F483047
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 840 | 270 | 840 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100002164|Ga0075428_10000216418 |
| Length | 132 |
| Sequence | MRGRLDHGMTRRQFEAMVEKALRKLPKDFRDKIANIAVVVEDWADEETLAEMGIEPPDTLYGLYRGVDLTARDSSYGNVLPDVITIYQGPIEEDAADEAEMGEIVRETVVHELGHYFGLDDDTMHRIEDGEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 186 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 202 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 203 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 206 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 213 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0.12 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 99.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058862_11757738 | 3300004803 | Unclassified | 810 |
| 2 | Ga0065712_10245799 | 3300005290 | Bacteria | 972 |
| 3 | Ga0065715_10011729 | 3300005293 | Bacteria | 3428 |
| 4 | Ga0065707_10377532 | 3300005295 | Bacteria | 876 |
| 5 | Ga0065707_10611206 | 3300005295 | Bacteria | 684 |
| 6 | Ga0070676_10267179 | 3300005328 | Bacteria | 1147 |
| 7 | Ga0070676_10324717 | 3300005328 | Bacteria | 1051 |
| 8 | Ga0070683_100197198 | 3300005329 | Bacteria | 1912 |
| 9 | Ga0070690_100459511 | 3300005330 | Bacteria | 945 |
| 10 | Ga0070670_100017818 | 3300005331 | Bacteria | 6094 |
| 11 | Ga0070677_10143732 | 3300005333 | Bacteria | 1103 |
| 12 | Ga0068869_100002767 | 3300005334 | Bacteria | 10622 |
| 13 | Ga0068869_100004989 | 3300005334 | Bacteria | 8308 |
| 14 | Ga0068869_100101413 | 3300005334 | Bacteria | 2177 |
| 15 | Ga0070680_100007214 | 3300005336 | Bacteria | 8472 |
| 16 | Ga0070680_100012717 | 3300005336 | Bacteria | 6541 |
| 17 | Ga0070680_100288171 | 3300005336 | Bacteria | 1392 |
| 18 | Ga0070682_100001205 | 3300005337 | Bacteria | 14746 |
| 19 | Ga0068868_100020041 | 3300005338 | Bacteria | 5018 |
| 20 | Ga0070689_100179716 | 3300005340 | Bacteria | 1718 |
| 21 | Ga0070689_100298731 | 3300005340 | Bacteria | 1340 |
| 22 | Ga0070691_10009079 | 3300005341 | Bacteria | 4546 |
| 23 | Ga0070691_10031148 | 3300005341 | Bacteria | 2501 |
| 24 | Ga0070691_10034723 | 3300005341 | Unclassified | 2374 |
| 25 | Ga0070691_10246765 | 3300005341 | Bacteria | 956 |
| 26 | Ga0070687_100084688 | 3300005343 | Bacteria | 1738 |
| 27 | Ga0070687_100741975 | 3300005343 | Bacteria | 690 |
| 28 | Ga0070661_100034153 | 3300005344 | Bacteria | 3688 |
| 29 | Ga0070692_10002740 | 3300005345 | Bacteria | 6926 |
| 30 | Ga0070692_10023433 | 3300005345 | Bacteria | 3025 |
| 31 | Ga0070692_10077902 | 3300005345 | Bacteria | 1779 |
| 32 | Ga0070668_100667745 | 3300005347 | Bacteria | 914 |
| 33 | Ga0070668_100768139 | 3300005347 | Unclassified | 854 |
| 34 | Ga0070669_100004573 | 3300005353 | Bacteria | 9989 |
| 35 | Ga0070669_100049648 | 3300005353 | Bacteria | 3063 |
| 36 | Ga0070675_100228953 | 3300005354 | Bacteria | 1621 |
| 37 | Ga0070675_100657013 | 3300005354 | Bacteria | 953 |
| 38 | Ga0070674_100510951 | 3300005356 | Bacteria | 1002 |
| 39 | Ga0070673_100138359 | 3300005364 | Bacteria | 2052 |
| 40 | Ga0070659_100054477 | 3300005366 | Unclassified | 3150 |
| 41 | Ga0070667_100134028 | 3300005367 | Bacteria | 2165 |
| 42 | Ga0070713_101373939 | 3300005436 | Unclassified | 685 |
| 43 | Ga0070701_10140966 | 3300005438 | Bacteria | 1378 |
| 44 | Ga0070701_10174487 | 3300005438 | Bacteria | 1254 |
| 45 | Ga0070711_100009216 | 3300005439 | Bacteria | 6068 |
| 46 | Ga0070711_100124791 | 3300005439 | Bacteria | 1910 |
| 47 | Ga0070705_100000542 | 3300005440 | Bacteria | 21855 |
| 48 | Ga0070705_100022294 | 3300005440 | Bacteria | 3383 |
| 49 | Ga0070705_100080985 | 3300005440 | Unclassified | 1993 |
| 50 | Ga0070705_100081654 | 3300005440 | Bacteria | 1987 |
| 51 | Ga0070705_100291214 | 3300005440 | Unclassified | 1165 |
| 52 | Ga0070700_100051905 | 3300005441 | Bacteria | 2555 |
| 53 | Ga0070700_100155761 | 3300005441 | Bacteria | 1567 |
| 54 | Ga0070700_100503985 | 3300005441 | Bacteria | 932 |
| 55 | Ga0070694_100000758 | 3300005444 | Bacteria | 18068 |
| 56 | Ga0070694_100004529 | 3300005444 | Bacteria | 8358 |
| 57 | Ga0070694_100009642 | 3300005444 | Bacteria | 5926 |
| 58 | Ga0070694_100012156 | 3300005444 | Bacteria | 5348 |
| 59 | Ga0070694_100046317 | 3300005444 | Bacteria | 2919 |
| 60 | Ga0070694_100058837 | 3300005444 | Bacteria | 2616 |
| 61 | Ga0070694_100082060 | 3300005444 | Bacteria | 2244 |
| 62 | Ga0070694_100467478 | 3300005444 | Bacteria | 998 |
| 63 | Ga0070694_100491713 | 3300005444 | Bacteria | 975 |
| 64 | Ga0070694_100824822 | 3300005444 | Bacteria | 762 |
| 65 | Ga0070694_100943122 | 3300005444 | Bacteria | 714 |
| 66 | Ga0070708_100031570 | 3300005445 | Bacteria | 4586 |
| 67 | Ga0070708_100085594 | 3300005445 | Bacteria | 2861 |
| 68 | Ga0070708_100127188 | 3300005445 | Bacteria | 2356 |
| 69 | Ga0070708_100324771 | 3300005445 | Bacteria | 1450 |
| 70 | Ga0070708_100739102 | 3300005445 | Bacteria | 925 |
| 71 | Ga0070708_101191452 | 3300005445 | Bacteria | 712 |
| 72 | Ga0070663_100013971 | 3300005455 | Bacteria | 5140 |
| 73 | Ga0070663_100866568 | 3300005455 | Bacteria | 778 |
| 74 | Ga0070662_100006301 | 3300005457 | Bacteria | 7644 |
| 75 | Ga0070662_100024955 | 3300005457 | Bacteria | 4124 |
| 76 | Ga0070662_100131215 | 3300005457 | Unclassified | 1932 |
| 77 | Ga0070681_10273174 | 3300005458 | Bacteria | 1601 |
| 78 | Ga0070681_10385237 | 3300005458 | Bacteria | 1313 |
| 79 | Ga0068867_100000884 | 3300005459 | Bacteria | 20270 |
| 80 | Ga0068867_100038507 | 3300005459 | Bacteria | 3481 |
| 81 | Ga0068867_100196977 | 3300005459 | Bacteria | 1611 |
| 82 | Ga0068867_100255013 | 3300005459 | Bacteria | 1428 |
| 83 | Ga0068867_101189603 | 3300005459 | Unclassified | 700 |
| 84 | Ga0070706_100046815 | 3300005467 | Bacteria | 3993 |
| 85 | Ga0070706_100064589 | 3300005467 | Bacteria | 3383 |
| 86 | Ga0070706_100097674 | 3300005467 | Bacteria | 2728 |
| 87 | Ga0070706_100116282 | 3300005467 | Bacteria | 2491 |
| 88 | Ga0070706_100132241 | 3300005467 | Bacteria | 2329 |
| 89 | Ga0070706_100264174 | 3300005467 | Bacteria | 1606 |
| 90 | Ga0070706_100524446 | 3300005467 | Unclassified | 1102 |
| 91 | Ga0070706_100729401 | 3300005467 | Bacteria | 918 |
| 92 | Ga0070707_100001624 | 3300005468 | Bacteria | 21802 |
| 93 | Ga0070707_100020638 | 3300005468 | Bacteria | 6217 |
| 94 | Ga0070707_100041460 | 3300005468 | Bacteria | 4406 |
| 95 | Ga0070707_100076514 | 3300005468 | Bacteria | 3228 |
| 96 | Ga0070707_100204283 | 3300005468 | Bacteria | 1926 |
| 97 | Ga0070707_100209644 | 3300005468 | Bacteria | 1899 |
| 98 | Ga0070707_100210990 | 3300005468 | Bacteria | 1893 |
| 99 | Ga0070707_100595038 | 3300005468 | Bacteria | 1068 |
| 100 | Ga0070707_100997634 | 3300005468 | Bacteria | 803 |
| 101 | Ga0070698_100008808 | 3300005471 | Bacteria | 10858 |
| 102 | Ga0070698_100081517 | 3300005471 | Bacteria | 3229 |
| 103 | Ga0070698_100168549 | 3300005471 | Bacteria | 2131 |
| 104 | Ga0070698_100610284 | 3300005471 | Bacteria | 1031 |
| 105 | Ga0070698_100905902 | 3300005471 | Unclassified | 827 |
| 106 | Ga0070699_100004727 | 3300005518 | Bacteria | 12040 |
| 107 | Ga0070699_100013765 | 3300005518 | Bacteria | 6959 |
| 108 | Ga0070699_100026620 | 3300005518 | Bacteria | 4987 |
| 109 | Ga0070699_100028052 | 3300005518 | Bacteria | 4855 |
| 110 | Ga0070699_100031808 | 3300005518 | Bacteria | 4556 |
| 111 | Ga0070699_100057929 | 3300005518 | Bacteria | 3355 |
| 112 | Ga0070699_100231328 | 3300005518 | Unclassified | 1648 |
| 113 | Ga0070699_100283016 | 3300005518 | Bacteria | 1485 |
| 114 | Ga0070699_100403560 | 3300005518 | Bacteria | 1236 |
| 115 | Ga0070699_100781194 | 3300005518 | Bacteria | 874 |
| 116 | Ga0070699_100830911 | 3300005518 | Bacteria | 846 |
| 117 | Ga0070699_101852047 | 3300005518 | Unclassified | 552 |
| 118 | Ga0070679_100267355 | 3300005530 | Bacteria | 1665 |
| 119 | Ga0070679_100415840 | 3300005530 | Bacteria | 1290 |
| 120 | Ga0070679_100857713 | 3300005530 | Unclassified | 851 |
| 121 | Ga0070684_100019566 | 3300005535 | Bacteria | 5603 |
| 122 | Ga0070697_100001002 | 3300005536 | Bacteria | 21307 |
| 123 | Ga0070697_100008817 | 3300005536 | Bacteria | 7872 |
| 124 | Ga0070697_100014904 | 3300005536 | Bacteria | 6102 |
| 125 | Ga0070697_100097916 | 3300005536 | Bacteria | 2434 |
| 126 | Ga0070697_100216812 | 3300005536 | Bacteria | 1630 |
| 127 | Ga0070697_100331569 | 3300005536 | Bacteria | 1312 |
| 128 | Ga0070697_100455484 | 3300005536 | Bacteria | 1115 |
| 129 | Ga0070697_101360882 | 3300005536 | Unclassified | 634 |
| 130 | Ga0068853_100001362 | 3300005539 | Bacteria | 17619 |
| 131 | Ga0070686_100243430 | 3300005544 | Bacteria | 1311 |
| 132 | Ga0070686_100593612 | 3300005544 | Bacteria | 872 |
| 133 | Ga0070686_101389115 | 3300005544 | Bacteria | 589 |
| 134 | Ga0070695_100000685 | 3300005545 | Bacteria | 18104 |
| 135 | Ga0070695_100001464 | 3300005545 | Bacteria | 13072 |
| 136 | Ga0070695_100003725 | 3300005545 | Bacteria | 8892 |
| 137 | Ga0070695_100036448 | 3300005545 | Bacteria | 3096 |
| 138 | Ga0070695_100506558 | 3300005545 | Bacteria | 934 |
| 139 | Ga0070695_100667098 | 3300005545 | Unclassified | 822 |
| 140 | Ga0070696_100005033 | 3300005546 | Bacteria | 8831 |
| 141 | Ga0070696_100012485 | 3300005546 | Bacteria | 5700 |
| 142 | Ga0070696_100134183 | 3300005546 | Bacteria | 1804 |
| 143 | Ga0070696_100335923 | 3300005546 | Bacteria | 1166 |
| 144 | Ga0070696_100855157 | 3300005546 | Bacteria | 752 |
| 145 | Ga0070696_101238939 | 3300005546 | Unclassified | 631 |
| 146 | Ga0070693_100000325 | 3300005547 | Bacteria | 21855 |
| 147 | Ga0070693_100193690 | 3300005547 | Bacteria | 1316 |
| 148 | Ga0070704_100000570 | 3300005549 | Bacteria | 17791 |
| 149 | Ga0070704_100040739 | 3300005549 | Bacteria | 3200 |
| 150 | Ga0070704_100095191 | 3300005549 | Bacteria | 2230 |
| 151 | Ga0070704_100194232 | 3300005549 | Bacteria | 1634 |
| 152 | Ga0070704_100512673 | 3300005549 | Unclassified | 1043 |
| 153 | Ga0070704_100640604 | 3300005549 | Bacteria | 937 |
| 154 | Ga0070704_101522716 | 3300005549 | Unclassified | 615 |
| 155 | Ga0068855_100042404 | 3300005563 | Bacteria | 5391 |
| 156 | Ga0070664_100030854 | 3300005564 | Bacteria | 4474 |
| 157 | Ga0068857_100038731 | 3300005577 | Bacteria | 4221 |
| 158 | Ga0068857_100065385 | 3300005577 | Bacteria | 3233 |
| 159 | Ga0068857_100152804 | 3300005577 | Bacteria | 2092 |
| 160 | Ga0068854_100000353 | 3300005578 | Bacteria | 29520 |
| 161 | Ga0068856_100010705 | 3300005614 | Bacteria | 8910 |
| 162 | Ga0070702_100019599 | 3300005615 | Bacteria | 3532 |
| 163 | Ga0070702_100081011 | 3300005615 | Bacteria | 1944 |
| 164 | Ga0070702_100121552 | 3300005615 | Bacteria | 1636 |
| 165 | Ga0068852_100376216 | 3300005616 | Bacteria | 1392 |
| 166 | Ga0068859_100002575 | 3300005617 | Bacteria | 18433 |
| 167 | Ga0068859_100369171 | 3300005617 | Bacteria | 1530 |
| 168 | Ga0068859_100393232 | 3300005617 | Bacteria | 1482 |
| 169 | Ga0068859_100545229 | 3300005617 | Bacteria | 1254 |
| 170 | Ga0068859_101424093 | 3300005617 | Bacteria | 764 |
| 171 | Ga0068864_100008897 | 3300005618 | Bacteria | 8276 |
| 172 | Ga0068866_10417343 | 3300005718 | Unclassified | 870 |
| 173 | Ga0068861_100033261 | 3300005719 | Bacteria | 3802 |
| 174 | Ga0068861_100453979 | 3300005719 | Bacteria | 1149 |
| 175 | Ga0068870_10028177 | 3300005840 | Bacteria | 2817 |
| 176 | Ga0068870_10484886 | 3300005840 | Bacteria | 821 |
| 177 | Ga0068863_100007896 | 3300005841 | Bacteria | 10405 |
| 178 | Ga0068863_100025704 | 3300005841 | Bacteria | 5615 |
| 179 | Ga0068863_100231289 | 3300005841 | Bacteria | 1783 |
| 180 | Ga0068863_100977756 | 3300005841 | Bacteria | 849 |
| 181 | Ga0068858_100537055 | 3300005842 | Bacteria | 1131 |
| 182 | Ga0068858_101672349 | 3300005842 | Unclassified | 628 |
| 183 | Ga0068860_100004896 | 3300005843 | Bacteria | 13649 |
| 184 | Ga0068860_100046278 | 3300005843 | Bacteria | 4148 |
| 185 | Ga0068860_100077464 | 3300005843 | Bacteria | 3162 |
| 186 | Ga0068860_100119632 | 3300005843 | Bacteria | 2521 |
| 187 | Ga0068860_100233869 | 3300005843 | Bacteria | 1786 |
| 188 | Ga0068860_100331703 | 3300005843 | Bacteria | 1494 |
| 189 | Ga0068860_100356627 | 3300005843 | Bacteria | 1440 |
| 190 | Ga0068860_100602011 | 3300005843 | Bacteria | 1104 |
| 191 | Ga0068862_100036298 | 3300005844 | Bacteria | 4178 |
| 192 | Ga0068862_100050690 | 3300005844 | Bacteria | 3548 |
| 193 | Ga0068862_100065277 | 3300005844 | Bacteria | 3135 |
| 194 | Ga0068862_100092228 | 3300005844 | Bacteria | 2640 |
| 195 | Ga0068862_101285885 | 3300005844 | Bacteria | 732 |
| 196 | Ga0081538_10006559 | 3300005981 | Bacteria | 10220 |
| 197 | Ga0081540_1078670 | 3300005983 | Bacteria | 1493 |
| 198 | Ga0081539_10000009 | 3300005985 | Bacteria | 509286 |
| 199 | Ga0070715_10220217 | 3300006163 | Bacteria | 975 |
| 200 | Ga0070716_100501756 | 3300006173 | Bacteria | 895 |
| 201 | Ga0070712_100001521 | 3300006175 | Bacteria | 14157 |
| 202 | Ga0097621_100284990 | 3300006237 | Unclassified | 1455 |
| 203 | Ga0075428_100001849 | 3300006844 | Bacteria | 22700 |
| 204 | Ga0075428_100002164 | 3300006844 | Bacteria | 21251 |
| 205 | Ga0075428_100005576 | 3300006844 | Bacteria | 13990 |
| 206 | Ga0075428_100016139 | 3300006844 | Bacteria | 8255 |
| 207 | Ga0075428_100018237 | 3300006844 | Bacteria | 7755 |
| 208 | Ga0075428_100105741 | 3300006844 | Bacteria | 3069 |
| 209 | Ga0075428_100975652 | 3300006844 | Unclassified | 897 |
| 210 | Ga0075428_100981563 | 3300006844 | Unclassified | 894 |
| 211 | Ga0075428_101476220 | 3300006844 | Bacteria | 713 |
| 212 | Ga0075430_100000760 | 3300006846 | Bacteria | 24879 |
| 213 | Ga0075430_100000893 | 3300006846 | Bacteria | 23384 |
| 214 | Ga0075430_100002774 | 3300006846 | Bacteria | 14637 |
| 215 | Ga0075430_100030579 | 3300006846 | Bacteria | 4574 |
| 216 | Ga0075430_100055745 | 3300006846 | Bacteria | 3324 |
| 217 | Ga0075430_100190612 | 3300006846 | Bacteria | 1704 |
| 218 | Ga0075430_100347169 | 3300006846 | Unclassified | 1226 |
| 219 | Ga0075430_100389660 | 3300006846 | Bacteria | 1150 |
| 220 | Ga0075431_100000158 | 3300006847 | Bacteria | 46980 |
| 221 | Ga0075431_100004832 | 3300006847 | Bacteria | 13263 |
| 222 | Ga0075431_100006182 | 3300006847 | Bacteria | 11884 |
| 223 | Ga0075431_100007290 | 3300006847 | Bacteria | 11015 |
| 224 | Ga0075431_100008729 | 3300006847 | Bacteria | 10155 |
| 225 | Ga0075431_100023595 | 3300006847 | Bacteria | 6296 |
| 226 | Ga0075431_100024787 | 3300006847 | Bacteria | 6150 |
| 227 | Ga0075431_100159022 | 3300006847 | Bacteria | 2324 |
| 228 | Ga0075431_100419874 | 3300006847 | Bacteria | 1337 |
| 229 | Ga0075431_100559901 | 3300006847 | Bacteria | 1130 |
| 230 | Ga0075431_100623064 | 3300006847 | Bacteria | 1061 |
| 231 | Ga0075431_100640068 | 3300006847 | Unclassified | 1044 |
| 232 | Ga0075433_10000230 | 3300006852 | Bacteria | 31980 |
| 233 | Ga0075433_10000972 | 3300006852 | Bacteria | 20350 |
| 234 | Ga0075433_10002435 | 3300006852 | Bacteria | 14167 |
| 235 | Ga0075433_10003721 | 3300006852 | Bacteria | 11804 |
| 236 | Ga0075433_10031282 | 3300006852 | Bacteria | 4549 |
| 237 | Ga0075433_10044033 | 3300006852 | Bacteria | 3877 |
| 238 | Ga0075433_10168573 | 3300006852 | Bacteria | 1949 |
| 239 | Ga0075433_10265941 | 3300006852 | Bacteria | 1520 |
| 240 | Ga0075433_10446179 | 3300006852 | Bacteria | 1141 |
| 241 | Ga0075434_100001442 | 3300006871 | Bacteria | 19971 |
| 242 | Ga0075434_100032819 | 3300006871 | Bacteria | 5121 |
| 243 | Ga0075434_100064385 | 3300006871 | Bacteria | 3650 |
| 244 | Ga0075434_100071293 | 3300006871 | Bacteria | 3466 |
| 245 | Ga0075434_100081334 | 3300006871 | Bacteria | 3237 |
| 246 | Ga0075434_100095969 | 3300006871 | Bacteria | 2970 |
| 247 | Ga0075434_100152432 | 3300006871 | Bacteria | 2332 |
| 248 | Ga0075434_100218627 | 3300006871 | Bacteria | 1925 |
| 249 | Ga0075434_102048839 | 3300006871 | Unclassified | 577 |
| 250 | Ga0075429_100000757 | 3300006880 | Bacteria | 25402 |
| 251 | Ga0075429_100020203 | 3300006880 | Bacteria | 5775 |
| 252 | Ga0075429_100024518 | 3300006880 | Bacteria | 5233 |
| 253 | Ga0075429_100050171 | 3300006880 | Unclassified | 3631 |
| 254 | Ga0075429_100054933 | 3300006880 | Bacteria | 3465 |
| 255 | Ga0075429_100055828 | 3300006880 | Bacteria | 3437 |
| 256 | Ga0075429_100106602 | 3300006880 | Bacteria | 2448 |
| 257 | Ga0075429_100261557 | 3300006880 | Bacteria | 1515 |
| 258 | Ga0075429_100324655 | 3300006880 | Bacteria | 1347 |
| 259 | Ga0075429_100328168 | 3300006880 | Bacteria | 1339 |
| 260 | Ga0075429_100519444 | 3300006880 | Bacteria | 1043 |
| 261 | Ga0075429_101278528 | 3300006880 | Bacteria | 640 |
| 262 | Ga0075429_101356612 | 3300006880 | Bacteria | 620 |
| 263 | Ga0068865_100209883 | 3300006881 | Bacteria | 1517 |
| 264 | Ga0068865_100341183 | 3300006881 | Bacteria | 1211 |
| 265 | Ga0068865_100617469 | 3300006881 | Bacteria | 918 |
| 266 | Ga0075436_100104024 | 3300006914 | Bacteria | 1979 |
| 267 | Ga0075436_100655441 | 3300006914 | Bacteria | 776 |
| 268 | Ga0075436_100767423 | 3300006914 | Unclassified | 717 |
| 269 | Ga0097620_100002575 | 3300006931 | Bacteria | 18433 |
| 270 | Ga0097620_100369168 | 3300006931 | Bacteria | 1530 |
| 271 | Ga0097620_100393239 | 3300006931 | Bacteria | 1482 |
| 272 | Ga0097620_100545267 | 3300006931 | Bacteria | 1254 |
| 273 | Ga0097620_101424076 | 3300006931 | Bacteria | 764 |
| 274 | Ga0075435_100069338 | 3300007076 | Unclassified | 2875 |
| 275 | Ga0075435_100216498 | 3300007076 | Bacteria | 1626 |
| 276 | Ga0075435_100222326 | 3300007076 | Bacteria | 1603 |
| 277 | Ga0075435_100487049 | 3300007076 | Bacteria | 1065 |
| 278 | Ga0075435_100501882 | 3300007076 | Bacteria | 1049 |
| 279 | Ga0075435_100549621 | 3300007076 | Bacteria | 1000 |
| 280 | Ga0075435_100741771 | 3300007076 | Bacteria | 854 |
| 281 | Ga0075435_101279612 | 3300007076 | Bacteria | 642 |
| 282 | Ga0099794_10002156 | 3300007265 | Bacteria | 7158 |
| 283 | Ga0099794_10055588 | 3300007265 | Bacteria | 1913 |
| 284 | Ga0099794_10358840 | 3300007265 | Unclassified | 759 |
| 285 | Ga0105240_10810126 | 3300009093 | Bacteria | 1014 |
| 286 | Ga0111539_10000370 | 3300009094 | Bacteria | 55548 |
| 287 | Ga0111539_10001809 | 3300009094 | Bacteria | 28474 |
| 288 | Ga0111539_11125599 | 3300009094 | Bacteria | 912 |
| 289 | Ga0111539_11811672 | 3300009094 | Unclassified | 708 |
| 290 | Ga0105245_10548129 | 3300009098 | Bacteria | 1178 |
| 291 | Ga0105247_10014347 | 3300009101 | Bacteria | 4757 |
| 292 | Ga0114129_10000443 | 3300009147 | Bacteria | 49208 |
| 293 | Ga0114129_10000599 | 3300009147 | Bacteria | 44461 |
| 294 | Ga0114129_10000708 | 3300009147 | Bacteria | 42096 |
| 295 | Ga0114129_10001075 | 3300009147 | Bacteria | 35911 |
| 296 | Ga0114129_10002320 | 3300009147 | Bacteria | 26415 |
| 297 | Ga0114129_10040851 | 3300009147 | Bacteria | 6538 |
| 298 | Ga0114129_10042842 | 3300009147 | Bacteria | 6370 |
| 299 | Ga0114129_10100270 | 3300009147 | Bacteria | 4007 |
| 300 | Ga0114129_10191525 | 3300009147 | Bacteria | 2776 |
| 301 | Ga0114129_10251975 | 3300009147 | Bacteria | 2369 |
| 302 | Ga0114129_10262982 | 3300009147 | Bacteria | 2311 |
| 303 | Ga0114129_10305180 | 3300009147 | Unclassified | 2120 |
| 304 | Ga0114129_10306476 | 3300009147 | Bacteria | 2115 |
| 305 | Ga0114129_10309719 | 3300009147 | Bacteria | 2102 |
| 306 | Ga0114129_10490996 | 3300009147 | Bacteria | 1605 |
| 307 | Ga0114129_10772496 | 3300009147 | Unclassified | 1228 |
| 308 | Ga0114129_10809405 | 3300009147 | Bacteria | 1194 |
| 309 | Ga0114129_11358201 | 3300009147 | Bacteria | 878 |
| 310 | Ga0114129_12163270 | 3300009147 | Bacteria | 670 |
| 311 | Ga0114129_12770874 | 3300009147 | Bacteria | 583 |
| 312 | Ga0114129_13022902 | 3300009147 | Bacteria | 552 |
| 313 | Ga0105243_10100476 | 3300009148 | Bacteria | 2400 |
| 314 | Ga0105243_10108421 | 3300009148 | Bacteria | 2318 |
| 315 | Ga0105243_11663010 | 3300009148 | Bacteria | 666 |
| 316 | Ga0105241_10000218 | 3300009174 | Bacteria | 43050 |
| 317 | Ga0105241_10058694 | 3300009174 | Bacteria | 2956 |
| 318 | Ga0105242_10005190 | 3300009176 | Bacteria | 10056 |
| 319 | Ga0105242_10358033 | 3300009176 | Bacteria | 1350 |
| 320 | Ga0105248_10059326 | 3300009177 | Bacteria | 4298 |
| 321 | Ga0105248_10121132 | 3300009177 | Bacteria | 2951 |
| 322 | Ga0105248_10293106 | 3300009177 | Bacteria | 1832 |
| 323 | Ga0105248_11808976 | 3300009177 | Bacteria | 693 |
| 324 | Ga0105238_10525137 | 3300009551 | Bacteria | 1186 |
| 325 | Ga0105249_10076713 | 3300009553 | Unclassified | 3098 |
| 326 | Ga0105249_10081138 | 3300009553 | Bacteria | 3014 |
| 327 | Ga0105249_10510523 | 3300009553 | Bacteria | 1248 |
| 328 | Ga0105249_11445337 | 3300009553 | Unclassified | 760 |
| 329 | Ga0105249_11455153 | 3300009553 | Bacteria | 757 |
| 330 | Ga0105239_11849730 | 3300010375 | Bacteria | 700 |
| 331 | Ga0105246_10883694 | 3300011119 | Unclassified | 800 |
| 332 | Ga0105246_12462689 | 3300011119 | Unclassified | 512 |
| 333 | Ga0157373_10000381 | 3300013100 | Bacteria | 35500 |
| 334 | Ga0157371_10193965 | 3300013102 | Bacteria | 1455 |
| 335 | Ga0157370_10894069 | 3300013104 | Bacteria | 806 |
| 336 | Ga0157369_10091723 | 3300013105 | Bacteria | 3242 |
| 337 | Ga0157378_10102117 | 3300013297 | Bacteria | 2619 |
| 338 | Ga0157378_10200643 | 3300013297 | Bacteria | 1886 |
| 339 | Ga0157378_10365546 | 3300013297 | Bacteria | 1413 |
| 340 | Ga0157378_10484496 | 3300013297 | Bacteria | 1233 |
| 341 | Ga0157378_10700076 | 3300013297 | Bacteria | 1032 |
| 342 | Ga0157378_10743689 | 3300013297 | Bacteria | 1003 |
| 343 | Ga0157378_11073152 | 3300013297 | Bacteria | 842 |
| 344 | Ga0163162_10437328 | 3300013306 | Bacteria | 1440 |
| 345 | Ga0163162_10764653 | 3300013306 | Bacteria | 1085 |
| 346 | Ga0163162_10884530 | 3300013306 | Unclassified | 1007 |
| 347 | Ga0163162_11999936 | 3300013306 | Bacteria | 664 |
| 348 | Ga0163162_12968616 | 3300013306 | Unclassified | 545 |
| 349 | Ga0157372_10001479 | 3300013307 | Bacteria | 25510 |
| 350 | Ga0157372_10325645 | 3300013307 | Unclassified | 1789 |
| 351 | Ga0157375_10091551 | 3300013308 | Bacteria | 3103 |
| 352 | Ga0157375_10119623 | 3300013308 | Bacteria | 2742 |
| 353 | Ga0157375_10657654 | 3300013308 | Bacteria | 1204 |
| 354 | Ga0163163_10192997 | 3300014325 | Bacteria | 2085 |
| 355 | Ga0163163_10217796 | 3300014325 | Bacteria | 1958 |
| 356 | Ga0157380_10230691 | 3300014326 | Bacteria | 1662 |
| 357 | Ga0157380_10336315 | 3300014326 | Bacteria | 1406 |
| 358 | Ga0157380_10338884 | 3300014326 | Bacteria | 1402 |
| 359 | Ga0157380_10691785 | 3300014326 | Bacteria | 1023 |
| 360 | Ga0157380_12641443 | 3300014326 | Bacteria | 568 |
| 361 | Ga0182008_10063236 | 3300014497 | Bacteria | 1823 |
| 362 | Ga0157377_11243655 | 3300014745 | Bacteria | 579 |
| 363 | Ga0157379_10184752 | 3300014968 | Bacteria | 1883 |
| 364 | Ga0157379_10554398 | 3300014968 | Unclassified | 1070 |
| 365 | Ga0182007_10029713 | 3300015262 | Bacteria | 1871 |
| 366 | Ga0163161_10266277 | 3300017792 | Bacteria | 1340 |
| 367 | Ga0163161_10587911 | 3300017792 | Bacteria | 916 |
| 368 | Ga0207653_10001826 | 3300025885 | Bacteria | 6786 |
| 369 | Ga0207653_10016897 | 3300025885 | Bacteria | 2295 |
| 370 | Ga0207653_10023098 | 3300025885 | Bacteria | 1979 |
| 371 | Ga0207710_10180592 | 3300025900 | Bacteria | 1035 |
| 372 | Ga0207688_10049701 | 3300025901 | Bacteria | 2344 |
| 373 | Ga0207647_10045326 | 3300025904 | Bacteria | 2744 |
| 374 | Ga0207685_10034619 | 3300025905 | Bacteria | 1836 |
| 375 | Ga0207645_10001324 | 3300025907 | Bacteria | 20346 |
| 376 | Ga0207645_10015479 | 3300025907 | Bacteria | 5065 |
| 377 | Ga0207643_10000157 | 3300025908 | Bacteria | 46902 |
| 378 | Ga0207684_10000169 | 3300025910 | Bacteria | 109181 |
| 379 | Ga0207684_10008133 | 3300025910 | Bacteria | 9350 |
| 380 | Ga0207684_10010283 | 3300025910 | Bacteria | 8236 |
| 381 | Ga0207684_10014651 | 3300025910 | Bacteria | 6754 |
| 382 | Ga0207684_10016896 | 3300025910 | Bacteria | 6267 |
| 383 | Ga0207684_10057467 | 3300025910 | Bacteria | 3301 |
| 384 | Ga0207684_10089629 | 3300025910 | Bacteria | 2620 |
| 385 | Ga0207684_10287306 | 3300025910 | Bacteria | 1418 |
| 386 | Ga0207684_10646322 | 3300025910 | Bacteria | 901 |
| 387 | Ga0207654_10026891 | 3300025911 | Bacteria | 3122 |
| 388 | Ga0207654_10081699 | 3300025911 | Bacteria | 1947 |
| 389 | Ga0207707_10000258 | 3300025912 | Bacteria | 57257 |
| 390 | Ga0207707_10071611 | 3300025912 | Bacteria | 3021 |
| 391 | Ga0207693_10001303 | 3300025915 | Bacteria | 22126 |
| 392 | Ga0207663_10101821 | 3300025916 | Unclassified | 1931 |
| 393 | Ga0207663_10277644 | 3300025916 | Bacteria | 1243 |
| 394 | Ga0207660_10001383 | 3300025917 | Bacteria | 16275 |
| 395 | Ga0207660_10036306 | 3300025917 | Bacteria | 3426 |
| 396 | Ga0207660_10688613 | 3300025917 | Bacteria | 834 |
| 397 | Ga0207662_10111945 | 3300025918 | Bacteria | 1703 |
| 398 | Ga0207657_10000373 | 3300025919 | Bacteria | 47375 |
| 399 | Ga0207649_10254932 | 3300025920 | Bacteria | 1265 |
| 400 | Ga0207652_10004142 | 3300025921 | Bacteria | 11838 |
| 401 | Ga0207652_10217124 | 3300025921 | Bacteria | 1723 |
| 402 | Ga0207652_10635813 | 3300025921 | Unclassified | 955 |
| 403 | Ga0207646_10002895 | 3300025922 | Bacteria | 19923 |
| 404 | Ga0207646_10004675 | 3300025922 | Bacteria | 14754 |
| 405 | Ga0207646_10017426 | 3300025922 | Bacteria | 6723 |
| 406 | Ga0207646_10038985 | 3300025922 | Bacteria | 4276 |
| 407 | Ga0207646_10045505 | 3300025922 | Bacteria | 3940 |
| 408 | Ga0207646_10065789 | 3300025922 | Bacteria | 3236 |
| 409 | Ga0207646_10264914 | 3300025922 | Bacteria | 1553 |
| 410 | Ga0207646_10891629 | 3300025922 | Bacteria | 789 |
| 411 | Ga0207646_11094596 | 3300025922 | Bacteria | 701 |
| 412 | Ga0207646_11554536 | 3300025922 | Bacteria | 572 |
| 413 | Ga0207681_10134534 | 3300025923 | Bacteria | 1832 |
| 414 | Ga0207659_10207175 | 3300025926 | Bacteria | 1569 |
| 415 | Ga0207690_10286300 | 3300025932 | Bacteria | 1285 |
| 416 | Ga0207690_10297285 | 3300025932 | Bacteria | 1262 |
| 417 | Ga0207706_10001857 | 3300025933 | Bacteria | 20682 |
| 418 | Ga0207706_10008929 | 3300025933 | Bacteria | 9225 |
| 419 | Ga0207706_10146584 | 3300025933 | Unclassified | 2076 |
| 420 | Ga0207706_10276969 | 3300025933 | Bacteria | 1464 |
| 421 | Ga0207686_10010046 | 3300025934 | Bacteria | 5149 |
| 422 | Ga0207709_10028023 | 3300025935 | Bacteria | 3253 |
| 423 | Ga0207709_10188770 | 3300025935 | Bacteria | 1462 |
| 424 | Ga0207670_10304253 | 3300025936 | Bacteria | 1249 |
| 425 | Ga0207670_10491276 | 3300025936 | Bacteria | 995 |
| 426 | Ga0207670_11829273 | 3300025936 | Bacteria | 516 |
| 427 | Ga0207704_10131946 | 3300025938 | Bacteria | 1732 |
| 428 | Ga0207704_10900388 | 3300025938 | Unclassified | 744 |
| 429 | Ga0207665_11242293 | 3300025939 | Bacteria | 594 |
| 430 | Ga0207711_10084644 | 3300025941 | Bacteria | 2776 |
| 431 | Ga0207711_10375272 | 3300025941 | Bacteria | 1319 |
| 432 | Ga0207711_11053164 | 3300025941 | Bacteria | 754 |
| 433 | Ga0207711_11902757 | 3300025941 | Archaea | 538 |
| 434 | Ga0207689_10000975 | 3300025942 | Bacteria | 27466 |
| 435 | Ga0207689_10001419 | 3300025942 | Bacteria | 22891 |
| 436 | Ga0207689_10003954 | 3300025942 | Bacteria | 13491 |
| 437 | Ga0207689_11511260 | 3300025942 | Archaea | 561 |
| 438 | Ga0207679_10000779 | 3300025945 | Bacteria | 20862 |
| 439 | Ga0207679_11392460 | 3300025945 | Bacteria | 643 |
| 440 | Ga0207667_10000857 | 3300025949 | Bacteria | 39178 |
| 441 | Ga0207651_10013096 | 3300025960 | Bacteria | 4730 |
| 442 | Ga0207712_10058438 | 3300025961 | Bacteria | 2725 |
| 443 | Ga0207712_10088740 | 3300025961 | Bacteria | 2272 |
| 444 | Ga0207712_10560610 | 3300025961 | Unclassified | 984 |
| 445 | Ga0207668_10541484 | 3300025972 | Bacteria | 1007 |
| 446 | Ga0207640_10011172 | 3300025981 | Bacteria | 5078 |
| 447 | Ga0207658_10419358 | 3300025986 | Bacteria | 1180 |
| 448 | Ga0207677_10011276 | 3300026023 | Bacteria | 5088 |
| 449 | Ga0207703_10415584 | 3300026035 | Bacteria | 1251 |
| 450 | Ga0207703_11233162 | 3300026035 | Bacteria | 719 |
| 451 | Ga0207639_10042698 | 3300026041 | Unclassified | 3399 |
| 452 | Ga0207678_10002143 | 3300026067 | Bacteria | 17878 |
| 453 | Ga0207678_10879095 | 3300026067 | Bacteria | 792 |
| 454 | Ga0207708_10119553 | 3300026075 | Bacteria | 2052 |
| 455 | Ga0207708_10195309 | 3300026075 | Bacteria | 1612 |
| 456 | Ga0207708_10292588 | 3300026075 | Bacteria | 1322 |
| 457 | Ga0207708_10399880 | 3300026075 | Bacteria | 1136 |
| 458 | Ga0207702_10001041 | 3300026078 | Bacteria | 28384 |
| 459 | Ga0207641_10178512 | 3300026088 | Bacteria | 1943 |
| 460 | Ga0207641_10344655 | 3300026088 | Bacteria | 1418 |
| 461 | Ga0207641_11596884 | 3300026088 | Bacteria | 654 |
| 462 | Ga0207648_10001790 | 3300026089 | Bacteria | 23546 |
| 463 | Ga0207648_10158747 | 3300026089 | Bacteria | 1997 |
| 464 | Ga0207648_10289800 | 3300026089 | Bacteria | 1466 |
| 465 | Ga0207648_10514659 | 3300026089 | Bacteria | 1096 |
| 466 | Ga0207648_11455425 | 3300026089 | Bacteria | 644 |
| 467 | Ga0207676_10046984 | 3300026095 | Bacteria | 3343 |
| 468 | Ga0207676_11883502 | 3300026095 | Bacteria | 597 |
| 469 | Ga0207674_10008510 | 3300026116 | Bacteria | 11845 |
| 470 | Ga0207674_10106524 | 3300026116 | Unclassified | 2781 |
| 471 | Ga0207674_10329661 | 3300026116 | Bacteria | 1476 |
| 472 | Ga0207675_100028715 | 3300026118 | Bacteria | 5182 |
| 473 | Ga0207675_100077456 | 3300026118 | Bacteria | 3115 |
| 474 | Ga0207675_100246138 | 3300026118 | Bacteria | 1729 |
| 475 | Ga0207675_100874761 | 3300026118 | Bacteria | 914 |
| 476 | Ga0207698_10090066 | 3300026142 | Bacteria | 2508 |
| 477 | Ga0209969_1003454 | 3300027360 | Unclassified | 2189 |
| 478 | Ga0209967_1001743 | 3300027364 | Bacteria | 2801 |
| 479 | Ga0209981_1020171 | 3300027378 | Unclassified | 949 |
| 480 | Ga0209996_1002603 | 3300027395 | Bacteria | 2238 |
| 481 | Ga0209984_1000344 | 3300027424 | Bacteria | 5139 |
| 482 | Ga0209995_1000323 | 3300027471 | Bacteria | 7498 |
| 483 | Ga0209995_1072062 | 3300027471 | Bacteria | 591 |
| 484 | Ga0209968_1002390 | 3300027526 | Bacteria | 2831 |
| 485 | Ga0209999_1004130 | 3300027543 | Unclassified | 2611 |
| 486 | Ga0209982_1001327 | 3300027552 | Unclassified | 3356 |
| 487 | Ga0209983_1001424 | 3300027665 | Bacteria | 5319 |
| 488 | Ga0209983_1084876 | 3300027665 | Bacteria | 711 |
| 489 | Ga0209588_1050700 | 3300027671 | Unclassified | 1342 |
| 490 | Ga0209971_1000031 | 3300027682 | Bacteria | 50315 |
| 491 | Ga0209971_1123873 | 3300027682 | Unclassified | 636 |
| 492 | Ga0209966_1000020 | 3300027695 | Bacteria | 68386 |
| 493 | Ga0209966_1014358 | 3300027695 | Bacteria | 1477 |
| 494 | Ga0209998_10000024 | 3300027717 | Bacteria | 64123 |
| 495 | Ga0209974_10001378 | 3300027876 | Bacteria | 8780 |
| 496 | Ga0209974_10003540 | 3300027876 | Bacteria | 5618 |
| 497 | Ga0207428_10000409 | 3300027907 | Bacteria | 53318 |
| 498 | Ga0207428_10007011 | 3300027907 | Bacteria | 10318 |
| 499 | Ga0207428_10318912 | 3300027907 | Bacteria | 1148 |
| 500 | Ga0268265_10012391 | 3300028380 | Bacteria | 5778 |
| 501 | Ga0268265_10105753 | 3300028380 | Bacteria | 2284 |
| 502 | Ga0268265_10119804 | 3300028380 | Bacteria | 2166 |
| 503 | Ga0268265_10452306 | 3300028380 | Unclassified | 1200 |
| 504 | Ga0268265_10829602 | 3300028380 | Bacteria | 903 |
| 505 | Ga0268265_11878580 | 3300028380 | Bacteria | 606 |
| 506 | Ga0268265_12231609 | 3300028380 | Bacteria | 554 |
| 507 | Ga0268264_10020556 | 3300028381 | Bacteria | 5394 |
| 508 | Ga0268264_10297626 | 3300028381 | Bacteria | 1518 |
| 509 | Ga0268264_10317022 | 3300028381 | Bacteria | 1473 |
| 510 | Ga0268264_10737805 | 3300028381 | Bacteria | 980 |
| 511 | Ga0268264_11143938 | 3300028381 | Bacteria | 787 |
| 512 | Ga0268264_11286725 | 3300028381 | Bacteria | 741 |
| 513 | Ga0307408_100095384 | 3300031548 | Bacteria | 2255 |
| 514 | Ga0307408_100384351 | 3300031548 | Bacteria | 1201 |
| 515 | Ga0307408_102065086 | 3300031548 | Archaea | 549 |
| 516 | Ga0307407_10859020 | 3300031903 | Unclassified | 694 |
| 517 | Ga0307409_100637127 | 3300031995 | Bacteria | 1058 |
| 518 | Ga0307416_100383603 | 3300032002 | Bacteria | 1436 |
| 519 | Ga0307414_10116872 | 3300032004 | Unclassified | 2043 |
| 520 | Ga0307414_10953980 | 3300032004 | Bacteria | 788 |
| 521 | Ga0307411_10135540 | 3300032005 | Bacteria | 1807 |
| 522 | Ga0373950_0008662 | 3300034818 | Bacteria | 1607 |
| 523 | Ga0373958_0113965 | 3300034819 | Unclassified | 647 |
| 524 | Ga0373959_0042518 | 3300034820 | Unclassified | 958 |
| 525 | Ga0373940_0031547 | 3300035088 | Bacteria | 1415 |
| 526 | Ga0373940_0039022 | 3300035088 | Bacteria | 1298 |
| 527 | Ga0373940_0206741 | 3300035088 | Bacteria | 647 |
| 528 | Ga0373949_0007980 | 3300035090 | Bacteria | 2318 |
| 529 | Ga0373949_0067790 | 3300035090 | Unclassified | 929 |
| 530 | Ga0373949_0216649 | 3300035090 | Bacteria | 580 |
| 531 | Ga0373949_0309313 | 3300035090 | Bacteria | 503 |
| 532 | Ga0373951_0025476 | 3300035091 | Bacteria | 1374 |
| 533 | Ga0373951_0143489 | 3300035091 | Unclassified | 665 |
| 534 | Ga0373939_0103364 | 3300035114 | Unclassified | 981 |
| 535 | Ga0373939_0317963 | 3300035114 | Bacteria | 625 |
| 536 | Ga0373941_0005607 | 3300035115 | Bacteria | 2967 |
| 537 | Ga0373941_0040453 | 3300035115 | Bacteria | 1438 |
| 538 | Ga0373960_0084805 | 3300035121 | Bacteria | 1004 |
| 539 | Ga0373961_0189560 | 3300035241 | Unclassified | 720 |
| 540 | Ga0373962_0002572 | 3300035242 | Bacteria | 4308 |
| 541 | Ga0373962_0159618 | 3300035242 | Bacteria | 743 |
| 542 | Ga0373962_0271558 | 3300035242 | Bacteria | 594 |
| 543 | Ga0373931_0567067 | 3300035691 | Bacteria | 739 |
| 544 | Ga0395899_0021054 | 3300037312 | Bacteria | 4946 |
| 545 | Ga0395899_0249976 | 3300037312 | Archaea | 1217 |
| 546 | Ga0395900_0017941 | 3300037418 | Bacteria | 7224 |
| 547 | Ga0395900_0146737 | 3300037418 | Unclassified | 2412 |
| 548 | Ga0395900_0642824 | 3300037418 | Unclassified | 998 |
| 549 | Ga0395898_0027302 | 3300037466 | Bacteria | 5733 |
| 550 | Ga0395905_0238600 | 3300037471 | Bacteria | 1699 |
| 551 | Ga0395905_0951272 | 3300037471 | Unclassified | 762 |
| 552 | Ga0395901_1081326 | 3300038443 | Bacteria | 773 |
| 553 | Ga0242420_017531 | 3300038996 | Bacteria | 1254 |
| 554 | Ga0242420_018387 | 3300038996 | Bacteria | 1230 |
| 555 | Ga0439437_020610 | 3300042000 | Bacteria | 796 |
| 556 | Ga0439441_012424 | 3300042001 | Bacteria | 1462 |
| 557 | Ga0439448_0043918 | 3300042005 | Bacteria | 1452 |
| 558 | Ga0439455_0007416 | 3300042012 | Bacteria | 2319 |
| 559 | Ga0439463_066613 | 3300042016 | Bacteria | 921 |
| 560 | Ga0439458_0083356 | 3300042157 | Unclassified | 817 |
| 561 | Ga0439459_0029527 | 3300042438 | Bacteria | 1107 |
| 562 | Ga0439459_0113996 | 3300042438 | Bacteria | 675 |
| 563 | Ga0439464_0001377 | 3300042439 | Bacteria | 5694 |
| 564 | Ga0439460_0004434 | 3300042461 | Bacteria | 3421 |
| 565 | Ga0451577_0003197 | 3300042876 | Bacteria | 18404 |
| 566 | Ga0451577_0017165 | 3300042876 | Bacteria | 6690 |
| 567 | Ga0451577_0057091 | 3300042876 | Bacteria | 3480 |
| 568 | Ga0451577_0138688 | 3300042876 | Unclassified | 2184 |
| 569 | Ga0451577_1298153 | 3300042876 | Bacteria | 647 |
| 570 | Ga0439440_0100268 | 3300042993 | Bacteria | 787 |
| 571 | Ga0453683_0008423 | 3300044673 | Bacteria | 6917 |
| 572 | Ga0453683_0048690 | 3300044673 | Bacteria | 2658 |
| 573 | Ga0453683_0053051 | 3300044673 | Bacteria | 2537 |
| 574 | Ga0453684_0051544 | 3300044712 | Bacteria | 5392 |
| 575 | Ga0453684_0059189 | 3300044712 | Bacteria | 4941 |
| 576 | Ga0453684_0189615 | 3300044712 | Bacteria | 2406 |
| 577 | Ga0453684_0493193 | 3300044712 | Unclassified | 1357 |
| 578 | Ga0453684_1385269 | 3300044712 | Bacteria | 730 |
| 579 | Ga0451576_0016285 | 3300045051 | Bacteria | 8210 |
| 580 | Ga0451576_0019862 | 3300045051 | Bacteria | 7327 |
| 581 | Ga0451576_0021455 | 3300045051 | Bacteria | 7019 |
| 582 | Ga0451576_0095258 | 3300045051 | Bacteria | 3096 |
| 583 | Ga0451576_0109256 | 3300045051 | Bacteria | 2878 |
| 584 | Ga0451576_0257085 | 3300045051 | Bacteria | 1825 |
| 585 | Ga0451576_0423844 | 3300045051 | Bacteria | 1396 |
| 586 | Ga0451576_1111137 | 3300045051 | Bacteria | 827 |
| 587 | Ga0451576_1623978 | 3300045051 | Bacteria | 670 |
| 588 | Ga0495580_0380069 | 3300046472 | Bacteria | 954 |
| 589 | Ga0495656_0018852 | 3300046615 | Bacteria | 2656 |
| 590 | Ga0495656_0817524 | 3300046615 | Bacteria | 504 |
| 591 | Ga0495669_0028327 | 3300046684 | Bacteria | 2453 |
| 592 | Ga0495669_0124325 | 3300046684 | Bacteria | 1211 |
| 593 | Ga0495669_0277659 | 3300046684 | Bacteria | 806 |
| 594 | Ga0495670_0311303 | 3300046691 | Bacteria | 845 |
| 595 | Ga0495636_0131050 | 3300047318 | Bacteria | 1115 |
| 596 | Ga0496102_0010289 | 3300048905 | Bacteria | 8043 |
| 597 | Ga0496102_0031996 | 3300048905 | Bacteria | 4723 |
| 598 | Ga0496102_0294221 | 3300048905 | Bacteria | 1530 |
| 599 | Ga0496104_1009209 | 3300048907 | Bacteria | 736 |
| 600 | Ga0496106_0125534 | 3300048909 | Bacteria | 2009 |
| 601 | Ga0496108_1719409 | 3300048911 | Bacteria | 516 |
| 602 | Ga0496109_0475642 | 3300048912 | Unclassified | 1180 |
| 603 | Ga0496112_0117827 | 3300048915 | Bacteria | 2626 |
| 604 | Ga0501031_0070611 | 3300049568 | Bacteria | 2275 |
| 605 | Ga0501031_0203984 | 3300049568 | Bacteria | 1290 |
| 606 | Ga0501031_0293101 | 3300049568 | Bacteria | 1055 |
| 607 | Ga0501033_0064984 | 3300049570 | Unclassified | 2684 |
| 608 | Ga0501033_0326261 | 3300049570 | Bacteria | 1078 |
| 609 | Ga0501034_0896459 | 3300049571 | Bacteria | 775 |
| 610 | Ga0501036_0045030 | 3300049572 | Bacteria | 3738 |
| 611 | Ga0501036_0046663 | 3300049572 | Bacteria | 3668 |
| 612 | Ga0501036_0211866 | 3300049572 | Bacteria | 1628 |
| 613 | Ga0501036_0433038 | 3300049572 | Bacteria | 1096 |
| 614 | Ga0501036_0826011 | 3300049572 | Unclassified | 762 |
| 615 | Ga0501037_0546355 | 3300049573 | Bacteria | 782 |
| 616 | Ga0501038_0067911 | 3300049574 | Bacteria | 3032 |
| 617 | Ga0501038_0514273 | 3300049574 | Bacteria | 914 |
| 618 | Ga0501038_1055619 | 3300049574 | Bacteria | 595 |
| 619 | Ga0501039_0019151 | 3300049575 | Bacteria | 5252 |
| 620 | Ga0501039_0144949 | 3300049575 | Bacteria | 1866 |
| 621 | Ga0501039_0424445 | 3300049575 | Bacteria | 1044 |
| 622 | Ga0501039_0864037 | 3300049575 | Bacteria | 705 |
| 623 | Ga0501040_0003451 | 3300049576 | Bacteria | 10205 |
| 624 | Ga0501040_0041964 | 3300049576 | Bacteria | 3116 |
| 625 | Ga0501040_0460028 | 3300049576 | Bacteria | 916 |
| 626 | Ga0501040_0611626 | 3300049576 | Bacteria | 787 |
| 627 | Ga0501040_0762225 | 3300049576 | Unclassified | 700 |
| 628 | Ga0501041_0050743 | 3300049577 | Bacteria | 2528 |
| 629 | Ga0501041_0465631 | 3300049577 | Bacteria | 803 |
| 630 | Ga0501041_0551987 | 3300049577 | Bacteria | 734 |
| 631 | Ga0501041_0579252 | 3300049577 | Bacteria | 716 |
| 632 | Ga0501041_0783905 | 3300049577 | Bacteria | 611 |
| 633 | Ga0501042_0009827 | 3300049578 | Bacteria | 6390 |
| 634 | Ga0501042_0040799 | 3300049578 | Bacteria | 3299 |
| 635 | Ga0501042_0358712 | 3300049578 | Bacteria | 1055 |
| 636 | Ga0501042_0414007 | 3300049578 | Unclassified | 977 |
| 637 | Ga0501042_0592977 | 3300049578 | Bacteria | 806 |
| 638 | Ga0501042_0596528 | 3300049578 | Bacteria | 803 |
| 639 | Ga0501042_0627368 | 3300049578 | Bacteria | 781 |
| 640 | Ga0501042_1269725 | 3300049578 | Bacteria | 537 |
| 641 | Ga0501043_0386663 | 3300049579 | Unclassified | 1059 |
| 642 | Ga0501043_0392161 | 3300049579 | Bacteria | 1050 |
| 643 | Ga0501043_0419529 | 3300049579 | Bacteria | 1009 |
| 644 | Ga0501046_0000607 | 3300049580 | Bacteria | 35214 |
| 645 | Ga0501046_0045322 | 3300049580 | Bacteria | 3495 |
| 646 | Ga0501046_0073675 | 3300049580 | Bacteria | 2650 |
| 647 | Ga0501046_0123008 | 3300049580 | Bacteria | 1973 |
| 648 | Ga0501047_0079990 | 3300049581 | Bacteria | 3142 |
| 649 | Ga0501048_0008791 | 3300049582 | Bacteria | 7612 |
| 650 | Ga0501048_0238240 | 3300049582 | Bacteria | 1291 |
| 651 | Ga0501048_0470416 | 3300049582 | Unclassified | 901 |
| 652 | Ga0501048_0662806 | 3300049582 | Unclassified | 749 |
| 653 | Ga0501048_1213297 | 3300049582 | Unclassified | 542 |
| 654 | Ga0501067_0508396 | 3300049583 | Bacteria | 674 |
| 655 | Ga0501068_0068617 | 3300049584 | Unclassified | 2161 |
| 656 | Ga0501068_0085258 | 3300049584 | Bacteria | 1944 |
| 657 | Ga0501068_0085735 | 3300049584 | Unclassified | 1938 |
| 658 | Ga0501069_0334062 | 3300049585 | Unclassified | 892 |
| 659 | Ga0501069_0364907 | 3300049585 | Bacteria | 852 |
| 660 | Ga0501070_1122823 | 3300049586 | Bacteria | 606 |
| 661 | Ga0501071_0058887 | 3300049587 | Bacteria | 2778 |
| 662 | Ga0501071_0334358 | 3300049587 | Bacteria | 1151 |
| 663 | Ga0501071_0841378 | 3300049587 | Bacteria | 708 |
| 664 | Ga0501072_0003099 | 3300049588 | Bacteria | 12529 |
| 665 | Ga0501072_0024347 | 3300049588 | Bacteria | 4708 |
| 666 | Ga0501072_0037942 | 3300049588 | Bacteria | 3780 |
| 667 | Ga0501072_0097083 | 3300049588 | Bacteria | 2342 |
| 668 | Ga0501072_0129011 | 3300049588 | Bacteria | 2015 |
| 669 | Ga0501072_0393340 | 3300049588 | Bacteria | 1100 |
| 670 | Ga0501072_0536302 | 3300049588 | Bacteria | 925 |
| 671 | Ga0501072_0697973 | 3300049588 | Unclassified | 798 |
| 672 | Ga0501073_0980430 | 3300049589 | Bacteria | 582 |
| 673 | Ga0501074_0017013 | 3300049590 | Bacteria | 5274 |
| 674 | Ga0501074_0109282 | 3300049590 | Bacteria | 1979 |
| 675 | Ga0501074_0162809 | 3300049590 | Bacteria | 1593 |
| 676 | Ga0501074_0329835 | 3300049590 | Bacteria | 1083 |
| 677 | Ga0501075_0001457 | 3300049591 | Bacteria | 15394 |
| 678 | Ga0501075_0009060 | 3300049591 | Bacteria | 6949 |
| 679 | Ga0501075_0070478 | 3300049591 | Bacteria | 2642 |
| 680 | Ga0501075_0080998 | 3300049591 | Bacteria | 2457 |
| 681 | Ga0501075_0304805 | 3300049591 | Bacteria | 1214 |
| 682 | Ga0501075_0347670 | 3300049591 | Bacteria | 1130 |
| 683 | Ga0501075_0367422 | 3300049591 | Bacteria | 1097 |
| 684 | Ga0501075_0806093 | 3300049591 | Bacteria | 714 |
| 685 | Ga0501075_1299798 | 3300049591 | Bacteria | 551 |
| 686 | Ga0501076_0003696 | 3300049592 | Bacteria | 10761 |
| 687 | Ga0501076_0105858 | 3300049592 | Bacteria | 2270 |
| 688 | Ga0501076_0115478 | 3300049592 | Bacteria | 2172 |
| 689 | Ga0501076_0128955 | 3300049592 | Bacteria | 2051 |
| 690 | Ga0501076_0186914 | 3300049592 | Bacteria | 1690 |
| 691 | Ga0501076_0589857 | 3300049592 | Bacteria | 917 |
| 692 | Ga0501076_1284485 | 3300049592 | Bacteria | 602 |
| 693 | Ga0501077_0001790 | 3300049593 | Bacteria | 12990 |
| 694 | Ga0501077_0015489 | 3300049593 | Bacteria | 4801 |
| 695 | Ga0501077_0068558 | 3300049593 | Bacteria | 2248 |
| 696 | Ga0501077_0134681 | 3300049593 | Bacteria | 1567 |
| 697 | Ga0501077_0140163 | 3300049593 | Unclassified | 1533 |
| 698 | Ga0501077_0166936 | 3300049593 | Bacteria | 1398 |
| 699 | Ga0501079_0022016 | 3300049741 | Bacteria | 4883 |
| 700 | Ga0501079_0028088 | 3300049741 | Bacteria | 4316 |
| 701 | Ga0501079_0042437 | 3300049741 | Bacteria | 3512 |
| 702 | Ga0501079_0142783 | 3300049741 | Bacteria | 1865 |
| 703 | Ga0501079_0829090 | 3300049741 | Bacteria | 728 |
| 704 | Ga0501079_1170185 | 3300049741 | Bacteria | 606 |
| 705 | Ga0501080_0224442 | 3300049742 | Bacteria | 1718 |
| 706 | Ga0501080_0378410 | 3300049742 | Unclassified | 1276 |
| 707 | Ga0501080_1607350 | 3300049742 | Bacteria | 550 |
| 708 | Ga0501081_0007524 | 3300049743 | Bacteria | 7064 |
| 709 | Ga0501081_0018275 | 3300049743 | Bacteria | 4653 |
| 710 | Ga0501081_0054818 | 3300049743 | Bacteria | 2754 |
| 711 | Ga0501081_0076183 | 3300049743 | Bacteria | 2342 |
| 712 | Ga0501081_0102296 | 3300049743 | Bacteria | 2026 |
| 713 | Ga0501081_0103072 | 3300049743 | Bacteria | 2019 |
| 714 | Ga0501081_0112754 | 3300049743 | Bacteria | 1931 |
| 715 | Ga0501081_0288219 | 3300049743 | Unclassified | 1203 |
| 716 | Ga0501081_0288548 | 3300049743 | Bacteria | 1202 |
| 717 | Ga0501081_0439269 | 3300049743 | Bacteria | 968 |
| 718 | Ga0501081_1026558 | 3300049743 | Bacteria | 623 |
| 719 | Ga0501083_0004913 | 3300049744 | Bacteria | 9460 |
| 720 | Ga0501083_1073616 | 3300049744 | Bacteria | 524 |
| 721 | Ga0501035_0435954 | 3300049822 | Bacteria | 1086 |
| 722 | Ga0501035_0542207 | 3300049822 | Bacteria | 954 |
| 723 | Ga0501045_0001608 | 3300049824 | Bacteria | 15107 |
| 724 | Ga0501045_0023140 | 3300049824 | Bacteria | 4452 |
| 725 | Ga0501045_0033745 | 3300049824 | Bacteria | 3712 |
| 726 | Ga0501045_0057787 | 3300049824 | Bacteria | 2839 |
| 727 | Ga0501045_0081106 | 3300049824 | Bacteria | 2392 |
| 728 | nmdc:mga05p37_102832_c1 | 3300050507 | Bacteria | 3518 |
| 729 | nmdc:mga05p37_114979_c1 | 3300050507 | Bacteria | 3307 |
| 730 | nmdc:mga05p37_1354391_c1 | 3300050507 | Bacteria | 721 |
| 731 | nmdc:mga05p37_1430242_c1 | 3300050507 | Archaea | 694 |
| 732 | nmdc:mga05p37_14677_c1 | 3300050507 | Bacteria | 9412 |
| 733 | nmdc:mga05p37_199_c1 | 3300050507 | Bacteria | 59838 |
| 734 | nmdc:mga05p37_263819_c1 | 3300050507 | Unclassified | 2060 |
| 735 | nmdc:mga05p37_3355_c1 | 3300050507 | Bacteria | 18678 |
| 736 | nmdc:mga05p37_38_c1 | 3300050507 | Bacteria | 109166 |
| 737 | nmdc:mga05p37_42209_c1 | 3300050507 | Bacteria | 5603 |
| 738 | nmdc:mga05p37_423690_c1 | 3300050507 | Bacteria | 1548 |
| 739 | nmdc:mga05p37_43249_c1 | 3300050507 | Bacteria | 5540 |
| 740 | nmdc:mga05p37_45640_c1 | 3300050507 | Bacteria | 5389 |
| 741 | nmdc:mga05p37_4951_c1 | 3300050507 | Bacteria | 15607 |
| 742 | nmdc:mga05p37_51992_c1 | 3300050507 | Bacteria | 5038 |
| 743 | nmdc:mga05p37_731220_c1 | 3300050507 | Bacteria | 1094 |
| 744 | nmdc:mga05p37_8986_c1 | 3300050507 | Bacteria | 11818 |
| 745 | nmdc:mga09592_1012_c1 | 3300050508 | Bacteria | 22338 |
| 746 | nmdc:mga09592_120388_c1 | 3300050508 | Bacteria | 2254 |
| 747 | nmdc:mga09592_129109_c1 | 3300050508 | Bacteria | 2174 |
| 748 | nmdc:mga09592_14052_c1 | 3300050508 | Bacteria | 6537 |
| 749 | nmdc:mga09592_1539_c1 | 3300050508 | Bacteria | 18555 |
| 750 | nmdc:mga09592_250750_c1 | 3300050508 | Bacteria | 1534 |
| 751 | nmdc:mga09592_452450_c1 | 3300050508 | Bacteria | 1108 |
| 752 | nmdc:mga09592_497381_c1 | 3300050508 | Bacteria | 1050 |
| 753 | nmdc:mga09592_582393_c1 | 3300050508 | Bacteria | 960 |
| 754 | nmdc:mga09592_69483_c1 | 3300050508 | Bacteria | 2988 |
| 755 | nmdc:mga09592_7358_c1 | 3300050508 | Bacteria | 8950 |
| 756 | nmdc:mga0qj67_2177_c1 | 3300050509 | Bacteria | 13940 |
| 757 | nmdc:mga0qj67_2412_c1 | 3300050509 | Bacteria | 13317 |
| 758 | nmdc:mga0qj67_358597_c1 | 3300050509 | Unclassified | 1178 |
| 759 | nmdc:mga0qj67_376022_c1 | 3300050509 | Bacteria | 1147 |
| 760 | nmdc:mga0qj67_4215_c1 | 3300050509 | Bacteria | 10414 |
| 761 | nmdc:mga0qj67_42659_c1 | 3300050509 | Bacteria | 3571 |
| 762 | nmdc:mga0qj67_935016_c1 | 3300050509 | Bacteria | 682 |
| 763 | nmdc:mga0qj67_99347_c1 | 3300050509 | Bacteria | 2345 |
| 764 | nmdc:mga06r32_13323_c1 | 3300050510 | Bacteria | 7447 |
| 765 | nmdc:mga06r32_14394_c1 | 3300050510 | Bacteria | 7180 |
| 766 | nmdc:mga06r32_237994_c1 | 3300050510 | Bacteria | 1808 |
| 767 | nmdc:mga06r32_26410_c1 | 3300050510 | Bacteria | 5414 |
| 768 | nmdc:mga06r32_287_c1 | 3300050510 | Bacteria | 41922 |
| 769 | nmdc:mga06r32_37213_c1 | 3300050510 | Bacteria | 4604 |
| 770 | nmdc:mga06r32_391973_c1 | 3300050510 | Bacteria | 1371 |
| 771 | nmdc:mga06r32_604616_c1 | 3300050510 | Bacteria | 1067 |
| 772 | nmdc:mga06r32_658506_c1 | 3300050510 | Bacteria | 1015 |
| 773 | nmdc:mga06r32_7053_c1 | 3300050510 | Bacteria | 10107 |
| 774 | nmdc:mga06r32_72465_c1 | 3300050510 | Bacteria | 3335 |
| 775 | nmdc:mga06r32_88462_c1 | 3300050510 | Unclassified | 3023 |
| 776 | nmdc:mga08y16_14948_c1 | 3300050511 | Bacteria | 8164 |
| 777 | nmdc:mga08y16_302485_c1 | 3300050511 | Bacteria | 1648 |
| 778 | nmdc:mga08y16_6148_c1 | 3300050511 | Bacteria | 12592 |
| 779 | nmdc:mga0n895_127669_c1 | 3300050512 | Bacteria | 2567 |
| 780 | nmdc:mga0n895_1575846_c1 | 3300050512 | Unclassified | 622 |
| 781 | nmdc:mga0n895_1587674_c1 | 3300050512 | Bacteria | 619 |
| 782 | nmdc:mga0n895_21645_c1 | 3300050512 | Bacteria | 6018 |
| 783 | nmdc:mga0n895_22280_c1 | 3300050512 | Bacteria | 5939 |
| 784 | nmdc:mga0n895_247386_c1 | 3300050512 | Bacteria | 1810 |
| 785 | nmdc:mga0n895_3925_c1 | 3300050512 | Bacteria | 3164 |
| 786 | nmdc:mga0n895_57777_c1 | 3300050512 | Bacteria | 3825 |
| 787 | nmdc:mga0n895_61_c1 | 3300050512 | Bacteria | 63108 |
| 788 | nmdc:mga0n895_93537_c1 | 3300050512 | Bacteria | 3010 |
| 789 | nmdc:mga0rr50_1176182_c1 | 3300050513 | Archaea | 652 |
| 790 | nmdc:mga0rr50_1190_c1 | 3300050513 | Bacteria | 14125 |
| 791 | nmdc:mga0rr50_18688_c1 | 3300050513 | Bacteria | 4661 |
| 792 | nmdc:mga0rr50_19205_c1 | 3300050513 | Bacteria | 4607 |
| 793 | nmdc:mga0rr50_415319_c1 | 3300050513 | Bacteria | 1138 |
| 794 | nmdc:mga0rr50_444332_c1 | 3300050513 | Unclassified | 1099 |
| 795 | nmdc:mga0rr50_631191_c1 | 3300050513 | Bacteria | 914 |
| 796 | nmdc:mga0rr50_665328_c1 | 3300050513 | Unclassified | 889 |
| 797 | nmdc:mga08x19_22050_c1 | 3300050514 | Bacteria | 3939 |
| 798 | nmdc:mga08x19_4283_c1 | 3300050514 | Bacteria | 8459 |
| 799 | nmdc:mga08x19_438958_c1 | 3300050514 | Unclassified | 918 |
| 800 | nmdc:mga08x19_764035_c1 | 3300050514 | Archaea | 686 |
| 801 | nmdc:mga08x19_905926_c1 | 3300050514 | Bacteria | 626 |
| 802 | nmdc:mga0a205_11244_c1 | 3300050515 | Bacteria | 8238 |
| 803 | nmdc:mga0a205_116102_c1 | 3300050515 | Bacteria | 2575 |
| 804 | nmdc:mga0a205_122_c1 | 3300050515 | Bacteria | 47141 |
| 805 | nmdc:mga0a205_136604_c1 | 3300050515 | Bacteria | 2352 |
| 806 | nmdc:mga0a205_32200_c1 | 3300050515 | Bacteria | 5027 |
| 807 | nmdc:mga0a205_34697_c1 | 3300050515 | Bacteria | 3508 |
| 808 | nmdc:mga0a205_5999_c1 | 3300050515 | Bacteria | 10954 |
| 809 | nmdc:mga0a205_66066_c1 | 3300050515 | Bacteria | 3495 |
| 810 | nmdc:mga0a205_7565_c1 | 3300050515 | Bacteria | 9840 |
| 811 | nmdc:mga0a205_78167_c1 | 3300050515 | Bacteria | 3197 |
| 812 | nmdc:mga0a205_895_c1 | 3300050515 | Bacteria | 17939 |
| 813 | nmdc:mga0a205_94817_c1 | 3300050515 | Bacteria | 2883 |
| 814 | Ga0501084_0005239 | 3300054114 | Bacteria | 10613 |
| 815 | Ga0501084_0009827 | 3300054114 | Bacteria | 7907 |
| 816 | Ga0501084_0012880 | 3300054114 | Bacteria | 6927 |
| 817 | Ga0501084_0051370 | 3300054114 | Bacteria | 3450 |
| 818 | Ga0501084_0092923 | 3300054114 | Unclassified | 2532 |
| 819 | Ga0501084_0544844 | 3300054114 | Unclassified | 980 |
| 820 | Ga0501084_0916731 | 3300054114 | Bacteria | 737 |
| 821 | Ga0501084_0923406 | 3300054114 | Bacteria | 734 |
| 822 | Ga0501084_0951500 | 3300054114 | Unclassified | 722 |
| 823 | Ga0501084_1107809 | 3300054114 | Unclassified | 665 |
| 824 | Ga0590071_028654 | 3300059421 | Bacteria | 1323 |
| 825 | Ga0501082_0001321 | 3300060353 | Bacteria | 21707 |
| 826 | Ga0501082_0008654 | 3300060353 | Bacteria | 8775 |
| 827 | Ga0501082_0054849 | 3300060353 | Bacteria | 3435 |
| 828 | Ga0501082_0105974 | 3300060353 | Bacteria | 2432 |
| 829 | Ga0501082_0119655 | 3300060353 | Bacteria | 2282 |
| 830 | Ga0501082_0412983 | 3300060353 | Bacteria | 1178 |
| 831 | Ga0501082_1489311 | 3300060353 | Bacteria | 591 |
| 832 | Ga0501082_1644234 | 3300060353 | Bacteria | 561 |
| 833 | Ga0530510_0032198 | 3300061734 | Bacteria | 3770 |
| 834 | Ga0530510_0041180 | 3300061734 | Bacteria | 3335 |
| 835 | Ga0530510_0059492 | 3300061734 | Bacteria | 2764 |
| 836 | Ga0530510_0190198 | 3300061734 | Bacteria | 1524 |
| 837 | Ga0530510_0231881 | 3300061734 | Bacteria | 1373 |
| 838 | Ga0530510_0266259 | 3300061734 | Bacteria | 1279 |
| 839 | Ga0530510_0391067 | 3300061734 | Bacteria | 1047 |
| 840 | Ga0530510_0531434 | 3300061734 | Unclassified | 892 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027471 | Ga0209995_1072062 | Ga0209995_10720621 | 109 |
| 2 | 3300005546 | Ga0070696_100134183 | Ga0070696_1001341832 | 110 |
| 3 | 3300006847 | Ga0075431_100159022 | Ga0075431_1001590222 | 110 |
| 4 | 3300006880 | Ga0075429_100261557 | Ga0075429_1002615572 | 110 |
| 5 | 3300007076 | Ga0075435_100501882 | Ga0075435_1005018821 | 110 |
| 6 | 3300050510 | nmdc:mga06r32_658506_c1 | nmdc:mga06r32_658506_c1_671_1003 | 110 |
| 7 | 3300006844 | Ga0075428_100016139 | Ga0075428_1000161394 | 114 |
| 8 | 3300006847 | Ga0075431_100024787 | Ga0075431_1000247872 | 114 |
| 9 | 3300006880 | Ga0075429_100054933 | Ga0075429_1000549332 | 114 |
| 10 | 3300050508 | nmdc:mga09592_120388_c1 | nmdc:mga09592_120388_c1_1637_2014 | 114 |
| 11 | 3300050510 | nmdc:mga06r32_13323_c1 | nmdc:mga06r32_13323_c1_5096_5473 | 114 |
| 12 | 3300011119 | Ga0105246_12462689 | Ga0105246_124626891 | 118 |
| 13 | 3300046472 | Ga0495580_0380069 | Ga0495580_0380069_42_404 | 120 |
| 14 | 3300005341 | Ga0070691_10246765 | Ga0070691_102467652 | 121 |
| 15 | 3300005444 | Ga0070694_100000758 | Ga0070694_1000007585 | 121 |
| 16 | 3300005536 | Ga0070697_100097916 | Ga0070697_1000979162 | 121 |
| 17 | 3300005545 | Ga0070695_100001464 | Ga0070695_10000146410 | 121 |
| 18 | 3300005549 | Ga0070704_100194232 | Ga0070704_1001942322 | 121 |
| 19 | 3300035090 | Ga0373949_0216649 | Ga0373949_0216649_16_381 | 121 |
| 20 | 3300035242 | Ga0373962_0159618 | Ga0373962_0159618_223_588 | 121 |
| 21 | 3300049572 | Ga0501036_0433038 | Ga0501036_0433038_702_1073 | 121 |
| 22 | 3300049576 | Ga0501040_0611626 | Ga0501040_0611626_341_712 | 121 |
| 23 | 3300049577 | Ga0501041_0551987 | Ga0501041_0551987_68_439 | 121 |
| 24 | 3300049579 | Ga0501043_0392161 | Ga0501043_0392161_340_711 | 121 |
| 25 | 3300049580 | Ga0501046_0073675 | Ga0501046_0073675_2018_2389 | 121 |
| 26 | 3300049584 | Ga0501068_0068617 | Ga0501068_0068617_972_1343 | 121 |
| 27 | 3300049588 | Ga0501072_0097083 | Ga0501072_0097083_730_1101 | 121 |
| 28 | 3300049593 | Ga0501077_0140163 | Ga0501077_0140163_162_533 | 121 |
| 29 | 3300049742 | Ga0501080_0224442 | Ga0501080_0224442_745_1116 | 121 |
| 30 | 3300049743 | Ga0501081_0018275 | Ga0501081_0018275_2472_2843 | 121 |
| 31 | 3300054114 | Ga0501084_0092923 | Ga0501084_0092923_844_1215 | 121 |
| 32 | 3300060353 | Ga0501082_0105974 | Ga0501082_0105974_1719_2090 | 121 |
| 33 | 3300061734 | Ga0530510_0266259 | Ga0530510_0266259_547_918 | 121 |
| 34 | 3300005458 | Ga0070681_10385237 | Ga0070681_103852372 | 122 |
| 35 | 3300005467 | Ga0070706_100116282 | Ga0070706_1001162822 | 122 |
| 36 | 3300005468 | Ga0070707_100020638 | Ga0070707_1000206384 | 122 |
| 37 | 3300005518 | Ga0070699_100283016 | Ga0070699_1002830162 | 122 |
| 38 | 3300006880 | Ga0075429_100324655 | Ga0075429_1003246552 | 122 |
| 39 | 3300009147 | Ga0114129_10809405 | Ga0114129_108094051 | 122 |
| 40 | 3300010375 | Ga0105239_11849730 | Ga0105239_118497301 | 122 |
| 41 | 3300025922 | Ga0207646_10017426 | Ga0207646_100174264 | 122 |
| 42 | 3300025936 | Ga0207670_11829273 | Ga0207670_118292731 | 122 |
| 43 | 3300025942 | Ga0207689_11511260 | Ga0207689_115112601 | 122 |
| 44 | 3300042000 | Ga0439437_020610 | Ga0439437_020610_280_648 | 122 |
| 45 | 3300042438 | Ga0439459_0113996 | Ga0439459_0113996_168_536 | 122 |
| 46 | 3300046691 | Ga0495670_0311303 | Ga0495670_0311303_33_401 | 122 |
| 47 | 3300049578 | Ga0501042_0358712 | Ga0501042_0358712_614_988 | 122 |
| 48 | 3300049588 | Ga0501072_0129011 | Ga0501072_0129011_1070_1444 | 122 |
| 49 | 3300049592 | Ga0501076_0128955 | Ga0501076_0128955_744_1181 | 122 |
| 50 | 3300049743 | Ga0501081_0288548 | Ga0501081_0288548_757_1131 | 122 |
| 51 | 3300049743 | Ga0501081_1026558 | Ga0501081_1026558_64_438 | 122 |
| 52 | 3300050508 | nmdc:mga09592_250750_c1 | nmdc:mga09592_250750_c1_394_762 | 122 |
| 53 | 3300054114 | Ga0501084_0544844 | Ga0501084_0544844_480_917 | 122 |
| 54 | 3300054114 | Ga0501084_0951500 | Ga0501084_0951500_38_475 | 122 |
| 55 | 3300061734 | Ga0530510_0391067 | Ga0530510_0391067_155_592 | 122 |
| 56 | 3300004803 | Ga0058862_11757738 | Ga0058862_117577381 | 123 |
| 57 | 3300005290 | Ga0065712_10245799 | Ga0065712_102457991 | 123 |
| 58 | 3300005293 | Ga0065715_10011729 | Ga0065715_100117292 | 123 |
| 59 | 3300005295 | Ga0065707_10377532 | Ga0065707_103775322 | 123 |
| 60 | 3300005295 | Ga0065707_10611206 | Ga0065707_106112061 | 123 |
| 61 | 3300005328 | Ga0070676_10267179 | Ga0070676_102671792 | 123 |
| 62 | 3300005328 | Ga0070676_10324717 | Ga0070676_103247172 | 123 |
| 63 | 3300005329 | Ga0070683_100197198 | Ga0070683_1001971983 | 123 |
| 64 | 3300005330 | Ga0070690_100459511 | Ga0070690_1004595111 | 123 |
| 65 | 3300005331 | Ga0070670_100017818 | Ga0070670_1000178185 | 123 |
| 66 | 3300005333 | Ga0070677_10143732 | Ga0070677_101437321 | 123 |
| 67 | 3300005334 | Ga0068869_100002767 | Ga0068869_1000027675 | 123 |
| 68 | 3300005334 | Ga0068869_100004989 | Ga0068869_1000049898 | 123 |
| 69 | 3300005334 | Ga0068869_100101413 | Ga0068869_1001014131 | 123 |
| 70 | 3300005336 | Ga0070680_100007214 | Ga0070680_1000072143 | 123 |
| 71 | 3300005336 | Ga0070680_100012717 | Ga0070680_1000127174 | 123 |
| 72 | 3300005336 | Ga0070680_100288171 | Ga0070680_1002881712 | 123 |
| 73 | 3300005337 | Ga0070682_100001205 | Ga0070682_10000120510 | 123 |
| 74 | 3300005338 | Ga0068868_100020041 | Ga0068868_1000200415 | 123 |
| 75 | 3300005340 | Ga0070689_100179716 | Ga0070689_1001797162 | 123 |
| 76 | 3300005340 | Ga0070689_100298731 | Ga0070689_1002987312 | 123 |
| 77 | 3300005341 | Ga0070691_10009079 | Ga0070691_100090794 | 123 |
| 78 | 3300005341 | Ga0070691_10031148 | Ga0070691_100311482 | 123 |
| 79 | 3300005341 | Ga0070691_10034723 | Ga0070691_100347231 | 123 |
| 80 | 3300005343 | Ga0070687_100084688 | Ga0070687_1000846882 | 123 |
| 81 | 3300005343 | Ga0070687_100741975 | Ga0070687_1007419752 | 123 |
| 82 | 3300005344 | Ga0070661_100034153 | Ga0070661_1000341533 | 123 |
| 83 | 3300005345 | Ga0070692_10002740 | Ga0070692_100027404 | 123 |
| 84 | 3300005345 | Ga0070692_10023433 | Ga0070692_100234333 | 123 |
| 85 | 3300005345 | Ga0070692_10077902 | Ga0070692_100779022 | 123 |
| 86 | 3300005347 | Ga0070668_100667745 | Ga0070668_1006677452 | 123 |
| 87 | 3300005347 | Ga0070668_100768139 | Ga0070668_1007681391 | 123 |
| 88 | 3300005353 | Ga0070669_100004573 | Ga0070669_1000045734 | 123 |
| 89 | 3300005353 | Ga0070669_100049648 | Ga0070669_1000496483 | 123 |
| 90 | 3300005354 | Ga0070675_100228953 | Ga0070675_1002289532 | 123 |
| 91 | 3300005354 | Ga0070675_100657013 | Ga0070675_1006570132 | 123 |
| 92 | 3300005356 | Ga0070674_100510951 | Ga0070674_1005109512 | 123 |
| 93 | 3300005364 | Ga0070673_100138359 | Ga0070673_1001383594 | 123 |
| 94 | 3300005366 | Ga0070659_100054477 | Ga0070659_1000544776 | 123 |
| 95 | 3300005367 | Ga0070667_100134028 | Ga0070667_1001340281 | 123 |
| 96 | 3300005436 | Ga0070713_101373939 | Ga0070713_1013739392 | 123 |
| 97 | 3300005438 | Ga0070701_10140966 | Ga0070701_101409662 | 123 |
| 98 | 3300005438 | Ga0070701_10174487 | Ga0070701_101744872 | 123 |
| 99 | 3300005439 | Ga0070711_100009216 | Ga0070711_1000092162 | 123 |
| 100 | 3300005439 | Ga0070711_100124791 | Ga0070711_1001247912 | 123 |
| 101 | 3300005440 | Ga0070705_100000542 | Ga0070705_10000054220 | 123 |
| 102 | 3300005440 | Ga0070705_100022294 | Ga0070705_1000222942 | 123 |
| 103 | 3300005440 | Ga0070705_100080985 | Ga0070705_1000809852 | 123 |
| 104 | 3300005440 | Ga0070705_100081654 | Ga0070705_1000816542 | 123 |
| 105 | 3300005440 | Ga0070705_100291214 | Ga0070705_1002912142 | 123 |
| 106 | 3300005441 | Ga0070700_100051905 | Ga0070700_1000519054 | 123 |
| 107 | 3300005441 | Ga0070700_100155761 | Ga0070700_1001557612 | 123 |
| 108 | 3300005441 | Ga0070700_100503985 | Ga0070700_1005039852 | 123 |
| 109 | 3300005444 | Ga0070694_100004529 | Ga0070694_10000452911 | 123 |
| 110 | 3300005444 | Ga0070694_100009642 | Ga0070694_1000096423 | 123 |
| 111 | 3300005444 | Ga0070694_100012156 | Ga0070694_1000121567 | 123 |
| 112 | 3300005444 | Ga0070694_100046317 | Ga0070694_1000463173 | 123 |
| 113 | 3300005444 | Ga0070694_100058837 | Ga0070694_1000588373 | 123 |
| 114 | 3300005444 | Ga0070694_100082060 | Ga0070694_1000820601 | 123 |
| 115 | 3300005444 | Ga0070694_100467478 | Ga0070694_1004674782 | 123 |
| 116 | 3300005444 | Ga0070694_100491713 | Ga0070694_1004917132 | 123 |
| 117 | 3300005444 | Ga0070694_100824822 | Ga0070694_1008248221 | 123 |
| 118 | 3300005444 | Ga0070694_100943122 | Ga0070694_1009431221 | 123 |
| 119 | 3300005445 | Ga0070708_100031570 | Ga0070708_1000315704 | 123 |
| 120 | 3300005445 | Ga0070708_100085594 | Ga0070708_1000855942 | 123 |
| 121 | 3300005445 | Ga0070708_100127188 | Ga0070708_1001271882 | 123 |
| 122 | 3300005445 | Ga0070708_100324771 | Ga0070708_1003247712 | 123 |
| 123 | 3300005445 | Ga0070708_100739102 | Ga0070708_1007391022 | 123 |
| 124 | 3300005445 | Ga0070708_101191452 | Ga0070708_1011914522 | 123 |
| 125 | 3300005455 | Ga0070663_100013971 | Ga0070663_1000139717 | 123 |
| 126 | 3300005455 | Ga0070663_100866568 | Ga0070663_1008665682 | 123 |
| 127 | 3300005457 | Ga0070662_100006301 | Ga0070662_1000063014 | 123 |
| 128 | 3300005457 | Ga0070662_100024955 | Ga0070662_1000249553 | 123 |
| 129 | 3300005457 | Ga0070662_100131215 | Ga0070662_1001312152 | 123 |
| 130 | 3300005458 | Ga0070681_10273174 | Ga0070681_102731742 | 123 |
| 131 | 3300005459 | Ga0068867_100000884 | Ga0068867_1000008842 | 123 |
| 132 | 3300005459 | Ga0068867_100038507 | Ga0068867_1000385071 | 123 |
| 133 | 3300005459 | Ga0068867_100196977 | Ga0068867_1001969772 | 123 |
| 134 | 3300005459 | Ga0068867_100255013 | Ga0068867_1002550132 | 123 |
| 135 | 3300005459 | Ga0068867_101189603 | Ga0068867_1011896031 | 123 |
| 136 | 3300005467 | Ga0070706_100046815 | Ga0070706_1000468152 | 123 |
| 137 | 3300005467 | Ga0070706_100064589 | Ga0070706_1000645894 | 123 |
| 138 | 3300005467 | Ga0070706_100097674 | Ga0070706_1000976742 | 123 |
| 139 | 3300005467 | Ga0070706_100132241 | Ga0070706_1001322412 | 123 |
| 140 | 3300005467 | Ga0070706_100264174 | Ga0070706_1002641742 | 123 |
| 141 | 3300005467 | Ga0070706_100524446 | Ga0070706_1005244462 | 123 |
| 142 | 3300005467 | Ga0070706_100729401 | Ga0070706_1007294012 | 123 |
| 143 | 3300005468 | Ga0070707_100001624 | Ga0070707_10000162413 | 123 |
| 144 | 3300005468 | Ga0070707_100041460 | Ga0070707_1000414603 | 123 |
| 145 | 3300005468 | Ga0070707_100076514 | Ga0070707_1000765142 | 123 |
| 146 | 3300005468 | Ga0070707_100204283 | Ga0070707_1002042832 | 123 |
| 147 | 3300005468 | Ga0070707_100209644 | Ga0070707_1002096442 | 123 |
| 148 | 3300005468 | Ga0070707_100210990 | Ga0070707_1002109902 | 123 |
| 149 | 3300005468 | Ga0070707_100595038 | Ga0070707_1005950382 | 123 |
| 150 | 3300005468 | Ga0070707_100997634 | Ga0070707_1009976341 | 123 |
| 151 | 3300005471 | Ga0070698_100008808 | Ga0070698_1000088082 | 123 |
| 152 | 3300005471 | Ga0070698_100081517 | Ga0070698_1000815172 | 123 |
| 153 | 3300005471 | Ga0070698_100168549 | Ga0070698_1001685492 | 123 |
| 154 | 3300005471 | Ga0070698_100610284 | Ga0070698_1006102842 | 123 |
| 155 | 3300005471 | Ga0070698_100905902 | Ga0070698_1009059022 | 123 |
| 156 | 3300005518 | Ga0070699_100004727 | Ga0070699_10000472713 | 123 |
| 157 | 3300005518 | Ga0070699_100013765 | Ga0070699_1000137656 | 123 |
| 158 | 3300005518 | Ga0070699_100026620 | Ga0070699_1000266202 | 123 |
| 159 | 3300005518 | Ga0070699_100028052 | Ga0070699_1000280524 | 123 |
| 160 | 3300005518 | Ga0070699_100031808 | Ga0070699_1000318084 | 123 |
| 161 | 3300005518 | Ga0070699_100057929 | Ga0070699_1000579292 | 123 |
| 162 | 3300005518 | Ga0070699_100231328 | Ga0070699_1002313282 | 123 |
| 163 | 3300005518 | Ga0070699_100403560 | Ga0070699_1004035602 | 123 |
| 164 | 3300005518 | Ga0070699_100781194 | Ga0070699_1007811942 | 123 |
| 165 | 3300005518 | Ga0070699_100830911 | Ga0070699_1008309112 | 123 |
| 166 | 3300005518 | Ga0070699_101852047 | Ga0070699_1018520471 | 123 |
| 167 | 3300005530 | Ga0070679_100267355 | Ga0070679_1002673553 | 123 |
| 168 | 3300005530 | Ga0070679_100415840 | Ga0070679_1004158402 | 123 |
| 169 | 3300005530 | Ga0070679_100857713 | Ga0070679_1008577132 | 123 |
| 170 | 3300005535 | Ga0070684_100019566 | Ga0070684_1000195663 | 123 |
| 171 | 3300005536 | Ga0070697_100001002 | Ga0070697_10000100221 | 123 |
| 172 | 3300005536 | Ga0070697_100008817 | Ga0070697_1000088172 | 123 |
| 173 | 3300005536 | Ga0070697_100014904 | Ga0070697_1000149046 | 123 |
| 174 | 3300005536 | Ga0070697_100216812 | Ga0070697_1002168122 | 123 |
| 175 | 3300005536 | Ga0070697_100331569 | Ga0070697_1003315692 | 123 |
| 176 | 3300005536 | Ga0070697_100455484 | Ga0070697_1004554841 | 123 |
| 177 | 3300005536 | Ga0070697_101360882 | Ga0070697_1013608821 | 123 |
| 178 | 3300005539 | Ga0068853_100001362 | Ga0068853_10000136220 | 123 |
| 179 | 3300005544 | Ga0070686_100243430 | Ga0070686_1002434302 | 123 |
| 180 | 3300005544 | Ga0070686_100593612 | Ga0070686_1005936122 | 123 |
| 181 | 3300005544 | Ga0070686_101389115 | Ga0070686_1013891151 | 123 |
| 182 | 3300005545 | Ga0070695_100000685 | Ga0070695_1000006858 | 123 |
| 183 | 3300005545 | Ga0070695_100003725 | Ga0070695_1000037255 | 123 |
| 184 | 3300005545 | Ga0070695_100036448 | Ga0070695_1000364482 | 123 |
| 185 | 3300005545 | Ga0070695_100506558 | Ga0070695_1005065581 | 123 |
| 186 | 3300005545 | Ga0070695_100667098 | Ga0070695_1006670982 | 123 |
| 187 | 3300005546 | Ga0070696_100005033 | Ga0070696_1000050334 | 123 |
| 188 | 3300005546 | Ga0070696_100012485 | Ga0070696_1000124853 | 123 |
| 189 | 3300005546 | Ga0070696_100335923 | Ga0070696_1003359231 | 123 |
| 190 | 3300005546 | Ga0070696_100855157 | Ga0070696_1008551572 | 123 |
| 191 | 3300005546 | Ga0070696_101238939 | Ga0070696_1012389391 | 123 |
| 192 | 3300005547 | Ga0070693_100000325 | Ga0070693_1000003254 | 123 |
| 193 | 3300005547 | Ga0070693_100193690 | Ga0070693_1001936902 | 123 |
| 194 | 3300005549 | Ga0070704_100000570 | Ga0070704_10000057018 | 123 |
| 195 | 3300005549 | Ga0070704_100040739 | Ga0070704_1000407392 | 123 |
| 196 | 3300005549 | Ga0070704_100095191 | Ga0070704_1000951912 | 123 |
| 197 | 3300005549 | Ga0070704_100512673 | Ga0070704_1005126731 | 123 |
| 198 | 3300005549 | Ga0070704_100640604 | Ga0070704_1006406042 | 123 |
| 199 | 3300005549 | Ga0070704_101522716 | Ga0070704_1015227161 | 123 |
| 200 | 3300005563 | Ga0068855_100042404 | Ga0068855_1000424042 | 123 |
| 201 | 3300005564 | Ga0070664_100030854 | Ga0070664_1000308542 | 123 |
| 202 | 3300005577 | Ga0068857_100038731 | Ga0068857_1000387312 | 123 |
| 203 | 3300005577 | Ga0068857_100065385 | Ga0068857_1000653853 | 123 |
| 204 | 3300005577 | Ga0068857_100152804 | Ga0068857_1001528042 | 123 |
| 205 | 3300005578 | Ga0068854_100000353 | Ga0068854_10000035314 | 123 |
| 206 | 3300005614 | Ga0068856_100010705 | Ga0068856_1000107058 | 123 |
| 207 | 3300005615 | Ga0070702_100019599 | Ga0070702_1000195992 | 123 |
| 208 | 3300005615 | Ga0070702_100081011 | Ga0070702_1000810112 | 123 |
| 209 | 3300005615 | Ga0070702_100121552 | Ga0070702_1001215522 | 123 |
| 210 | 3300005616 | Ga0068852_100376216 | Ga0068852_1003762162 | 123 |
| 211 | 3300005617 | Ga0068859_100002575 | Ga0068859_10000257516 | 123 |
| 212 | 3300005617 | Ga0068859_100369171 | Ga0068859_1003691711 | 123 |
| 213 | 3300005617 | Ga0068859_100393232 | Ga0068859_1003932322 | 123 |
| 214 | 3300005617 | Ga0068859_100545229 | Ga0068859_1005452292 | 123 |
| 215 | 3300005617 | Ga0068859_101424093 | Ga0068859_1014240932 | 123 |
| 216 | 3300005618 | Ga0068864_100008897 | Ga0068864_1000088971 | 123 |
| 217 | 3300005718 | Ga0068866_10417343 | Ga0068866_104173431 | 123 |
| 218 | 3300005719 | Ga0068861_100033261 | Ga0068861_1000332612 | 123 |
| 219 | 3300005719 | Ga0068861_100453979 | Ga0068861_1004539792 | 123 |
| 220 | 3300005840 | Ga0068870_10028177 | Ga0068870_100281773 | 123 |
| 221 | 3300005840 | Ga0068870_10484886 | Ga0068870_104848861 | 123 |
| 222 | 3300005841 | Ga0068863_100007896 | Ga0068863_1000078966 | 123 |
| 223 | 3300005841 | Ga0068863_100025704 | Ga0068863_1000257043 | 123 |
| 224 | 3300005841 | Ga0068863_100231289 | Ga0068863_1002312892 | 123 |
| 225 | 3300005841 | Ga0068863_100977756 | Ga0068863_1009777562 | 123 |
| 226 | 3300005842 | Ga0068858_100537055 | Ga0068858_1005370552 | 123 |
| 227 | 3300005842 | Ga0068858_101672349 | Ga0068858_1016723491 | 123 |
| 228 | 3300005843 | Ga0068860_100004896 | Ga0068860_1000048964 | 123 |
| 229 | 3300005843 | Ga0068860_100046278 | Ga0068860_1000462783 | 123 |
| 230 | 3300005843 | Ga0068860_100077464 | Ga0068860_1000774643 | 123 |
| 231 | 3300005843 | Ga0068860_100119632 | Ga0068860_1001196322 | 123 |
| 232 | 3300005843 | Ga0068860_100233869 | Ga0068860_1002338692 | 123 |
| 233 | 3300005843 | Ga0068860_100331703 | Ga0068860_1003317031 | 123 |
| 234 | 3300005843 | Ga0068860_100356627 | Ga0068860_1003566272 | 123 |
| 235 | 3300005843 | Ga0068860_100602011 | Ga0068860_1006020111 | 123 |
| 236 | 3300005844 | Ga0068862_100036298 | Ga0068862_1000362982 | 123 |
| 237 | 3300005844 | Ga0068862_100050690 | Ga0068862_1000506905 | 123 |
| 238 | 3300005844 | Ga0068862_100065277 | Ga0068862_1000652772 | 123 |
| 239 | 3300005844 | Ga0068862_100092228 | Ga0068862_1000922282 | 123 |
| 240 | 3300005844 | Ga0068862_101285885 | Ga0068862_1012858852 | 123 |
| 241 | 3300005981 | Ga0081538_10006559 | Ga0081538_100065595 | 123 |
| 242 | 3300005983 | Ga0081540_1078670 | Ga0081540_10786702 | 123 |
| 243 | 3300005985 | Ga0081539_10000009 | Ga0081539_10000009166 | 123 |
| 244 | 3300006163 | Ga0070715_10220217 | Ga0070715_102202171 | 123 |
| 245 | 3300006173 | Ga0070716_100501756 | Ga0070716_1005017562 | 123 |
| 246 | 3300006175 | Ga0070712_100001521 | Ga0070712_1000015219 | 123 |
| 247 | 3300006237 | Ga0097621_100284990 | Ga0097621_1002849902 | 123 |
| 248 | 3300006844 | Ga0075428_100001849 | Ga0075428_10000184916 | 123 |
| 249 | 3300006844 | Ga0075428_100002164 | Ga0075428_10000216418 | 123 |
| 250 | 3300006844 | Ga0075428_100005576 | Ga0075428_10000557614 | 123 |
| 251 | 3300006844 | Ga0075428_100018237 | Ga0075428_1000182372 | 123 |
| 252 | 3300006844 | Ga0075428_100105741 | Ga0075428_1001057412 | 123 |
| 253 | 3300006844 | Ga0075428_100975652 | Ga0075428_1009756522 | 123 |
| 254 | 3300006844 | Ga0075428_100981563 | Ga0075428_1009815632 | 123 |
| 255 | 3300006844 | Ga0075428_101476220 | Ga0075428_1014762202 | 123 |
| 256 | 3300006846 | Ga0075430_100000760 | Ga0075430_1000007606 | 123 |
| 257 | 3300006846 | Ga0075430_100000893 | Ga0075430_10000089322 | 123 |
| 258 | 3300006846 | Ga0075430_100002774 | Ga0075430_1000027745 | 123 |
| 259 | 3300006846 | Ga0075430_100030579 | Ga0075430_1000305792 | 123 |
| 260 | 3300006846 | Ga0075430_100055745 | Ga0075430_1000557452 | 123 |
| 261 | 3300006846 | Ga0075430_100190612 | Ga0075430_1001906121 | 123 |
| 262 | 3300006846 | Ga0075430_100347169 | Ga0075430_1003471692 | 123 |
| 263 | 3300006846 | Ga0075430_100389660 | Ga0075430_1003896601 | 123 |
| 264 | 3300006847 | Ga0075431_100000158 | Ga0075431_10000015825 | 123 |
| 265 | 3300006847 | Ga0075431_100004832 | Ga0075431_1000048329 | 123 |
| 266 | 3300006847 | Ga0075431_100006182 | Ga0075431_1000061826 | 123 |
| 267 | 3300006847 | Ga0075431_100007290 | Ga0075431_1000072902 | 123 |
| 268 | 3300006847 | Ga0075431_100008729 | Ga0075431_1000087297 | 123 |
| 269 | 3300006847 | Ga0075431_100023595 | Ga0075431_1000235952 | 123 |
| 270 | 3300006847 | Ga0075431_100419874 | Ga0075431_1004198742 | 123 |
| 271 | 3300006847 | Ga0075431_100559901 | Ga0075431_1005599011 | 123 |
| 272 | 3300006847 | Ga0075431_100623064 | Ga0075431_1006230642 | 123 |
| 273 | 3300006847 | Ga0075431_100640068 | Ga0075431_1006400682 | 123 |
| 274 | 3300006852 | Ga0075433_10000230 | Ga0075433_1000023024 | 123 |
| 275 | 3300006852 | Ga0075433_10000972 | Ga0075433_100009727 | 123 |
| 276 | 3300006852 | Ga0075433_10002435 | Ga0075433_1000243514 | 123 |
| 277 | 3300006852 | Ga0075433_10003721 | Ga0075433_1000372112 | 123 |
| 278 | 3300006852 | Ga0075433_10031282 | Ga0075433_100312823 | 123 |
| 279 | 3300006852 | Ga0075433_10044033 | Ga0075433_100440334 | 123 |
| 280 | 3300006852 | Ga0075433_10168573 | Ga0075433_101685732 | 123 |
| 281 | 3300006852 | Ga0075433_10265941 | Ga0075433_102659412 | 123 |
| 282 | 3300006852 | Ga0075433_10446179 | Ga0075433_104461792 | 123 |
| 283 | 3300006871 | Ga0075434_100001442 | Ga0075434_10000144212 | 123 |
| 284 | 3300006871 | Ga0075434_100032819 | Ga0075434_1000328192 | 123 |
| 285 | 3300006871 | Ga0075434_100064385 | Ga0075434_1000643852 | 123 |
| 286 | 3300006871 | Ga0075434_100071293 | Ga0075434_1000712933 | 123 |
| 287 | 3300006871 | Ga0075434_100081334 | Ga0075434_1000813342 | 123 |
| 288 | 3300006871 | Ga0075434_100095969 | Ga0075434_1000959693 | 123 |
| 289 | 3300006871 | Ga0075434_100152432 | Ga0075434_1001524322 | 123 |
| 290 | 3300006871 | Ga0075434_100218627 | Ga0075434_1002186272 | 123 |
| 291 | 3300006871 | Ga0075434_102048839 | Ga0075434_1020488391 | 123 |
| 292 | 3300006880 | Ga0075429_100000757 | Ga0075429_1000007578 | 123 |
| 293 | 3300006880 | Ga0075429_100020203 | Ga0075429_1000202032 | 123 |
| 294 | 3300006880 | Ga0075429_100024518 | Ga0075429_1000245185 | 123 |
| 295 | 3300006880 | Ga0075429_100050171 | Ga0075429_1000501712 | 123 |
| 296 | 3300006880 | Ga0075429_100055828 | Ga0075429_1000558284 | 123 |
| 297 | 3300006880 | Ga0075429_100106602 | Ga0075429_1001066022 | 123 |
| 298 | 3300006880 | Ga0075429_100328168 | Ga0075429_1003281682 | 123 |
| 299 | 3300006880 | Ga0075429_100519444 | Ga0075429_1005194442 | 123 |
| 300 | 3300006880 | Ga0075429_101278528 | Ga0075429_1012785282 | 123 |
| 301 | 3300006880 | Ga0075429_101356612 | Ga0075429_1013566121 | 123 |
| 302 | 3300006881 | Ga0068865_100209883 | Ga0068865_1002098832 | 123 |
| 303 | 3300006881 | Ga0068865_100341183 | Ga0068865_1003411832 | 123 |
| 304 | 3300006881 | Ga0068865_100617469 | Ga0068865_1006174691 | 123 |
| 305 | 3300006914 | Ga0075436_100104024 | Ga0075436_1001040242 | 123 |
| 306 | 3300006914 | Ga0075436_100655441 | Ga0075436_1006554412 | 123 |
| 307 | 3300006914 | Ga0075436_100767423 | Ga0075436_1007674232 | 123 |
| 308 | 3300006931 | Ga0097620_100002575 | Ga0097620_10000257516 | 123 |
| 309 | 3300006931 | Ga0097620_100369168 | Ga0097620_1003691681 | 123 |
| 310 | 3300006931 | Ga0097620_100393239 | Ga0097620_1003932392 | 123 |
| 311 | 3300006931 | Ga0097620_100545267 | Ga0097620_1005452672 | 123 |
| 312 | 3300006931 | Ga0097620_101424076 | Ga0097620_1014240762 | 123 |
| 313 | 3300007076 | Ga0075435_100069338 | Ga0075435_1000693383 | 123 |
| 314 | 3300007076 | Ga0075435_100216498 | Ga0075435_1002164982 | 123 |
| 315 | 3300007076 | Ga0075435_100222326 | Ga0075435_1002223261 | 123 |
| 316 | 3300007076 | Ga0075435_100487049 | Ga0075435_1004870492 | 123 |
| 317 | 3300007076 | Ga0075435_100549621 | Ga0075435_1005496212 | 123 |
| 318 | 3300007076 | Ga0075435_100741771 | Ga0075435_1007417712 | 123 |
| 319 | 3300007076 | Ga0075435_101279612 | Ga0075435_1012796122 | 123 |
| 320 | 3300007265 | Ga0099794_10002156 | Ga0099794_100021562 | 123 |
| 321 | 3300007265 | Ga0099794_10055588 | Ga0099794_100555882 | 123 |
| 322 | 3300007265 | Ga0099794_10358840 | Ga0099794_103588401 | 123 |
| 323 | 3300009093 | Ga0105240_10810126 | Ga0105240_108101261 | 123 |
| 324 | 3300009094 | Ga0111539_10000370 | Ga0111539_1000037014 | 123 |
| 325 | 3300009094 | Ga0111539_10001809 | Ga0111539_100018093 | 123 |
| 326 | 3300009094 | Ga0111539_11125599 | Ga0111539_111255991 | 123 |
| 327 | 3300009094 | Ga0111539_11811672 | Ga0111539_118116722 | 123 |
| 328 | 3300009098 | Ga0105245_10548129 | Ga0105245_105481291 | 123 |
| 329 | 3300009101 | Ga0105247_10014347 | Ga0105247_100143472 | 123 |
| 330 | 3300009147 | Ga0114129_10000443 | Ga0114129_1000044325 | 123 |
| 331 | 3300009147 | Ga0114129_10000599 | Ga0114129_1000059924 | 123 |
| 332 | 3300009147 | Ga0114129_10000708 | Ga0114129_1000070811 | 123 |
| 333 | 3300009147 | Ga0114129_10001075 | Ga0114129_1000107526 | 123 |
| 334 | 3300009147 | Ga0114129_10002320 | Ga0114129_100023202 | 123 |
| 335 | 3300009147 | Ga0114129_10040851 | Ga0114129_100408515 | 123 |
| 336 | 3300009147 | Ga0114129_10042842 | Ga0114129_100428422 | 123 |
| 337 | 3300009147 | Ga0114129_10100270 | Ga0114129_101002703 | 123 |
| 338 | 3300009147 | Ga0114129_10191525 | Ga0114129_101915252 | 123 |
| 339 | 3300009147 | Ga0114129_10251975 | Ga0114129_102519753 | 123 |
| 340 | 3300009147 | Ga0114129_10262982 | Ga0114129_102629824 | 123 |
| 341 | 3300009147 | Ga0114129_10305180 | Ga0114129_103051802 | 123 |
| 342 | 3300009147 | Ga0114129_10306476 | Ga0114129_103064762 | 123 |
| 343 | 3300009147 | Ga0114129_10309719 | Ga0114129_103097192 | 123 |
| 344 | 3300009147 | Ga0114129_10490996 | Ga0114129_104909961 | 123 |
| 345 | 3300009147 | Ga0114129_10772496 | Ga0114129_107724962 | 123 |
| 346 | 3300009147 | Ga0114129_11358201 | Ga0114129_113582012 | 123 |
| 347 | 3300009147 | Ga0114129_12163270 | Ga0114129_121632701 | 123 |
| 348 | 3300009147 | Ga0114129_12770874 | Ga0114129_127708741 | 123 |
| 349 | 3300009147 | Ga0114129_13022902 | Ga0114129_130229021 | 123 |
| 350 | 3300009148 | Ga0105243_10100476 | Ga0105243_101004762 | 123 |
| 351 | 3300009148 | Ga0105243_10108421 | Ga0105243_101084212 | 123 |
| 352 | 3300009148 | Ga0105243_11663010 | Ga0105243_116630102 | 123 |
| 353 | 3300009174 | Ga0105241_10000218 | Ga0105241_1000021815 | 123 |
| 354 | 3300009174 | Ga0105241_10058694 | Ga0105241_100586944 | 123 |
| 355 | 3300009176 | Ga0105242_10005190 | Ga0105242_100051904 | 123 |
| 356 | 3300009176 | Ga0105242_10358033 | Ga0105242_103580332 | 123 |
| 357 | 3300009177 | Ga0105248_10059326 | Ga0105248_100593262 | 123 |
| 358 | 3300009177 | Ga0105248_10121132 | Ga0105248_101211322 | 123 |
| 359 | 3300009177 | Ga0105248_10293106 | Ga0105248_102931062 | 123 |
| 360 | 3300009177 | Ga0105248_11808976 | Ga0105248_118089762 | 123 |
| 361 | 3300009551 | Ga0105238_10525137 | Ga0105238_105251372 | 123 |
| 362 | 3300009553 | Ga0105249_10076713 | Ga0105249_100767134 | 123 |
| 363 | 3300009553 | Ga0105249_10081138 | Ga0105249_100811384 | 123 |
| 364 | 3300009553 | Ga0105249_10510523 | Ga0105249_105105232 | 123 |
| 365 | 3300009553 | Ga0105249_11445337 | Ga0105249_114453372 | 123 |
| 366 | 3300009553 | Ga0105249_11455153 | Ga0105249_114551531 | 123 |
| 367 | 3300011119 | Ga0105246_10883694 | Ga0105246_108836941 | 123 |
| 368 | 3300013100 | Ga0157373_10000381 | Ga0157373_100003811 | 123 |
| 369 | 3300013102 | Ga0157371_10193965 | Ga0157371_101939652 | 123 |
| 370 | 3300013104 | Ga0157370_10894069 | Ga0157370_108940691 | 123 |
| 371 | 3300013105 | Ga0157369_10091723 | Ga0157369_100917234 | 123 |
| 372 | 3300013297 | Ga0157378_10102117 | Ga0157378_101021172 | 123 |
| 373 | 3300013297 | Ga0157378_10200643 | Ga0157378_102006432 | 123 |
| 374 | 3300013297 | Ga0157378_10365546 | Ga0157378_103655462 | 123 |
| 375 | 3300013297 | Ga0157378_10484496 | Ga0157378_104844962 | 123 |
| 376 | 3300013297 | Ga0157378_10700076 | Ga0157378_107000762 | 123 |
| 377 | 3300013297 | Ga0157378_10743689 | Ga0157378_107436892 | 123 |
| 378 | 3300013297 | Ga0157378_11073152 | Ga0157378_110731522 | 123 |
| 379 | 3300013306 | Ga0163162_10437328 | Ga0163162_104373282 | 123 |
| 380 | 3300013306 | Ga0163162_10764653 | Ga0163162_107646532 | 123 |
| 381 | 3300013306 | Ga0163162_10884530 | Ga0163162_108845302 | 123 |
| 382 | 3300013306 | Ga0163162_11999936 | Ga0163162_119999362 | 123 |
| 383 | 3300013306 | Ga0163162_12968616 | Ga0163162_129686161 | 123 |
| 384 | 3300013307 | Ga0157372_10001479 | Ga0157372_100014792 | 123 |
| 385 | 3300013307 | Ga0157372_10325645 | Ga0157372_103256451 | 123 |
| 386 | 3300013308 | Ga0157375_10091551 | Ga0157375_100915512 | 123 |
| 387 | 3300013308 | Ga0157375_10119623 | Ga0157375_101196231 | 123 |
| 388 | 3300013308 | Ga0157375_10657654 | Ga0157375_106576542 | 123 |
| 389 | 3300014325 | Ga0163163_10192997 | Ga0163163_101929972 | 123 |
| 390 | 3300014325 | Ga0163163_10217796 | Ga0163163_102177962 | 123 |
| 391 | 3300014326 | Ga0157380_10230691 | Ga0157380_102306911 | 123 |
| 392 | 3300014326 | Ga0157380_10336315 | Ga0157380_103363151 | 123 |
| 393 | 3300014326 | Ga0157380_10338884 | Ga0157380_103388842 | 123 |
| 394 | 3300014326 | Ga0157380_10691785 | Ga0157380_106917852 | 123 |
| 395 | 3300014326 | Ga0157380_12641443 | Ga0157380_126414432 | 123 |
| 396 | 3300014497 | Ga0182008_10063236 | Ga0182008_100632362 | 123 |
| 397 | 3300014745 | Ga0157377_11243655 | Ga0157377_112436552 | 123 |
| 398 | 3300014968 | Ga0157379_10184752 | Ga0157379_101847522 | 123 |
| 399 | 3300014968 | Ga0157379_10554398 | Ga0157379_105543981 | 123 |
| 400 | 3300015262 | Ga0182007_10029713 | Ga0182007_100297132 | 123 |
| 401 | 3300017792 | Ga0163161_10266277 | Ga0163161_102662772 | 123 |
| 402 | 3300017792 | Ga0163161_10587911 | Ga0163161_105879112 | 123 |
| 403 | 3300025885 | Ga0207653_10001826 | Ga0207653_100018263 | 123 |
| 404 | 3300025885 | Ga0207653_10016897 | Ga0207653_100168972 | 123 |
| 405 | 3300025885 | Ga0207653_10023098 | Ga0207653_100230982 | 123 |
| 406 | 3300025900 | Ga0207710_10180592 | Ga0207710_101805922 | 123 |
| 407 | 3300025901 | Ga0207688_10049701 | Ga0207688_100497012 | 123 |
| 408 | 3300025904 | Ga0207647_10045326 | Ga0207647_100453262 | 123 |
| 409 | 3300025905 | Ga0207685_10034619 | Ga0207685_100346192 | 123 |
| 410 | 3300025907 | Ga0207645_10001324 | Ga0207645_100013246 | 123 |
| 411 | 3300025907 | Ga0207645_10015479 | Ga0207645_100154795 | 123 |
| 412 | 3300025908 | Ga0207643_10000157 | Ga0207643_1000015725 | 123 |
| 413 | 3300025910 | Ga0207684_10000169 | Ga0207684_1000016943 | 123 |
| 414 | 3300025910 | Ga0207684_10008133 | Ga0207684_100081337 | 123 |
| 415 | 3300025910 | Ga0207684_10010283 | Ga0207684_100102836 | 123 |
| 416 | 3300025910 | Ga0207684_10014651 | Ga0207684_100146518 | 123 |
| 417 | 3300025910 | Ga0207684_10016896 | Ga0207684_100168964 | 123 |
| 418 | 3300025910 | Ga0207684_10057467 | Ga0207684_100574672 | 123 |
| 419 | 3300025910 | Ga0207684_10089629 | Ga0207684_100896292 | 123 |
| 420 | 3300025910 | Ga0207684_10287306 | Ga0207684_102873062 | 123 |
| 421 | 3300025910 | Ga0207684_10646322 | Ga0207684_106463221 | 123 |
| 422 | 3300025911 | Ga0207654_10026891 | Ga0207654_100268912 | 123 |
| 423 | 3300025911 | Ga0207654_10081699 | Ga0207654_100816992 | 123 |
| 424 | 3300025912 | Ga0207707_10000258 | Ga0207707_1000025830 | 123 |
| 425 | 3300025912 | Ga0207707_10071611 | Ga0207707_100716113 | 123 |
| 426 | 3300025915 | Ga0207693_10001303 | Ga0207693_1000130317 | 123 |
| 427 | 3300025916 | Ga0207663_10101821 | Ga0207663_101018212 | 123 |
| 428 | 3300025916 | Ga0207663_10277644 | Ga0207663_102776442 | 123 |
| 429 | 3300025917 | Ga0207660_10001383 | Ga0207660_100013832 | 123 |
| 430 | 3300025917 | Ga0207660_10036306 | Ga0207660_100363063 | 123 |
| 431 | 3300025917 | Ga0207660_10688613 | Ga0207660_106886132 | 123 |
| 432 | 3300025918 | Ga0207662_10111945 | Ga0207662_101119451 | 123 |
| 433 | 3300025919 | Ga0207657_10000373 | Ga0207657_1000037316 | 123 |
| 434 | 3300025920 | Ga0207649_10254932 | Ga0207649_102549321 | 123 |
| 435 | 3300025921 | Ga0207652_10004142 | Ga0207652_100041424 | 123 |
| 436 | 3300025921 | Ga0207652_10217124 | Ga0207652_102171241 | 123 |
| 437 | 3300025921 | Ga0207652_10635813 | Ga0207652_106358132 | 123 |
| 438 | 3300025922 | Ga0207646_10002895 | Ga0207646_100028952 | 123 |
| 439 | 3300025922 | Ga0207646_10004675 | Ga0207646_1000467513 | 123 |
| 440 | 3300025922 | Ga0207646_10038985 | Ga0207646_100389852 | 123 |
| 441 | 3300025922 | Ga0207646_10045505 | Ga0207646_100455054 | 123 |
| 442 | 3300025922 | Ga0207646_10065789 | Ga0207646_100657894 | 123 |
| 443 | 3300025922 | Ga0207646_10264914 | Ga0207646_102649142 | 123 |
| 444 | 3300025922 | Ga0207646_10891629 | Ga0207646_108916291 | 123 |
| 445 | 3300025922 | Ga0207646_11094596 | Ga0207646_110945961 | 123 |
| 446 | 3300025922 | Ga0207646_11554536 | Ga0207646_115545361 | 123 |
| 447 | 3300025923 | Ga0207681_10134534 | Ga0207681_101345342 | 123 |
| 448 | 3300025926 | Ga0207659_10207175 | Ga0207659_102071752 | 123 |
| 449 | 3300025932 | Ga0207690_10286300 | Ga0207690_102863002 | 123 |
| 450 | 3300025932 | Ga0207690_10297285 | Ga0207690_102972851 | 123 |
| 451 | 3300025933 | Ga0207706_10001857 | Ga0207706_100018574 | 123 |
| 452 | 3300025933 | Ga0207706_10008929 | Ga0207706_100089294 | 123 |
| 453 | 3300025933 | Ga0207706_10146584 | Ga0207706_101465842 | 123 |
| 454 | 3300025933 | Ga0207706_10276969 | Ga0207706_102769691 | 123 |
| 455 | 3300025934 | Ga0207686_10010046 | Ga0207686_100100464 | 123 |
| 456 | 3300025935 | Ga0207709_10028023 | Ga0207709_100280232 | 123 |
| 457 | 3300025935 | Ga0207709_10188770 | Ga0207709_101887701 | 123 |
| 458 | 3300025936 | Ga0207670_10304253 | Ga0207670_103042532 | 123 |
| 459 | 3300025936 | Ga0207670_10491276 | Ga0207670_104912761 | 123 |
| 460 | 3300025938 | Ga0207704_10131946 | Ga0207704_101319461 | 123 |
| 461 | 3300025938 | Ga0207704_10900388 | Ga0207704_109003882 | 123 |
| 462 | 3300025939 | Ga0207665_11242293 | Ga0207665_112422932 | 123 |
| 463 | 3300025941 | Ga0207711_10084644 | Ga0207711_100846443 | 123 |
| 464 | 3300025941 | Ga0207711_10375272 | Ga0207711_103752721 | 123 |
| 465 | 3300025941 | Ga0207711_11053164 | Ga0207711_110531642 | 123 |
| 466 | 3300025941 | Ga0207711_11902757 | Ga0207711_119027571 | 123 |
| 467 | 3300025942 | Ga0207689_10000975 | Ga0207689_100009752 | 123 |
| 468 | 3300025942 | Ga0207689_10001419 | Ga0207689_1000141921 | 123 |
| 469 | 3300025942 | Ga0207689_10003954 | Ga0207689_100039542 | 123 |
| 470 | 3300025945 | Ga0207679_10000779 | Ga0207679_1000077919 | 123 |
| 471 | 3300025945 | Ga0207679_11392460 | Ga0207679_113924602 | 123 |
| 472 | 3300025949 | Ga0207667_10000857 | Ga0207667_1000085726 | 123 |
| 473 | 3300025960 | Ga0207651_10013096 | Ga0207651_100130963 | 123 |
| 474 | 3300025961 | Ga0207712_10058438 | Ga0207712_100584384 | 123 |
| 475 | 3300025961 | Ga0207712_10088740 | Ga0207712_100887402 | 123 |
| 476 | 3300025961 | Ga0207712_10560610 | Ga0207712_105606102 | 123 |
| 477 | 3300025972 | Ga0207668_10541484 | Ga0207668_105414841 | 123 |
| 478 | 3300025981 | Ga0207640_10011172 | Ga0207640_100111722 | 123 |
| 479 | 3300025986 | Ga0207658_10419358 | Ga0207658_104193582 | 123 |
| 480 | 3300026023 | Ga0207677_10011276 | Ga0207677_100112762 | 123 |
| 481 | 3300026035 | Ga0207703_10415584 | Ga0207703_104155842 | 123 |
| 482 | 3300026035 | Ga0207703_11233162 | Ga0207703_112331621 | 123 |
| 483 | 3300026041 | Ga0207639_10042698 | Ga0207639_100426984 | 123 |
| 484 | 3300026067 | Ga0207678_10002143 | Ga0207678_100021436 | 123 |
| 485 | 3300026067 | Ga0207678_10879095 | Ga0207678_108790951 | 123 |
| 486 | 3300026075 | Ga0207708_10119553 | Ga0207708_101195532 | 123 |
| 487 | 3300026075 | Ga0207708_10195309 | Ga0207708_101953092 | 123 |
| 488 | 3300026075 | Ga0207708_10292588 | Ga0207708_102925881 | 123 |
| 489 | 3300026075 | Ga0207708_10399880 | Ga0207708_103998802 | 123 |
| 490 | 3300026078 | Ga0207702_10001041 | Ga0207702_1000104113 | 123 |
| 491 | 3300026088 | Ga0207641_10178512 | Ga0207641_101785121 | 123 |
| 492 | 3300026088 | Ga0207641_10344655 | Ga0207641_103446552 | 123 |
| 493 | 3300026088 | Ga0207641_11596884 | Ga0207641_115968841 | 123 |
| 494 | 3300026089 | Ga0207648_10001790 | Ga0207648_1000179021 | 123 |
| 495 | 3300026089 | Ga0207648_10158747 | Ga0207648_101587472 | 123 |
| 496 | 3300026089 | Ga0207648_10289800 | Ga0207648_102898002 | 123 |
| 497 | 3300026089 | Ga0207648_10514659 | Ga0207648_105146592 | 123 |
| 498 | 3300026089 | Ga0207648_11455425 | Ga0207648_114554251 | 123 |
| 499 | 3300026095 | Ga0207676_10046984 | Ga0207676_100469842 | 123 |
| 500 | 3300026095 | Ga0207676_11883502 | Ga0207676_118835021 | 123 |
| 501 | 3300026116 | Ga0207674_10008510 | Ga0207674_100085104 | 123 |
| 502 | 3300026116 | Ga0207674_10106524 | Ga0207674_101065243 | 123 |
| 503 | 3300026116 | Ga0207674_10329661 | Ga0207674_103296612 | 123 |
| 504 | 3300026118 | Ga0207675_100028715 | Ga0207675_1000287152 | 123 |
| 505 | 3300026118 | Ga0207675_100077456 | Ga0207675_1000774562 | 123 |
| 506 | 3300026118 | Ga0207675_100246138 | Ga0207675_1002461382 | 123 |
| 507 | 3300026118 | Ga0207675_100874761 | Ga0207675_1008747612 | 123 |
| 508 | 3300026142 | Ga0207698_10090066 | Ga0207698_100900663 | 123 |
| 509 | 3300027360 | Ga0209969_1003454 | Ga0209969_10034543 | 123 |
| 510 | 3300027364 | Ga0209967_1001743 | Ga0209967_10017433 | 123 |
| 511 | 3300027378 | Ga0209981_1020171 | Ga0209981_10201712 | 123 |
| 512 | 3300027395 | Ga0209996_1002603 | Ga0209996_10026033 | 123 |
| 513 | 3300027424 | Ga0209984_1000344 | Ga0209984_10003442 | 123 |
| 514 | 3300027471 | Ga0209995_1000323 | Ga0209995_10003232 | 123 |
| 515 | 3300027526 | Ga0209968_1002390 | Ga0209968_10023902 | 123 |
| 516 | 3300027543 | Ga0209999_1004130 | Ga0209999_10041303 | 123 |
| 517 | 3300027552 | Ga0209982_1001327 | Ga0209982_10013272 | 123 |
| 518 | 3300027665 | Ga0209983_1001424 | Ga0209983_10014247 | 123 |
| 519 | 3300027665 | Ga0209983_1084876 | Ga0209983_10848762 | 123 |
| 520 | 3300027671 | Ga0209588_1050700 | Ga0209588_10507002 | 123 |
| 521 | 3300027682 | Ga0209971_1000031 | Ga0209971_100003122 | 123 |
| 522 | 3300027682 | Ga0209971_1123873 | Ga0209971_11238731 | 123 |
| 523 | 3300027695 | Ga0209966_1000020 | Ga0209966_100002023 | 123 |
| 524 | 3300027695 | Ga0209966_1014358 | Ga0209966_10143582 | 123 |
| 525 | 3300027717 | Ga0209998_10000024 | Ga0209998_1000002427 | 123 |
| 526 | 3300027876 | Ga0209974_10001378 | Ga0209974_100013784 | 123 |
| 527 | 3300027876 | Ga0209974_10003540 | Ga0209974_100035405 | 123 |
| 528 | 3300027907 | Ga0207428_10000409 | Ga0207428_1000040935 | 123 |
| 529 | 3300027907 | Ga0207428_10007011 | Ga0207428_100070113 | 123 |
| 530 | 3300027907 | Ga0207428_10318912 | Ga0207428_103189122 | 123 |
| 531 | 3300028380 | Ga0268265_10012391 | Ga0268265_100123915 | 123 |
| 532 | 3300028380 | Ga0268265_10105753 | Ga0268265_101057532 | 123 |
| 533 | 3300028380 | Ga0268265_10119804 | Ga0268265_101198042 | 123 |
| 534 | 3300028380 | Ga0268265_10452306 | Ga0268265_104523062 | 123 |
| 535 | 3300028380 | Ga0268265_10829602 | Ga0268265_108296022 | 123 |
| 536 | 3300028380 | Ga0268265_11878580 | Ga0268265_118785801 | 123 |
| 537 | 3300028380 | Ga0268265_12231609 | Ga0268265_122316091 | 123 |
| 538 | 3300028381 | Ga0268264_10020556 | Ga0268264_100205563 | 123 |
| 539 | 3300028381 | Ga0268264_10297626 | Ga0268264_102976262 | 123 |
| 540 | 3300028381 | Ga0268264_10317022 | Ga0268264_103170222 | 123 |
| 541 | 3300028381 | Ga0268264_10737805 | Ga0268264_107378052 | 123 |
| 542 | 3300028381 | Ga0268264_11143938 | Ga0268264_111439382 | 123 |
| 543 | 3300028381 | Ga0268264_11286725 | Ga0268264_112867252 | 123 |
| 544 | 3300031548 | Ga0307408_100095384 | Ga0307408_1000953842 | 123 |
| 545 | 3300031548 | Ga0307408_100384351 | Ga0307408_1003843512 | 123 |
| 546 | 3300031548 | Ga0307408_102065086 | Ga0307408_1020650862 | 123 |
| 547 | 3300031903 | Ga0307407_10859020 | Ga0307407_108590201 | 123 |
| 548 | 3300031995 | Ga0307409_100637127 | Ga0307409_1006371272 | 123 |
| 549 | 3300032002 | Ga0307416_100383603 | Ga0307416_1003836032 | 123 |
| 550 | 3300032004 | Ga0307414_10116872 | Ga0307414_101168722 | 123 |
| 551 | 3300032004 | Ga0307414_10953980 | Ga0307414_109539802 | 123 |
| 552 | 3300032005 | Ga0307411_10135540 | Ga0307411_101355402 | 123 |
| 553 | 3300034818 | Ga0373950_0008662 | Ga0373950_0008662_732_1106 | 123 |
| 554 | 3300034819 | Ga0373958_0113965 | Ga0373958_0113965_15_386 | 123 |
| 555 | 3300034820 | Ga0373959_0042518 | Ga0373959_0042518_115_486 | 123 |
| 556 | 3300035088 | Ga0373940_0031547 | Ga0373940_0031547_974_1345 | 123 |
| 557 | 3300035088 | Ga0373940_0039022 | Ga0373940_0039022_877_1251 | 123 |
| 558 | 3300035088 | Ga0373940_0206741 | Ga0373940_0206741_124_498 | 123 |
| 559 | 3300035090 | Ga0373949_0007980 | Ga0373949_0007980_284_655 | 123 |
| 560 | 3300035090 | Ga0373949_0067790 | Ga0373949_0067790_478_849 | 123 |
| 561 | 3300035090 | Ga0373949_0309313 | Ga0373949_0309313_107_481 | 123 |
| 562 | 3300035091 | Ga0373951_0025476 | Ga0373951_0025476_470_841 | 123 |
| 563 | 3300035091 | Ga0373951_0143489 | Ga0373951_0143489_242_616 | 123 |
| 564 | 3300035114 | Ga0373939_0103364 | Ga0373939_0103364_135_509 | 123 |
| 565 | 3300035114 | Ga0373939_0317963 | Ga0373939_0317963_47_421 | 123 |
| 566 | 3300035115 | Ga0373941_0005607 | Ga0373941_0005607_2492_2866 | 123 |
| 567 | 3300035115 | Ga0373941_0040453 | Ga0373941_0040453_167_541 | 123 |
| 568 | 3300035121 | Ga0373960_0084805 | Ga0373960_0084805_548_922 | 123 |
| 569 | 3300035241 | Ga0373961_0189560 | Ga0373961_0189560_80_451 | 123 |
| 570 | 3300035242 | Ga0373962_0002572 | Ga0373962_0002572_479_853 | 123 |
| 571 | 3300035242 | Ga0373962_0271558 | Ga0373962_0271558_142_516 | 123 |
| 572 | 3300035691 | Ga0373931_0567067 | Ga0373931_0567067_263_637 | 123 |
| 573 | 3300037312 | Ga0395899_0021054 | Ga0395899_0021054_2354_2728 | 123 |
| 574 | 3300037312 | Ga0395899_0249976 | Ga0395899_0249976_458_832 | 123 |
| 575 | 3300037418 | Ga0395900_0017941 | Ga0395900_0017941_2825_3199 | 123 |
| 576 | 3300037418 | Ga0395900_0146737 | Ga0395900_0146737_1759_2133 | 123 |
| 577 | 3300037418 | Ga0395900_0642824 | Ga0395900_0642824_251_625 | 123 |
| 578 | 3300037466 | Ga0395898_0027302 | Ga0395898_0027302_5233_5607 | 123 |
| 579 | 3300037471 | Ga0395905_0238600 | Ga0395905_0238600_28_402 | 123 |
| 580 | 3300037471 | Ga0395905_0951272 | Ga0395905_0951272_150_524 | 123 |
| 581 | 3300038443 | Ga0395901_1081326 | Ga0395901_1081326_364_738 | 123 |
| 582 | 3300038996 | Ga0242420_017531 | Ga0242420_017531_840_1214 | 123 |
| 583 | 3300038996 | Ga0242420_018387 | Ga0242420_018387_325_696 | 123 |
| 584 | 3300042001 | Ga0439441_012424 | Ga0439441_012424_612_983 | 123 |
| 585 | 3300042005 | Ga0439448_0043918 | Ga0439448_0043918_856_1227 | 123 |
| 586 | 3300042012 | Ga0439455_0007416 | Ga0439455_0007416_1673_2044 | 123 |
| 587 | 3300042016 | Ga0439463_066613 | Ga0439463_066613_435_806 | 123 |
| 588 | 3300042157 | Ga0439458_0083356 | Ga0439458_0083356_398_769 | 123 |
| 589 | 3300042438 | Ga0439459_0029527 | Ga0439459_0029527_155_526 | 123 |
| 590 | 3300042439 | Ga0439464_0001377 | Ga0439464_0001377_4568_4939 | 123 |
| 591 | 3300042461 | Ga0439460_0004434 | Ga0439460_0004434_2429_2800 | 123 |
| 592 | 3300042876 | Ga0451577_0003197 | Ga0451577_0003197_3227_3598 | 123 |
| 593 | 3300042876 | Ga0451577_0017165 | Ga0451577_0017165_245_625 | 123 |
| 594 | 3300042876 | Ga0451577_0057091 | Ga0451577_0057091_560_931 | 123 |
| 595 | 3300042876 | Ga0451577_0138688 | Ga0451577_0138688_433_804 | 123 |
| 596 | 3300042876 | Ga0451577_1298153 | Ga0451577_1298153_181_558 | 123 |
| 597 | 3300042993 | Ga0439440_0100268 | Ga0439440_0100268_370_741 | 123 |
| 598 | 3300044673 | Ga0453683_0008423 | Ga0453683_0008423_5561_5938 | 123 |
| 599 | 3300044673 | Ga0453683_0048690 | Ga0453683_0048690_120_500 | 123 |
| 600 | 3300044673 | Ga0453683_0053051 | Ga0453683_0053051_1826_2197 | 123 |
| 601 | 3300044712 | Ga0453684_0051544 | Ga0453684_0051544_2972_3343 | 123 |
| 602 | 3300044712 | Ga0453684_0059189 | Ga0453684_0059189_255_635 | 123 |
| 603 | 3300044712 | Ga0453684_0189615 | Ga0453684_0189615_680_1051 | 123 |
| 604 | 3300044712 | Ga0453684_0493193 | Ga0453684_0493193_502_873 | 123 |
| 605 | 3300044712 | Ga0453684_1385269 | Ga0453684_1385269_121_495 | 123 |
| 606 | 3300045051 | Ga0451576_0016285 | Ga0451576_0016285_5211_5582 | 123 |
| 607 | 3300045051 | Ga0451576_0019862 | Ga0451576_0019862_3378_3764 | 123 |
| 608 | 3300045051 | Ga0451576_0021455 | Ga0451576_0021455_2367_2738 | 123 |
| 609 | 3300045051 | Ga0451576_0095258 | Ga0451576_0095258_2202_2576 | 123 |
| 610 | 3300045051 | Ga0451576_0109256 | Ga0451576_0109256_2377_2748 | 123 |
| 611 | 3300045051 | Ga0451576_0257085 | Ga0451576_0257085_247_618 | 123 |
| 612 | 3300045051 | Ga0451576_0423844 | Ga0451576_0423844_537_914 | 123 |
| 613 | 3300045051 | Ga0451576_1111137 | Ga0451576_1111137_323_694 | 123 |
| 614 | 3300045051 | Ga0451576_1623978 | Ga0451576_1623978_159_533 | 123 |
| 615 | 3300046615 | Ga0495656_0018852 | Ga0495656_0018852_616_990 | 123 |
| 616 | 3300046615 | Ga0495656_0817524 | Ga0495656_0817524_73_456 | 123 |
| 617 | 3300046684 | Ga0495669_0028327 | Ga0495669_0028327_1999_2373 | 123 |
| 618 | 3300046684 | Ga0495669_0124325 | Ga0495669_0124325_681_1055 | 123 |
| 619 | 3300046684 | Ga0495669_0277659 | Ga0495669_0277659_185_562 | 123 |
| 620 | 3300047318 | Ga0495636_0131050 | Ga0495636_0131050_65_439 | 123 |
| 621 | 3300048905 | Ga0496102_0010289 | Ga0496102_0010289_7034_7405 | 123 |
| 622 | 3300048905 | Ga0496102_0031996 | Ga0496102_0031996_1864_2238 | 123 |
| 623 | 3300048905 | Ga0496102_0294221 | Ga0496102_0294221_429_812 | 123 |
| 624 | 3300048907 | Ga0496104_1009209 | Ga0496104_1009209_63_437 | 123 |
| 625 | 3300048909 | Ga0496106_0125534 | Ga0496106_0125534_1515_1889 | 123 |
| 626 | 3300048911 | Ga0496108_1719409 | Ga0496108_1719409_91_474 | 123 |
| 627 | 3300048912 | Ga0496109_0475642 | Ga0496109_0475642_513_884 | 123 |
| 628 | 3300048915 | Ga0496112_0117827 | Ga0496112_0117827_869_1240 | 123 |
| 629 | 3300049568 | Ga0501031_0070611 | Ga0501031_0070611_480_851 | 123 |
| 630 | 3300049568 | Ga0501031_0203984 | Ga0501031_0203984_231_608 | 123 |
| 631 | 3300049568 | Ga0501031_0293101 | Ga0501031_0293101_250_633 | 123 |
| 632 | 3300049570 | Ga0501033_0064984 | Ga0501033_0064984_126_497 | 123 |
| 633 | 3300049570 | Ga0501033_0326261 | Ga0501033_0326261_553_930 | 123 |
| 634 | 3300049571 | Ga0501034_0896459 | Ga0501034_0896459_201_584 | 123 |
| 635 | 3300049572 | Ga0501036_0045030 | Ga0501036_0045030_2895_3278 | 123 |
| 636 | 3300049572 | Ga0501036_0046663 | Ga0501036_0046663_3158_3535 | 123 |
| 637 | 3300049572 | Ga0501036_0211866 | Ga0501036_0211866_599_970 | 123 |
| 638 | 3300049572 | Ga0501036_0826011 | Ga0501036_0826011_338_715 | 123 |
| 639 | 3300049573 | Ga0501037_0546355 | Ga0501037_0546355_123_506 | 123 |
| 640 | 3300049574 | Ga0501038_0067911 | Ga0501038_0067911_1690_2073 | 123 |
| 641 | 3300049574 | Ga0501038_0514273 | Ga0501038_0514273_292_663 | 123 |
| 642 | 3300049574 | Ga0501038_1055619 | Ga0501038_1055619_111_491 | 123 |
| 643 | 3300049575 | Ga0501039_0019151 | Ga0501039_0019151_354_737 | 123 |
| 644 | 3300049575 | Ga0501039_0144949 | Ga0501039_0144949_147_524 | 123 |
| 645 | 3300049575 | Ga0501039_0424445 | Ga0501039_0424445_356_730 | 123 |
| 646 | 3300049575 | Ga0501039_0864037 | Ga0501039_0864037_229_600 | 123 |
| 647 | 3300049576 | Ga0501040_0003451 | Ga0501040_0003451_1778_2149 | 123 |
| 648 | 3300049576 | Ga0501040_0041964 | Ga0501040_0041964_2289_2660 | 123 |
| 649 | 3300049576 | Ga0501040_0460028 | Ga0501040_0460028_469_840 | 123 |
| 650 | 3300049576 | Ga0501040_0762225 | Ga0501040_0762225_302_679 | 123 |
| 651 | 3300049577 | Ga0501041_0050743 | Ga0501041_0050743_1658_2032 | 123 |
| 652 | 3300049577 | Ga0501041_0465631 | Ga0501041_0465631_151_534 | 123 |
| 653 | 3300049577 | Ga0501041_0579252 | Ga0501041_0579252_205_591 | 123 |
| 654 | 3300049577 | Ga0501041_0783905 | Ga0501041_0783905_210_587 | 123 |
| 655 | 3300049578 | Ga0501042_0009827 | Ga0501042_0009827_3898_4269 | 123 |
| 656 | 3300049578 | Ga0501042_0040799 | Ga0501042_0040799_117_494 | 123 |
| 657 | 3300049578 | Ga0501042_0414007 | Ga0501042_0414007_160_534 | 123 |
| 658 | 3300049578 | Ga0501042_0592977 | Ga0501042_0592977_173_547 | 123 |
| 659 | 3300049578 | Ga0501042_0596528 | Ga0501042_0596528_267_638 | 123 |
| 660 | 3300049578 | Ga0501042_0627368 | Ga0501042_0627368_357_740 | 123 |
| 661 | 3300049578 | Ga0501042_1269725 | Ga0501042_1269725_59_430 | 123 |
| 662 | 3300049579 | Ga0501043_0386663 | Ga0501043_0386663_133_516 | 123 |
| 663 | 3300049579 | Ga0501043_0419529 | Ga0501043_0419529_323_697 | 123 |
| 664 | 3300049580 | Ga0501046_0000607 | Ga0501046_0000607_19445_19816 | 123 |
| 665 | 3300049580 | Ga0501046_0045322 | Ga0501046_0045322_2999_3376 | 123 |
| 666 | 3300049580 | Ga0501046_0123008 | Ga0501046_0123008_557_940 | 123 |
| 667 | 3300049581 | Ga0501047_0079990 | Ga0501047_0079990_1141_1512 | 123 |
| 668 | 3300049582 | Ga0501048_0008791 | Ga0501048_0008791_5841_6212 | 123 |
| 669 | 3300049582 | Ga0501048_0238240 | Ga0501048_0238240_286_660 | 123 |
| 670 | 3300049582 | Ga0501048_0470416 | Ga0501048_0470416_382_765 | 123 |
| 671 | 3300049582 | Ga0501048_0662806 | Ga0501048_0662806_345_722 | 123 |
| 672 | 3300049582 | Ga0501048_1213297 | Ga0501048_1213297_18_398 | 123 |
| 673 | 3300049583 | Ga0501067_0508396 | Ga0501067_0508396_114_485 | 123 |
| 674 | 3300049584 | Ga0501068_0085258 | Ga0501068_0085258_1516_1890 | 123 |
| 675 | 3300049584 | Ga0501068_0085735 | Ga0501068_0085735_161_532 | 123 |
| 676 | 3300049585 | Ga0501069_0334062 | Ga0501069_0334062_122_493 | 123 |
| 677 | 3300049585 | Ga0501069_0364907 | Ga0501069_0364907_196_570 | 123 |
| 678 | 3300049586 | Ga0501070_1122823 | Ga0501070_1122823_116_493 | 123 |
| 679 | 3300049587 | Ga0501071_0058887 | Ga0501071_0058887_730_1101 | 123 |
| 680 | 3300049587 | Ga0501071_0334358 | Ga0501071_0334358_307_690 | 123 |
| 681 | 3300049587 | Ga0501071_0841378 | Ga0501071_0841378_176_547 | 123 |
| 682 | 3300049588 | Ga0501072_0003099 | Ga0501072_0003099_1414_1788 | 123 |
| 683 | 3300049588 | Ga0501072_0024347 | Ga0501072_0024347_2252_2635 | 123 |
| 684 | 3300049588 | Ga0501072_0037942 | Ga0501072_0037942_3253_3630 | 123 |
| 685 | 3300049588 | Ga0501072_0393340 | Ga0501072_0393340_607_990 | 123 |
| 686 | 3300049588 | Ga0501072_0536302 | Ga0501072_0536302_88_462 | 123 |
| 687 | 3300049588 | Ga0501072_0697973 | Ga0501072_0697973_154_531 | 123 |
| 688 | 3300049589 | Ga0501073_0980430 | Ga0501073_0980430_68_451 | 123 |
| 689 | 3300049590 | Ga0501074_0017013 | Ga0501074_0017013_4661_5032 | 123 |
| 690 | 3300049590 | Ga0501074_0109282 | Ga0501074_0109282_1408_1779 | 123 |
| 691 | 3300049590 | Ga0501074_0162809 | Ga0501074_0162809_71_445 | 123 |
| 692 | 3300049590 | Ga0501074_0329835 | Ga0501074_0329835_664_1047 | 123 |
| 693 | 3300049591 | Ga0501075_0001457 | Ga0501075_0001457_13869_14246 | 123 |
| 694 | 3300049591 | Ga0501075_0009060 | Ga0501075_0009060_5841_6212 | 123 |
| 695 | 3300049591 | Ga0501075_0070478 | Ga0501075_0070478_2235_2609 | 123 |
| 696 | 3300049591 | Ga0501075_0080998 | Ga0501075_0080998_2006_2380 | 123 |
| 697 | 3300049591 | Ga0501075_0304805 | Ga0501075_0304805_204_584 | 123 |
| 698 | 3300049591 | Ga0501075_0347670 | Ga0501075_0347670_179_556 | 123 |
| 699 | 3300049591 | Ga0501075_0367422 | Ga0501075_0367422_373_747 | 123 |
| 700 | 3300049591 | Ga0501075_0806093 | Ga0501075_0806093_116_499 | 123 |
| 701 | 3300049591 | Ga0501075_1299798 | Ga0501075_1299798_134_505 | 123 |
| 702 | 3300049592 | Ga0501076_0003696 | Ga0501076_0003696_2414_2785 | 123 |
| 703 | 3300049592 | Ga0501076_0105858 | Ga0501076_0105858_1178_1561 | 123 |
| 704 | 3300049592 | Ga0501076_0115478 | Ga0501076_0115478_1702_2073 | 123 |
| 705 | 3300049592 | Ga0501076_0186914 | Ga0501076_0186914_1292_1663 | 123 |
| 706 | 3300049592 | Ga0501076_0589857 | Ga0501076_0589857_228_602 | 123 |
| 707 | 3300049592 | Ga0501076_1284485 | Ga0501076_1284485_193_570 | 123 |
| 708 | 3300049593 | Ga0501077_0001790 | Ga0501077_0001790_4978_5355 | 123 |
| 709 | 3300049593 | Ga0501077_0015489 | Ga0501077_0015489_594_965 | 123 |
| 710 | 3300049593 | Ga0501077_0068558 | Ga0501077_0068558_55_429 | 123 |
| 711 | 3300049593 | Ga0501077_0134681 | Ga0501077_0134681_1088_1471 | 123 |
| 712 | 3300049593 | Ga0501077_0166936 | Ga0501077_0166936_241_624 | 123 |
| 713 | 3300049741 | Ga0501079_0022016 | Ga0501079_0022016_2199_2570 | 123 |
| 714 | 3300049741 | Ga0501079_0028088 | Ga0501079_0028088_2901_3284 | 123 |
| 715 | 3300049741 | Ga0501079_0042437 | Ga0501079_0042437_3095_3469 | 123 |
| 716 | 3300049741 | Ga0501079_0142783 | Ga0501079_0142783_436_807 | 123 |
| 717 | 3300049741 | Ga0501079_0829090 | Ga0501079_0829090_82_456 | 123 |
| 718 | 3300049741 | Ga0501079_1170185 | Ga0501079_1170185_14_391 | 123 |
| 719 | 3300049742 | Ga0501080_0378410 | Ga0501080_0378410_688_1071 | 123 |
| 720 | 3300049742 | Ga0501080_1607350 | Ga0501080_1607350_122_496 | 123 |
| 721 | 3300049743 | Ga0501081_0007524 | Ga0501081_0007524_121_495 | 123 |
| 722 | 3300049743 | Ga0501081_0054818 | Ga0501081_0054818_1285_1656 | 123 |
| 723 | 3300049743 | Ga0501081_0076183 | Ga0501081_0076183_1283_1660 | 123 |
| 724 | 3300049743 | Ga0501081_0102296 | Ga0501081_0102296_1366_1740 | 123 |
| 725 | 3300049743 | Ga0501081_0103072 | Ga0501081_0103072_1164_1544 | 123 |
| 726 | 3300049743 | Ga0501081_0112754 | Ga0501081_0112754_278_655 | 123 |
| 727 | 3300049743 | Ga0501081_0288219 | Ga0501081_0288219_135_506 | 123 |
| 728 | 3300049743 | Ga0501081_0439269 | Ga0501081_0439269_343_714 | 123 |
| 729 | 3300049744 | Ga0501083_0004913 | Ga0501083_0004913_7857_8228 | 123 |
| 730 | 3300049744 | Ga0501083_1073616 | Ga0501083_1073616_45_419 | 123 |
| 731 | 3300049822 | Ga0501035_0435954 | Ga0501035_0435954_640_1011 | 123 |
| 732 | 3300049822 | Ga0501035_0542207 | Ga0501035_0542207_46_417 | 123 |
| 733 | 3300049824 | Ga0501045_0001608 | Ga0501045_0001608_13437_13808 | 123 |
| 734 | 3300049824 | Ga0501045_0023140 | Ga0501045_0023140_149_526 | 123 |
| 735 | 3300049824 | Ga0501045_0033745 | Ga0501045_0033745_2636_3019 | 123 |
| 736 | 3300049824 | Ga0501045_0057787 | Ga0501045_0057787_532_915 | 123 |
| 737 | 3300049824 | Ga0501045_0081106 | Ga0501045_0081106_282_656 | 123 |
| 738 | 3300050507 | nmdc:mga05p37_102832_c1 | nmdc:mga05p37_102832_c1_1025_1399 | 123 |
| 739 | 3300050507 | nmdc:mga05p37_114979_c1 | nmdc:mga05p37_114979_c1_1960_2334 | 123 |
| 740 | 3300050507 | nmdc:mga05p37_1354391_c1 | nmdc:mga05p37_1354391_c1_312_686 | 123 |
| 741 | 3300050507 | nmdc:mga05p37_1430242_c1 | nmdc:mga05p37_1430242_c1_248_619 | 123 |
| 742 | 3300050507 | nmdc:mga05p37_14677_c1 | nmdc:mga05p37_14677_c1_5539_5913 | 123 |
| 743 | 3300050507 | nmdc:mga05p37_199_c1 | nmdc:mga05p37_199_c1_21974_22348 | 123 |
| 744 | 3300050507 | nmdc:mga05p37_263819_c1 | nmdc:mga05p37_263819_c1_608_982 | 123 |
| 745 | 3300050507 | nmdc:mga05p37_3355_c1 | nmdc:mga05p37_3355_c1_12098_12472 | 123 |
| 746 | 3300050507 | nmdc:mga05p37_38_c1 | nmdc:mga05p37_38_c1_17719_18099 | 123 |
| 747 | 3300050507 | nmdc:mga05p37_42209_c1 | nmdc:mga05p37_42209_c1_1933_2307 | 123 |
| 748 | 3300050507 | nmdc:mga05p37_423690_c1 | nmdc:mga05p37_423690_c1_51_422 | 123 |
| 749 | 3300050507 | nmdc:mga05p37_43249_c1 | nmdc:mga05p37_43249_c1_118_495 | 123 |
| 750 | 3300050507 | nmdc:mga05p37_45640_c1 | nmdc:mga05p37_45640_c1_2851_3225 | 123 |
| 751 | 3300050507 | nmdc:mga05p37_4951_c1 | nmdc:mga05p37_4951_c1_8386_8763 | 123 |
| 752 | 3300050507 | nmdc:mga05p37_51992_c1 | nmdc:mga05p37_51992_c1_2939_3337 | 123 |
| 753 | 3300050507 | nmdc:mga05p37_731220_c1 | nmdc:mga05p37_731220_c1_73_447 | 123 |
| 754 | 3300050507 | nmdc:mga05p37_8986_c1 | nmdc:mga05p37_8986_c1_6079_6453 | 123 |
| 755 | 3300050508 | nmdc:mga09592_1012_c1 | nmdc:mga09592_1012_c1_3171_3569 | 123 |
| 756 | 3300050508 | nmdc:mga09592_129109_c1 | nmdc:mga09592_129109_c1_1727_2101 | 123 |
| 757 | 3300050508 | nmdc:mga09592_14052_c1 | nmdc:mga09592_14052_c1_4993_5373 | 123 |
| 758 | 3300050508 | nmdc:mga09592_1539_c1 | nmdc:mga09592_1539_c1_3471_3845 | 123 |
| 759 | 3300050508 | nmdc:mga09592_452450_c1 | nmdc:mga09592_452450_c1_706_1080 | 123 |
| 760 | 3300050508 | nmdc:mga09592_497381_c1 | nmdc:mga09592_497381_c1_138_512 | 123 |
| 761 | 3300050508 | nmdc:mga09592_582393_c1 | nmdc:mga09592_582393_c1_256_627 | 123 |
| 762 | 3300050508 | nmdc:mga09592_69483_c1 | nmdc:mga09592_69483_c1_318_692 | 123 |
| 763 | 3300050508 | nmdc:mga09592_7358_c1 | nmdc:mga09592_7358_c1_2290_2664 | 123 |
| 764 | 3300050509 | nmdc:mga0qj67_2177_c1 | nmdc:mga0qj67_2177_c1_10092_10469 | 123 |
| 765 | 3300050509 | nmdc:mga0qj67_2412_c1 | nmdc:mga0qj67_2412_c1_9036_9410 | 123 |
| 766 | 3300050509 | nmdc:mga0qj67_358597_c1 | nmdc:mga0qj67_358597_c1_176_550 | 123 |
| 767 | 3300050509 | nmdc:mga0qj67_376022_c1 | nmdc:mga0qj67_376022_c1_90_464 | 123 |
| 768 | 3300050509 | nmdc:mga0qj67_4215_c1 | nmdc:mga0qj67_4215_c1_1271_1669 | 123 |
| 769 | 3300050509 | nmdc:mga0qj67_42659_c1 | nmdc:mga0qj67_42659_c1_1873_2247 | 123 |
| 770 | 3300050509 | nmdc:mga0qj67_935016_c1 | nmdc:mga0qj67_935016_c1_122_493 | 123 |
| 771 | 3300050509 | nmdc:mga0qj67_99347_c1 | nmdc:mga0qj67_99347_c1_10_384 | 123 |
| 772 | 3300050510 | nmdc:mga06r32_14394_c1 | nmdc:mga06r32_14394_c1_537_911 | 123 |
| 773 | 3300050510 | nmdc:mga06r32_237994_c1 | nmdc:mga06r32_237994_c1_1359_1742 | 123 |
| 774 | 3300050510 | nmdc:mga06r32_26410_c1 | nmdc:mga06r32_26410_c1_4942_5316 | 123 |
| 775 | 3300050510 | nmdc:mga06r32_287_c1 | nmdc:mga06r32_287_c1_20214_20594 | 123 |
| 776 | 3300050510 | nmdc:mga06r32_37213_c1 | nmdc:mga06r32_37213_c1_2936_3334 | 123 |
| 777 | 3300050510 | nmdc:mga06r32_391973_c1 | nmdc:mga06r32_391973_c1_789_1163 | 123 |
| 778 | 3300050510 | nmdc:mga06r32_604616_c1 | nmdc:mga06r32_604616_c1_606_977 | 123 |
| 779 | 3300050510 | nmdc:mga06r32_7053_c1 | nmdc:mga06r32_7053_c1_2400_2777 | 123 |
| 780 | 3300050510 | nmdc:mga06r32_72465_c1 | nmdc:mga06r32_72465_c1_2169_2543 | 123 |
| 781 | 3300050510 | nmdc:mga06r32_88462_c1 | nmdc:mga06r32_88462_c1_486_860 | 123 |
| 782 | 3300050511 | nmdc:mga08y16_14948_c1 | nmdc:mga08y16_14948_c1_3207_3578 | 123 |
| 783 | 3300050511 | nmdc:mga08y16_302485_c1 | nmdc:mga08y16_302485_c1_37_420 | 123 |
| 784 | 3300050511 | nmdc:mga08y16_6148_c1 | nmdc:mga08y16_6148_c1_12045_12419 | 123 |
| 785 | 3300050512 | nmdc:mga0n895_127669_c1 | nmdc:mga0n895_127669_c1_1026_1397 | 123 |
| 786 | 3300050512 | nmdc:mga0n895_1575846_c1 | nmdc:mga0n895_1575846_c1_51_425 | 123 |
| 787 | 3300050512 | nmdc:mga0n895_1587674_c1 | nmdc:mga0n895_1587674_c1_222_605 | 123 |
| 788 | 3300050512 | nmdc:mga0n895_21645_c1 | nmdc:mga0n895_21645_c1_3582_3956 | 123 |
| 789 | 3300050512 | nmdc:mga0n895_22280_c1 | nmdc:mga0n895_22280_c1_1033_1404 | 123 |
| 790 | 3300050512 | nmdc:mga0n895_247386_c1 | nmdc:mga0n895_247386_c1_406_777 | 123 |
| 791 | 3300050512 | nmdc:mga0n895_3925_c1 | nmdc:mga0n895_3925_c1_2012_2389 | 123 |
| 792 | 3300050512 | nmdc:mga0n895_57777_c1 | nmdc:mga0n895_57777_c1_2010_2384 | 123 |
| 793 | 3300050512 | nmdc:mga0n895_61_c1 | nmdc:mga0n895_61_c1_21376_21750 | 123 |
| 794 | 3300050512 | nmdc:mga0n895_93537_c1 | nmdc:mga0n895_93537_c1_1040_1411 | 123 |
| 795 | 3300050513 | nmdc:mga0rr50_1176182_c1 | nmdc:mga0rr50_1176182_c1_38_409 | 123 |
| 796 | 3300050513 | nmdc:mga0rr50_1190_c1 | nmdc:mga0rr50_1190_c1_9349_9723 | 123 |
| 797 | 3300050513 | nmdc:mga0rr50_18688_c1 | nmdc:mga0rr50_18688_c1_1786_2160 | 123 |
| 798 | 3300050513 | nmdc:mga0rr50_19205_c1 | nmdc:mga0rr50_19205_c1_689_1063 | 123 |
| 799 | 3300050513 | nmdc:mga0rr50_415319_c1 | nmdc:mga0rr50_415319_c1_392_766 | 123 |
| 800 | 3300050513 | nmdc:mga0rr50_444332_c1 | nmdc:mga0rr50_444332_c1_579_953 | 123 |
| 801 | 3300050513 | nmdc:mga0rr50_631191_c1 | nmdc:mga0rr50_631191_c1_490_864 | 123 |
| 802 | 3300050513 | nmdc:mga0rr50_665328_c1 | nmdc:mga0rr50_665328_c1_157_531 | 123 |
| 803 | 3300050514 | nmdc:mga08x19_22050_c1 | nmdc:mga08x19_22050_c1_1243_1617 | 123 |
| 804 | 3300050514 | nmdc:mga08x19_4283_c1 | nmdc:mga08x19_4283_c1_4839_5213 | 123 |
| 805 | 3300050514 | nmdc:mga08x19_438958_c1 | nmdc:mga08x19_438958_c1_20_394 | 123 |
| 806 | 3300050514 | nmdc:mga08x19_764035_c1 | nmdc:mga08x19_764035_c1_137_511 | 123 |
| 807 | 3300050514 | nmdc:mga08x19_905926_c1 | nmdc:mga08x19_905926_c1_202_573 | 123 |
| 808 | 3300050515 | nmdc:mga0a205_11244_c1 | nmdc:mga0a205_11244_c1_7189_7560 | 123 |
| 809 | 3300050515 | nmdc:mga0a205_116102_c1 | nmdc:mga0a205_116102_c1_1412_1786 | 123 |
| 810 | 3300050515 | nmdc:mga0a205_122_c1 | nmdc:mga0a205_122_c1_32832_33206 | 123 |
| 811 | 3300050515 | nmdc:mga0a205_136604_c1 | nmdc:mga0a205_136604_c1_504_878 | 123 |
| 812 | 3300050515 | nmdc:mga0a205_32200_c1 | nmdc:mga0a205_32200_c1_3766_4140 | 123 |
| 813 | 3300050515 | nmdc:mga0a205_34697_c1 | nmdc:mga0a205_34697_c1_2349_2723 | 123 |
| 814 | 3300050515 | nmdc:mga0a205_5999_c1 | nmdc:mga0a205_5999_c1_3631_4005 | 123 |
| 815 | 3300050515 | nmdc:mga0a205_66066_c1 | nmdc:mga0a205_66066_c1_1433_1807 | 123 |
| 816 | 3300050515 | nmdc:mga0a205_7565_c1 | nmdc:mga0a205_7565_c1_1227_1598 | 123 |
| 817 | 3300050515 | nmdc:mga0a205_78167_c1 | nmdc:mga0a205_78167_c1_307_678 | 123 |
| 818 | 3300050515 | nmdc:mga0a205_895_c1 | nmdc:mga0a205_895_c1_5700_6071 | 123 |
| 819 | 3300050515 | nmdc:mga0a205_94817_c1 | nmdc:mga0a205_94817_c1_2242_2616 | 123 |
| 820 | 3300054114 | Ga0501084_0005239 | Ga0501084_0005239_6486_6863 | 123 |
| 821 | 3300054114 | Ga0501084_0009827 | Ga0501084_0009827_7081_7464 | 123 |
| 822 | 3300054114 | Ga0501084_0012880 | Ga0501084_0012880_1258_1629 | 123 |
| 823 | 3300054114 | Ga0501084_0051370 | Ga0501084_0051370_1369_1752 | 123 |
| 824 | 3300054114 | Ga0501084_0916731 | Ga0501084_0916731_139_519 | 123 |
| 825 | 3300054114 | Ga0501084_0923406 | Ga0501084_0923406_314_688 | 123 |
| 826 | 3300054114 | Ga0501084_1107809 | Ga0501084_1107809_246_623 | 123 |
| 827 | 3300059421 | Ga0590071_028654 | Ga0590071_028654_90_467 | 123 |
| 828 | 3300060353 | Ga0501082_0001321 | Ga0501082_0001321_19169_19540 | 123 |
| 829 | 3300060353 | Ga0501082_0008654 | Ga0501082_0008654_7566_7943 | 123 |
| 830 | 3300060353 | Ga0501082_0054849 | Ga0501082_0054849_1845_2219 | 123 |
| 831 | 3300060353 | Ga0501082_0119655 | Ga0501082_0119655_1417_1800 | 123 |
| 832 | 3300060353 | Ga0501082_0412983 | Ga0501082_0412983_23_394 | 123 |
| 833 | 3300060353 | Ga0501082_1489311 | Ga0501082_1489311_74_448 | 123 |
| 834 | 3300060353 | Ga0501082_1644234 | Ga0501082_1644234_32_415 | 123 |
| 835 | 3300061734 | Ga0530510_0032198 | Ga0530510_0032198_1856_2233 | 123 |
| 836 | 3300061734 | Ga0530510_0041180 | Ga0530510_0041180_103_474 | 123 |
| 837 | 3300061734 | Ga0530510_0059492 | Ga0530510_0059492_1142_1513 | 123 |
| 838 | 3300061734 | Ga0530510_0190198 | Ga0530510_0190198_1005_1388 | 123 |
| 839 | 3300061734 | Ga0530510_0231881 | Ga0530510_0231881_247_630 | 123 |
| 840 | 3300061734 | Ga0530510_0531434 | Ga0530510_0531434_198_569 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e11-assembly2.cif.gz_B | crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution | 0.7487 | 1 | 121 |
| 3e11-assembly2.cif.gz_B | crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution | 0.7183 | 1 | 121 |
| 6cdk-assembly1.cif.gz_A | characterization of the p1+ intermediate state of nitrogenase p-cluster | 0.5484 | 1 | 38 |
| 2ejq-assembly1.cif.gz_A | conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 | 0.5456 | 2 | 109 |
| 6o7s-assembly1.cif.gz_C | nitrogenase mofep mutant s188a from azotobacter vinelandii in the indigo carmine oxidized state | 0.5272 | 2 | 42 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e11B00 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.7442 | 1 | 121 | 3.30.2010.20 |
| 3e11B00 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.7203 | 1 | 121 | 3.30.2010.20 |
| af_O53352_14_135_3.30.2010.20 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.6058 | 1 | 112 | 3.30.2010.20 |
| af_O53352_14_135_3.30.2010.20 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.5561 | 1 | 112 | 3.30.2010.20 |
| 2ejqA00 | Alpha Beta;2-Layer Sandwich;Zincin-like; | 0.5456 | 2 | 109 | 3.30.2010.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7XY82-F1-model_v4 | Metallopeptidase family protein | 0.8201 | 1 | 116 |
|
| AF-A0A2V7XY82-F1-model_v4 | Metallopeptidase family protein | 0.7961 | 1 | 116 |
|
| AF-A0A536K7L6-F1-model_v4 | Metallopeptidase family protein | 0.7702 | 1 | 114 |
|
| AF-A0A6B0ZI63-F1-model_v4 | Metallopeptidase family protein | 0.7634 | 1 | 119 |
|
| AF-A0A318A933-F1-model_v4 | Metallopeptidase family protein | 0.7587 | 1 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar