F483047

General Info

Members Datasets Scaffolds Average Seq Length
840 270 840 124

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100002164|Ga0075428_10000216418
Length 132
Sequence MRGRLDHGMTRRQFEAMVEKALRKLPKDFRDKIANIAVVVEDWADEETLAEMGIEPPDTLYGLYRGVDLTARDSSYGNVLPDVITIYQGPIEEDAADEAEMGEIVRETVVHELGHYFGLDDDTMHRIEDGEV

Samples

Sample ID Description Type Environment
1 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
185 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
186 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
202 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.95
Rhizosphere 99.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_11757738 3300004803 Unclassified 810
2 Ga0065712_10245799 3300005290 Bacteria 972
3 Ga0065715_10011729 3300005293 Bacteria 3428
4 Ga0065707_10377532 3300005295 Bacteria 876
5 Ga0065707_10611206 3300005295 Bacteria 684
6 Ga0070676_10267179 3300005328 Bacteria 1147
7 Ga0070676_10324717 3300005328 Bacteria 1051
8 Ga0070683_100197198 3300005329 Bacteria 1912
9 Ga0070690_100459511 3300005330 Bacteria 945
10 Ga0070670_100017818 3300005331 Bacteria 6094
11 Ga0070677_10143732 3300005333 Bacteria 1103
12 Ga0068869_100002767 3300005334 Bacteria 10622
13 Ga0068869_100004989 3300005334 Bacteria 8308
14 Ga0068869_100101413 3300005334 Bacteria 2177
15 Ga0070680_100007214 3300005336 Bacteria 8472
16 Ga0070680_100012717 3300005336 Bacteria 6541
17 Ga0070680_100288171 3300005336 Bacteria 1392
18 Ga0070682_100001205 3300005337 Bacteria 14746
19 Ga0068868_100020041 3300005338 Bacteria 5018
20 Ga0070689_100179716 3300005340 Bacteria 1718
21 Ga0070689_100298731 3300005340 Bacteria 1340
22 Ga0070691_10009079 3300005341 Bacteria 4546
23 Ga0070691_10031148 3300005341 Bacteria 2501
24 Ga0070691_10034723 3300005341 Unclassified 2374
25 Ga0070691_10246765 3300005341 Bacteria 956
26 Ga0070687_100084688 3300005343 Bacteria 1738
27 Ga0070687_100741975 3300005343 Bacteria 690
28 Ga0070661_100034153 3300005344 Bacteria 3688
29 Ga0070692_10002740 3300005345 Bacteria 6926
30 Ga0070692_10023433 3300005345 Bacteria 3025
31 Ga0070692_10077902 3300005345 Bacteria 1779
32 Ga0070668_100667745 3300005347 Bacteria 914
33 Ga0070668_100768139 3300005347 Unclassified 854
34 Ga0070669_100004573 3300005353 Bacteria 9989
35 Ga0070669_100049648 3300005353 Bacteria 3063
36 Ga0070675_100228953 3300005354 Bacteria 1621
37 Ga0070675_100657013 3300005354 Bacteria 953
38 Ga0070674_100510951 3300005356 Bacteria 1002
39 Ga0070673_100138359 3300005364 Bacteria 2052
40 Ga0070659_100054477 3300005366 Unclassified 3150
41 Ga0070667_100134028 3300005367 Bacteria 2165
42 Ga0070713_101373939 3300005436 Unclassified 685
43 Ga0070701_10140966 3300005438 Bacteria 1378
44 Ga0070701_10174487 3300005438 Bacteria 1254
45 Ga0070711_100009216 3300005439 Bacteria 6068
46 Ga0070711_100124791 3300005439 Bacteria 1910
47 Ga0070705_100000542 3300005440 Bacteria 21855
48 Ga0070705_100022294 3300005440 Bacteria 3383
49 Ga0070705_100080985 3300005440 Unclassified 1993
50 Ga0070705_100081654 3300005440 Bacteria 1987
51 Ga0070705_100291214 3300005440 Unclassified 1165
52 Ga0070700_100051905 3300005441 Bacteria 2555
53 Ga0070700_100155761 3300005441 Bacteria 1567
54 Ga0070700_100503985 3300005441 Bacteria 932
55 Ga0070694_100000758 3300005444 Bacteria 18068
56 Ga0070694_100004529 3300005444 Bacteria 8358
57 Ga0070694_100009642 3300005444 Bacteria 5926
58 Ga0070694_100012156 3300005444 Bacteria 5348
59 Ga0070694_100046317 3300005444 Bacteria 2919
60 Ga0070694_100058837 3300005444 Bacteria 2616
61 Ga0070694_100082060 3300005444 Bacteria 2244
62 Ga0070694_100467478 3300005444 Bacteria 998
63 Ga0070694_100491713 3300005444 Bacteria 975
64 Ga0070694_100824822 3300005444 Bacteria 762
65 Ga0070694_100943122 3300005444 Bacteria 714
66 Ga0070708_100031570 3300005445 Bacteria 4586
67 Ga0070708_100085594 3300005445 Bacteria 2861
68 Ga0070708_100127188 3300005445 Bacteria 2356
69 Ga0070708_100324771 3300005445 Bacteria 1450
70 Ga0070708_100739102 3300005445 Bacteria 925
71 Ga0070708_101191452 3300005445 Bacteria 712
72 Ga0070663_100013971 3300005455 Bacteria 5140
73 Ga0070663_100866568 3300005455 Bacteria 778
74 Ga0070662_100006301 3300005457 Bacteria 7644
75 Ga0070662_100024955 3300005457 Bacteria 4124
76 Ga0070662_100131215 3300005457 Unclassified 1932
77 Ga0070681_10273174 3300005458 Bacteria 1601
78 Ga0070681_10385237 3300005458 Bacteria 1313
79 Ga0068867_100000884 3300005459 Bacteria 20270
80 Ga0068867_100038507 3300005459 Bacteria 3481
81 Ga0068867_100196977 3300005459 Bacteria 1611
82 Ga0068867_100255013 3300005459 Bacteria 1428
83 Ga0068867_101189603 3300005459 Unclassified 700
84 Ga0070706_100046815 3300005467 Bacteria 3993
85 Ga0070706_100064589 3300005467 Bacteria 3383
86 Ga0070706_100097674 3300005467 Bacteria 2728
87 Ga0070706_100116282 3300005467 Bacteria 2491
88 Ga0070706_100132241 3300005467 Bacteria 2329
89 Ga0070706_100264174 3300005467 Bacteria 1606
90 Ga0070706_100524446 3300005467 Unclassified 1102
91 Ga0070706_100729401 3300005467 Bacteria 918
92 Ga0070707_100001624 3300005468 Bacteria 21802
93 Ga0070707_100020638 3300005468 Bacteria 6217
94 Ga0070707_100041460 3300005468 Bacteria 4406
95 Ga0070707_100076514 3300005468 Bacteria 3228
96 Ga0070707_100204283 3300005468 Bacteria 1926
97 Ga0070707_100209644 3300005468 Bacteria 1899
98 Ga0070707_100210990 3300005468 Bacteria 1893
99 Ga0070707_100595038 3300005468 Bacteria 1068
100 Ga0070707_100997634 3300005468 Bacteria 803
101 Ga0070698_100008808 3300005471 Bacteria 10858
102 Ga0070698_100081517 3300005471 Bacteria 3229
103 Ga0070698_100168549 3300005471 Bacteria 2131
104 Ga0070698_100610284 3300005471 Bacteria 1031
105 Ga0070698_100905902 3300005471 Unclassified 827
106 Ga0070699_100004727 3300005518 Bacteria 12040
107 Ga0070699_100013765 3300005518 Bacteria 6959
108 Ga0070699_100026620 3300005518 Bacteria 4987
109 Ga0070699_100028052 3300005518 Bacteria 4855
110 Ga0070699_100031808 3300005518 Bacteria 4556
111 Ga0070699_100057929 3300005518 Bacteria 3355
112 Ga0070699_100231328 3300005518 Unclassified 1648
113 Ga0070699_100283016 3300005518 Bacteria 1485
114 Ga0070699_100403560 3300005518 Bacteria 1236
115 Ga0070699_100781194 3300005518 Bacteria 874
116 Ga0070699_100830911 3300005518 Bacteria 846
117 Ga0070699_101852047 3300005518 Unclassified 552
118 Ga0070679_100267355 3300005530 Bacteria 1665
119 Ga0070679_100415840 3300005530 Bacteria 1290
120 Ga0070679_100857713 3300005530 Unclassified 851
121 Ga0070684_100019566 3300005535 Bacteria 5603
122 Ga0070697_100001002 3300005536 Bacteria 21307
123 Ga0070697_100008817 3300005536 Bacteria 7872
124 Ga0070697_100014904 3300005536 Bacteria 6102
125 Ga0070697_100097916 3300005536 Bacteria 2434
126 Ga0070697_100216812 3300005536 Bacteria 1630
127 Ga0070697_100331569 3300005536 Bacteria 1312
128 Ga0070697_100455484 3300005536 Bacteria 1115
129 Ga0070697_101360882 3300005536 Unclassified 634
130 Ga0068853_100001362 3300005539 Bacteria 17619
131 Ga0070686_100243430 3300005544 Bacteria 1311
132 Ga0070686_100593612 3300005544 Bacteria 872
133 Ga0070686_101389115 3300005544 Bacteria 589
134 Ga0070695_100000685 3300005545 Bacteria 18104
135 Ga0070695_100001464 3300005545 Bacteria 13072
136 Ga0070695_100003725 3300005545 Bacteria 8892
137 Ga0070695_100036448 3300005545 Bacteria 3096
138 Ga0070695_100506558 3300005545 Bacteria 934
139 Ga0070695_100667098 3300005545 Unclassified 822
140 Ga0070696_100005033 3300005546 Bacteria 8831
141 Ga0070696_100012485 3300005546 Bacteria 5700
142 Ga0070696_100134183 3300005546 Bacteria 1804
143 Ga0070696_100335923 3300005546 Bacteria 1166
144 Ga0070696_100855157 3300005546 Bacteria 752
145 Ga0070696_101238939 3300005546 Unclassified 631
146 Ga0070693_100000325 3300005547 Bacteria 21855
147 Ga0070693_100193690 3300005547 Bacteria 1316
148 Ga0070704_100000570 3300005549 Bacteria 17791
149 Ga0070704_100040739 3300005549 Bacteria 3200
150 Ga0070704_100095191 3300005549 Bacteria 2230
151 Ga0070704_100194232 3300005549 Bacteria 1634
152 Ga0070704_100512673 3300005549 Unclassified 1043
153 Ga0070704_100640604 3300005549 Bacteria 937
154 Ga0070704_101522716 3300005549 Unclassified 615
155 Ga0068855_100042404 3300005563 Bacteria 5391
156 Ga0070664_100030854 3300005564 Bacteria 4474
157 Ga0068857_100038731 3300005577 Bacteria 4221
158 Ga0068857_100065385 3300005577 Bacteria 3233
159 Ga0068857_100152804 3300005577 Bacteria 2092
160 Ga0068854_100000353 3300005578 Bacteria 29520
161 Ga0068856_100010705 3300005614 Bacteria 8910
162 Ga0070702_100019599 3300005615 Bacteria 3532
163 Ga0070702_100081011 3300005615 Bacteria 1944
164 Ga0070702_100121552 3300005615 Bacteria 1636
165 Ga0068852_100376216 3300005616 Bacteria 1392
166 Ga0068859_100002575 3300005617 Bacteria 18433
167 Ga0068859_100369171 3300005617 Bacteria 1530
168 Ga0068859_100393232 3300005617 Bacteria 1482
169 Ga0068859_100545229 3300005617 Bacteria 1254
170 Ga0068859_101424093 3300005617 Bacteria 764
171 Ga0068864_100008897 3300005618 Bacteria 8276
172 Ga0068866_10417343 3300005718 Unclassified 870
173 Ga0068861_100033261 3300005719 Bacteria 3802
174 Ga0068861_100453979 3300005719 Bacteria 1149
175 Ga0068870_10028177 3300005840 Bacteria 2817
176 Ga0068870_10484886 3300005840 Bacteria 821
177 Ga0068863_100007896 3300005841 Bacteria 10405
178 Ga0068863_100025704 3300005841 Bacteria 5615
179 Ga0068863_100231289 3300005841 Bacteria 1783
180 Ga0068863_100977756 3300005841 Bacteria 849
181 Ga0068858_100537055 3300005842 Bacteria 1131
182 Ga0068858_101672349 3300005842 Unclassified 628
183 Ga0068860_100004896 3300005843 Bacteria 13649
184 Ga0068860_100046278 3300005843 Bacteria 4148
185 Ga0068860_100077464 3300005843 Bacteria 3162
186 Ga0068860_100119632 3300005843 Bacteria 2521
187 Ga0068860_100233869 3300005843 Bacteria 1786
188 Ga0068860_100331703 3300005843 Bacteria 1494
189 Ga0068860_100356627 3300005843 Bacteria 1440
190 Ga0068860_100602011 3300005843 Bacteria 1104
191 Ga0068862_100036298 3300005844 Bacteria 4178
192 Ga0068862_100050690 3300005844 Bacteria 3548
193 Ga0068862_100065277 3300005844 Bacteria 3135
194 Ga0068862_100092228 3300005844 Bacteria 2640
195 Ga0068862_101285885 3300005844 Bacteria 732
196 Ga0081538_10006559 3300005981 Bacteria 10220
197 Ga0081540_1078670 3300005983 Bacteria 1493
198 Ga0081539_10000009 3300005985 Bacteria 509286
199 Ga0070715_10220217 3300006163 Bacteria 975
200 Ga0070716_100501756 3300006173 Bacteria 895
201 Ga0070712_100001521 3300006175 Bacteria 14157
202 Ga0097621_100284990 3300006237 Unclassified 1455
203 Ga0075428_100001849 3300006844 Bacteria 22700
204 Ga0075428_100002164 3300006844 Bacteria 21251
205 Ga0075428_100005576 3300006844 Bacteria 13990
206 Ga0075428_100016139 3300006844 Bacteria 8255
207 Ga0075428_100018237 3300006844 Bacteria 7755
208 Ga0075428_100105741 3300006844 Bacteria 3069
209 Ga0075428_100975652 3300006844 Unclassified 897
210 Ga0075428_100981563 3300006844 Unclassified 894
211 Ga0075428_101476220 3300006844 Bacteria 713
212 Ga0075430_100000760 3300006846 Bacteria 24879
213 Ga0075430_100000893 3300006846 Bacteria 23384
214 Ga0075430_100002774 3300006846 Bacteria 14637
215 Ga0075430_100030579 3300006846 Bacteria 4574
216 Ga0075430_100055745 3300006846 Bacteria 3324
217 Ga0075430_100190612 3300006846 Bacteria 1704
218 Ga0075430_100347169 3300006846 Unclassified 1226
219 Ga0075430_100389660 3300006846 Bacteria 1150
220 Ga0075431_100000158 3300006847 Bacteria 46980
221 Ga0075431_100004832 3300006847 Bacteria 13263
222 Ga0075431_100006182 3300006847 Bacteria 11884
223 Ga0075431_100007290 3300006847 Bacteria 11015
224 Ga0075431_100008729 3300006847 Bacteria 10155
225 Ga0075431_100023595 3300006847 Bacteria 6296
226 Ga0075431_100024787 3300006847 Bacteria 6150
227 Ga0075431_100159022 3300006847 Bacteria 2324
228 Ga0075431_100419874 3300006847 Bacteria 1337
229 Ga0075431_100559901 3300006847 Bacteria 1130
230 Ga0075431_100623064 3300006847 Bacteria 1061
231 Ga0075431_100640068 3300006847 Unclassified 1044
232 Ga0075433_10000230 3300006852 Bacteria 31980
233 Ga0075433_10000972 3300006852 Bacteria 20350
234 Ga0075433_10002435 3300006852 Bacteria 14167
235 Ga0075433_10003721 3300006852 Bacteria 11804
236 Ga0075433_10031282 3300006852 Bacteria 4549
237 Ga0075433_10044033 3300006852 Bacteria 3877
238 Ga0075433_10168573 3300006852 Bacteria 1949
239 Ga0075433_10265941 3300006852 Bacteria 1520
240 Ga0075433_10446179 3300006852 Bacteria 1141
241 Ga0075434_100001442 3300006871 Bacteria 19971
242 Ga0075434_100032819 3300006871 Bacteria 5121
243 Ga0075434_100064385 3300006871 Bacteria 3650
244 Ga0075434_100071293 3300006871 Bacteria 3466
245 Ga0075434_100081334 3300006871 Bacteria 3237
246 Ga0075434_100095969 3300006871 Bacteria 2970
247 Ga0075434_100152432 3300006871 Bacteria 2332
248 Ga0075434_100218627 3300006871 Bacteria 1925
249 Ga0075434_102048839 3300006871 Unclassified 577
250 Ga0075429_100000757 3300006880 Bacteria 25402
251 Ga0075429_100020203 3300006880 Bacteria 5775
252 Ga0075429_100024518 3300006880 Bacteria 5233
253 Ga0075429_100050171 3300006880 Unclassified 3631
254 Ga0075429_100054933 3300006880 Bacteria 3465
255 Ga0075429_100055828 3300006880 Bacteria 3437
256 Ga0075429_100106602 3300006880 Bacteria 2448
257 Ga0075429_100261557 3300006880 Bacteria 1515
258 Ga0075429_100324655 3300006880 Bacteria 1347
259 Ga0075429_100328168 3300006880 Bacteria 1339
260 Ga0075429_100519444 3300006880 Bacteria 1043
261 Ga0075429_101278528 3300006880 Bacteria 640
262 Ga0075429_101356612 3300006880 Bacteria 620
263 Ga0068865_100209883 3300006881 Bacteria 1517
264 Ga0068865_100341183 3300006881 Bacteria 1211
265 Ga0068865_100617469 3300006881 Bacteria 918
266 Ga0075436_100104024 3300006914 Bacteria 1979
267 Ga0075436_100655441 3300006914 Bacteria 776
268 Ga0075436_100767423 3300006914 Unclassified 717
269 Ga0097620_100002575 3300006931 Bacteria 18433
270 Ga0097620_100369168 3300006931 Bacteria 1530
271 Ga0097620_100393239 3300006931 Bacteria 1482
272 Ga0097620_100545267 3300006931 Bacteria 1254
273 Ga0097620_101424076 3300006931 Bacteria 764
274 Ga0075435_100069338 3300007076 Unclassified 2875
275 Ga0075435_100216498 3300007076 Bacteria 1626
276 Ga0075435_100222326 3300007076 Bacteria 1603
277 Ga0075435_100487049 3300007076 Bacteria 1065
278 Ga0075435_100501882 3300007076 Bacteria 1049
279 Ga0075435_100549621 3300007076 Bacteria 1000
280 Ga0075435_100741771 3300007076 Bacteria 854
281 Ga0075435_101279612 3300007076 Bacteria 642
282 Ga0099794_10002156 3300007265 Bacteria 7158
283 Ga0099794_10055588 3300007265 Bacteria 1913
284 Ga0099794_10358840 3300007265 Unclassified 759
285 Ga0105240_10810126 3300009093 Bacteria 1014
286 Ga0111539_10000370 3300009094 Bacteria 55548
287 Ga0111539_10001809 3300009094 Bacteria 28474
288 Ga0111539_11125599 3300009094 Bacteria 912
289 Ga0111539_11811672 3300009094 Unclassified 708
290 Ga0105245_10548129 3300009098 Bacteria 1178
291 Ga0105247_10014347 3300009101 Bacteria 4757
292 Ga0114129_10000443 3300009147 Bacteria 49208
293 Ga0114129_10000599 3300009147 Bacteria 44461
294 Ga0114129_10000708 3300009147 Bacteria 42096
295 Ga0114129_10001075 3300009147 Bacteria 35911
296 Ga0114129_10002320 3300009147 Bacteria 26415
297 Ga0114129_10040851 3300009147 Bacteria 6538
298 Ga0114129_10042842 3300009147 Bacteria 6370
299 Ga0114129_10100270 3300009147 Bacteria 4007
300 Ga0114129_10191525 3300009147 Bacteria 2776
301 Ga0114129_10251975 3300009147 Bacteria 2369
302 Ga0114129_10262982 3300009147 Bacteria 2311
303 Ga0114129_10305180 3300009147 Unclassified 2120
304 Ga0114129_10306476 3300009147 Bacteria 2115
305 Ga0114129_10309719 3300009147 Bacteria 2102
306 Ga0114129_10490996 3300009147 Bacteria 1605
307 Ga0114129_10772496 3300009147 Unclassified 1228
308 Ga0114129_10809405 3300009147 Bacteria 1194
309 Ga0114129_11358201 3300009147 Bacteria 878
310 Ga0114129_12163270 3300009147 Bacteria 670
311 Ga0114129_12770874 3300009147 Bacteria 583
312 Ga0114129_13022902 3300009147 Bacteria 552
313 Ga0105243_10100476 3300009148 Bacteria 2400
314 Ga0105243_10108421 3300009148 Bacteria 2318
315 Ga0105243_11663010 3300009148 Bacteria 666
316 Ga0105241_10000218 3300009174 Bacteria 43050
317 Ga0105241_10058694 3300009174 Bacteria 2956
318 Ga0105242_10005190 3300009176 Bacteria 10056
319 Ga0105242_10358033 3300009176 Bacteria 1350
320 Ga0105248_10059326 3300009177 Bacteria 4298
321 Ga0105248_10121132 3300009177 Bacteria 2951
322 Ga0105248_10293106 3300009177 Bacteria 1832
323 Ga0105248_11808976 3300009177 Bacteria 693
324 Ga0105238_10525137 3300009551 Bacteria 1186
325 Ga0105249_10076713 3300009553 Unclassified 3098
326 Ga0105249_10081138 3300009553 Bacteria 3014
327 Ga0105249_10510523 3300009553 Bacteria 1248
328 Ga0105249_11445337 3300009553 Unclassified 760
329 Ga0105249_11455153 3300009553 Bacteria 757
330 Ga0105239_11849730 3300010375 Bacteria 700
331 Ga0105246_10883694 3300011119 Unclassified 800
332 Ga0105246_12462689 3300011119 Unclassified 512
333 Ga0157373_10000381 3300013100 Bacteria 35500
334 Ga0157371_10193965 3300013102 Bacteria 1455
335 Ga0157370_10894069 3300013104 Bacteria 806
336 Ga0157369_10091723 3300013105 Bacteria 3242
337 Ga0157378_10102117 3300013297 Bacteria 2619
338 Ga0157378_10200643 3300013297 Bacteria 1886
339 Ga0157378_10365546 3300013297 Bacteria 1413
340 Ga0157378_10484496 3300013297 Bacteria 1233
341 Ga0157378_10700076 3300013297 Bacteria 1032
342 Ga0157378_10743689 3300013297 Bacteria 1003
343 Ga0157378_11073152 3300013297 Bacteria 842
344 Ga0163162_10437328 3300013306 Bacteria 1440
345 Ga0163162_10764653 3300013306 Bacteria 1085
346 Ga0163162_10884530 3300013306 Unclassified 1007
347 Ga0163162_11999936 3300013306 Bacteria 664
348 Ga0163162_12968616 3300013306 Unclassified 545
349 Ga0157372_10001479 3300013307 Bacteria 25510
350 Ga0157372_10325645 3300013307 Unclassified 1789
351 Ga0157375_10091551 3300013308 Bacteria 3103
352 Ga0157375_10119623 3300013308 Bacteria 2742
353 Ga0157375_10657654 3300013308 Bacteria 1204
354 Ga0163163_10192997 3300014325 Bacteria 2085
355 Ga0163163_10217796 3300014325 Bacteria 1958
356 Ga0157380_10230691 3300014326 Bacteria 1662
357 Ga0157380_10336315 3300014326 Bacteria 1406
358 Ga0157380_10338884 3300014326 Bacteria 1402
359 Ga0157380_10691785 3300014326 Bacteria 1023
360 Ga0157380_12641443 3300014326 Bacteria 568
361 Ga0182008_10063236 3300014497 Bacteria 1823
362 Ga0157377_11243655 3300014745 Bacteria 579
363 Ga0157379_10184752 3300014968 Bacteria 1883
364 Ga0157379_10554398 3300014968 Unclassified 1070
365 Ga0182007_10029713 3300015262 Bacteria 1871
366 Ga0163161_10266277 3300017792 Bacteria 1340
367 Ga0163161_10587911 3300017792 Bacteria 916
368 Ga0207653_10001826 3300025885 Bacteria 6786
369 Ga0207653_10016897 3300025885 Bacteria 2295
370 Ga0207653_10023098 3300025885 Bacteria 1979
371 Ga0207710_10180592 3300025900 Bacteria 1035
372 Ga0207688_10049701 3300025901 Bacteria 2344
373 Ga0207647_10045326 3300025904 Bacteria 2744
374 Ga0207685_10034619 3300025905 Bacteria 1836
375 Ga0207645_10001324 3300025907 Bacteria 20346
376 Ga0207645_10015479 3300025907 Bacteria 5065
377 Ga0207643_10000157 3300025908 Bacteria 46902
378 Ga0207684_10000169 3300025910 Bacteria 109181
379 Ga0207684_10008133 3300025910 Bacteria 9350
380 Ga0207684_10010283 3300025910 Bacteria 8236
381 Ga0207684_10014651 3300025910 Bacteria 6754
382 Ga0207684_10016896 3300025910 Bacteria 6267
383 Ga0207684_10057467 3300025910 Bacteria 3301
384 Ga0207684_10089629 3300025910 Bacteria 2620
385 Ga0207684_10287306 3300025910 Bacteria 1418
386 Ga0207684_10646322 3300025910 Bacteria 901
387 Ga0207654_10026891 3300025911 Bacteria 3122
388 Ga0207654_10081699 3300025911 Bacteria 1947
389 Ga0207707_10000258 3300025912 Bacteria 57257
390 Ga0207707_10071611 3300025912 Bacteria 3021
391 Ga0207693_10001303 3300025915 Bacteria 22126
392 Ga0207663_10101821 3300025916 Unclassified 1931
393 Ga0207663_10277644 3300025916 Bacteria 1243
394 Ga0207660_10001383 3300025917 Bacteria 16275
395 Ga0207660_10036306 3300025917 Bacteria 3426
396 Ga0207660_10688613 3300025917 Bacteria 834
397 Ga0207662_10111945 3300025918 Bacteria 1703
398 Ga0207657_10000373 3300025919 Bacteria 47375
399 Ga0207649_10254932 3300025920 Bacteria 1265
400 Ga0207652_10004142 3300025921 Bacteria 11838
401 Ga0207652_10217124 3300025921 Bacteria 1723
402 Ga0207652_10635813 3300025921 Unclassified 955
403 Ga0207646_10002895 3300025922 Bacteria 19923
404 Ga0207646_10004675 3300025922 Bacteria 14754
405 Ga0207646_10017426 3300025922 Bacteria 6723
406 Ga0207646_10038985 3300025922 Bacteria 4276
407 Ga0207646_10045505 3300025922 Bacteria 3940
408 Ga0207646_10065789 3300025922 Bacteria 3236
409 Ga0207646_10264914 3300025922 Bacteria 1553
410 Ga0207646_10891629 3300025922 Bacteria 789
411 Ga0207646_11094596 3300025922 Bacteria 701
412 Ga0207646_11554536 3300025922 Bacteria 572
413 Ga0207681_10134534 3300025923 Bacteria 1832
414 Ga0207659_10207175 3300025926 Bacteria 1569
415 Ga0207690_10286300 3300025932 Bacteria 1285
416 Ga0207690_10297285 3300025932 Bacteria 1262
417 Ga0207706_10001857 3300025933 Bacteria 20682
418 Ga0207706_10008929 3300025933 Bacteria 9225
419 Ga0207706_10146584 3300025933 Unclassified 2076
420 Ga0207706_10276969 3300025933 Bacteria 1464
421 Ga0207686_10010046 3300025934 Bacteria 5149
422 Ga0207709_10028023 3300025935 Bacteria 3253
423 Ga0207709_10188770 3300025935 Bacteria 1462
424 Ga0207670_10304253 3300025936 Bacteria 1249
425 Ga0207670_10491276 3300025936 Bacteria 995
426 Ga0207670_11829273 3300025936 Bacteria 516
427 Ga0207704_10131946 3300025938 Bacteria 1732
428 Ga0207704_10900388 3300025938 Unclassified 744
429 Ga0207665_11242293 3300025939 Bacteria 594
430 Ga0207711_10084644 3300025941 Bacteria 2776
431 Ga0207711_10375272 3300025941 Bacteria 1319
432 Ga0207711_11053164 3300025941 Bacteria 754
433 Ga0207711_11902757 3300025941 Archaea 538
434 Ga0207689_10000975 3300025942 Bacteria 27466
435 Ga0207689_10001419 3300025942 Bacteria 22891
436 Ga0207689_10003954 3300025942 Bacteria 13491
437 Ga0207689_11511260 3300025942 Archaea 561
438 Ga0207679_10000779 3300025945 Bacteria 20862
439 Ga0207679_11392460 3300025945 Bacteria 643
440 Ga0207667_10000857 3300025949 Bacteria 39178
441 Ga0207651_10013096 3300025960 Bacteria 4730
442 Ga0207712_10058438 3300025961 Bacteria 2725
443 Ga0207712_10088740 3300025961 Bacteria 2272
444 Ga0207712_10560610 3300025961 Unclassified 984
445 Ga0207668_10541484 3300025972 Bacteria 1007
446 Ga0207640_10011172 3300025981 Bacteria 5078
447 Ga0207658_10419358 3300025986 Bacteria 1180
448 Ga0207677_10011276 3300026023 Bacteria 5088
449 Ga0207703_10415584 3300026035 Bacteria 1251
450 Ga0207703_11233162 3300026035 Bacteria 719
451 Ga0207639_10042698 3300026041 Unclassified 3399
452 Ga0207678_10002143 3300026067 Bacteria 17878
453 Ga0207678_10879095 3300026067 Bacteria 792
454 Ga0207708_10119553 3300026075 Bacteria 2052
455 Ga0207708_10195309 3300026075 Bacteria 1612
456 Ga0207708_10292588 3300026075 Bacteria 1322
457 Ga0207708_10399880 3300026075 Bacteria 1136
458 Ga0207702_10001041 3300026078 Bacteria 28384
459 Ga0207641_10178512 3300026088 Bacteria 1943
460 Ga0207641_10344655 3300026088 Bacteria 1418
461 Ga0207641_11596884 3300026088 Bacteria 654
462 Ga0207648_10001790 3300026089 Bacteria 23546
463 Ga0207648_10158747 3300026089 Bacteria 1997
464 Ga0207648_10289800 3300026089 Bacteria 1466
465 Ga0207648_10514659 3300026089 Bacteria 1096
466 Ga0207648_11455425 3300026089 Bacteria 644
467 Ga0207676_10046984 3300026095 Bacteria 3343
468 Ga0207676_11883502 3300026095 Bacteria 597
469 Ga0207674_10008510 3300026116 Bacteria 11845
470 Ga0207674_10106524 3300026116 Unclassified 2781
471 Ga0207674_10329661 3300026116 Bacteria 1476
472 Ga0207675_100028715 3300026118 Bacteria 5182
473 Ga0207675_100077456 3300026118 Bacteria 3115
474 Ga0207675_100246138 3300026118 Bacteria 1729
475 Ga0207675_100874761 3300026118 Bacteria 914
476 Ga0207698_10090066 3300026142 Bacteria 2508
477 Ga0209969_1003454 3300027360 Unclassified 2189
478 Ga0209967_1001743 3300027364 Bacteria 2801
479 Ga0209981_1020171 3300027378 Unclassified 949
480 Ga0209996_1002603 3300027395 Bacteria 2238
481 Ga0209984_1000344 3300027424 Bacteria 5139
482 Ga0209995_1000323 3300027471 Bacteria 7498
483 Ga0209995_1072062 3300027471 Bacteria 591
484 Ga0209968_1002390 3300027526 Bacteria 2831
485 Ga0209999_1004130 3300027543 Unclassified 2611
486 Ga0209982_1001327 3300027552 Unclassified 3356
487 Ga0209983_1001424 3300027665 Bacteria 5319
488 Ga0209983_1084876 3300027665 Bacteria 711
489 Ga0209588_1050700 3300027671 Unclassified 1342
490 Ga0209971_1000031 3300027682 Bacteria 50315
491 Ga0209971_1123873 3300027682 Unclassified 636
492 Ga0209966_1000020 3300027695 Bacteria 68386
493 Ga0209966_1014358 3300027695 Bacteria 1477
494 Ga0209998_10000024 3300027717 Bacteria 64123
495 Ga0209974_10001378 3300027876 Bacteria 8780
496 Ga0209974_10003540 3300027876 Bacteria 5618
497 Ga0207428_10000409 3300027907 Bacteria 53318
498 Ga0207428_10007011 3300027907 Bacteria 10318
499 Ga0207428_10318912 3300027907 Bacteria 1148
500 Ga0268265_10012391 3300028380 Bacteria 5778
501 Ga0268265_10105753 3300028380 Bacteria 2284
502 Ga0268265_10119804 3300028380 Bacteria 2166
503 Ga0268265_10452306 3300028380 Unclassified 1200
504 Ga0268265_10829602 3300028380 Bacteria 903
505 Ga0268265_11878580 3300028380 Bacteria 606
506 Ga0268265_12231609 3300028380 Bacteria 554
507 Ga0268264_10020556 3300028381 Bacteria 5394
508 Ga0268264_10297626 3300028381 Bacteria 1518
509 Ga0268264_10317022 3300028381 Bacteria 1473
510 Ga0268264_10737805 3300028381 Bacteria 980
511 Ga0268264_11143938 3300028381 Bacteria 787
512 Ga0268264_11286725 3300028381 Bacteria 741
513 Ga0307408_100095384 3300031548 Bacteria 2255
514 Ga0307408_100384351 3300031548 Bacteria 1201
515 Ga0307408_102065086 3300031548 Archaea 549
516 Ga0307407_10859020 3300031903 Unclassified 694
517 Ga0307409_100637127 3300031995 Bacteria 1058
518 Ga0307416_100383603 3300032002 Bacteria 1436
519 Ga0307414_10116872 3300032004 Unclassified 2043
520 Ga0307414_10953980 3300032004 Bacteria 788
521 Ga0307411_10135540 3300032005 Bacteria 1807
522 Ga0373950_0008662 3300034818 Bacteria 1607
523 Ga0373958_0113965 3300034819 Unclassified 647
524 Ga0373959_0042518 3300034820 Unclassified 958
525 Ga0373940_0031547 3300035088 Bacteria 1415
526 Ga0373940_0039022 3300035088 Bacteria 1298
527 Ga0373940_0206741 3300035088 Bacteria 647
528 Ga0373949_0007980 3300035090 Bacteria 2318
529 Ga0373949_0067790 3300035090 Unclassified 929
530 Ga0373949_0216649 3300035090 Bacteria 580
531 Ga0373949_0309313 3300035090 Bacteria 503
532 Ga0373951_0025476 3300035091 Bacteria 1374
533 Ga0373951_0143489 3300035091 Unclassified 665
534 Ga0373939_0103364 3300035114 Unclassified 981
535 Ga0373939_0317963 3300035114 Bacteria 625
536 Ga0373941_0005607 3300035115 Bacteria 2967
537 Ga0373941_0040453 3300035115 Bacteria 1438
538 Ga0373960_0084805 3300035121 Bacteria 1004
539 Ga0373961_0189560 3300035241 Unclassified 720
540 Ga0373962_0002572 3300035242 Bacteria 4308
541 Ga0373962_0159618 3300035242 Bacteria 743
542 Ga0373962_0271558 3300035242 Bacteria 594
543 Ga0373931_0567067 3300035691 Bacteria 739
544 Ga0395899_0021054 3300037312 Bacteria 4946
545 Ga0395899_0249976 3300037312 Archaea 1217
546 Ga0395900_0017941 3300037418 Bacteria 7224
547 Ga0395900_0146737 3300037418 Unclassified 2412
548 Ga0395900_0642824 3300037418 Unclassified 998
549 Ga0395898_0027302 3300037466 Bacteria 5733
550 Ga0395905_0238600 3300037471 Bacteria 1699
551 Ga0395905_0951272 3300037471 Unclassified 762
552 Ga0395901_1081326 3300038443 Bacteria 773
553 Ga0242420_017531 3300038996 Bacteria 1254
554 Ga0242420_018387 3300038996 Bacteria 1230
555 Ga0439437_020610 3300042000 Bacteria 796
556 Ga0439441_012424 3300042001 Bacteria 1462
557 Ga0439448_0043918 3300042005 Bacteria 1452
558 Ga0439455_0007416 3300042012 Bacteria 2319
559 Ga0439463_066613 3300042016 Bacteria 921
560 Ga0439458_0083356 3300042157 Unclassified 817
561 Ga0439459_0029527 3300042438 Bacteria 1107
562 Ga0439459_0113996 3300042438 Bacteria 675
563 Ga0439464_0001377 3300042439 Bacteria 5694
564 Ga0439460_0004434 3300042461 Bacteria 3421
565 Ga0451577_0003197 3300042876 Bacteria 18404
566 Ga0451577_0017165 3300042876 Bacteria 6690
567 Ga0451577_0057091 3300042876 Bacteria 3480
568 Ga0451577_0138688 3300042876 Unclassified 2184
569 Ga0451577_1298153 3300042876 Bacteria 647
570 Ga0439440_0100268 3300042993 Bacteria 787
571 Ga0453683_0008423 3300044673 Bacteria 6917
572 Ga0453683_0048690 3300044673 Bacteria 2658
573 Ga0453683_0053051 3300044673 Bacteria 2537
574 Ga0453684_0051544 3300044712 Bacteria 5392
575 Ga0453684_0059189 3300044712 Bacteria 4941
576 Ga0453684_0189615 3300044712 Bacteria 2406
577 Ga0453684_0493193 3300044712 Unclassified 1357
578 Ga0453684_1385269 3300044712 Bacteria 730
579 Ga0451576_0016285 3300045051 Bacteria 8210
580 Ga0451576_0019862 3300045051 Bacteria 7327
581 Ga0451576_0021455 3300045051 Bacteria 7019
582 Ga0451576_0095258 3300045051 Bacteria 3096
583 Ga0451576_0109256 3300045051 Bacteria 2878
584 Ga0451576_0257085 3300045051 Bacteria 1825
585 Ga0451576_0423844 3300045051 Bacteria 1396
586 Ga0451576_1111137 3300045051 Bacteria 827
587 Ga0451576_1623978 3300045051 Bacteria 670
588 Ga0495580_0380069 3300046472 Bacteria 954
589 Ga0495656_0018852 3300046615 Bacteria 2656
590 Ga0495656_0817524 3300046615 Bacteria 504
591 Ga0495669_0028327 3300046684 Bacteria 2453
592 Ga0495669_0124325 3300046684 Bacteria 1211
593 Ga0495669_0277659 3300046684 Bacteria 806
594 Ga0495670_0311303 3300046691 Bacteria 845
595 Ga0495636_0131050 3300047318 Bacteria 1115
596 Ga0496102_0010289 3300048905 Bacteria 8043
597 Ga0496102_0031996 3300048905 Bacteria 4723
598 Ga0496102_0294221 3300048905 Bacteria 1530
599 Ga0496104_1009209 3300048907 Bacteria 736
600 Ga0496106_0125534 3300048909 Bacteria 2009
601 Ga0496108_1719409 3300048911 Bacteria 516
602 Ga0496109_0475642 3300048912 Unclassified 1180
603 Ga0496112_0117827 3300048915 Bacteria 2626
604 Ga0501031_0070611 3300049568 Bacteria 2275
605 Ga0501031_0203984 3300049568 Bacteria 1290
606 Ga0501031_0293101 3300049568 Bacteria 1055
607 Ga0501033_0064984 3300049570 Unclassified 2684
608 Ga0501033_0326261 3300049570 Bacteria 1078
609 Ga0501034_0896459 3300049571 Bacteria 775
610 Ga0501036_0045030 3300049572 Bacteria 3738
611 Ga0501036_0046663 3300049572 Bacteria 3668
612 Ga0501036_0211866 3300049572 Bacteria 1628
613 Ga0501036_0433038 3300049572 Bacteria 1096
614 Ga0501036_0826011 3300049572 Unclassified 762
615 Ga0501037_0546355 3300049573 Bacteria 782
616 Ga0501038_0067911 3300049574 Bacteria 3032
617 Ga0501038_0514273 3300049574 Bacteria 914
618 Ga0501038_1055619 3300049574 Bacteria 595
619 Ga0501039_0019151 3300049575 Bacteria 5252
620 Ga0501039_0144949 3300049575 Bacteria 1866
621 Ga0501039_0424445 3300049575 Bacteria 1044
622 Ga0501039_0864037 3300049575 Bacteria 705
623 Ga0501040_0003451 3300049576 Bacteria 10205
624 Ga0501040_0041964 3300049576 Bacteria 3116
625 Ga0501040_0460028 3300049576 Bacteria 916
626 Ga0501040_0611626 3300049576 Bacteria 787
627 Ga0501040_0762225 3300049576 Unclassified 700
628 Ga0501041_0050743 3300049577 Bacteria 2528
629 Ga0501041_0465631 3300049577 Bacteria 803
630 Ga0501041_0551987 3300049577 Bacteria 734
631 Ga0501041_0579252 3300049577 Bacteria 716
632 Ga0501041_0783905 3300049577 Bacteria 611
633 Ga0501042_0009827 3300049578 Bacteria 6390
634 Ga0501042_0040799 3300049578 Bacteria 3299
635 Ga0501042_0358712 3300049578 Bacteria 1055
636 Ga0501042_0414007 3300049578 Unclassified 977
637 Ga0501042_0592977 3300049578 Bacteria 806
638 Ga0501042_0596528 3300049578 Bacteria 803
639 Ga0501042_0627368 3300049578 Bacteria 781
640 Ga0501042_1269725 3300049578 Bacteria 537
641 Ga0501043_0386663 3300049579 Unclassified 1059
642 Ga0501043_0392161 3300049579 Bacteria 1050
643 Ga0501043_0419529 3300049579 Bacteria 1009
644 Ga0501046_0000607 3300049580 Bacteria 35214
645 Ga0501046_0045322 3300049580 Bacteria 3495
646 Ga0501046_0073675 3300049580 Bacteria 2650
647 Ga0501046_0123008 3300049580 Bacteria 1973
648 Ga0501047_0079990 3300049581 Bacteria 3142
649 Ga0501048_0008791 3300049582 Bacteria 7612
650 Ga0501048_0238240 3300049582 Bacteria 1291
651 Ga0501048_0470416 3300049582 Unclassified 901
652 Ga0501048_0662806 3300049582 Unclassified 749
653 Ga0501048_1213297 3300049582 Unclassified 542
654 Ga0501067_0508396 3300049583 Bacteria 674
655 Ga0501068_0068617 3300049584 Unclassified 2161
656 Ga0501068_0085258 3300049584 Bacteria 1944
657 Ga0501068_0085735 3300049584 Unclassified 1938
658 Ga0501069_0334062 3300049585 Unclassified 892
659 Ga0501069_0364907 3300049585 Bacteria 852
660 Ga0501070_1122823 3300049586 Bacteria 606
661 Ga0501071_0058887 3300049587 Bacteria 2778
662 Ga0501071_0334358 3300049587 Bacteria 1151
663 Ga0501071_0841378 3300049587 Bacteria 708
664 Ga0501072_0003099 3300049588 Bacteria 12529
665 Ga0501072_0024347 3300049588 Bacteria 4708
666 Ga0501072_0037942 3300049588 Bacteria 3780
667 Ga0501072_0097083 3300049588 Bacteria 2342
668 Ga0501072_0129011 3300049588 Bacteria 2015
669 Ga0501072_0393340 3300049588 Bacteria 1100
670 Ga0501072_0536302 3300049588 Bacteria 925
671 Ga0501072_0697973 3300049588 Unclassified 798
672 Ga0501073_0980430 3300049589 Bacteria 582
673 Ga0501074_0017013 3300049590 Bacteria 5274
674 Ga0501074_0109282 3300049590 Bacteria 1979
675 Ga0501074_0162809 3300049590 Bacteria 1593
676 Ga0501074_0329835 3300049590 Bacteria 1083
677 Ga0501075_0001457 3300049591 Bacteria 15394
678 Ga0501075_0009060 3300049591 Bacteria 6949
679 Ga0501075_0070478 3300049591 Bacteria 2642
680 Ga0501075_0080998 3300049591 Bacteria 2457
681 Ga0501075_0304805 3300049591 Bacteria 1214
682 Ga0501075_0347670 3300049591 Bacteria 1130
683 Ga0501075_0367422 3300049591 Bacteria 1097
684 Ga0501075_0806093 3300049591 Bacteria 714
685 Ga0501075_1299798 3300049591 Bacteria 551
686 Ga0501076_0003696 3300049592 Bacteria 10761
687 Ga0501076_0105858 3300049592 Bacteria 2270
688 Ga0501076_0115478 3300049592 Bacteria 2172
689 Ga0501076_0128955 3300049592 Bacteria 2051
690 Ga0501076_0186914 3300049592 Bacteria 1690
691 Ga0501076_0589857 3300049592 Bacteria 917
692 Ga0501076_1284485 3300049592 Bacteria 602
693 Ga0501077_0001790 3300049593 Bacteria 12990
694 Ga0501077_0015489 3300049593 Bacteria 4801
695 Ga0501077_0068558 3300049593 Bacteria 2248
696 Ga0501077_0134681 3300049593 Bacteria 1567
697 Ga0501077_0140163 3300049593 Unclassified 1533
698 Ga0501077_0166936 3300049593 Bacteria 1398
699 Ga0501079_0022016 3300049741 Bacteria 4883
700 Ga0501079_0028088 3300049741 Bacteria 4316
701 Ga0501079_0042437 3300049741 Bacteria 3512
702 Ga0501079_0142783 3300049741 Bacteria 1865
703 Ga0501079_0829090 3300049741 Bacteria 728
704 Ga0501079_1170185 3300049741 Bacteria 606
705 Ga0501080_0224442 3300049742 Bacteria 1718
706 Ga0501080_0378410 3300049742 Unclassified 1276
707 Ga0501080_1607350 3300049742 Bacteria 550
708 Ga0501081_0007524 3300049743 Bacteria 7064
709 Ga0501081_0018275 3300049743 Bacteria 4653
710 Ga0501081_0054818 3300049743 Bacteria 2754
711 Ga0501081_0076183 3300049743 Bacteria 2342
712 Ga0501081_0102296 3300049743 Bacteria 2026
713 Ga0501081_0103072 3300049743 Bacteria 2019
714 Ga0501081_0112754 3300049743 Bacteria 1931
715 Ga0501081_0288219 3300049743 Unclassified 1203
716 Ga0501081_0288548 3300049743 Bacteria 1202
717 Ga0501081_0439269 3300049743 Bacteria 968
718 Ga0501081_1026558 3300049743 Bacteria 623
719 Ga0501083_0004913 3300049744 Bacteria 9460
720 Ga0501083_1073616 3300049744 Bacteria 524
721 Ga0501035_0435954 3300049822 Bacteria 1086
722 Ga0501035_0542207 3300049822 Bacteria 954
723 Ga0501045_0001608 3300049824 Bacteria 15107
724 Ga0501045_0023140 3300049824 Bacteria 4452
725 Ga0501045_0033745 3300049824 Bacteria 3712
726 Ga0501045_0057787 3300049824 Bacteria 2839
727 Ga0501045_0081106 3300049824 Bacteria 2392
728 nmdc:mga05p37_102832_c1 3300050507 Bacteria 3518
729 nmdc:mga05p37_114979_c1 3300050507 Bacteria 3307
730 nmdc:mga05p37_1354391_c1 3300050507 Bacteria 721
731 nmdc:mga05p37_1430242_c1 3300050507 Archaea 694
732 nmdc:mga05p37_14677_c1 3300050507 Bacteria 9412
733 nmdc:mga05p37_199_c1 3300050507 Bacteria 59838
734 nmdc:mga05p37_263819_c1 3300050507 Unclassified 2060
735 nmdc:mga05p37_3355_c1 3300050507 Bacteria 18678
736 nmdc:mga05p37_38_c1 3300050507 Bacteria 109166
737 nmdc:mga05p37_42209_c1 3300050507 Bacteria 5603
738 nmdc:mga05p37_423690_c1 3300050507 Bacteria 1548
739 nmdc:mga05p37_43249_c1 3300050507 Bacteria 5540
740 nmdc:mga05p37_45640_c1 3300050507 Bacteria 5389
741 nmdc:mga05p37_4951_c1 3300050507 Bacteria 15607
742 nmdc:mga05p37_51992_c1 3300050507 Bacteria 5038
743 nmdc:mga05p37_731220_c1 3300050507 Bacteria 1094
744 nmdc:mga05p37_8986_c1 3300050507 Bacteria 11818
745 nmdc:mga09592_1012_c1 3300050508 Bacteria 22338
746 nmdc:mga09592_120388_c1 3300050508 Bacteria 2254
747 nmdc:mga09592_129109_c1 3300050508 Bacteria 2174
748 nmdc:mga09592_14052_c1 3300050508 Bacteria 6537
749 nmdc:mga09592_1539_c1 3300050508 Bacteria 18555
750 nmdc:mga09592_250750_c1 3300050508 Bacteria 1534
751 nmdc:mga09592_452450_c1 3300050508 Bacteria 1108
752 nmdc:mga09592_497381_c1 3300050508 Bacteria 1050
753 nmdc:mga09592_582393_c1 3300050508 Bacteria 960
754 nmdc:mga09592_69483_c1 3300050508 Bacteria 2988
755 nmdc:mga09592_7358_c1 3300050508 Bacteria 8950
756 nmdc:mga0qj67_2177_c1 3300050509 Bacteria 13940
757 nmdc:mga0qj67_2412_c1 3300050509 Bacteria 13317
758 nmdc:mga0qj67_358597_c1 3300050509 Unclassified 1178
759 nmdc:mga0qj67_376022_c1 3300050509 Bacteria 1147
760 nmdc:mga0qj67_4215_c1 3300050509 Bacteria 10414
761 nmdc:mga0qj67_42659_c1 3300050509 Bacteria 3571
762 nmdc:mga0qj67_935016_c1 3300050509 Bacteria 682
763 nmdc:mga0qj67_99347_c1 3300050509 Bacteria 2345
764 nmdc:mga06r32_13323_c1 3300050510 Bacteria 7447
765 nmdc:mga06r32_14394_c1 3300050510 Bacteria 7180
766 nmdc:mga06r32_237994_c1 3300050510 Bacteria 1808
767 nmdc:mga06r32_26410_c1 3300050510 Bacteria 5414
768 nmdc:mga06r32_287_c1 3300050510 Bacteria 41922
769 nmdc:mga06r32_37213_c1 3300050510 Bacteria 4604
770 nmdc:mga06r32_391973_c1 3300050510 Bacteria 1371
771 nmdc:mga06r32_604616_c1 3300050510 Bacteria 1067
772 nmdc:mga06r32_658506_c1 3300050510 Bacteria 1015
773 nmdc:mga06r32_7053_c1 3300050510 Bacteria 10107
774 nmdc:mga06r32_72465_c1 3300050510 Bacteria 3335
775 nmdc:mga06r32_88462_c1 3300050510 Unclassified 3023
776 nmdc:mga08y16_14948_c1 3300050511 Bacteria 8164
777 nmdc:mga08y16_302485_c1 3300050511 Bacteria 1648
778 nmdc:mga08y16_6148_c1 3300050511 Bacteria 12592
779 nmdc:mga0n895_127669_c1 3300050512 Bacteria 2567
780 nmdc:mga0n895_1575846_c1 3300050512 Unclassified 622
781 nmdc:mga0n895_1587674_c1 3300050512 Bacteria 619
782 nmdc:mga0n895_21645_c1 3300050512 Bacteria 6018
783 nmdc:mga0n895_22280_c1 3300050512 Bacteria 5939
784 nmdc:mga0n895_247386_c1 3300050512 Bacteria 1810
785 nmdc:mga0n895_3925_c1 3300050512 Bacteria 3164
786 nmdc:mga0n895_57777_c1 3300050512 Bacteria 3825
787 nmdc:mga0n895_61_c1 3300050512 Bacteria 63108
788 nmdc:mga0n895_93537_c1 3300050512 Bacteria 3010
789 nmdc:mga0rr50_1176182_c1 3300050513 Archaea 652
790 nmdc:mga0rr50_1190_c1 3300050513 Bacteria 14125
791 nmdc:mga0rr50_18688_c1 3300050513 Bacteria 4661
792 nmdc:mga0rr50_19205_c1 3300050513 Bacteria 4607
793 nmdc:mga0rr50_415319_c1 3300050513 Bacteria 1138
794 nmdc:mga0rr50_444332_c1 3300050513 Unclassified 1099
795 nmdc:mga0rr50_631191_c1 3300050513 Bacteria 914
796 nmdc:mga0rr50_665328_c1 3300050513 Unclassified 889
797 nmdc:mga08x19_22050_c1 3300050514 Bacteria 3939
798 nmdc:mga08x19_4283_c1 3300050514 Bacteria 8459
799 nmdc:mga08x19_438958_c1 3300050514 Unclassified 918
800 nmdc:mga08x19_764035_c1 3300050514 Archaea 686
801 nmdc:mga08x19_905926_c1 3300050514 Bacteria 626
802 nmdc:mga0a205_11244_c1 3300050515 Bacteria 8238
803 nmdc:mga0a205_116102_c1 3300050515 Bacteria 2575
804 nmdc:mga0a205_122_c1 3300050515 Bacteria 47141
805 nmdc:mga0a205_136604_c1 3300050515 Bacteria 2352
806 nmdc:mga0a205_32200_c1 3300050515 Bacteria 5027
807 nmdc:mga0a205_34697_c1 3300050515 Bacteria 3508
808 nmdc:mga0a205_5999_c1 3300050515 Bacteria 10954
809 nmdc:mga0a205_66066_c1 3300050515 Bacteria 3495
810 nmdc:mga0a205_7565_c1 3300050515 Bacteria 9840
811 nmdc:mga0a205_78167_c1 3300050515 Bacteria 3197
812 nmdc:mga0a205_895_c1 3300050515 Bacteria 17939
813 nmdc:mga0a205_94817_c1 3300050515 Bacteria 2883
814 Ga0501084_0005239 3300054114 Bacteria 10613
815 Ga0501084_0009827 3300054114 Bacteria 7907
816 Ga0501084_0012880 3300054114 Bacteria 6927
817 Ga0501084_0051370 3300054114 Bacteria 3450
818 Ga0501084_0092923 3300054114 Unclassified 2532
819 Ga0501084_0544844 3300054114 Unclassified 980
820 Ga0501084_0916731 3300054114 Bacteria 737
821 Ga0501084_0923406 3300054114 Bacteria 734
822 Ga0501084_0951500 3300054114 Unclassified 722
823 Ga0501084_1107809 3300054114 Unclassified 665
824 Ga0590071_028654 3300059421 Bacteria 1323
825 Ga0501082_0001321 3300060353 Bacteria 21707
826 Ga0501082_0008654 3300060353 Bacteria 8775
827 Ga0501082_0054849 3300060353 Bacteria 3435
828 Ga0501082_0105974 3300060353 Bacteria 2432
829 Ga0501082_0119655 3300060353 Bacteria 2282
830 Ga0501082_0412983 3300060353 Bacteria 1178
831 Ga0501082_1489311 3300060353 Bacteria 591
832 Ga0501082_1644234 3300060353 Bacteria 561
833 Ga0530510_0032198 3300061734 Bacteria 3770
834 Ga0530510_0041180 3300061734 Bacteria 3335
835 Ga0530510_0059492 3300061734 Bacteria 2764
836 Ga0530510_0190198 3300061734 Bacteria 1524
837 Ga0530510_0231881 3300061734 Bacteria 1373
838 Ga0530510_0266259 3300061734 Bacteria 1279
839 Ga0530510_0391067 3300061734 Bacteria 1047
840 Ga0530510_0531434 3300061734 Unclassified 892

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027471 Ga0209995_1072062 Ga0209995_10720621 109
2 3300005546 Ga0070696_100134183 Ga0070696_1001341832 110
3 3300006847 Ga0075431_100159022 Ga0075431_1001590222 110
4 3300006880 Ga0075429_100261557 Ga0075429_1002615572 110
5 3300007076 Ga0075435_100501882 Ga0075435_1005018821 110
6 3300050510 nmdc:mga06r32_658506_c1 nmdc:mga06r32_658506_c1_671_1003 110
7 3300006844 Ga0075428_100016139 Ga0075428_1000161394 114
8 3300006847 Ga0075431_100024787 Ga0075431_1000247872 114
9 3300006880 Ga0075429_100054933 Ga0075429_1000549332 114
10 3300050508 nmdc:mga09592_120388_c1 nmdc:mga09592_120388_c1_1637_2014 114
11 3300050510 nmdc:mga06r32_13323_c1 nmdc:mga06r32_13323_c1_5096_5473 114
12 3300011119 Ga0105246_12462689 Ga0105246_124626891 118
13 3300046472 Ga0495580_0380069 Ga0495580_0380069_42_404 120
14 3300005341 Ga0070691_10246765 Ga0070691_102467652 121
15 3300005444 Ga0070694_100000758 Ga0070694_1000007585 121
16 3300005536 Ga0070697_100097916 Ga0070697_1000979162 121
17 3300005545 Ga0070695_100001464 Ga0070695_10000146410 121
18 3300005549 Ga0070704_100194232 Ga0070704_1001942322 121
19 3300035090 Ga0373949_0216649 Ga0373949_0216649_16_381 121
20 3300035242 Ga0373962_0159618 Ga0373962_0159618_223_588 121
21 3300049572 Ga0501036_0433038 Ga0501036_0433038_702_1073 121
22 3300049576 Ga0501040_0611626 Ga0501040_0611626_341_712 121
23 3300049577 Ga0501041_0551987 Ga0501041_0551987_68_439 121
24 3300049579 Ga0501043_0392161 Ga0501043_0392161_340_711 121
25 3300049580 Ga0501046_0073675 Ga0501046_0073675_2018_2389 121
26 3300049584 Ga0501068_0068617 Ga0501068_0068617_972_1343 121
27 3300049588 Ga0501072_0097083 Ga0501072_0097083_730_1101 121
28 3300049593 Ga0501077_0140163 Ga0501077_0140163_162_533 121
29 3300049742 Ga0501080_0224442 Ga0501080_0224442_745_1116 121
30 3300049743 Ga0501081_0018275 Ga0501081_0018275_2472_2843 121
31 3300054114 Ga0501084_0092923 Ga0501084_0092923_844_1215 121
32 3300060353 Ga0501082_0105974 Ga0501082_0105974_1719_2090 121
33 3300061734 Ga0530510_0266259 Ga0530510_0266259_547_918 121
34 3300005458 Ga0070681_10385237 Ga0070681_103852372 122
35 3300005467 Ga0070706_100116282 Ga0070706_1001162822 122
36 3300005468 Ga0070707_100020638 Ga0070707_1000206384 122
37 3300005518 Ga0070699_100283016 Ga0070699_1002830162 122
38 3300006880 Ga0075429_100324655 Ga0075429_1003246552 122
39 3300009147 Ga0114129_10809405 Ga0114129_108094051 122
40 3300010375 Ga0105239_11849730 Ga0105239_118497301 122
41 3300025922 Ga0207646_10017426 Ga0207646_100174264 122
42 3300025936 Ga0207670_11829273 Ga0207670_118292731 122
43 3300025942 Ga0207689_11511260 Ga0207689_115112601 122
44 3300042000 Ga0439437_020610 Ga0439437_020610_280_648 122
45 3300042438 Ga0439459_0113996 Ga0439459_0113996_168_536 122
46 3300046691 Ga0495670_0311303 Ga0495670_0311303_33_401 122
47 3300049578 Ga0501042_0358712 Ga0501042_0358712_614_988 122
48 3300049588 Ga0501072_0129011 Ga0501072_0129011_1070_1444 122
49 3300049592 Ga0501076_0128955 Ga0501076_0128955_744_1181 122
50 3300049743 Ga0501081_0288548 Ga0501081_0288548_757_1131 122
51 3300049743 Ga0501081_1026558 Ga0501081_1026558_64_438 122
52 3300050508 nmdc:mga09592_250750_c1 nmdc:mga09592_250750_c1_394_762 122
53 3300054114 Ga0501084_0544844 Ga0501084_0544844_480_917 122
54 3300054114 Ga0501084_0951500 Ga0501084_0951500_38_475 122
55 3300061734 Ga0530510_0391067 Ga0530510_0391067_155_592 122
56 3300004803 Ga0058862_11757738 Ga0058862_117577381 123
57 3300005290 Ga0065712_10245799 Ga0065712_102457991 123
58 3300005293 Ga0065715_10011729 Ga0065715_100117292 123
59 3300005295 Ga0065707_10377532 Ga0065707_103775322 123
60 3300005295 Ga0065707_10611206 Ga0065707_106112061 123
61 3300005328 Ga0070676_10267179 Ga0070676_102671792 123
62 3300005328 Ga0070676_10324717 Ga0070676_103247172 123
63 3300005329 Ga0070683_100197198 Ga0070683_1001971983 123
64 3300005330 Ga0070690_100459511 Ga0070690_1004595111 123
65 3300005331 Ga0070670_100017818 Ga0070670_1000178185 123
66 3300005333 Ga0070677_10143732 Ga0070677_101437321 123
67 3300005334 Ga0068869_100002767 Ga0068869_1000027675 123
68 3300005334 Ga0068869_100004989 Ga0068869_1000049898 123
69 3300005334 Ga0068869_100101413 Ga0068869_1001014131 123
70 3300005336 Ga0070680_100007214 Ga0070680_1000072143 123
71 3300005336 Ga0070680_100012717 Ga0070680_1000127174 123
72 3300005336 Ga0070680_100288171 Ga0070680_1002881712 123
73 3300005337 Ga0070682_100001205 Ga0070682_10000120510 123
74 3300005338 Ga0068868_100020041 Ga0068868_1000200415 123
75 3300005340 Ga0070689_100179716 Ga0070689_1001797162 123
76 3300005340 Ga0070689_100298731 Ga0070689_1002987312 123
77 3300005341 Ga0070691_10009079 Ga0070691_100090794 123
78 3300005341 Ga0070691_10031148 Ga0070691_100311482 123
79 3300005341 Ga0070691_10034723 Ga0070691_100347231 123
80 3300005343 Ga0070687_100084688 Ga0070687_1000846882 123
81 3300005343 Ga0070687_100741975 Ga0070687_1007419752 123
82 3300005344 Ga0070661_100034153 Ga0070661_1000341533 123
83 3300005345 Ga0070692_10002740 Ga0070692_100027404 123
84 3300005345 Ga0070692_10023433 Ga0070692_100234333 123
85 3300005345 Ga0070692_10077902 Ga0070692_100779022 123
86 3300005347 Ga0070668_100667745 Ga0070668_1006677452 123
87 3300005347 Ga0070668_100768139 Ga0070668_1007681391 123
88 3300005353 Ga0070669_100004573 Ga0070669_1000045734 123
89 3300005353 Ga0070669_100049648 Ga0070669_1000496483 123
90 3300005354 Ga0070675_100228953 Ga0070675_1002289532 123
91 3300005354 Ga0070675_100657013 Ga0070675_1006570132 123
92 3300005356 Ga0070674_100510951 Ga0070674_1005109512 123
93 3300005364 Ga0070673_100138359 Ga0070673_1001383594 123
94 3300005366 Ga0070659_100054477 Ga0070659_1000544776 123
95 3300005367 Ga0070667_100134028 Ga0070667_1001340281 123
96 3300005436 Ga0070713_101373939 Ga0070713_1013739392 123
97 3300005438 Ga0070701_10140966 Ga0070701_101409662 123
98 3300005438 Ga0070701_10174487 Ga0070701_101744872 123
99 3300005439 Ga0070711_100009216 Ga0070711_1000092162 123
100 3300005439 Ga0070711_100124791 Ga0070711_1001247912 123
101 3300005440 Ga0070705_100000542 Ga0070705_10000054220 123
102 3300005440 Ga0070705_100022294 Ga0070705_1000222942 123
103 3300005440 Ga0070705_100080985 Ga0070705_1000809852 123
104 3300005440 Ga0070705_100081654 Ga0070705_1000816542 123
105 3300005440 Ga0070705_100291214 Ga0070705_1002912142 123
106 3300005441 Ga0070700_100051905 Ga0070700_1000519054 123
107 3300005441 Ga0070700_100155761 Ga0070700_1001557612 123
108 3300005441 Ga0070700_100503985 Ga0070700_1005039852 123
109 3300005444 Ga0070694_100004529 Ga0070694_10000452911 123
110 3300005444 Ga0070694_100009642 Ga0070694_1000096423 123
111 3300005444 Ga0070694_100012156 Ga0070694_1000121567 123
112 3300005444 Ga0070694_100046317 Ga0070694_1000463173 123
113 3300005444 Ga0070694_100058837 Ga0070694_1000588373 123
114 3300005444 Ga0070694_100082060 Ga0070694_1000820601 123
115 3300005444 Ga0070694_100467478 Ga0070694_1004674782 123
116 3300005444 Ga0070694_100491713 Ga0070694_1004917132 123
117 3300005444 Ga0070694_100824822 Ga0070694_1008248221 123
118 3300005444 Ga0070694_100943122 Ga0070694_1009431221 123
119 3300005445 Ga0070708_100031570 Ga0070708_1000315704 123
120 3300005445 Ga0070708_100085594 Ga0070708_1000855942 123
121 3300005445 Ga0070708_100127188 Ga0070708_1001271882 123
122 3300005445 Ga0070708_100324771 Ga0070708_1003247712 123
123 3300005445 Ga0070708_100739102 Ga0070708_1007391022 123
124 3300005445 Ga0070708_101191452 Ga0070708_1011914522 123
125 3300005455 Ga0070663_100013971 Ga0070663_1000139717 123
126 3300005455 Ga0070663_100866568 Ga0070663_1008665682 123
127 3300005457 Ga0070662_100006301 Ga0070662_1000063014 123
128 3300005457 Ga0070662_100024955 Ga0070662_1000249553 123
129 3300005457 Ga0070662_100131215 Ga0070662_1001312152 123
130 3300005458 Ga0070681_10273174 Ga0070681_102731742 123
131 3300005459 Ga0068867_100000884 Ga0068867_1000008842 123
132 3300005459 Ga0068867_100038507 Ga0068867_1000385071 123
133 3300005459 Ga0068867_100196977 Ga0068867_1001969772 123
134 3300005459 Ga0068867_100255013 Ga0068867_1002550132 123
135 3300005459 Ga0068867_101189603 Ga0068867_1011896031 123
136 3300005467 Ga0070706_100046815 Ga0070706_1000468152 123
137 3300005467 Ga0070706_100064589 Ga0070706_1000645894 123
138 3300005467 Ga0070706_100097674 Ga0070706_1000976742 123
139 3300005467 Ga0070706_100132241 Ga0070706_1001322412 123
140 3300005467 Ga0070706_100264174 Ga0070706_1002641742 123
141 3300005467 Ga0070706_100524446 Ga0070706_1005244462 123
142 3300005467 Ga0070706_100729401 Ga0070706_1007294012 123
143 3300005468 Ga0070707_100001624 Ga0070707_10000162413 123
144 3300005468 Ga0070707_100041460 Ga0070707_1000414603 123
145 3300005468 Ga0070707_100076514 Ga0070707_1000765142 123
146 3300005468 Ga0070707_100204283 Ga0070707_1002042832 123
147 3300005468 Ga0070707_100209644 Ga0070707_1002096442 123
148 3300005468 Ga0070707_100210990 Ga0070707_1002109902 123
149 3300005468 Ga0070707_100595038 Ga0070707_1005950382 123
150 3300005468 Ga0070707_100997634 Ga0070707_1009976341 123
151 3300005471 Ga0070698_100008808 Ga0070698_1000088082 123
152 3300005471 Ga0070698_100081517 Ga0070698_1000815172 123
153 3300005471 Ga0070698_100168549 Ga0070698_1001685492 123
154 3300005471 Ga0070698_100610284 Ga0070698_1006102842 123
155 3300005471 Ga0070698_100905902 Ga0070698_1009059022 123
156 3300005518 Ga0070699_100004727 Ga0070699_10000472713 123
157 3300005518 Ga0070699_100013765 Ga0070699_1000137656 123
158 3300005518 Ga0070699_100026620 Ga0070699_1000266202 123
159 3300005518 Ga0070699_100028052 Ga0070699_1000280524 123
160 3300005518 Ga0070699_100031808 Ga0070699_1000318084 123
161 3300005518 Ga0070699_100057929 Ga0070699_1000579292 123
162 3300005518 Ga0070699_100231328 Ga0070699_1002313282 123
163 3300005518 Ga0070699_100403560 Ga0070699_1004035602 123
164 3300005518 Ga0070699_100781194 Ga0070699_1007811942 123
165 3300005518 Ga0070699_100830911 Ga0070699_1008309112 123
166 3300005518 Ga0070699_101852047 Ga0070699_1018520471 123
167 3300005530 Ga0070679_100267355 Ga0070679_1002673553 123
168 3300005530 Ga0070679_100415840 Ga0070679_1004158402 123
169 3300005530 Ga0070679_100857713 Ga0070679_1008577132 123
170 3300005535 Ga0070684_100019566 Ga0070684_1000195663 123
171 3300005536 Ga0070697_100001002 Ga0070697_10000100221 123
172 3300005536 Ga0070697_100008817 Ga0070697_1000088172 123
173 3300005536 Ga0070697_100014904 Ga0070697_1000149046 123
174 3300005536 Ga0070697_100216812 Ga0070697_1002168122 123
175 3300005536 Ga0070697_100331569 Ga0070697_1003315692 123
176 3300005536 Ga0070697_100455484 Ga0070697_1004554841 123
177 3300005536 Ga0070697_101360882 Ga0070697_1013608821 123
178 3300005539 Ga0068853_100001362 Ga0068853_10000136220 123
179 3300005544 Ga0070686_100243430 Ga0070686_1002434302 123
180 3300005544 Ga0070686_100593612 Ga0070686_1005936122 123
181 3300005544 Ga0070686_101389115 Ga0070686_1013891151 123
182 3300005545 Ga0070695_100000685 Ga0070695_1000006858 123
183 3300005545 Ga0070695_100003725 Ga0070695_1000037255 123
184 3300005545 Ga0070695_100036448 Ga0070695_1000364482 123
185 3300005545 Ga0070695_100506558 Ga0070695_1005065581 123
186 3300005545 Ga0070695_100667098 Ga0070695_1006670982 123
187 3300005546 Ga0070696_100005033 Ga0070696_1000050334 123
188 3300005546 Ga0070696_100012485 Ga0070696_1000124853 123
189 3300005546 Ga0070696_100335923 Ga0070696_1003359231 123
190 3300005546 Ga0070696_100855157 Ga0070696_1008551572 123
191 3300005546 Ga0070696_101238939 Ga0070696_1012389391 123
192 3300005547 Ga0070693_100000325 Ga0070693_1000003254 123
193 3300005547 Ga0070693_100193690 Ga0070693_1001936902 123
194 3300005549 Ga0070704_100000570 Ga0070704_10000057018 123
195 3300005549 Ga0070704_100040739 Ga0070704_1000407392 123
196 3300005549 Ga0070704_100095191 Ga0070704_1000951912 123
197 3300005549 Ga0070704_100512673 Ga0070704_1005126731 123
198 3300005549 Ga0070704_100640604 Ga0070704_1006406042 123
199 3300005549 Ga0070704_101522716 Ga0070704_1015227161 123
200 3300005563 Ga0068855_100042404 Ga0068855_1000424042 123
201 3300005564 Ga0070664_100030854 Ga0070664_1000308542 123
202 3300005577 Ga0068857_100038731 Ga0068857_1000387312 123
203 3300005577 Ga0068857_100065385 Ga0068857_1000653853 123
204 3300005577 Ga0068857_100152804 Ga0068857_1001528042 123
205 3300005578 Ga0068854_100000353 Ga0068854_10000035314 123
206 3300005614 Ga0068856_100010705 Ga0068856_1000107058 123
207 3300005615 Ga0070702_100019599 Ga0070702_1000195992 123
208 3300005615 Ga0070702_100081011 Ga0070702_1000810112 123
209 3300005615 Ga0070702_100121552 Ga0070702_1001215522 123
210 3300005616 Ga0068852_100376216 Ga0068852_1003762162 123
211 3300005617 Ga0068859_100002575 Ga0068859_10000257516 123
212 3300005617 Ga0068859_100369171 Ga0068859_1003691711 123
213 3300005617 Ga0068859_100393232 Ga0068859_1003932322 123
214 3300005617 Ga0068859_100545229 Ga0068859_1005452292 123
215 3300005617 Ga0068859_101424093 Ga0068859_1014240932 123
216 3300005618 Ga0068864_100008897 Ga0068864_1000088971 123
217 3300005718 Ga0068866_10417343 Ga0068866_104173431 123
218 3300005719 Ga0068861_100033261 Ga0068861_1000332612 123
219 3300005719 Ga0068861_100453979 Ga0068861_1004539792 123
220 3300005840 Ga0068870_10028177 Ga0068870_100281773 123
221 3300005840 Ga0068870_10484886 Ga0068870_104848861 123
222 3300005841 Ga0068863_100007896 Ga0068863_1000078966 123
223 3300005841 Ga0068863_100025704 Ga0068863_1000257043 123
224 3300005841 Ga0068863_100231289 Ga0068863_1002312892 123
225 3300005841 Ga0068863_100977756 Ga0068863_1009777562 123
226 3300005842 Ga0068858_100537055 Ga0068858_1005370552 123
227 3300005842 Ga0068858_101672349 Ga0068858_1016723491 123
228 3300005843 Ga0068860_100004896 Ga0068860_1000048964 123
229 3300005843 Ga0068860_100046278 Ga0068860_1000462783 123
230 3300005843 Ga0068860_100077464 Ga0068860_1000774643 123
231 3300005843 Ga0068860_100119632 Ga0068860_1001196322 123
232 3300005843 Ga0068860_100233869 Ga0068860_1002338692 123
233 3300005843 Ga0068860_100331703 Ga0068860_1003317031 123
234 3300005843 Ga0068860_100356627 Ga0068860_1003566272 123
235 3300005843 Ga0068860_100602011 Ga0068860_1006020111 123
236 3300005844 Ga0068862_100036298 Ga0068862_1000362982 123
237 3300005844 Ga0068862_100050690 Ga0068862_1000506905 123
238 3300005844 Ga0068862_100065277 Ga0068862_1000652772 123
239 3300005844 Ga0068862_100092228 Ga0068862_1000922282 123
240 3300005844 Ga0068862_101285885 Ga0068862_1012858852 123
241 3300005981 Ga0081538_10006559 Ga0081538_100065595 123
242 3300005983 Ga0081540_1078670 Ga0081540_10786702 123
243 3300005985 Ga0081539_10000009 Ga0081539_10000009166 123
244 3300006163 Ga0070715_10220217 Ga0070715_102202171 123
245 3300006173 Ga0070716_100501756 Ga0070716_1005017562 123
246 3300006175 Ga0070712_100001521 Ga0070712_1000015219 123
247 3300006237 Ga0097621_100284990 Ga0097621_1002849902 123
248 3300006844 Ga0075428_100001849 Ga0075428_10000184916 123
249 3300006844 Ga0075428_100002164 Ga0075428_10000216418 123
250 3300006844 Ga0075428_100005576 Ga0075428_10000557614 123
251 3300006844 Ga0075428_100018237 Ga0075428_1000182372 123
252 3300006844 Ga0075428_100105741 Ga0075428_1001057412 123
253 3300006844 Ga0075428_100975652 Ga0075428_1009756522 123
254 3300006844 Ga0075428_100981563 Ga0075428_1009815632 123
255 3300006844 Ga0075428_101476220 Ga0075428_1014762202 123
256 3300006846 Ga0075430_100000760 Ga0075430_1000007606 123
257 3300006846 Ga0075430_100000893 Ga0075430_10000089322 123
258 3300006846 Ga0075430_100002774 Ga0075430_1000027745 123
259 3300006846 Ga0075430_100030579 Ga0075430_1000305792 123
260 3300006846 Ga0075430_100055745 Ga0075430_1000557452 123
261 3300006846 Ga0075430_100190612 Ga0075430_1001906121 123
262 3300006846 Ga0075430_100347169 Ga0075430_1003471692 123
263 3300006846 Ga0075430_100389660 Ga0075430_1003896601 123
264 3300006847 Ga0075431_100000158 Ga0075431_10000015825 123
265 3300006847 Ga0075431_100004832 Ga0075431_1000048329 123
266 3300006847 Ga0075431_100006182 Ga0075431_1000061826 123
267 3300006847 Ga0075431_100007290 Ga0075431_1000072902 123
268 3300006847 Ga0075431_100008729 Ga0075431_1000087297 123
269 3300006847 Ga0075431_100023595 Ga0075431_1000235952 123
270 3300006847 Ga0075431_100419874 Ga0075431_1004198742 123
271 3300006847 Ga0075431_100559901 Ga0075431_1005599011 123
272 3300006847 Ga0075431_100623064 Ga0075431_1006230642 123
273 3300006847 Ga0075431_100640068 Ga0075431_1006400682 123
274 3300006852 Ga0075433_10000230 Ga0075433_1000023024 123
275 3300006852 Ga0075433_10000972 Ga0075433_100009727 123
276 3300006852 Ga0075433_10002435 Ga0075433_1000243514 123
277 3300006852 Ga0075433_10003721 Ga0075433_1000372112 123
278 3300006852 Ga0075433_10031282 Ga0075433_100312823 123
279 3300006852 Ga0075433_10044033 Ga0075433_100440334 123
280 3300006852 Ga0075433_10168573 Ga0075433_101685732 123
281 3300006852 Ga0075433_10265941 Ga0075433_102659412 123
282 3300006852 Ga0075433_10446179 Ga0075433_104461792 123
283 3300006871 Ga0075434_100001442 Ga0075434_10000144212 123
284 3300006871 Ga0075434_100032819 Ga0075434_1000328192 123
285 3300006871 Ga0075434_100064385 Ga0075434_1000643852 123
286 3300006871 Ga0075434_100071293 Ga0075434_1000712933 123
287 3300006871 Ga0075434_100081334 Ga0075434_1000813342 123
288 3300006871 Ga0075434_100095969 Ga0075434_1000959693 123
289 3300006871 Ga0075434_100152432 Ga0075434_1001524322 123
290 3300006871 Ga0075434_100218627 Ga0075434_1002186272 123
291 3300006871 Ga0075434_102048839 Ga0075434_1020488391 123
292 3300006880 Ga0075429_100000757 Ga0075429_1000007578 123
293 3300006880 Ga0075429_100020203 Ga0075429_1000202032 123
294 3300006880 Ga0075429_100024518 Ga0075429_1000245185 123
295 3300006880 Ga0075429_100050171 Ga0075429_1000501712 123
296 3300006880 Ga0075429_100055828 Ga0075429_1000558284 123
297 3300006880 Ga0075429_100106602 Ga0075429_1001066022 123
298 3300006880 Ga0075429_100328168 Ga0075429_1003281682 123
299 3300006880 Ga0075429_100519444 Ga0075429_1005194442 123
300 3300006880 Ga0075429_101278528 Ga0075429_1012785282 123
301 3300006880 Ga0075429_101356612 Ga0075429_1013566121 123
302 3300006881 Ga0068865_100209883 Ga0068865_1002098832 123
303 3300006881 Ga0068865_100341183 Ga0068865_1003411832 123
304 3300006881 Ga0068865_100617469 Ga0068865_1006174691 123
305 3300006914 Ga0075436_100104024 Ga0075436_1001040242 123
306 3300006914 Ga0075436_100655441 Ga0075436_1006554412 123
307 3300006914 Ga0075436_100767423 Ga0075436_1007674232 123
308 3300006931 Ga0097620_100002575 Ga0097620_10000257516 123
309 3300006931 Ga0097620_100369168 Ga0097620_1003691681 123
310 3300006931 Ga0097620_100393239 Ga0097620_1003932392 123
311 3300006931 Ga0097620_100545267 Ga0097620_1005452672 123
312 3300006931 Ga0097620_101424076 Ga0097620_1014240762 123
313 3300007076 Ga0075435_100069338 Ga0075435_1000693383 123
314 3300007076 Ga0075435_100216498 Ga0075435_1002164982 123
315 3300007076 Ga0075435_100222326 Ga0075435_1002223261 123
316 3300007076 Ga0075435_100487049 Ga0075435_1004870492 123
317 3300007076 Ga0075435_100549621 Ga0075435_1005496212 123
318 3300007076 Ga0075435_100741771 Ga0075435_1007417712 123
319 3300007076 Ga0075435_101279612 Ga0075435_1012796122 123
320 3300007265 Ga0099794_10002156 Ga0099794_100021562 123
321 3300007265 Ga0099794_10055588 Ga0099794_100555882 123
322 3300007265 Ga0099794_10358840 Ga0099794_103588401 123
323 3300009093 Ga0105240_10810126 Ga0105240_108101261 123
324 3300009094 Ga0111539_10000370 Ga0111539_1000037014 123
325 3300009094 Ga0111539_10001809 Ga0111539_100018093 123
326 3300009094 Ga0111539_11125599 Ga0111539_111255991 123
327 3300009094 Ga0111539_11811672 Ga0111539_118116722 123
328 3300009098 Ga0105245_10548129 Ga0105245_105481291 123
329 3300009101 Ga0105247_10014347 Ga0105247_100143472 123
330 3300009147 Ga0114129_10000443 Ga0114129_1000044325 123
331 3300009147 Ga0114129_10000599 Ga0114129_1000059924 123
332 3300009147 Ga0114129_10000708 Ga0114129_1000070811 123
333 3300009147 Ga0114129_10001075 Ga0114129_1000107526 123
334 3300009147 Ga0114129_10002320 Ga0114129_100023202 123
335 3300009147 Ga0114129_10040851 Ga0114129_100408515 123
336 3300009147 Ga0114129_10042842 Ga0114129_100428422 123
337 3300009147 Ga0114129_10100270 Ga0114129_101002703 123
338 3300009147 Ga0114129_10191525 Ga0114129_101915252 123
339 3300009147 Ga0114129_10251975 Ga0114129_102519753 123
340 3300009147 Ga0114129_10262982 Ga0114129_102629824 123
341 3300009147 Ga0114129_10305180 Ga0114129_103051802 123
342 3300009147 Ga0114129_10306476 Ga0114129_103064762 123
343 3300009147 Ga0114129_10309719 Ga0114129_103097192 123
344 3300009147 Ga0114129_10490996 Ga0114129_104909961 123
345 3300009147 Ga0114129_10772496 Ga0114129_107724962 123
346 3300009147 Ga0114129_11358201 Ga0114129_113582012 123
347 3300009147 Ga0114129_12163270 Ga0114129_121632701 123
348 3300009147 Ga0114129_12770874 Ga0114129_127708741 123
349 3300009147 Ga0114129_13022902 Ga0114129_130229021 123
350 3300009148 Ga0105243_10100476 Ga0105243_101004762 123
351 3300009148 Ga0105243_10108421 Ga0105243_101084212 123
352 3300009148 Ga0105243_11663010 Ga0105243_116630102 123
353 3300009174 Ga0105241_10000218 Ga0105241_1000021815 123
354 3300009174 Ga0105241_10058694 Ga0105241_100586944 123
355 3300009176 Ga0105242_10005190 Ga0105242_100051904 123
356 3300009176 Ga0105242_10358033 Ga0105242_103580332 123
357 3300009177 Ga0105248_10059326 Ga0105248_100593262 123
358 3300009177 Ga0105248_10121132 Ga0105248_101211322 123
359 3300009177 Ga0105248_10293106 Ga0105248_102931062 123
360 3300009177 Ga0105248_11808976 Ga0105248_118089762 123
361 3300009551 Ga0105238_10525137 Ga0105238_105251372 123
362 3300009553 Ga0105249_10076713 Ga0105249_100767134 123
363 3300009553 Ga0105249_10081138 Ga0105249_100811384 123
364 3300009553 Ga0105249_10510523 Ga0105249_105105232 123
365 3300009553 Ga0105249_11445337 Ga0105249_114453372 123
366 3300009553 Ga0105249_11455153 Ga0105249_114551531 123
367 3300011119 Ga0105246_10883694 Ga0105246_108836941 123
368 3300013100 Ga0157373_10000381 Ga0157373_100003811 123
369 3300013102 Ga0157371_10193965 Ga0157371_101939652 123
370 3300013104 Ga0157370_10894069 Ga0157370_108940691 123
371 3300013105 Ga0157369_10091723 Ga0157369_100917234 123
372 3300013297 Ga0157378_10102117 Ga0157378_101021172 123
373 3300013297 Ga0157378_10200643 Ga0157378_102006432 123
374 3300013297 Ga0157378_10365546 Ga0157378_103655462 123
375 3300013297 Ga0157378_10484496 Ga0157378_104844962 123
376 3300013297 Ga0157378_10700076 Ga0157378_107000762 123
377 3300013297 Ga0157378_10743689 Ga0157378_107436892 123
378 3300013297 Ga0157378_11073152 Ga0157378_110731522 123
379 3300013306 Ga0163162_10437328 Ga0163162_104373282 123
380 3300013306 Ga0163162_10764653 Ga0163162_107646532 123
381 3300013306 Ga0163162_10884530 Ga0163162_108845302 123
382 3300013306 Ga0163162_11999936 Ga0163162_119999362 123
383 3300013306 Ga0163162_12968616 Ga0163162_129686161 123
384 3300013307 Ga0157372_10001479 Ga0157372_100014792 123
385 3300013307 Ga0157372_10325645 Ga0157372_103256451 123
386 3300013308 Ga0157375_10091551 Ga0157375_100915512 123
387 3300013308 Ga0157375_10119623 Ga0157375_101196231 123
388 3300013308 Ga0157375_10657654 Ga0157375_106576542 123
389 3300014325 Ga0163163_10192997 Ga0163163_101929972 123
390 3300014325 Ga0163163_10217796 Ga0163163_102177962 123
391 3300014326 Ga0157380_10230691 Ga0157380_102306911 123
392 3300014326 Ga0157380_10336315 Ga0157380_103363151 123
393 3300014326 Ga0157380_10338884 Ga0157380_103388842 123
394 3300014326 Ga0157380_10691785 Ga0157380_106917852 123
395 3300014326 Ga0157380_12641443 Ga0157380_126414432 123
396 3300014497 Ga0182008_10063236 Ga0182008_100632362 123
397 3300014745 Ga0157377_11243655 Ga0157377_112436552 123
398 3300014968 Ga0157379_10184752 Ga0157379_101847522 123
399 3300014968 Ga0157379_10554398 Ga0157379_105543981 123
400 3300015262 Ga0182007_10029713 Ga0182007_100297132 123
401 3300017792 Ga0163161_10266277 Ga0163161_102662772 123
402 3300017792 Ga0163161_10587911 Ga0163161_105879112 123
403 3300025885 Ga0207653_10001826 Ga0207653_100018263 123
404 3300025885 Ga0207653_10016897 Ga0207653_100168972 123
405 3300025885 Ga0207653_10023098 Ga0207653_100230982 123
406 3300025900 Ga0207710_10180592 Ga0207710_101805922 123
407 3300025901 Ga0207688_10049701 Ga0207688_100497012 123
408 3300025904 Ga0207647_10045326 Ga0207647_100453262 123
409 3300025905 Ga0207685_10034619 Ga0207685_100346192 123
410 3300025907 Ga0207645_10001324 Ga0207645_100013246 123
411 3300025907 Ga0207645_10015479 Ga0207645_100154795 123
412 3300025908 Ga0207643_10000157 Ga0207643_1000015725 123
413 3300025910 Ga0207684_10000169 Ga0207684_1000016943 123
414 3300025910 Ga0207684_10008133 Ga0207684_100081337 123
415 3300025910 Ga0207684_10010283 Ga0207684_100102836 123
416 3300025910 Ga0207684_10014651 Ga0207684_100146518 123
417 3300025910 Ga0207684_10016896 Ga0207684_100168964 123
418 3300025910 Ga0207684_10057467 Ga0207684_100574672 123
419 3300025910 Ga0207684_10089629 Ga0207684_100896292 123
420 3300025910 Ga0207684_10287306 Ga0207684_102873062 123
421 3300025910 Ga0207684_10646322 Ga0207684_106463221 123
422 3300025911 Ga0207654_10026891 Ga0207654_100268912 123
423 3300025911 Ga0207654_10081699 Ga0207654_100816992 123
424 3300025912 Ga0207707_10000258 Ga0207707_1000025830 123
425 3300025912 Ga0207707_10071611 Ga0207707_100716113 123
426 3300025915 Ga0207693_10001303 Ga0207693_1000130317 123
427 3300025916 Ga0207663_10101821 Ga0207663_101018212 123
428 3300025916 Ga0207663_10277644 Ga0207663_102776442 123
429 3300025917 Ga0207660_10001383 Ga0207660_100013832 123
430 3300025917 Ga0207660_10036306 Ga0207660_100363063 123
431 3300025917 Ga0207660_10688613 Ga0207660_106886132 123
432 3300025918 Ga0207662_10111945 Ga0207662_101119451 123
433 3300025919 Ga0207657_10000373 Ga0207657_1000037316 123
434 3300025920 Ga0207649_10254932 Ga0207649_102549321 123
435 3300025921 Ga0207652_10004142 Ga0207652_100041424 123
436 3300025921 Ga0207652_10217124 Ga0207652_102171241 123
437 3300025921 Ga0207652_10635813 Ga0207652_106358132 123
438 3300025922 Ga0207646_10002895 Ga0207646_100028952 123
439 3300025922 Ga0207646_10004675 Ga0207646_1000467513 123
440 3300025922 Ga0207646_10038985 Ga0207646_100389852 123
441 3300025922 Ga0207646_10045505 Ga0207646_100455054 123
442 3300025922 Ga0207646_10065789 Ga0207646_100657894 123
443 3300025922 Ga0207646_10264914 Ga0207646_102649142 123
444 3300025922 Ga0207646_10891629 Ga0207646_108916291 123
445 3300025922 Ga0207646_11094596 Ga0207646_110945961 123
446 3300025922 Ga0207646_11554536 Ga0207646_115545361 123
447 3300025923 Ga0207681_10134534 Ga0207681_101345342 123
448 3300025926 Ga0207659_10207175 Ga0207659_102071752 123
449 3300025932 Ga0207690_10286300 Ga0207690_102863002 123
450 3300025932 Ga0207690_10297285 Ga0207690_102972851 123
451 3300025933 Ga0207706_10001857 Ga0207706_100018574 123
452 3300025933 Ga0207706_10008929 Ga0207706_100089294 123
453 3300025933 Ga0207706_10146584 Ga0207706_101465842 123
454 3300025933 Ga0207706_10276969 Ga0207706_102769691 123
455 3300025934 Ga0207686_10010046 Ga0207686_100100464 123
456 3300025935 Ga0207709_10028023 Ga0207709_100280232 123
457 3300025935 Ga0207709_10188770 Ga0207709_101887701 123
458 3300025936 Ga0207670_10304253 Ga0207670_103042532 123
459 3300025936 Ga0207670_10491276 Ga0207670_104912761 123
460 3300025938 Ga0207704_10131946 Ga0207704_101319461 123
461 3300025938 Ga0207704_10900388 Ga0207704_109003882 123
462 3300025939 Ga0207665_11242293 Ga0207665_112422932 123
463 3300025941 Ga0207711_10084644 Ga0207711_100846443 123
464 3300025941 Ga0207711_10375272 Ga0207711_103752721 123
465 3300025941 Ga0207711_11053164 Ga0207711_110531642 123
466 3300025941 Ga0207711_11902757 Ga0207711_119027571 123
467 3300025942 Ga0207689_10000975 Ga0207689_100009752 123
468 3300025942 Ga0207689_10001419 Ga0207689_1000141921 123
469 3300025942 Ga0207689_10003954 Ga0207689_100039542 123
470 3300025945 Ga0207679_10000779 Ga0207679_1000077919 123
471 3300025945 Ga0207679_11392460 Ga0207679_113924602 123
472 3300025949 Ga0207667_10000857 Ga0207667_1000085726 123
473 3300025960 Ga0207651_10013096 Ga0207651_100130963 123
474 3300025961 Ga0207712_10058438 Ga0207712_100584384 123
475 3300025961 Ga0207712_10088740 Ga0207712_100887402 123
476 3300025961 Ga0207712_10560610 Ga0207712_105606102 123
477 3300025972 Ga0207668_10541484 Ga0207668_105414841 123
478 3300025981 Ga0207640_10011172 Ga0207640_100111722 123
479 3300025986 Ga0207658_10419358 Ga0207658_104193582 123
480 3300026023 Ga0207677_10011276 Ga0207677_100112762 123
481 3300026035 Ga0207703_10415584 Ga0207703_104155842 123
482 3300026035 Ga0207703_11233162 Ga0207703_112331621 123
483 3300026041 Ga0207639_10042698 Ga0207639_100426984 123
484 3300026067 Ga0207678_10002143 Ga0207678_100021436 123
485 3300026067 Ga0207678_10879095 Ga0207678_108790951 123
486 3300026075 Ga0207708_10119553 Ga0207708_101195532 123
487 3300026075 Ga0207708_10195309 Ga0207708_101953092 123
488 3300026075 Ga0207708_10292588 Ga0207708_102925881 123
489 3300026075 Ga0207708_10399880 Ga0207708_103998802 123
490 3300026078 Ga0207702_10001041 Ga0207702_1000104113 123
491 3300026088 Ga0207641_10178512 Ga0207641_101785121 123
492 3300026088 Ga0207641_10344655 Ga0207641_103446552 123
493 3300026088 Ga0207641_11596884 Ga0207641_115968841 123
494 3300026089 Ga0207648_10001790 Ga0207648_1000179021 123
495 3300026089 Ga0207648_10158747 Ga0207648_101587472 123
496 3300026089 Ga0207648_10289800 Ga0207648_102898002 123
497 3300026089 Ga0207648_10514659 Ga0207648_105146592 123
498 3300026089 Ga0207648_11455425 Ga0207648_114554251 123
499 3300026095 Ga0207676_10046984 Ga0207676_100469842 123
500 3300026095 Ga0207676_11883502 Ga0207676_118835021 123
501 3300026116 Ga0207674_10008510 Ga0207674_100085104 123
502 3300026116 Ga0207674_10106524 Ga0207674_101065243 123
503 3300026116 Ga0207674_10329661 Ga0207674_103296612 123
504 3300026118 Ga0207675_100028715 Ga0207675_1000287152 123
505 3300026118 Ga0207675_100077456 Ga0207675_1000774562 123
506 3300026118 Ga0207675_100246138 Ga0207675_1002461382 123
507 3300026118 Ga0207675_100874761 Ga0207675_1008747612 123
508 3300026142 Ga0207698_10090066 Ga0207698_100900663 123
509 3300027360 Ga0209969_1003454 Ga0209969_10034543 123
510 3300027364 Ga0209967_1001743 Ga0209967_10017433 123
511 3300027378 Ga0209981_1020171 Ga0209981_10201712 123
512 3300027395 Ga0209996_1002603 Ga0209996_10026033 123
513 3300027424 Ga0209984_1000344 Ga0209984_10003442 123
514 3300027471 Ga0209995_1000323 Ga0209995_10003232 123
515 3300027526 Ga0209968_1002390 Ga0209968_10023902 123
516 3300027543 Ga0209999_1004130 Ga0209999_10041303 123
517 3300027552 Ga0209982_1001327 Ga0209982_10013272 123
518 3300027665 Ga0209983_1001424 Ga0209983_10014247 123
519 3300027665 Ga0209983_1084876 Ga0209983_10848762 123
520 3300027671 Ga0209588_1050700 Ga0209588_10507002 123
521 3300027682 Ga0209971_1000031 Ga0209971_100003122 123
522 3300027682 Ga0209971_1123873 Ga0209971_11238731 123
523 3300027695 Ga0209966_1000020 Ga0209966_100002023 123
524 3300027695 Ga0209966_1014358 Ga0209966_10143582 123
525 3300027717 Ga0209998_10000024 Ga0209998_1000002427 123
526 3300027876 Ga0209974_10001378 Ga0209974_100013784 123
527 3300027876 Ga0209974_10003540 Ga0209974_100035405 123
528 3300027907 Ga0207428_10000409 Ga0207428_1000040935 123
529 3300027907 Ga0207428_10007011 Ga0207428_100070113 123
530 3300027907 Ga0207428_10318912 Ga0207428_103189122 123
531 3300028380 Ga0268265_10012391 Ga0268265_100123915 123
532 3300028380 Ga0268265_10105753 Ga0268265_101057532 123
533 3300028380 Ga0268265_10119804 Ga0268265_101198042 123
534 3300028380 Ga0268265_10452306 Ga0268265_104523062 123
535 3300028380 Ga0268265_10829602 Ga0268265_108296022 123
536 3300028380 Ga0268265_11878580 Ga0268265_118785801 123
537 3300028380 Ga0268265_12231609 Ga0268265_122316091 123
538 3300028381 Ga0268264_10020556 Ga0268264_100205563 123
539 3300028381 Ga0268264_10297626 Ga0268264_102976262 123
540 3300028381 Ga0268264_10317022 Ga0268264_103170222 123
541 3300028381 Ga0268264_10737805 Ga0268264_107378052 123
542 3300028381 Ga0268264_11143938 Ga0268264_111439382 123
543 3300028381 Ga0268264_11286725 Ga0268264_112867252 123
544 3300031548 Ga0307408_100095384 Ga0307408_1000953842 123
545 3300031548 Ga0307408_100384351 Ga0307408_1003843512 123
546 3300031548 Ga0307408_102065086 Ga0307408_1020650862 123
547 3300031903 Ga0307407_10859020 Ga0307407_108590201 123
548 3300031995 Ga0307409_100637127 Ga0307409_1006371272 123
549 3300032002 Ga0307416_100383603 Ga0307416_1003836032 123
550 3300032004 Ga0307414_10116872 Ga0307414_101168722 123
551 3300032004 Ga0307414_10953980 Ga0307414_109539802 123
552 3300032005 Ga0307411_10135540 Ga0307411_101355402 123
553 3300034818 Ga0373950_0008662 Ga0373950_0008662_732_1106 123
554 3300034819 Ga0373958_0113965 Ga0373958_0113965_15_386 123
555 3300034820 Ga0373959_0042518 Ga0373959_0042518_115_486 123
556 3300035088 Ga0373940_0031547 Ga0373940_0031547_974_1345 123
557 3300035088 Ga0373940_0039022 Ga0373940_0039022_877_1251 123
558 3300035088 Ga0373940_0206741 Ga0373940_0206741_124_498 123
559 3300035090 Ga0373949_0007980 Ga0373949_0007980_284_655 123
560 3300035090 Ga0373949_0067790 Ga0373949_0067790_478_849 123
561 3300035090 Ga0373949_0309313 Ga0373949_0309313_107_481 123
562 3300035091 Ga0373951_0025476 Ga0373951_0025476_470_841 123
563 3300035091 Ga0373951_0143489 Ga0373951_0143489_242_616 123
564 3300035114 Ga0373939_0103364 Ga0373939_0103364_135_509 123
565 3300035114 Ga0373939_0317963 Ga0373939_0317963_47_421 123
566 3300035115 Ga0373941_0005607 Ga0373941_0005607_2492_2866 123
567 3300035115 Ga0373941_0040453 Ga0373941_0040453_167_541 123
568 3300035121 Ga0373960_0084805 Ga0373960_0084805_548_922 123
569 3300035241 Ga0373961_0189560 Ga0373961_0189560_80_451 123
570 3300035242 Ga0373962_0002572 Ga0373962_0002572_479_853 123
571 3300035242 Ga0373962_0271558 Ga0373962_0271558_142_516 123
572 3300035691 Ga0373931_0567067 Ga0373931_0567067_263_637 123
573 3300037312 Ga0395899_0021054 Ga0395899_0021054_2354_2728 123
574 3300037312 Ga0395899_0249976 Ga0395899_0249976_458_832 123
575 3300037418 Ga0395900_0017941 Ga0395900_0017941_2825_3199 123
576 3300037418 Ga0395900_0146737 Ga0395900_0146737_1759_2133 123
577 3300037418 Ga0395900_0642824 Ga0395900_0642824_251_625 123
578 3300037466 Ga0395898_0027302 Ga0395898_0027302_5233_5607 123
579 3300037471 Ga0395905_0238600 Ga0395905_0238600_28_402 123
580 3300037471 Ga0395905_0951272 Ga0395905_0951272_150_524 123
581 3300038443 Ga0395901_1081326 Ga0395901_1081326_364_738 123
582 3300038996 Ga0242420_017531 Ga0242420_017531_840_1214 123
583 3300038996 Ga0242420_018387 Ga0242420_018387_325_696 123
584 3300042001 Ga0439441_012424 Ga0439441_012424_612_983 123
585 3300042005 Ga0439448_0043918 Ga0439448_0043918_856_1227 123
586 3300042012 Ga0439455_0007416 Ga0439455_0007416_1673_2044 123
587 3300042016 Ga0439463_066613 Ga0439463_066613_435_806 123
588 3300042157 Ga0439458_0083356 Ga0439458_0083356_398_769 123
589 3300042438 Ga0439459_0029527 Ga0439459_0029527_155_526 123
590 3300042439 Ga0439464_0001377 Ga0439464_0001377_4568_4939 123
591 3300042461 Ga0439460_0004434 Ga0439460_0004434_2429_2800 123
592 3300042876 Ga0451577_0003197 Ga0451577_0003197_3227_3598 123
593 3300042876 Ga0451577_0017165 Ga0451577_0017165_245_625 123
594 3300042876 Ga0451577_0057091 Ga0451577_0057091_560_931 123
595 3300042876 Ga0451577_0138688 Ga0451577_0138688_433_804 123
596 3300042876 Ga0451577_1298153 Ga0451577_1298153_181_558 123
597 3300042993 Ga0439440_0100268 Ga0439440_0100268_370_741 123
598 3300044673 Ga0453683_0008423 Ga0453683_0008423_5561_5938 123
599 3300044673 Ga0453683_0048690 Ga0453683_0048690_120_500 123
600 3300044673 Ga0453683_0053051 Ga0453683_0053051_1826_2197 123
601 3300044712 Ga0453684_0051544 Ga0453684_0051544_2972_3343 123
602 3300044712 Ga0453684_0059189 Ga0453684_0059189_255_635 123
603 3300044712 Ga0453684_0189615 Ga0453684_0189615_680_1051 123
604 3300044712 Ga0453684_0493193 Ga0453684_0493193_502_873 123
605 3300044712 Ga0453684_1385269 Ga0453684_1385269_121_495 123
606 3300045051 Ga0451576_0016285 Ga0451576_0016285_5211_5582 123
607 3300045051 Ga0451576_0019862 Ga0451576_0019862_3378_3764 123
608 3300045051 Ga0451576_0021455 Ga0451576_0021455_2367_2738 123
609 3300045051 Ga0451576_0095258 Ga0451576_0095258_2202_2576 123
610 3300045051 Ga0451576_0109256 Ga0451576_0109256_2377_2748 123
611 3300045051 Ga0451576_0257085 Ga0451576_0257085_247_618 123
612 3300045051 Ga0451576_0423844 Ga0451576_0423844_537_914 123
613 3300045051 Ga0451576_1111137 Ga0451576_1111137_323_694 123
614 3300045051 Ga0451576_1623978 Ga0451576_1623978_159_533 123
615 3300046615 Ga0495656_0018852 Ga0495656_0018852_616_990 123
616 3300046615 Ga0495656_0817524 Ga0495656_0817524_73_456 123
617 3300046684 Ga0495669_0028327 Ga0495669_0028327_1999_2373 123
618 3300046684 Ga0495669_0124325 Ga0495669_0124325_681_1055 123
619 3300046684 Ga0495669_0277659 Ga0495669_0277659_185_562 123
620 3300047318 Ga0495636_0131050 Ga0495636_0131050_65_439 123
621 3300048905 Ga0496102_0010289 Ga0496102_0010289_7034_7405 123
622 3300048905 Ga0496102_0031996 Ga0496102_0031996_1864_2238 123
623 3300048905 Ga0496102_0294221 Ga0496102_0294221_429_812 123
624 3300048907 Ga0496104_1009209 Ga0496104_1009209_63_437 123
625 3300048909 Ga0496106_0125534 Ga0496106_0125534_1515_1889 123
626 3300048911 Ga0496108_1719409 Ga0496108_1719409_91_474 123
627 3300048912 Ga0496109_0475642 Ga0496109_0475642_513_884 123
628 3300048915 Ga0496112_0117827 Ga0496112_0117827_869_1240 123
629 3300049568 Ga0501031_0070611 Ga0501031_0070611_480_851 123
630 3300049568 Ga0501031_0203984 Ga0501031_0203984_231_608 123
631 3300049568 Ga0501031_0293101 Ga0501031_0293101_250_633 123
632 3300049570 Ga0501033_0064984 Ga0501033_0064984_126_497 123
633 3300049570 Ga0501033_0326261 Ga0501033_0326261_553_930 123
634 3300049571 Ga0501034_0896459 Ga0501034_0896459_201_584 123
635 3300049572 Ga0501036_0045030 Ga0501036_0045030_2895_3278 123
636 3300049572 Ga0501036_0046663 Ga0501036_0046663_3158_3535 123
637 3300049572 Ga0501036_0211866 Ga0501036_0211866_599_970 123
638 3300049572 Ga0501036_0826011 Ga0501036_0826011_338_715 123
639 3300049573 Ga0501037_0546355 Ga0501037_0546355_123_506 123
640 3300049574 Ga0501038_0067911 Ga0501038_0067911_1690_2073 123
641 3300049574 Ga0501038_0514273 Ga0501038_0514273_292_663 123
642 3300049574 Ga0501038_1055619 Ga0501038_1055619_111_491 123
643 3300049575 Ga0501039_0019151 Ga0501039_0019151_354_737 123
644 3300049575 Ga0501039_0144949 Ga0501039_0144949_147_524 123
645 3300049575 Ga0501039_0424445 Ga0501039_0424445_356_730 123
646 3300049575 Ga0501039_0864037 Ga0501039_0864037_229_600 123
647 3300049576 Ga0501040_0003451 Ga0501040_0003451_1778_2149 123
648 3300049576 Ga0501040_0041964 Ga0501040_0041964_2289_2660 123
649 3300049576 Ga0501040_0460028 Ga0501040_0460028_469_840 123
650 3300049576 Ga0501040_0762225 Ga0501040_0762225_302_679 123
651 3300049577 Ga0501041_0050743 Ga0501041_0050743_1658_2032 123
652 3300049577 Ga0501041_0465631 Ga0501041_0465631_151_534 123
653 3300049577 Ga0501041_0579252 Ga0501041_0579252_205_591 123
654 3300049577 Ga0501041_0783905 Ga0501041_0783905_210_587 123
655 3300049578 Ga0501042_0009827 Ga0501042_0009827_3898_4269 123
656 3300049578 Ga0501042_0040799 Ga0501042_0040799_117_494 123
657 3300049578 Ga0501042_0414007 Ga0501042_0414007_160_534 123
658 3300049578 Ga0501042_0592977 Ga0501042_0592977_173_547 123
659 3300049578 Ga0501042_0596528 Ga0501042_0596528_267_638 123
660 3300049578 Ga0501042_0627368 Ga0501042_0627368_357_740 123
661 3300049578 Ga0501042_1269725 Ga0501042_1269725_59_430 123
662 3300049579 Ga0501043_0386663 Ga0501043_0386663_133_516 123
663 3300049579 Ga0501043_0419529 Ga0501043_0419529_323_697 123
664 3300049580 Ga0501046_0000607 Ga0501046_0000607_19445_19816 123
665 3300049580 Ga0501046_0045322 Ga0501046_0045322_2999_3376 123
666 3300049580 Ga0501046_0123008 Ga0501046_0123008_557_940 123
667 3300049581 Ga0501047_0079990 Ga0501047_0079990_1141_1512 123
668 3300049582 Ga0501048_0008791 Ga0501048_0008791_5841_6212 123
669 3300049582 Ga0501048_0238240 Ga0501048_0238240_286_660 123
670 3300049582 Ga0501048_0470416 Ga0501048_0470416_382_765 123
671 3300049582 Ga0501048_0662806 Ga0501048_0662806_345_722 123
672 3300049582 Ga0501048_1213297 Ga0501048_1213297_18_398 123
673 3300049583 Ga0501067_0508396 Ga0501067_0508396_114_485 123
674 3300049584 Ga0501068_0085258 Ga0501068_0085258_1516_1890 123
675 3300049584 Ga0501068_0085735 Ga0501068_0085735_161_532 123
676 3300049585 Ga0501069_0334062 Ga0501069_0334062_122_493 123
677 3300049585 Ga0501069_0364907 Ga0501069_0364907_196_570 123
678 3300049586 Ga0501070_1122823 Ga0501070_1122823_116_493 123
679 3300049587 Ga0501071_0058887 Ga0501071_0058887_730_1101 123
680 3300049587 Ga0501071_0334358 Ga0501071_0334358_307_690 123
681 3300049587 Ga0501071_0841378 Ga0501071_0841378_176_547 123
682 3300049588 Ga0501072_0003099 Ga0501072_0003099_1414_1788 123
683 3300049588 Ga0501072_0024347 Ga0501072_0024347_2252_2635 123
684 3300049588 Ga0501072_0037942 Ga0501072_0037942_3253_3630 123
685 3300049588 Ga0501072_0393340 Ga0501072_0393340_607_990 123
686 3300049588 Ga0501072_0536302 Ga0501072_0536302_88_462 123
687 3300049588 Ga0501072_0697973 Ga0501072_0697973_154_531 123
688 3300049589 Ga0501073_0980430 Ga0501073_0980430_68_451 123
689 3300049590 Ga0501074_0017013 Ga0501074_0017013_4661_5032 123
690 3300049590 Ga0501074_0109282 Ga0501074_0109282_1408_1779 123
691 3300049590 Ga0501074_0162809 Ga0501074_0162809_71_445 123
692 3300049590 Ga0501074_0329835 Ga0501074_0329835_664_1047 123
693 3300049591 Ga0501075_0001457 Ga0501075_0001457_13869_14246 123
694 3300049591 Ga0501075_0009060 Ga0501075_0009060_5841_6212 123
695 3300049591 Ga0501075_0070478 Ga0501075_0070478_2235_2609 123
696 3300049591 Ga0501075_0080998 Ga0501075_0080998_2006_2380 123
697 3300049591 Ga0501075_0304805 Ga0501075_0304805_204_584 123
698 3300049591 Ga0501075_0347670 Ga0501075_0347670_179_556 123
699 3300049591 Ga0501075_0367422 Ga0501075_0367422_373_747 123
700 3300049591 Ga0501075_0806093 Ga0501075_0806093_116_499 123
701 3300049591 Ga0501075_1299798 Ga0501075_1299798_134_505 123
702 3300049592 Ga0501076_0003696 Ga0501076_0003696_2414_2785 123
703 3300049592 Ga0501076_0105858 Ga0501076_0105858_1178_1561 123
704 3300049592 Ga0501076_0115478 Ga0501076_0115478_1702_2073 123
705 3300049592 Ga0501076_0186914 Ga0501076_0186914_1292_1663 123
706 3300049592 Ga0501076_0589857 Ga0501076_0589857_228_602 123
707 3300049592 Ga0501076_1284485 Ga0501076_1284485_193_570 123
708 3300049593 Ga0501077_0001790 Ga0501077_0001790_4978_5355 123
709 3300049593 Ga0501077_0015489 Ga0501077_0015489_594_965 123
710 3300049593 Ga0501077_0068558 Ga0501077_0068558_55_429 123
711 3300049593 Ga0501077_0134681 Ga0501077_0134681_1088_1471 123
712 3300049593 Ga0501077_0166936 Ga0501077_0166936_241_624 123
713 3300049741 Ga0501079_0022016 Ga0501079_0022016_2199_2570 123
714 3300049741 Ga0501079_0028088 Ga0501079_0028088_2901_3284 123
715 3300049741 Ga0501079_0042437 Ga0501079_0042437_3095_3469 123
716 3300049741 Ga0501079_0142783 Ga0501079_0142783_436_807 123
717 3300049741 Ga0501079_0829090 Ga0501079_0829090_82_456 123
718 3300049741 Ga0501079_1170185 Ga0501079_1170185_14_391 123
719 3300049742 Ga0501080_0378410 Ga0501080_0378410_688_1071 123
720 3300049742 Ga0501080_1607350 Ga0501080_1607350_122_496 123
721 3300049743 Ga0501081_0007524 Ga0501081_0007524_121_495 123
722 3300049743 Ga0501081_0054818 Ga0501081_0054818_1285_1656 123
723 3300049743 Ga0501081_0076183 Ga0501081_0076183_1283_1660 123
724 3300049743 Ga0501081_0102296 Ga0501081_0102296_1366_1740 123
725 3300049743 Ga0501081_0103072 Ga0501081_0103072_1164_1544 123
726 3300049743 Ga0501081_0112754 Ga0501081_0112754_278_655 123
727 3300049743 Ga0501081_0288219 Ga0501081_0288219_135_506 123
728 3300049743 Ga0501081_0439269 Ga0501081_0439269_343_714 123
729 3300049744 Ga0501083_0004913 Ga0501083_0004913_7857_8228 123
730 3300049744 Ga0501083_1073616 Ga0501083_1073616_45_419 123
731 3300049822 Ga0501035_0435954 Ga0501035_0435954_640_1011 123
732 3300049822 Ga0501035_0542207 Ga0501035_0542207_46_417 123
733 3300049824 Ga0501045_0001608 Ga0501045_0001608_13437_13808 123
734 3300049824 Ga0501045_0023140 Ga0501045_0023140_149_526 123
735 3300049824 Ga0501045_0033745 Ga0501045_0033745_2636_3019 123
736 3300049824 Ga0501045_0057787 Ga0501045_0057787_532_915 123
737 3300049824 Ga0501045_0081106 Ga0501045_0081106_282_656 123
738 3300050507 nmdc:mga05p37_102832_c1 nmdc:mga05p37_102832_c1_1025_1399 123
739 3300050507 nmdc:mga05p37_114979_c1 nmdc:mga05p37_114979_c1_1960_2334 123
740 3300050507 nmdc:mga05p37_1354391_c1 nmdc:mga05p37_1354391_c1_312_686 123
741 3300050507 nmdc:mga05p37_1430242_c1 nmdc:mga05p37_1430242_c1_248_619 123
742 3300050507 nmdc:mga05p37_14677_c1 nmdc:mga05p37_14677_c1_5539_5913 123
743 3300050507 nmdc:mga05p37_199_c1 nmdc:mga05p37_199_c1_21974_22348 123
744 3300050507 nmdc:mga05p37_263819_c1 nmdc:mga05p37_263819_c1_608_982 123
745 3300050507 nmdc:mga05p37_3355_c1 nmdc:mga05p37_3355_c1_12098_12472 123
746 3300050507 nmdc:mga05p37_38_c1 nmdc:mga05p37_38_c1_17719_18099 123
747 3300050507 nmdc:mga05p37_42209_c1 nmdc:mga05p37_42209_c1_1933_2307 123
748 3300050507 nmdc:mga05p37_423690_c1 nmdc:mga05p37_423690_c1_51_422 123
749 3300050507 nmdc:mga05p37_43249_c1 nmdc:mga05p37_43249_c1_118_495 123
750 3300050507 nmdc:mga05p37_45640_c1 nmdc:mga05p37_45640_c1_2851_3225 123
751 3300050507 nmdc:mga05p37_4951_c1 nmdc:mga05p37_4951_c1_8386_8763 123
752 3300050507 nmdc:mga05p37_51992_c1 nmdc:mga05p37_51992_c1_2939_3337 123
753 3300050507 nmdc:mga05p37_731220_c1 nmdc:mga05p37_731220_c1_73_447 123
754 3300050507 nmdc:mga05p37_8986_c1 nmdc:mga05p37_8986_c1_6079_6453 123
755 3300050508 nmdc:mga09592_1012_c1 nmdc:mga09592_1012_c1_3171_3569 123
756 3300050508 nmdc:mga09592_129109_c1 nmdc:mga09592_129109_c1_1727_2101 123
757 3300050508 nmdc:mga09592_14052_c1 nmdc:mga09592_14052_c1_4993_5373 123
758 3300050508 nmdc:mga09592_1539_c1 nmdc:mga09592_1539_c1_3471_3845 123
759 3300050508 nmdc:mga09592_452450_c1 nmdc:mga09592_452450_c1_706_1080 123
760 3300050508 nmdc:mga09592_497381_c1 nmdc:mga09592_497381_c1_138_512 123
761 3300050508 nmdc:mga09592_582393_c1 nmdc:mga09592_582393_c1_256_627 123
762 3300050508 nmdc:mga09592_69483_c1 nmdc:mga09592_69483_c1_318_692 123
763 3300050508 nmdc:mga09592_7358_c1 nmdc:mga09592_7358_c1_2290_2664 123
764 3300050509 nmdc:mga0qj67_2177_c1 nmdc:mga0qj67_2177_c1_10092_10469 123
765 3300050509 nmdc:mga0qj67_2412_c1 nmdc:mga0qj67_2412_c1_9036_9410 123
766 3300050509 nmdc:mga0qj67_358597_c1 nmdc:mga0qj67_358597_c1_176_550 123
767 3300050509 nmdc:mga0qj67_376022_c1 nmdc:mga0qj67_376022_c1_90_464 123
768 3300050509 nmdc:mga0qj67_4215_c1 nmdc:mga0qj67_4215_c1_1271_1669 123
769 3300050509 nmdc:mga0qj67_42659_c1 nmdc:mga0qj67_42659_c1_1873_2247 123
770 3300050509 nmdc:mga0qj67_935016_c1 nmdc:mga0qj67_935016_c1_122_493 123
771 3300050509 nmdc:mga0qj67_99347_c1 nmdc:mga0qj67_99347_c1_10_384 123
772 3300050510 nmdc:mga06r32_14394_c1 nmdc:mga06r32_14394_c1_537_911 123
773 3300050510 nmdc:mga06r32_237994_c1 nmdc:mga06r32_237994_c1_1359_1742 123
774 3300050510 nmdc:mga06r32_26410_c1 nmdc:mga06r32_26410_c1_4942_5316 123
775 3300050510 nmdc:mga06r32_287_c1 nmdc:mga06r32_287_c1_20214_20594 123
776 3300050510 nmdc:mga06r32_37213_c1 nmdc:mga06r32_37213_c1_2936_3334 123
777 3300050510 nmdc:mga06r32_391973_c1 nmdc:mga06r32_391973_c1_789_1163 123
778 3300050510 nmdc:mga06r32_604616_c1 nmdc:mga06r32_604616_c1_606_977 123
779 3300050510 nmdc:mga06r32_7053_c1 nmdc:mga06r32_7053_c1_2400_2777 123
780 3300050510 nmdc:mga06r32_72465_c1 nmdc:mga06r32_72465_c1_2169_2543 123
781 3300050510 nmdc:mga06r32_88462_c1 nmdc:mga06r32_88462_c1_486_860 123
782 3300050511 nmdc:mga08y16_14948_c1 nmdc:mga08y16_14948_c1_3207_3578 123
783 3300050511 nmdc:mga08y16_302485_c1 nmdc:mga08y16_302485_c1_37_420 123
784 3300050511 nmdc:mga08y16_6148_c1 nmdc:mga08y16_6148_c1_12045_12419 123
785 3300050512 nmdc:mga0n895_127669_c1 nmdc:mga0n895_127669_c1_1026_1397 123
786 3300050512 nmdc:mga0n895_1575846_c1 nmdc:mga0n895_1575846_c1_51_425 123
787 3300050512 nmdc:mga0n895_1587674_c1 nmdc:mga0n895_1587674_c1_222_605 123
788 3300050512 nmdc:mga0n895_21645_c1 nmdc:mga0n895_21645_c1_3582_3956 123
789 3300050512 nmdc:mga0n895_22280_c1 nmdc:mga0n895_22280_c1_1033_1404 123
790 3300050512 nmdc:mga0n895_247386_c1 nmdc:mga0n895_247386_c1_406_777 123
791 3300050512 nmdc:mga0n895_3925_c1 nmdc:mga0n895_3925_c1_2012_2389 123
792 3300050512 nmdc:mga0n895_57777_c1 nmdc:mga0n895_57777_c1_2010_2384 123
793 3300050512 nmdc:mga0n895_61_c1 nmdc:mga0n895_61_c1_21376_21750 123
794 3300050512 nmdc:mga0n895_93537_c1 nmdc:mga0n895_93537_c1_1040_1411 123
795 3300050513 nmdc:mga0rr50_1176182_c1 nmdc:mga0rr50_1176182_c1_38_409 123
796 3300050513 nmdc:mga0rr50_1190_c1 nmdc:mga0rr50_1190_c1_9349_9723 123
797 3300050513 nmdc:mga0rr50_18688_c1 nmdc:mga0rr50_18688_c1_1786_2160 123
798 3300050513 nmdc:mga0rr50_19205_c1 nmdc:mga0rr50_19205_c1_689_1063 123
799 3300050513 nmdc:mga0rr50_415319_c1 nmdc:mga0rr50_415319_c1_392_766 123
800 3300050513 nmdc:mga0rr50_444332_c1 nmdc:mga0rr50_444332_c1_579_953 123
801 3300050513 nmdc:mga0rr50_631191_c1 nmdc:mga0rr50_631191_c1_490_864 123
802 3300050513 nmdc:mga0rr50_665328_c1 nmdc:mga0rr50_665328_c1_157_531 123
803 3300050514 nmdc:mga08x19_22050_c1 nmdc:mga08x19_22050_c1_1243_1617 123
804 3300050514 nmdc:mga08x19_4283_c1 nmdc:mga08x19_4283_c1_4839_5213 123
805 3300050514 nmdc:mga08x19_438958_c1 nmdc:mga08x19_438958_c1_20_394 123
806 3300050514 nmdc:mga08x19_764035_c1 nmdc:mga08x19_764035_c1_137_511 123
807 3300050514 nmdc:mga08x19_905926_c1 nmdc:mga08x19_905926_c1_202_573 123
808 3300050515 nmdc:mga0a205_11244_c1 nmdc:mga0a205_11244_c1_7189_7560 123
809 3300050515 nmdc:mga0a205_116102_c1 nmdc:mga0a205_116102_c1_1412_1786 123
810 3300050515 nmdc:mga0a205_122_c1 nmdc:mga0a205_122_c1_32832_33206 123
811 3300050515 nmdc:mga0a205_136604_c1 nmdc:mga0a205_136604_c1_504_878 123
812 3300050515 nmdc:mga0a205_32200_c1 nmdc:mga0a205_32200_c1_3766_4140 123
813 3300050515 nmdc:mga0a205_34697_c1 nmdc:mga0a205_34697_c1_2349_2723 123
814 3300050515 nmdc:mga0a205_5999_c1 nmdc:mga0a205_5999_c1_3631_4005 123
815 3300050515 nmdc:mga0a205_66066_c1 nmdc:mga0a205_66066_c1_1433_1807 123
816 3300050515 nmdc:mga0a205_7565_c1 nmdc:mga0a205_7565_c1_1227_1598 123
817 3300050515 nmdc:mga0a205_78167_c1 nmdc:mga0a205_78167_c1_307_678 123
818 3300050515 nmdc:mga0a205_895_c1 nmdc:mga0a205_895_c1_5700_6071 123
819 3300050515 nmdc:mga0a205_94817_c1 nmdc:mga0a205_94817_c1_2242_2616 123
820 3300054114 Ga0501084_0005239 Ga0501084_0005239_6486_6863 123
821 3300054114 Ga0501084_0009827 Ga0501084_0009827_7081_7464 123
822 3300054114 Ga0501084_0012880 Ga0501084_0012880_1258_1629 123
823 3300054114 Ga0501084_0051370 Ga0501084_0051370_1369_1752 123
824 3300054114 Ga0501084_0916731 Ga0501084_0916731_139_519 123
825 3300054114 Ga0501084_0923406 Ga0501084_0923406_314_688 123
826 3300054114 Ga0501084_1107809 Ga0501084_1107809_246_623 123
827 3300059421 Ga0590071_028654 Ga0590071_028654_90_467 123
828 3300060353 Ga0501082_0001321 Ga0501082_0001321_19169_19540 123
829 3300060353 Ga0501082_0008654 Ga0501082_0008654_7566_7943 123
830 3300060353 Ga0501082_0054849 Ga0501082_0054849_1845_2219 123
831 3300060353 Ga0501082_0119655 Ga0501082_0119655_1417_1800 123
832 3300060353 Ga0501082_0412983 Ga0501082_0412983_23_394 123
833 3300060353 Ga0501082_1489311 Ga0501082_1489311_74_448 123
834 3300060353 Ga0501082_1644234 Ga0501082_1644234_32_415 123
835 3300061734 Ga0530510_0032198 Ga0530510_0032198_1856_2233 123
836 3300061734 Ga0530510_0041180 Ga0530510_0041180_103_474 123
837 3300061734 Ga0530510_0059492 Ga0530510_0059492_1142_1513 123
838 3300061734 Ga0530510_0190198 Ga0530510_0190198_1005_1388 123
839 3300061734 Ga0530510_0231881 Ga0530510_0231881_247_630 123
840 3300061734 Ga0530510_0531434 Ga0530510_0531434_198_569 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

33

130

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7487 1 121
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7183 1 121
6cdk-assembly1.cif.gz_A characterization of the p1+ intermediate state of nitrogenase p-cluster 0.5484 1 38
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.5456 2 109
6o7s-assembly1.cif.gz_C nitrogenase mofep mutant s188a from azotobacter vinelandii in the indigo carmine oxidized state 0.5272 2 42
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7442 1 121 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7203 1 121 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6058 1 112 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.5561 1 112 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.5456 2 109 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A2V7XY82-F1-model_v4 Metallopeptidase family protein 0.8201 1 116
AF-A0A2V7XY82-F1-model_v4 Metallopeptidase family protein 0.7961 1 116
AF-A0A536K7L6-F1-model_v4 Metallopeptidase family protein 0.7702 1 114
AF-A0A6B0ZI63-F1-model_v4 Metallopeptidase family protein 0.7634 1 119
AF-A0A318A933-F1-model_v4 Metallopeptidase family protein 0.7587 1 120

Feature Viewer

pLDDT pTM Quality
71.66 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map