3300048924 Bacteria 2036
738 Ga0496121_0117262 3300048924 Bacteria 2017
739 Ga0496121_0144691 3300048924 Bacteria 1758
740 Ga0496121_0162927 3300048924 Bacteria 1628
741 Ga0496121_0667498 3300048924 Bacteria 631
742 Ga0496121_0725905 3300048924 Bacteria 594
743 Ga0496124_0160570 3300048927 Bacteria 1752
744 Ga0496124_0343699 3300048927 Bacteria 1058
745 Ga0496124_0838671 3300048927 Bacteria 565
746 Ga0496126_0048684 3300048929 Bacteria 3872
747 Ga0496126_0051129 3300048929 Bacteria 3763
748 Ga0496126_0095324 3300048929 Bacteria 2610
749 Ga0496126_0143672 3300048929 Bacteria 2051
750 Ga0496126_0183448 3300048929 Bacteria 1776
751 Ga0496126_0195935 3300048929 Bacteria 1708
752 Ga0495682_0149792 3300049460 Bacteria 832
753 Ga0501039_0151466 3300049575 Bacteria 1822
754 Ga0501040_0408954 3300049576 Bacteria 975
755 Ga0501048_0374792 3300049582 Bacteria 1016
756 Ga0501067_0143110 3300049583 Bacteria 1332
757 Ga0501069_0084753 3300049585 Bacteria 1788
758 Ga0501071_0603174 3300049587 Bacteria 844
759 Ga0501076_0129214 3300049592 Bacteria 2049
760 Ga0501253_076654 3300049683 Bacteria 748
761 Ga0501080_1349116 3300049742 Bacteria 610
762 Ga0501083_0452968 3300049744 Bacteria 835
763 nmdc:mga03683_110337_c1 3300050489 Bacteria 1216
764 nmdc:mga03683_25789_c1 3300050489 Bacteria 930
765 nmdc:mga03n38_147412_c1 3300050490 Bacteria 1181
766 nmdc:mga03n38_233004_c1 3300050490 Bacteria 966
767 nmdc:mga03n38_40050_c1 3300050490 Bacteria 2035
768 nmdc:mga03n38_598708_c1 3300050490 Bacteria 628
769 nmdc:mga00v17_20753_c1 3300050491 Bacteria 3768
770 nmdc:mga00v17_39463_c1 3300050491 Bacteria 2828
771 nmdc:mga0yw44_11143_c1 3300050492 Bacteria 4625
772 nmdc:mga0yw44_17750_c1 3300050492 Bacteria 3881
773 nmdc:mga0yw44_237547_c1 3300050492 Bacteria 1211
774 nmdc:mga0yw44_271400_c1 3300050492 Bacteria 1132
775 nmdc:mga0yw44_687794_c1 3300050492 Bacteria 695
776 nmdc:mga0yw44_712432_c1 3300050492 Bacteria 682
777 nmdc:mga0k408_208302_c1 3300050493 Bacteria 1167
778 nmdc:mga0k408_247025_c1 3300050493 Bacteria 1066
779 nmdc:mga0k408_316344_c1 3300050493 Bacteria 931
780 nmdc:mga0k408_500603_c1 3300050493 Bacteria 720
781 nmdc:mga0k408_92347_c1 3300050493 Bacteria 1779
782 nmdc:mga06z11_102986_c1 3300050494 Bacteria 1569
783 nmdc:mga06z11_114484_c1 3300050494 Bacteria 1497
784 nmdc:mga06z11_396166_c1 3300050494 Bacteria 831
785 nmdc:mga06z11_84892_c1 3300050494 Bacteria 1707
786 nmdc:mga04h51_102634_c1 3300050495 Bacteria 1044
787 nmdc:mga04h51_240865_c1 3300050495 Bacteria 722
788 nmdc:mga07m45_229537_c1 3300050496 Bacteria 1080
789 nmdc:mga07m45_359804_c1 3300050496 Bacteria 845
790 nmdc:mga05p37_280399_c1 3300050507 Bacteria 1988
791 nmdc:mga09592_864812_c1 3300050508 Bacteria 762
792 nmdc:mga08y16_252069_c1 3300050511 Bacteria 1824
793 nmdc:mga08y16_52748_c1 3300050511 Bacteria 4254
794 nmdc:mga0n895_231793_c1 3300050512 Bacteria 1874
795 nmdc:mga0n895_96815_c1 3300050512 Bacteria 2956
796 nmdc:mga0rr50_510481_c1 3300050513 Bacteria 1022
797 nmdc:mga08x19_156384_c1 3300050514 Bacteria 1546
798 nmdc:mga0sz30_173101_c1 3300050516 Bacteria 957
799 nmdc:mga0sz30_2375_c1 3300050516 Bacteria 6399
800 Ga0495601_0182233 3300053077 Bacteria 1373
801 Ga0495612_0353284 3300053078 Bacteria 664
802 Ga0500635_0042806 3300053080 Bacteria 1520
803 Ga0495655_0030987 3300053083 Bacteria 1298
804 Ga0495655_0137101 3300053083 Bacteria 758
805 Ga0495655_0184621 3300053083 Bacteria 674
806 Ga0495595_0022694 3300053084 Bacteria 2757
807 Ga0495619_0076255 3300053085 Bacteria 2251
808 Ga0495619_0147462 3300053085 Bacteria 1622
809 Ga0495619_0472951 3300053085 Bacteria 863
810 Ga0495619_0479230 3300053085 Bacteria 857
811 Ga0495619_0505978 3300053085 Bacteria 830
812 Ga0500643_034871 3300053087 Bacteria 1513
813 Ga0500583_0236271 3300053092 Bacteria 904
814 Ga0500651_0614898 3300053093 Bacteria 588
815 Ga0500556_0120072 3300053104 Bacteria 1025
816 Ga0500562_057460 3300053108 Bacteria 1044
817 Ga0500595_002264 3300053119 Bacteria 9721
818 Ga0500621_286602 3300053126 Bacteria 534
819 Ga0500652_169256 3300053131 Bacteria 900
820 Ga0500568_0013761 3300053139 Bacteria 3677
821 Ga0500568_0085210 3300053139 Bacteria 1196
822 Ga0500588_0099133 3300053146 Bacteria 1002
823 Ga0500590_079426 3300053148 Bacteria 1615
824 Ga0500604_0027224 3300053151 Bacteria 1653
825 Ga0500627_0268999 3300053158 Bacteria 751
826 Ga0500638_089332 3300053162 Bacteria 1453
827 Ga0500637_0037350 3300053178 Bacteria 2730
828 Ga0500645_020334 3300053730 Bacteria 2058
829 Ga0500601_007746 3300053737 Bacteria 1191
830 2509147140 2508501128 Bacteria 8613869
831 2513697362 2513237101 Bacteria 7952346
832 2513894520 2513237141 Bacteria 8496279
833 2524464017 2524023210 Bacteria 9029266
834 2723843142 2721755755 Bacteria 8322773
835 2793079455
836 2874612529 2874604998 Bacteria 7834745
837 2876815419 2876808645 Bacteria 8824342
838 2879117971 2879110137 Bacteria 8907982
839 2885389063 2885383462 Bacteria 9473874
840 2889033557 2889033259 Bacteria 9099371
841 2903773563 2903768456 Bacteria 9749579
842 2922366933 2922361189 Bacteria 7436256
843 2922390290 2922386360 Bacteria 7017218
844 2935680391 2935675223 Bacteria 9928132
845 8006971341 8006964411 Bacteria 8966052
846 8006989293 8006984368 Bacteria 9651211
847 8006997769 8006994254 Bacteria 8309700
848 Ga0207671_10046369
849 JGI25153J46596_10000738
850 JGI25404J52841_10034065
851 JGI25404J52841_10045997
852 Ga0070658_10204841
853 Ga0070658_11232997
854 Ga0070683_100046407
855 Ga0070683_100085825
856 Ga0070683_100711428
857 Ga0070690_100013883
858 Ga0070690_100167770
859 Ga0068869_100111564
860 Ga0068869_100140009
861 Ga0068869_100678915
862 Ga0070680_100041234
863 Ga0070680_100097113
864 Ga0070682_100081625
865 Ga0070682_100166454
866 Ga0068868_100105245
867 Ga0068868_100840835
868 Ga0070660_100045219
869 Ga0070660_100723886
870 Ga0070689_100087788
871 Ga0070689_100386224
872 Ga0070691_10017425
873 Ga0070691_10687710
874 Ga0070661_100106092
875 Ga0070661_100155180
876 Ga0070668_100108937
877 Ga0070668_100384927
878 Ga0070668_100776887
879 Ga0070671_100216516
880 Ga0070671_100270463
881 Ga0070674_100035143
882 Ga0070674_100606462
883 Ga0070673_100112844
884 Ga0070688_100636508
885 Ga0070659_100306833
886 Ga0070667_100818892
887 Ga0070709_10006702
888 Ga0070709_10056857
889 Ga0070714_100038279
890 Ga0070713_100000639
891 Ga0070713_100162001
892 Ga0070713_100186503
893 Ga0070713_100437271
894 Ga0070713_101666109
895 Ga0070710_10000587
896 Ga0070710_10011649
897 Ga0070710_10365614
898 Ga0070711_100002894
899 Ga0070711_100010862
900 Ga0070711_100056134
901 Ga0070711_100504301
902 Ga0070700_100402497
903 Ga0070694_100282225
904 Ga0070663_100047725
905 Ga0070663_100136230
906 Ga0070663_100342347
907 Ga0070663_100419404
908 Ga0070663_101191428
909 Ga0070678_100007967
910 Ga0070678_100035283
911 Ga0070678_100039559
912 Ga0070678_100182435
913 Ga0070678_100667614
914 Ga0070678_100949599
915 Ga0070678_101210350
916 Ga0070662_101085215
917 Ga0070662_101308940
918 Ga0070681_10243335
919 Ga0070681_10326740
920 Ga0070681_10616512
921 Ga0068867_100427323
922 Ga0070706_100295436
923 Ga0070706_100686722
924 Ga0070698_100446026
925 Ga0070699_100401973
926 Ga0070679_100037593
927 Ga0070679_100121452
928 Ga0070684_100048506
929 Ga0070684_100071583
930 Ga0070697_100661171
931 Ga0068853_100022775
932 Ga0068853_101513461
933 Ga0070672_100173630
934 Ga0070672_100249753
935 Ga0070672_100433265
936 Ga0070672_100985026
937 Ga0070695_100997145
938 Ga0070665_100020950
939 Ga0070665_100141030
940 Ga0070665_101145853
941 Ga0070704_100139027
942 Ga0068855_100037992
943 Ga0068855_100978600
944 Ga0068857_100096949
945 Ga0068854_100115871
946 Ga0068854_101587808
947 Ga0068856_100305264
948 Ga0068852_100045466
949 Ga0068852_100103442
950 Ga0068852_100121441
951 Ga0068859_100067475
952 Ga0068859_101145404
953 Ga0068866_10088106
954 Ga0068866_10249820
955 Ga0068861_100184644
956 Ga0068861_100428231
957 Ga0068861_100478419
958 Ga0068861_100727947
959 Ga0068861_100728080
960 Ga0068861_100860445
961 Ga0068851_10020777
962 Ga0068870_10648718
963 Ga0068863_100441310
964 Ga0068863_100487712
965 Ga0068863_101117319
966 Ga0068863_101234951
967 Ga0068858_100647625
968 Ga0068858_100650875
969 Ga0068858_100790473
970 Ga0068860_100272452
971 Ga0068860_100297484
972 Ga0068860_100688221
973 Ga0068862_100197996
974 Ga0068862_100345724
975 Ga0068862_100674795
976 Ga0068862_100890268
977 Ga0081540_1000996
978 Ga0081540_1008013
979 Ga0081540_1010852
980 Ga0081540_1028988
981 Ga0081540_1070603
982 Ga0081540_1084170
983 Ga0070717_10014303
984 Ga0070717_10016137
985 Ga0070717_10652728
986 Ga0070717_10768691
987 Ga0075365_10018424
988 Ga0075365_10081134
989 Ga0075365_10192006
990 Ga0075368_10075758
991 Ga0075368_10122459
992 Ga0075363_100019054
993 Ga0075363_100123081
994 Ga0075363_100219492
995 Ga0075364_10022187
996 Ga0075364_10024862
997 Ga0075432_10117063
998 Ga0070715_10000260
999 Ga0070715_10152161
1000 Ga0070715_10180972
1001 Ga0070715_10784804
1002 Ga0070716_100000213
1003 Ga0070716_100788485
1004 Ga0070712_100016528
1005 Ga0070712_100030454
1006 Ga0070712_100307522
1007 Ga0070712_100596097
1008 Ga0070712_101200732
1009 Ga0075362_10008950
1010 Ga0075362_10017105
1011 Ga0075367_10081513
1012 Ga0075367_10220969
1013 Ga0075367_10394915
1014 Ga0075369_10026249
1015 Ga0075369_10190453
1016 Ga0075369_10225014
1017 Ga0075366_10074726
1018 Ga0075366_10159577
1019 Ga0075366_10307885
1020 Ga0075366_10330866
1021 Ga0075366_10334142
1022 Ga0097621_100146155
1023 Ga0097621_100468823
1024 Ga0097621_100610753
1025 Ga0075370_10092808
1026 Ga0075370_10148475
1027 Ga0075370_10180483
1028 Ga0075370_10241932
1029 Ga0068871_100220538
1030 Ga0068871_100239002
1031 Ga0068871_100343989
1032 Ga0068871_100616684
1033 Ga0075428_100220390
1034 Ga0075434_100357445
1035 Ga0075434_100422251
1036 Ga0075434_101885805
1037 Ga0075429_101026858
1038 Ga0068865_100035745
1039 Ga0068865_100094453
1040 Ga0068865_100686260
1041 Ga0097620_100067486
1042 Ga0097620_101145396
1043 Ga0099794_10607846
1044 Ga0105250_10229701
1045 Ga0105240_10023381
1046 Ga0111539_10089698
1047 Ga0111539_10335277
1048 Ga0111539_10654197
1049 Ga0105245_10699423
1050 Ga0105247_10196299
1051 Ga0105247_10377793
1052 Ga0105247_10423711
1053 Ga0105247_10510664
1054 Ga0105247_10526546
1055 Ga0114129_10345513
1056 Ga0114129_12095665
1057 Ga0105243_10421131
1058 Ga0105241_10148258
1059 Ga0105242_10136248
1060 Ga0105242_10380007
1061 Ga0105248_10186176
1062 Ga0105248_11246741
1063 Ga0105248_11534024
1064 Ga0105248_11800019
1065 Ga0105248_12412611
1066 Ga0105237_10005728
1067 Ga0105237_10022378
1068 Ga0105237_10210020
1069 Ga0105237_10377248
1070 Ga0105237_10501099
1071 Ga0105237_10512303
1072 Ga0105238_10008040
1073 Ga0105238_10273510
1074 Ga0105238_10766484
1075 Ga0105249_10215265
1076 Ga0105249_10548053
1077 Ga0105249_10577928
1078 Ga0105249_11118552
1079 Ga0099796_10076649
1080 Ga0105239_10024893
1081 Ga0105239_10175718
1082 Ga0105246_10409631
1083 Ga0105246_11009239
1084 Ga0157370_10573190
1085 Ga0157370_10591335
1086 Ga0157369_10005591
1087 Ga0157369_10058666
1088 Ga0157369_10139062
1089 Ga0157369_11403379
1090 Ga0157374_10430092
1091 Ga0157374_10795978
1092 Ga0157378_10336043
1093 Ga0163162_10463681
1094 Ga0163162_10643681
1095 Ga0163162_11002550
1096 Ga0163162_12084648
1097 Ga0163162_12124838
1098 Ga0157375_10022963
1099 Ga0157375_10370365
1100 Ga0157375_10726273
1101 Ga0157375_10748276
1102 Ga0163163_10250536
1103 Ga0163163_10386048
1104 Ga0157380_10181760
1105 Ga0157380_10280804
1106 Ga0157380_10469416
1107 Ga0182008_10309086
1108 Ga0157377_10388553
1109 Ga0157379_10218455
1110 Ga0157379_12579359
1111 Ga0182007_10163807
1112 Ga0163161_10292705
1113 Ga0213873_10021246
1114 Ga0213876_10021664
1115 Ga0213875_10013237
1116 Ga0209758_1037278
1117 Ga0207697_10042990
1118 Ga0207697_10067325
1119 Ga0207656_10021724
1120 Ga0207692_10000295
1121 Ga0207692_10013187
1122 Ga0207692_10238312
1123 Ga0207692_10276885
1124 Ga0207642_10070349
1125 Ga0207642_10149150
1126 Ga0207710_10219092
1127 Ga0207688_10056972
1128 Ga0207688_10078530
1129 Ga0207647_10403377
1130 Ga0207685_10052993
1131 Ga0207685_10077989
1132 Ga0207699_10007555
1133 Ga0207699_10023406
1134 Ga0207645_10061625
1135 Ga0207705_10263517
1136 Ga0207684_10197578
1137 Ga0207707_10000455
1138 Ga0207707_10468889
1139 Ga0207695_10126008
1140 Ga0207671_10138314
1141 Ga0207671_10296442
1142 Ga0207671_10310201
1143 Ga0207671_10381600
1144 Ga0207693_10000674
1145 Ga0207693_10001851
1146 Ga0207693_10015809
1147 Ga0207693_10050083
1148 Ga0207693_10067664
1149 Ga0207663_10001588
1150 Ga0207663_10009598
1151 Ga0207663_10042485
1152 Ga0207660_10065575
1153 Ga0207660_11010440
1154 Ga0207657_10001360
1155 Ga0207652_10001894
1156 Ga0207652_10093384
1157 Ga0207694_10039433
1158 Ga0207694_10993350
1159 Ga0207687_10489152
1160 Ga0207700_10007259
1161 Ga0207700_10012187
1162 Ga0207700_10074150
1163 Ga0207700_10430378
1164 Ga0207700_11255226
1165 Ga0207664_10037043
1166 Ga0207664_10055294
1167 Ga0207664_10229713
1168 Ga0207644_10977860
1169 Ga0207644_11049904
1170 Ga0207690_10605731
1171 Ga0207706_10265785
1172 Ga0207686_10164109
1173 Ga0207686_10293278
1174 Ga0207686_10553192
1175 Ga0207709_10129363
1176 Ga0207670_10162598
1177 Ga0207669_10010625
1178 Ga0207669_10018303
1179 Ga0207704_10029068
1180 Ga0207704_10078158
1181 Ga0207704_10280412
1182 Ga0207704_10450085
1183 Ga0207704_10876513
1184 Ga0207665_10000214
1185 Ga0207665_10033322
1186 Ga0207665_10096749
1187 Ga0207691_10065199
1188 Ga0207691_10258482
1189 Ga0207691_10339415
1190 Ga0207711_10040565
1191 Ga0207711_10955443
1192 Ga0207689_10121032
1193 Ga0207689_10479860
1194 Ga0207661_10002719
1195 Ga0207661_10294037
1196 Ga0207661_10931377
1197 Ga0207679_10193770
1198 Ga0207679_10284023
1199 Ga0207667_10023687
1200 Ga0207667_10154277
1201 Ga0207651_10394540
1202 Ga0207651_10505896
1203 Ga0207712_10151232
1204 Ga0207712_10280574
1205 Ga0207712_10315584
1206 Ga0207712_10555030
1207 Ga0207712_10639570
1208 Ga0207712_10708308
1209 Ga0207668_10047201
1210 Ga0207668_10300481
1211 Ga0207668_10747410
1212 Ga0207640_10203072
1213 Ga0207658_10851444
1214 Ga0207677_10297427
1215 Ga0207677_10669261
1216 Ga0207703_10391072
1217 Ga0207703_10429766
1218 Ga0207703_10632625
1219 Ga0207703_11135097
1220 Ga0207639_10016673
1221 Ga0207639_10143069
1222 Ga0207639_10274317
1223 Ga0207678_10029610
1224 Ga0207678_10035630
1225 Ga0207678_10071503
1226 Ga0207678_10187503
1227 Ga0207678_10212330
1228 Ga0207678_10229302
1229 Ga0207678_10332732
1230 Ga0207708_10290076
1231 Ga0207641_10186159
1232 Ga0207641_10720666
1233 Ga0207641_10745576
1234 Ga0207648_10166283
1235 Ga0207676_12052619
1236 Ga0207674_10043139
1237 Ga0207675_100144538
1238 Ga0207675_100208285
1239 Ga0207675_100281521
1240 Ga0207675_100304369
1241 Ga0207675_100308354
1242 Ga0207683_10038663
1243 Ga0207683_10185005
1244 Ga0207683_10195445
1245 Ga0207683_10218970
1246 Ga0207683_10348917
1247 Ga0207683_10857372
1248 Ga0207698_10016150
1249 Ga0207698_10418598
1250 Ga0209813_10213110
1251 Ga0207428_10062077
1252 Ga0268266_10013121
1253 Ga0268266_10016287
1254 Ga0268266_10430651
1255 Ga0268265_10082483
1256 Ga0268265_10404034
1257 Ga0268264_10281335
1258 Ga0268264_10295862
1259 Ga0268264_10547334
1260 Ga0268264_11101328
1261 Ga0265337_1081691
1262 Ga0265326_10040065
1263 Ga0265319_1044016
1264 Ga0265334_10027999
1265 Ga0265323_10003068
1266 Ga0265322_10167050
1267 Ga0265336_10000859
1268 Ga0307517_10247537
1269 Ga0265338_10000013
1270 Ga0265324_10074979
1271 Ga0265339_10013486
1272 Ga0307513_10028716
1273 Ga0307509_10165469
1274 Ga0307509_10439273
1275 Ga0307509_10482178
1276 Ga0307508_10000034
1277 Ga0307516_10025519
1278 Ga0307516_10025796
1279 Ga0307405_10323080
1280 Ga0307405_11486689
1281 Ga0307405_11584876
1282 Ga0307406_10083660
1283 Ga0307406_10459534
1284 Ga0307406_10536560
1285 Ga0307406_10612986
1286 Ga0307412_10103281
1287 Ga0307412_10198455
1288 Ga0307409_101046979
1289 Ga0307416_100868086
1290 Ga0307414_10290685
1291 Ga0307414_10619343
1292 Ga0307411_11316122
1293 Ga0307510_10009700
1294 Ga0307510_10019525
1295 Ga0373930_0021715
1296 Ga0373938_0095645
1297 Ga0373952_0030864
1298 Ga0373923_0011318
1299 Ga0373932_0005334
1300 Ga0373932_0190672
1301 Ga0373941_0125165
1302 Ga0373945_0023726
1303 Ga0373954_0046188
1304 Ga0373960_0026103
1305 Ga0373960_0239337
1306 Ga0373943_0026562
1307 Ga0373946_0186293
1308 Ga0373955_0011011
1309 Ga0373955_0030328
1310 Ga0373955_0067511
1311 Ga0373955_0110258
1312 Ga0373942_0075522
1313 Ga0373924_0033016
1314 Ga0373924_0041591
1315 Ga0373931_0001895
1316 Ga0373931_0519099
1317 Ga0373931_0527053
1318 Ga0373935_0003068
1319 Ga0373927_0004108
1320 Ga0373927_0023382
1321 Ga0373927_0035091
1322 Ga0373927_0084258
1323 Ga0373933_0061032
1324 Ga0373933_0329103
1325 Ga0373947_0006080
1326 Ga0373937_0045613
1327 Ga0373937_0388974
1328 Ga0373937_0713768
1329 Ga0373925_0028943
1330 Ga0373925_0405153
1331 Ga0373925_0454881
1332 Ga0395900_0085903
1333 Ga0395898_0025898
1334 Ga0395905_0100628
1335 Ga0395905_0108120
1336 Ga0395905_1155520
1337 Ga0436364_0636868
1338 Ga0395901_0751093
1339 Ga0436365_0239398
1340 Ga0436365_1782545
1341 Ga0436360_0024377
1342 Ga0436360_0920934
1343 Ga0436361_0024877
1344 Ga0436361_0289886
1345 Ga0436361_0536600
1346 Ga0436361_0928467
1347 Ga0436363_1080177
1348 Ga0436362_0128160
1349 Ga0436362_0771524
1350 Ga0439465_0118292
1351 Ga0439465_0211306
1352 Ga0451795_1468814
1353 Ga0451798_0995831
1354 Ga0451802_2150413
1355 Ga0451835_1106034
1356 Ga0451853_3631163
1357 Ga0439454_004785
1358 Ga0439459_0164150
1359 Ga0439464_0186938
1360 Ga0466963_0115955
1361 Ga0466968_0197809
1362 Ga0466970_0334568
1363 Ga0466959_0013508
1364 Ga0466967_0716561
1365 Ga0495617_006940
1366 Ga0495617_030440
1367 Ga0495617_108255
1368 Ga0495627_119528
1369 Ga0495592_0006658
1370 Ga0495603_0000064
1371 Ga0495603_0029475
1372 Ga0495603_0029732
1373 Ga0495603_0049543
1374 Ga0495629_0001385
1375 Ga0495629_0095759
1376 Ga0495629_0353411
1377 Ga0495638_0045785
1378 Ga0495638_0161249
1379 Ga0495638_0208667
1380 Ga0495641_0005307
1381 Ga0495641_0184280
1382 Ga0495651_0056086
1383 Ga0495651_0541574
1384 Ga0495653_0290916
1385 Ga0495650_0063228
1386 Ga0495650_0222336
1387 Ga0495580_0006847
1388 Ga0495582_0000173
1389 Ga0495582_0072963
1390 Ga0495605_0090050
1391 Ga0495639_0000218
1392 Ga0495639_0070181
1393 Ga0495662_0013475
1394 Ga0495664_0041556
1395 Ga0495664_0045785
1396 Ga0495584_0063161
1397 Ga0495585_0029264
1398 Ga0495594_0000590
1399 Ga0495594_0030720
1400 Ga0495594_0053484
1401 Ga0495596_0093823
1402 Ga0495596_0164633
1403 Ga0495607_0388423
1404 Ga0495606_0314867
1405 Ga0495606_0355611
1406 Ga0495610_0150886
1407 Ga0495610_0215605
1408 Ga0495610_0232949
1409 Ga0495616_0105913
1410 Ga0495618_0241763
1411 Ga0495628_0092922
1412 Ga0495630_0000613
1413 Ga0495632_0061385
1414 Ga0495632_0090578
1415 Ga0495632_0097751
1416 Ga0495643_0183790
1417 Ga0495644_0087385
1418 Ga0495644_0176917
1419 Ga0495644_0258925
1420 Ga0495663_0063068
1421 Ga0495666_0015057
1422 Ga0495652_0050312
1423 Ga0495652_0247135
1424 Ga0495652_0386301
1425 Ga0495665_0000531
1426 Ga0495640_0001572
1427 Ga0495586_0210931
1428 Ga0495586_0268524
1429 Ga0495587_0176942
1430 Ga0495587_0472786
1431 Ga0495598_0026127
1432 Ga0495598_0027478
1433 Ga0495621_0134804
1434 Ga0495621_0226074
1435 Ga0495597_0360420
1436 Ga0495645_0091766
1437 Ga0495622_0004472
1438 Ga0495622_0078533
1439 Ga0495633_0038360
1440 Ga0495633_0275321
1441 Ga0495667_0275820
1442 Ga0495667_0353769
1443 Ga0495656_0005268
1444 Ga0495656_0056879
1445 Ga0495656_0082041
1446 Ga0495656_0089573
1447 Ga0495656_0108972
1448 Ga0495656_0110573
1449 Ga0495668_0044002
1450 Ga0495634_0005581
1451 Ga0495625_0148756
1452 Ga0495635_0021824
1453 Ga0495635_0125225
1454 Ga0495635_0126515
1455 Ga0495659_0006815
1456 Ga0495661_0103488
1457 Ga0495661_0552032
1458 Ga0495588_0022423
1459 Ga0495588_0025243
1460 Ga0495657_0067110
1461 Ga0495599_0427853
1462 Ga0495623_0039786
1463 Ga0495623_0183506
1464 Ga0495623_0494395
1465 Ga0495646_0007737
1466 Ga0495647_0001441
1467 Ga0495647_0014634
1468 Ga0495658_0001201
1469 Ga0495669_0000675
1470 Ga0495669_0104914
1471 Ga0495669_0207424
1472 Ga0495613_0004213
1473 Ga0495624_0005853
1474 Ga0495624_0164859
1475 Ga0495624_0370334
1476 Ga0495670_0012092
1477 Ga0495670_0235856
1478 Ga0495671_0105081
1479 Ga0495671_0233148
1480 Ga0495671_0468364
1481 Ga0495589_0087665
1482 Ga0495589_0330599
1483 Ga0495600_0159162
1484 Ga0495600_0183566
1485 Ga0495581_0000015
1486 Ga0495581_0297782
1487 Ga0495581_0687951
1488 Ga0495604_0129080
1489 Ga0495604_0262333
1490 Ga0495636_0040926
1491 Ga0495636_0183268
1492 Ga0495674_0285389
1493 Ga0495674_0331709
1494 Ga0495674_0388136
1495 Ga0495672_0236902
1496 Ga0495672_0246398
1497 Ga0495676_0010028
1498 Ga0495676_0068201
1499 Ga0495680_0028809
1500 Ga0495680_0287239
1501 Ga0495683_0341062
1502 Ga0495673_0011722
1503 Ga0495673_0102385
1504 Ga0495673_0251120
1505 Ga0495681_0081927
1506 Ga0495684_0020248
1507 Ga0495684_0142254
1508 Ga0495593_0000053
1509 Ga0495593_0229582
1510 Ga0495602_0174049
1511 Ga0495602_0553794
1512 Ga0495602_0709517
1513 Ga0495614_0013513
1514 Ga0495615_0059280
1515 Ga0496100_0001613
1516 Ga0496100_0157079
1517 Ga0496100_0164416
1518 Ga0496100_0767428
1519 Ga0496101_0004421
1520 Ga0496101_0059329
1521 Ga0496101_0092016
1522 Ga0496101_0191351
1523 Ga0496102_0010509
1524 Ga0496102_0012054
1525 Ga0496102_0142359
1526 Ga0496102_0177578
1527 Ga0496102_0195854
1528 Ga0496103_0018374
1529 Ga0496103_0028159
1530 Ga0496103_0060299
1531 Ga0496104_0018347
1532 Ga0496104_0081042
1533 Ga0496104_0156129
1534 Ga0496105_0004722
1535 Ga0496105_0031311
1536 Ga0496105_0258662
1537 Ga0496106_0040286
1538 Ga0496106_0128796
1539 Ga0496106_0175618
1540 Ga0496106_0380327
1541 Ga0496106_0506692
1542 Ga0496106_0929778
1543 Ga0496107_0004750
1544 Ga0496107_0010483
1545 Ga0496107_0135756
1546 Ga0496107_0450600
1547 Ga0496107_0833083
1548 Ga0496108_0027428
1549 Ga0496108_0067242
1550 Ga0496108_0162530
1551 Ga0496109_0007688
1552 Ga0496109_0010512
1553 Ga0496109_0063721
1554 Ga0496109_0372800
1555 Ga0496110_0007695
1556 Ga0496110_0018621
1557 Ga0496110_0028880
1558 Ga0496110_0163974
1559 Ga0496111_0003597
1560 Ga0496111_0082770
1561 Ga0496111_0127639
1562 Ga0496112_0021305
1563 Ga0496112_0025430
1564 Ga0496112_0028407
1565 Ga0496112_0070372
1566 Ga0496113_0005354
1567 Ga0496113_0006480
1568 Ga0496113_0084714
1569 Ga0496114_0004664
1570 Ga0496114_0008103
1571 Ga0496114_0110348
1572 Ga0496114_1358833
1573 Ga0496115_0005898
1574 Ga0496115_0018787
1575 Ga0496115_0036422
1576 Ga0496115_0266100
1577 Ga0496115_0330665
1578 Ga0496115_0689995
1579 Ga0496117_0163140
1580 Ga0496119_0033029
1581 Ga0496119_0407421
1582 Ga0496120_0125166
1583 Ga0496120_0140607
1584 Ga0496121_0115654
1585 Ga0496121_0117262
1586 Ga0496121_0144691
1587 Ga0496121_0162927
1588 Ga0496121_0667498
1589 Ga0496121_0725905
1590 Ga0496124_0160570
1591 Ga0496124_0343699
1592 Ga0496124_0838671
1593 Ga0496126_0048684
1594 Ga0496126_0051129
1595 Ga0496126_0095324
1596 Ga0496126_0143672
1597 Ga0496126_0183448
1598 Ga0496126_0195935
1599 Ga0495682_0149792
1600 Ga0501039_0151466
1601 Ga0501040_0408954
1602 Ga0501048_0374792
1603 Ga0501067_0143110
1604 Ga0501069_0084753
1605 Ga0501071_0603174
1606 Ga0501076_0129214
1607 Ga0501253_076654
1608 Ga0501080_1349116
1609 Ga0501083_0452968
1610 nmdc:mga03683_110337_c1
1611 nmdc:mga03683_25789_c1
1612 nmdc:mga03n38_147412_c1
1613 nmdc:mga03n38_233004_c1
1614 nmdc:mga03n38_40050_c1
1615 nmdc:mga03n38_598708_c1
1616 nmdc:mga00v17_20753_c1
1617 nmdc:mga00v17_39463_c1
1618 nmdc:mga0yw44_11143_c1
1619 nmdc:mga0yw44_17750_c1
1620 nmdc:mga0yw44_237547_c1
1621 nmdc:mga0yw44_271400_c1
1622 nmdc:mga0yw44_687794_c1
1623 nmdc:mga0yw44_712432_c1
1624 nmdc:mga0k408_208302_c1
1625 nmdc:mga0k408_247025_c1
1626 nmdc:mga0k408_316344_c1
1627 nmdc:mga0k408_500603_c1
1628 nmdc:mga0k408_92347_c1
1629 nmdc:mga06z11_102986_c1
1630 nmdc:mga06z11_114484_c1
1631 nmdc:mga06z11_396166_c1
1632 nmdc:mga06z11_84892_c1
1633 nmdc:mga04h51_102634_c1
1634 nmdc:mga04h51_240865_c1
1635 nmdc:mga07m45_229537_c1
1636 nmdc:mga07m45_359804_c1
1637 nmdc:mga05p37_280399_c1
1638 nmdc:mga09592_864812_c1
1639 nmdc:mga08y16_252069_c1
1640 nmdc:mga08y16_52748_c1
1641 nmdc:mga0n895_231793_c1
1642 nmdc:mga0n895_96815_c1
1643 nmdc:mga0rr50_510481_c1
1644 nmdc:mga08x19_156384_c1
1645 nmdc:mga0sz30_173101_c1
1646 nmdc:mga0sz30_2375_c1
1647 Ga0495601_0182233
1648 Ga0495612_0353284
1649 Ga0500635_0042806
1650 Ga0495655_0030987
1651 Ga0495655_0137101
1652 Ga0495655_0184621
1653 Ga0495595_0022694
1654 Ga0495619_0076255
1655 Ga0495619_0147462
1656 Ga0495619_0472951
1657 Ga0495619_0479230
1658 Ga0495619_0505978
1659 Ga0500643_034871
1660 Ga0500583_0236271
1661 Ga0500651_0614898
1662 Ga0500556_0120072
1663 Ga0500562_057460
1664 Ga0500595_002264
1665 Ga0500621_286602
1666 Ga0500652_169256
1667 Ga0500568_0013761
1668 Ga0500568_0085210
1669 Ga0500588_0099133
1670 Ga0500590_079426
1671 Ga0500604_0027224
1672 Ga0500627_0268999
1673 Ga0500638_089332
1674 Ga0500637_0037350
1675 Ga0500645_020334
1676 Ga0500601_007746
1677 2509147140
1678 2513697362
1679 2513894520
1680 2524464017
1681 2723843142
1682 2793079455
1683 2874612529
1684 2876815419
1685 2879117971
1686 2885389063
1687 2889033557
1688 2903773563
1689 2922366933
1690 2922390290
1691 2935680391
1692 8006971341
1693 8006989293
1694 8006997769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

21

130

0.79

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

129

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

48

128

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9242 1 157
7ovv-assembly1.cif.gz_A crystal structure of the arabidopsis thaliana thialysine acetyltransferase atnata2 0.9147 3 149
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9138 4 157
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9078 1 157
7ovv-assembly1.cif.gz_B crystal structure of the arabidopsis thaliana thialysine acetyltransferase atnata2 0.8992 3 149
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9375 1 157 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.928 2 159 3.40.630.30
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9207 1 157 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.917 2 159 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9138 4 157 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6I3JPZ9-F1-model_v4 deleted 0.9707 1 93
AF-A0A7I7PG00-F1-model_v4 N-acetyltransferase GCN5 0.9674 1 123 GO:0008080
AF-A0A537GXG3-F1-model_v4 GNAT family N-acetyltransferase 0.9672 2 93 GO:0008080
AF-A0A7X8CKI2-F1-model_v4 GNAT family N-acetyltransferase 0.9606 3 144 GO:0008080
AF-A0A6I3JPZ9-F1-model_v4 deleted 0.9606 1 93

Map