F483046

General Info

Members Datasets Scaffolds Average Seq Length
840 438 795 218

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100278133|Ga0068860_1002781332
Length 242
Sequence VDLEKLARSLGCKPNLADWIDMSTFPNSPRLLKGGIVLLDPETAAVRRIISLQYNPDTLTRSLQIQGVSAEGGSGDRSEILRLKGPPVETIKLDAEIDATDQLEFPDQNANAVEVGIHPQLAALEAIVYPSSNQLQSNNALAKSGTLEIIPMQSALTLFIWSKNRIIPVRLTDFSITEEAFDPNLNPIRAKVSLGMRVLSVNDVGFDAKAGSLYMTYQQQKERLAGLAPAGSFANLGIKGIT

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
4 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
5 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
6 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
7 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
8 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
9 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
10 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
11 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
12 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
13 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
14 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
15 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
16 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
17 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
18 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
19 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
20 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
21 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
22 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
23 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
24 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
25 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
26 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
27 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
28 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
29 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
30 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
31 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
32 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
33 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
34 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
35 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
36 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
37 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
38 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
39 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
158 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
229 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
251 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
252 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
253 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
270 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
271 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
275 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
302 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
317 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
333 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
334 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
335 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
339 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
340 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
346 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
351 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
352 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
353 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
357 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
381 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
382 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
383 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
384 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
385 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
386 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
387 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
388 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
389 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
390 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
394 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
397 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
398 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
399 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
402 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
403 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
404 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
405 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
406 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
411 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
414 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
415 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
416 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
419 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
420 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
421 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
422 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
423 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
424 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
429 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
430 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
433 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
434 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
435 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
436 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
437 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
438 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.29
Metatranscriptomes 0.36
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 4.29
Rhizoplane 4.17
Rhizosphere 83.93
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10062575 3300001990 Unclassified 1118
2 JGI25162J39368_1000021 3300002737 Bacteria 248155
3 JGI25162J39368_1000707 3300002737 Bacteria 23218
4 rootL2_10045889 3300003322 Bacteria 14944
5 Ga0065715_10350947 3300005293 Bacteria 935
6 Ga0070658_10024973 3300005327 Bacteria 4792
7 Ga0070676_10001365 3300005328 Bacteria 12295
8 Ga0070676_10275900 3300005328 Bacteria 1131
9 Ga0070683_100005497 3300005329 Bacteria 10585
10 Ga0070683_100244370 3300005329 Unclassified 1707
11 Ga0070670_100019037 3300005331 Bacteria 5887
12 Ga0070670_100453797 3300005331 Unclassified 1136
13 Ga0070680_100007785 3300005336 Bacteria 8166
14 Ga0070680_100029492 3300005336 Bacteria 4407
15 Ga0070680_100249716 3300005336 Bacteria 1500
16 Ga0070682_100005081 3300005337 Bacteria 7315
17 Ga0070682_100021240 3300005337 Unclassified 3827
18 Ga0070682_100052021 3300005337 Unclassified 2562
19 Ga0070682_100118182 3300005337 Bacteria 1776
20 Ga0068868_100000525 3300005338 Bacteria 25646
21 Ga0068868_100690047 3300005338 Bacteria 913
22 Ga0070660_100004581 3300005339 Bacteria 9554
23 Ga0070660_100032659 3300005339 Bacteria 3919
24 Ga0070660_100896162 3300005339 Unclassified 748
25 Ga0070661_100025467 3300005344 Bacteria 4252
26 Ga0070661_100026941 3300005344 Bacteria 4137
27 Ga0070668_100001796 3300005347 Bacteria 15603
28 Ga0070669_100082448 3300005353 Unclassified 2397
29 Ga0070675_100001838 3300005354 Bacteria 15687
30 Ga0070675_100021607 3300005354 Bacteria 5142
31 Ga0070675_100030163 3300005354 Bacteria 4376
32 Ga0070675_100033989 3300005354 Bacteria 4136
33 Ga0070675_100095108 3300005354 Bacteria 2501
34 Ga0070675_100664971 3300005354 Bacteria 947
35 Ga0070671_100128317 3300005355 Bacteria 2135
36 Ga0070671_100372922 3300005355 Unclassified 1219
37 Ga0070674_100039663 3300005356 Bacteria 3181
38 Ga0070674_100051574 3300005356 Unclassified 2836
39 Ga0070673_100072012 3300005364 Bacteria 2778
40 Ga0070673_100111521 3300005364 Unclassified 2269
41 Ga0070688_100005618 3300005365 Bacteria 6617
42 Ga0070688_100041178 3300005365 Bacteria 2834
43 Ga0070688_100086340 3300005365 Bacteria 2041
44 Ga0070659_100017169 3300005366 Bacteria 5440
45 Ga0070659_100020312 3300005366 Bacteria 5044
46 Ga0070659_100429742 3300005366 Bacteria 1118
47 Ga0070667_100281844 3300005367 Unclassified 1492
48 Ga0070703_10000028 3300005406 Bacteria 70844
49 Ga0070709_10001310 3300005434 Bacteria 13561
50 Ga0070709_10047141 3300005434 Bacteria 2683
51 Ga0070714_100073232 3300005435 Bacteria 2968
52 Ga0070714_100100534 3300005435 Bacteria 2547
53 Ga0070714_100354589 3300005435 Bacteria 1378
54 Ga0070713_100009503 3300005436 Bacteria 6966
55 Ga0070713_100011411 3300005436 Bacteria 6472
56 Ga0070713_100016390 3300005436 Bacteria 5571
57 Ga0070713_100334351 3300005436 Bacteria 1402
58 Ga0070710_10037147 3300005437 Bacteria 2667
59 Ga0070711_100061942 3300005439 Bacteria 2606
60 Ga0070711_100331230 3300005439 Bacteria 1219
61 Ga0070700_100026559 3300005441 Bacteria 3421
62 Ga0070694_100141269 3300005444 Unclassified 1749
63 Ga0070708_100001158 3300005445 Bacteria 20294
64 Ga0070708_100033795 3300005445 Bacteria 4444
65 Ga0070663_100060139 3300005455 Unclassified 2732
66 Ga0070663_100099150 3300005455 Bacteria 2171
67 Ga0070678_100093752 3300005456 Bacteria 2309
68 Ga0070662_100039407 3300005457 Unclassified 3360
69 Ga0070662_100139938 3300005457 Unclassified 1874
70 Ga0070681_10014527 3300005458 Bacteria 7836
71 Ga0070681_10601079 3300005458 Bacteria 1014
72 Ga0068867_100062849 3300005459 Bacteria 2759
73 Ga0068867_100619731 3300005459 Bacteria 946
74 Ga0070685_10023921 3300005466 Unclassified 3350
75 Ga0070685_10256918 3300005466 Bacteria 1160
76 Ga0070706_100000054 3300005467 Bacteria 138243
77 Ga0070706_100002050 3300005467 Bacteria 20660
78 Ga0070706_100010342 3300005467 Bacteria 8668
79 Ga0070706_100106436 3300005467 Unclassified 2609
80 Ga0070706_100242415 3300005467 Unclassified 1683
81 Ga0070706_100632978 3300005467 Unclassified 993
82 Ga0070707_100000239 3300005468 Bacteria 54793
83 Ga0070707_100216115 3300005468 Bacteria 1868
84 Ga0070707_100854076 3300005468 Bacteria 874
85 Ga0070698_100044407 3300005471 Bacteria 4551
86 Ga0070698_100477253 3300005471 Unclassified 1184
87 Ga0070698_100723730 3300005471 Bacteria 938
88 Ga0070699_100000537 3300005518 Bacteria 35816
89 Ga0070699_100268587 3300005518 Bacteria 1526
90 Ga0070699_100837631 3300005518 Bacteria 842
91 Ga0070699_100905235 3300005518 Bacteria 808
92 Ga0070679_100002001 3300005530 Bacteria 18303
93 Ga0070679_100093100 3300005530 Bacteria 3001
94 Ga0070679_100097836 3300005530 Bacteria 2922
95 Ga0070679_100110006 3300005530 Unclassified 2742
96 Ga0070684_100172892 3300005535 Unclassified 1962
97 Ga0070684_100259545 3300005535 Bacteria 1589
98 Ga0070684_100369344 3300005535 Bacteria 1321
99 Ga0070684_100864457 3300005535 Unclassified 847
100 Ga0070697_100082945 3300005536 Bacteria 2643
101 Ga0070697_100485789 3300005536 Unclassified 1079
102 Ga0068853_100000009 3300005539 Bacteria 257819
103 Ga0068853_100012548 3300005539 Bacteria 6893
104 Ga0068853_100105098 3300005539 Unclassified 2501
105 Ga0068853_100202288 3300005539 Bacteria 1808
106 Ga0068853_100420619 3300005539 Bacteria 1253
107 Ga0068853_100630553 3300005539 Unclassified 1019
108 Ga0070672_100024811 3300005543 Bacteria 4438
109 Ga0070672_100160954 3300005543 Bacteria 1862
110 Ga0070695_100044466 3300005545 Bacteria 2828
111 Ga0070695_100190549 3300005545 Unclassified 1459
112 Ga0070696_100005655 3300005546 Bacteria 8354
113 Ga0070696_100013767 3300005546 Bacteria 5432
114 Ga0070696_100081829 3300005546 Bacteria 2288
115 Ga0070693_100096813 3300005547 Bacteria 1790
116 Ga0070665_100090139 3300005548 Bacteria 3072
117 Ga0070704_100012085 3300005549 Bacteria 5323
118 Ga0070704_100105819 3300005549 Bacteria 2131
119 Ga0068855_100051207 3300005563 Bacteria 4864
120 Ga0068855_100130656 3300005563 Bacteria 2868
121 Ga0068855_100175622 3300005563 Unclassified 2424
122 Ga0068855_100444100 3300005563 Bacteria 1416
123 Ga0068855_100615990 3300005563 Bacteria 1169
124 Ga0070664_100010698 3300005564 Bacteria 7440
125 Ga0070664_100047406 3300005564 Bacteria 3630
126 Ga0070664_100065958 3300005564 Bacteria 3090
127 Ga0070664_100083669 3300005564 Bacteria 2753
128 Ga0068857_100019637 3300005577 Bacteria 5937
129 Ga0068857_100328970 3300005577 Unclassified 1412
130 Ga0068857_100665212 3300005577 Bacteria 988
131 Ga0068854_100759538 3300005578 Bacteria 842
132 Ga0068856_100067066 3300005614 Bacteria 3546
133 Ga0068856_100159430 3300005614 Bacteria 2266
134 Ga0070702_100176784 3300005615 Bacteria 1393
135 Ga0068852_100301393 3300005616 Bacteria 1551
136 Ga0068852_100321810 3300005616 Bacteria 1502
137 Ga0068852_100717822 3300005616 Bacteria 1010
138 Ga0068859_100004794 3300005617 Bacteria 13765
139 Ga0068859_101066579 3300005617 Bacteria 888
140 Ga0068864_100003643 3300005618 Bacteria 12736
141 Ga0068864_100008166 3300005618 Bacteria 8632
142 Ga0068864_100019477 3300005618 Bacteria 5674
143 Ga0068864_100750907 3300005618 Bacteria 956
144 Ga0068861_100227085 3300005719 Unclassified 1581
145 Ga0068851_10081585 3300005834 Bacteria 1690
146 Ga0068870_10018510 3300005840 Bacteria 3365
147 Ga0068870_10318004 3300005840 Bacteria 988
148 Ga0068863_100015093 3300005841 Bacteria 7421
149 Ga0068863_100393604 3300005841 Bacteria 1354
150 Ga0068858_100134901 3300005842 Bacteria 2316
151 Ga0068858_100240978 3300005842 Bacteria 1716
152 Ga0068858_100875001 3300005842 Unclassified 878
153 Ga0068860_100014481 3300005843 Bacteria 7721
154 Ga0068860_100278133 3300005843 Unclassified 1635
155 Ga0068862_100582241 3300005844 Unclassified 1072
156 Ga0081455_10004441 3300005937 Bacteria 15739
157 Ga0081455_10026936 3300005937 Bacteria 5275
158 Ga0081455_10155696 3300005937 Unclassified 1757
159 Ga0081540_1002973 3300005983 Bacteria 13591
160 Ga0081539_10003337 3300005985 Bacteria 19955
161 Ga0070717_10008698 3300006028 Bacteria 7595
162 Ga0070717_10011578 3300006028 Bacteria 6705
163 Ga0070717_10059834 3300006028 Bacteria 3153
164 Ga0070717_10205125 3300006028 Bacteria 1728
165 Ga0070717_10205568 3300006028 Bacteria 1726
166 Ga0075365_10205618 3300006038 Bacteria 1380
167 Ga0070712_100021750 3300006175 Bacteria 4217
168 Ga0070712_100313185 3300006175 Unclassified 1274
169 Ga0070712_100403787 3300006175 Bacteria 1129
170 Ga0070712_100569754 3300006175 Unclassified 956
171 Ga0075367_10063345 3300006178 Unclassified 2210
172 Ga0097621_100997034 3300006237 Unclassified 783
173 Ga0068871_100289320 3300006358 Bacteria 1435
174 Ga0068871_100393601 3300006358 Unclassified 1233
175 Ga0075428_100007087 3300006844 Bacteria 12418
176 Ga0075430_100044508 3300006846 Bacteria 3753
177 Ga0075431_100003851 3300006847 Bacteria 14593
178 Ga0075431_100159389 3300006847 Bacteria 2321
179 Ga0075433_10078796 3300006852 Bacteria 2903
180 Ga0075434_100082850 3300006871 Bacteria 3205
181 Ga0075434_100996338 3300006871 Unclassified 852
182 Ga0075429_100011488 3300006880 Bacteria 7678
183 Ga0075429_100133962 3300006880 Bacteria 2168
184 Ga0075429_100184828 3300006880 Bacteria 1826
185 Ga0075429_100230223 3300006880 Unclassified 1623
186 Ga0075429_100773110 3300006880 Bacteria 841
187 Ga0068865_100872312 3300006881 Bacteria 781
188 Ga0075436_100000966 3300006914 Bacteria 19290
189 Ga0075436_100222643 3300006914 Bacteria 1339
190 Ga0097620_100004794 3300006931 Bacteria 13765
191 Ga0097620_101066624 3300006931 Bacteria 888
192 Ga0075435_100002824 3300007076 Bacteria 11624
193 Ga0105240_10000649 3300009093 Bacteria 64145
194 Ga0105240_10296091 3300009093 Bacteria 1853
195 Ga0105240_10462672 3300009093 Bacteria 1417
196 Ga0105240_11077015 3300009093 Bacteria 856
197 Ga0105240_11105534 3300009093 Bacteria 843
198 Ga0111539_10080785 3300009094 Bacteria 3824
199 Ga0111539_10171353 3300009094 Bacteria 2536
200 Ga0111539_10195393 3300009094 Bacteria 2360
201 Ga0111539_10682201 3300009094 Bacteria 1196
202 Ga0111539_11271653 3300009094 Bacteria 854
203 Ga0105245_10095366 3300009098 Bacteria 2745
204 Ga0105247_10653800 3300009101 Bacteria 786
205 Ga0114129_10000891 3300009147 Bacteria 38929
206 Ga0114129_10000925 3300009147 Bacteria 38300
207 Ga0114129_10040003 3300009147 Bacteria 6613
208 Ga0114129_10054512 3300009147 Bacteria 5605
209 Ga0114129_10064851 3300009147 Bacteria 5098
210 Ga0114129_10882256 3300009147 Bacteria 1135
211 Ga0105241_10000325 3300009174 Bacteria 36012
212 Ga0105241_10220137 3300009174 Bacteria 1595
213 Ga0105242_10195875 3300009176 Bacteria 1792
214 Ga0105248_10107692 3300009177 Bacteria 3143
215 Ga0105237_10025607 3300009545 Bacteria 6030
216 Ga0105237_10045862 3300009545 Bacteria 4398
217 Ga0105238_10000947 3300009551 Bacteria 29742
218 Ga0105238_10133817 3300009551 Bacteria 2457
219 Ga0105238_10345425 3300009551 Bacteria 1477
220 Ga0105249_10003319 3300009553 Bacteria 13938
221 Ga0105249_10034979 3300009553 Unclassified 4554
222 Ga0105239_10017597 3300010375 Bacteria 7904
223 Ga0105239_10031131 3300010375 Bacteria 5870
224 Ga0105239_10042919 3300010375 Bacteria 4955
225 Ga0105239_10075202 3300010375 Unclassified 3713
226 Ga0105239_10384936 3300010375 Bacteria 1586
227 Ga0157373_10021393 3300013100 Bacteria 4699
228 Ga0157371_10091760 3300013102 Bacteria 2151
229 Ga0157370_10032254 3300013104 Bacteria 5116
230 Ga0157369_10065706 3300013105 Bacteria 3904
231 Ga0157369_10101650 3300013105 Bacteria 3063
232 Ga0157369_10136893 3300013105 Unclassified 2592
233 Ga0157369_10347081 3300013105 Unclassified 1542
234 Ga0157369_10763249 3300013105 Bacteria 994
235 Ga0157374_10222083 3300013296 Bacteria 1854
236 Ga0157374_10874867 3300013296 Bacteria 916
237 Ga0157378_10081961 3300013297 Bacteria 2917
238 Ga0157378_10816576 3300013297 Bacteria 959
239 Ga0163162_10011067 3300013306 Bacteria 8789
240 Ga0163162_10039284 3300013306 Unclassified 4728
241 Ga0163162_10085424 3300013306 Bacteria 3232
242 Ga0163162_10470983 3300013306 Unclassified 1388
243 Ga0157372_10025291 3300013307 Bacteria 6453
244 Ga0157372_10034586 3300013307 Bacteria 5556
245 Ga0157372_10093746 3300013307 Bacteria 3418
246 Ga0157372_10122700 3300013307 Bacteria 2986
247 Ga0157372_10242030 3300013307 Unclassified 2093
248 Ga0157372_10339840 3300013307 Bacteria 1749
249 Ga0157375_10025565 3300013308 Bacteria 5489
250 Ga0157375_10037268 3300013308 Bacteria 4658
251 Ga0157375_10093753 3300013308 Bacteria 3069
252 Ga0157375_10109113 3300013308 Bacteria 2863
253 Ga0157375_10171421 3300013308 Unclassified 2318
254 Ga0157375_10597604 3300013308 Bacteria 1263
255 Ga0157375_10640911 3300013308 Unclassified 1219
256 Ga0163163_10010087 3300014325 Bacteria 8474
257 Ga0163163_10054362 3300014325 Bacteria 3956
258 Ga0163163_10204127 3300014325 Bacteria 2025
259 Ga0163163_10215476 3300014325 Unclassified 1969
260 Ga0163163_10395448 3300014325 Bacteria 1440
261 Ga0163163_10532846 3300014325 Bacteria 1237
262 Ga0157380_10008561 3300014326 Bacteria 7314
263 Ga0157380_10087328 3300014326 Bacteria 2564
264 Ga0157380_10184688 3300014326 Unclassified 1835
265 Ga0157380_10808738 3300014326 Bacteria 955
266 Ga0157380_11124458 3300014326 Bacteria 826
267 Ga0182008_10193236 3300014497 Bacteria 1033
268 Ga0157377_10000198 3300014745 Bacteria 33472
269 Ga0157377_10636794 3300014745 Bacteria 765
270 Ga0157379_10508429 3300014968 Bacteria 1117
271 Ga0157379_10710492 3300014968 Unclassified 944
272 Ga0157379_10769308 3300014968 Unclassified 907
273 Ga0157376_10076551 3300014969 Bacteria 2859
274 Ga0157376_10093323 3300014969 Bacteria 2612
275 Ga0157376_10339400 3300014969 Bacteria 1434
276 Ga0157376_10409255 3300014969 Unclassified 1313
277 Ga0157376_10501507 3300014969 Bacteria 1193
278 Ga0163161_10005882 3300017792 Bacteria 8509
279 Ga0163161_10018771 3300017792 Bacteria 4847
280 Ga0206356_10545819 3300020070 Bacteria 2102
281 Ga0206353_11476788 3300020082 Bacteria 1154
282 Ga0213876_10000383 3300021384 Bacteria 37442
283 Ga0213876_10004391 3300021384 Bacteria 7902
284 Ga0213875_10132095 3300021388 Bacteria 1167
285 Ga0209025_1055119 3300025294 Bacteria 1540
286 Ga0207697_10004662 3300025315 Bacteria 6501
287 Ga0207656_10114125 3300025321 Bacteria 1252
288 Ga0207653_10000047 3300025885 Bacteria 91340
289 Ga0207682_10001298 3300025893 Bacteria 11470
290 Ga0207682_10024997 3300025893 Unclassified 2367
291 Ga0207692_10004054 3300025898 Bacteria 5773
292 Ga0207692_10083783 3300025898 Unclassified 1712
293 Ga0207680_10064063 3300025903 Bacteria 2252
294 Ga0207647_10074137 3300025904 Unclassified 2050
295 Ga0207699_10000924 3300025906 Bacteria 14028
296 Ga0207699_10328238 3300025906 Bacteria 1075
297 Ga0207645_10004181 3300025907 Bacteria 10718
298 Ga0207643_10005051 3300025908 Bacteria 7065
299 Ga0207684_10011572 3300025910 Bacteria 7711
300 Ga0207684_10059014 3300025910 Bacteria 3257
301 Ga0207684_10072307 3300025910 Unclassified 2929
302 Ga0207654_10009511 3300025911 Bacteria 4938
303 Ga0207654_10426063 3300025911 Bacteria 927
304 Ga0207707_10095347 3300025912 Bacteria 2600
305 Ga0207707_10134888 3300025912 Unclassified 2158
306 Ga0207695_10000795 3300025913 Bacteria 59172
307 Ga0207695_10965234 3300025913 Bacteria 732
308 Ga0207671_10002410 3300025914 Bacteria 20048
309 Ga0207671_10175540 3300025914 Bacteria 1665
310 Ga0207693_10036250 3300025915 Bacteria 3888
311 Ga0207693_10049856 3300025915 Bacteria 3287
312 Ga0207693_10264481 3300025915 Unclassified 1348
313 Ga0207663_10132285 3300025916 Unclassified 1725
314 Ga0207660_10002229 3300025917 Bacteria 12819
315 Ga0207660_10056576 3300025917 Bacteria 2807
316 Ga0207660_10159362 3300025917 Unclassified 1740
317 Ga0207657_10000952 3300025919 Bacteria 30667
318 Ga0207657_10166766 3300025919 Unclassified 1786
319 Ga0207649_10010144 3300025920 Bacteria 5170
320 Ga0207649_10065106 3300025920 Bacteria 2306
321 Ga0207652_10011404 3300025921 Bacteria 7165
322 Ga0207652_10026809 3300025921 Bacteria 4802
323 Ga0207652_10059128 3300025921 Bacteria 3304
324 Ga0207646_10000397 3300025922 Bacteria 58349
325 Ga0207646_10270890 3300025922 Bacteria 1535
326 Ga0207681_10018639 3300025923 Viruses 4375
327 Ga0207694_10021828 3300025924 Unclassified 4853
328 Ga0207694_10091917 3300025924 Bacteria 2395
329 Ga0207650_10022802 3300025925 Bacteria 4435
330 Ga0207650_10517500 3300025925 Unclassified 998
331 Ga0207659_10007179 3300025926 Bacteria 6840
332 Ga0207659_10141430 3300025926 Bacteria 1868
333 Ga0207687_10060541 3300025927 Bacteria 2671
334 Ga0207700_10007343 3300025928 Bacteria 6730
335 Ga0207700_10150685 3300025928 Bacteria 1921
336 Ga0207700_10334297 3300025928 Bacteria 1315
337 Ga0207664_10311654 3300025929 Bacteria 1387
338 Ga0207664_10419122 3300025929 Unclassified 1192
339 Ga0207690_10083797 3300025932 Unclassified 2233
340 Ga0207706_10066354 3300025933 Bacteria 3176
341 Ga0207706_10176820 3300025933 Unclassified 1875
342 Ga0207670_10100594 3300025936 Unclassified 2064
343 Ga0207670_10428244 3300025936 Bacteria 1063
344 Ga0207704_10048407 3300025938 Bacteria 2548
345 Ga0207665_10002211 3300025939 Bacteria 13127
346 Ga0207665_10005339 3300025939 Bacteria 8586
347 Ga0207691_10000806 3300025940 Bacteria 31170
348 Ga0207691_10004233 3300025940 Bacteria 13940
349 Ga0207691_10034784 3300025940 Bacteria 4682
350 Ga0207661_10001181 3300025944 Bacteria 17466
351 Ga0207661_10485137 3300025944 Bacteria 1128
352 Ga0207661_10564060 3300025944 Bacteria 1044
353 Ga0207679_10030001 3300025945 Bacteria 3793
354 Ga0207679_10316602 3300025945 Bacteria 1350
355 Ga0207679_10544435 3300025945 Bacteria 1041
356 Ga0207667_10136611 3300025949 Unclassified 2525
357 Ga0207667_10286284 3300025949 Bacteria 1684
358 Ga0207667_10303000 3300025949 Bacteria 1633
359 Ga0207667_10959175 3300025949 Bacteria 844
360 Ga0207651_10149598 3300025960 Bacteria 1815
361 Ga0207651_10302062 3300025960 Unclassified 1331
362 Ga0207712_10052093 3300025961 Bacteria 2866
363 Ga0207712_10064913 3300025961 Unclassified 2604
364 Ga0207640_10705191 3300025981 Bacteria 866
365 Ga0207677_10000069 3300026023 Bacteria 85177
366 Ga0207677_10593620 3300026023 Bacteria 971
367 Ga0207677_10630757 3300026023 Bacteria 944
368 Ga0207639_10000004 3300026041 Bacteria 698784
369 Ga0207639_10081121 3300026041 Unclassified 2568
370 Ga0207639_10124739 3300026041 Bacteria 2122
371 Ga0207639_10321162 3300026041 Bacteria 1375
372 Ga0207678_10012175 3300026067 Bacteria 7557
373 Ga0207678_10028291 3300026067 Bacteria 4894
374 Ga0207678_10053897 3300026067 Bacteria 3464
375 Ga0207708_10078508 3300026075 Bacteria 2535
376 Ga0207708_10088900 3300026075 Bacteria 2380
377 Ga0207708_10109542 3300026075 Bacteria 2143
378 Ga0207702_10149078 3300026078 Bacteria 2126
379 Ga0207702_10390112 3300026078 Bacteria 1341
380 Ga0207702_10686070 3300026078 Unclassified 1009
381 Ga0207641_10011898 3300026088 Bacteria 7138
382 Ga0207648_10021824 3300026089 Bacteria 5752
383 Ga0207648_10160525 3300026089 Bacteria 1985
384 Ga0207648_10194499 3300026089 Bacteria 1798
385 Ga0207676_10039788 3300026095 Bacteria 3599
386 Ga0207676_10084603 3300026095 Unclassified 2586
387 Ga0207676_10112522 3300026095 Bacteria 2280
388 Ga0207674_10000851 3300026116 Bacteria 39823
389 Ga0207674_10095916 3300026116 Bacteria 2951
390 Ga0207683_10000378 3300026121 Bacteria 41000
391 Ga0207683_10035444 3300026121 Bacteria 4340
392 Ga0207698_10688074 3300026142 Bacteria 1016
393 Ga0207698_10693218 3300026142 Bacteria 1013
394 Ga0207428_10086831 3300027907 Bacteria 2434
395 Ga0268265_10169113 3300028380 Bacteria 1866
396 Ga0268264_10012641 3300028381 Bacteria 6951
397 Ga0268264_10176766 3300028381 Unclassified 1935
398 Ga0268264_10332964 3300028381 Bacteria 1439
399 Ga0265337_1000316 3300028556 Bacteria 25715
400 Ga0265334_10033751 3300028573 Bacteria 2034
401 Ga0307517_10165301 3300028786 Bacteria 1472
402 Ga0265338_10007992 3300028800 Bacteria 12946
403 Ga0265338_10039682 3300028800 Bacteria 4437
404 Ga0265773_1007486 3300031018 Bacteria 853
405 Ga0265328_10000019 3300031239 Bacteria 130536
406 Ga0265325_10068349 3300031241 Bacteria 1788
407 Ga0265325_10074036 3300031241 Bacteria 1704
408 Ga0265339_10025010 3300031249 Bacteria 3434
409 Ga0265331_10002224 3300031250 Bacteria 13297
410 Ga0265327_10000035 3300031251 Bacteria 314419
411 Ga0265316_10078942 3300031344 Bacteria 2526
412 Ga0307513_10054120 3300031456 Bacteria 4306
413 Ga0307513_10357936 3300031456 Bacteria 1205
414 Ga0307509_10385900 3300031507 Bacteria 1112
415 Ga0307408_100076296 3300031548 Unclassified 2493
416 Ga0307508_10000021 3300031616 Bacteria 183823
417 Ga0307508_10023815 3300031616 Bacteria 5559
418 Ga0316579_10046638 3300031691 Bacteria 2022
419 Ga0265314_10018880 3300031711 Bacteria 5354
420 Ga0316576_10346823 3300031727 Bacteria 1105
421 Ga0307516_10003536 3300031730 Bacteria 19989
422 Ga0307405_10044543 3300031731 Bacteria 2714
423 Ga0307413_10033250 3300031824 Bacteria 2934
424 Ga0307413_10036587 3300031824 Bacteria 2827
425 Ga0307410_10005296 3300031852 Bacteria 6809
426 Ga0307410_10096610 3300031852 Bacteria 2109
427 Ga0307410_10391882 3300031852 Bacteria 1120
428 Ga0307406_10073512 3300031901 Unclassified 2248
429 Ga0307406_10453210 3300031901 Bacteria 1030
430 Ga0307409_100002953 3300031995 Bacteria 9051
431 Ga0307409_100013091 3300031995 Bacteria 5320
432 Ga0307416_100009450 3300032002 Bacteria 6384
433 Ga0307416_100038876 3300032002 Bacteria 3676
434 Ga0307416_100549217 3300032002 Bacteria 1228
435 Ga0307411_10096171 3300032005 Bacteria 2081
436 Ga0307415_100058672 3300032126 Bacteria 2650
437 Ga0307415_100602262 3300032126 Unclassified 978
438 Ga0307510_10014932 3300033180 Bacteria 9185
439 Ga0373926_0002060 3300035083 Bacteria 6330
440 Ga0373944_0059718 3300035089 Bacteria 1220
441 Ga0373923_0003042 3300035111 Bacteria 5302
442 Ga0373936_0002263 3300035113 Bacteria 7195
443 Ga0373936_0079469 3300035113 Bacteria 1363
444 Ga0373939_0110974 3300035114 Bacteria 955
445 Ga0373945_0019842 3300035116 Bacteria 2296
446 Ga0373954_0006708 3300035118 Bacteria 5021
447 Ga0373956_0181699 3300035119 Unclassified 994
448 Ga0373943_0001215 3300035170 Bacteria 11520
449 Ga0373943_0036590 3300035170 Bacteria 2351
450 Ga0373946_0010546 3300035171 Bacteria 3422
451 Ga0373955_0000030 3300035172 Bacteria 56889
452 Ga0373955_0270189 3300035172 Unclassified 1022
453 Ga0373961_0199730 3300035241 Unclassified 705
454 Ga0373924_0001737 3300035410 Bacteria 7193
455 Ga0373931_0184243 3300035691 Bacteria 1238
456 Ga0373935_0000187 3300035692 Bacteria 29255
457 Ga0373935_0004307 3300035692 Bacteria 8349
458 Ga0373935_0029694 3300035692 Bacteria 3384
459 Ga0373935_0470381 3300035692 Bacteria 910
460 Ga0373927_0005916 3300035695 Bacteria 8379
461 Ga0373927_0008772 3300035695 Bacteria 6794
462 Ga0373927_0157142 3300035695 Bacteria 1489
463 Ga0373933_0004479 3300035724 Bacteria 7662
464 Ga0373933_0419084 3300035724 Unclassified 874
465 Ga0373947_0000734 3300035725 Bacteria 19621
466 Ga0373947_0005433 3300035725 Bacteria 7437
467 Ga0373947_0009514 3300035725 Bacteria 5582
468 Ga0373937_0000004 3300036401 Bacteria 212269
469 Ga0373937_0004880 3300036401 Bacteria 11404
470 Ga0373937_0036285 3300036401 Unclassified 4492
471 Ga0373937_0052754 3300036401 Bacteria 3730
472 Ga0373937_0346310 3300036401 Bacteria 1407
473 Ga0373937_0690841 3300036401 Bacteria 967
474 Ga0316582_0009233 3300036647 Bacteria 5342
475 Ga0373925_0000095 3300037068 Bacteria 95071
476 Ga0373925_0001070 3300037068 Bacteria 24705
477 Ga0373925_0081895 3300037068 Bacteria 2455
478 Ga0373925_0470317 3300037068 Bacteria 1031
479 Ga0395899_0355401 3300037312 Bacteria 979
480 Ga0395898_0590991 3300037466 Bacteria 1053
481 Ga0395905_0269750 3300037471 Bacteria 1588
482 Ga0395905_0574021 3300037471 Bacteria 1029
483 Ga0316581_0002336 3300037588 Bacteria 4513
484 Ga0436364_0499655 3300037853 Bacteria 1706
485 Ga0395901_0000076 3300038443 Bacteria 138169
486 Ga0237819_00071 3300038705 Bacteria 36005
487 Ga0436365_0085465 3300039437 Bacteria 1621
488 Ga0436365_0153842 3300039437 Bacteria 46672
489 Ga0436365_1820314 3300039437 Bacteria 36693
490 Ga0436360_0959870 3300039438 Bacteria 1344
491 Ga0436360_1332558 3300039438 Bacteria 2031
492 Ga0436361_0153732 3300039447 Bacteria 1908
493 Ga0436361_0958498 3300039447 Unclassified 1513
494 Ga0436361_1037273 3300039447 Unclassified 919
495 Ga0436361_1146288 3300039447 Bacteria 2472
496 Ga0436363_0414782 3300039450 Bacteria 2382
497 Ga0436363_0774788 3300039450 Bacteria 1174
498 Ga0436363_1105616 3300039450 Bacteria 2108
499 Ga0439431_0010386 3300041997 Unclassified 2113
500 Ga0451577_0000083 3300042876 Bacteria 213999
501 Ga0451577_0144288 3300042876 Unclassified 2140
502 Ga0466963_0046998 3300044694 Bacteria 2848
503 Ga0466963_0366653 3300044694 Bacteria 1015
504 Ga0453684_0000533 3300044712 Bacteria 144782
505 Ga0451576_0174216 3300045051 Bacteria 2246
506 Ga0451576_0299369 3300045051 Bacteria 1682
507 Ga0451576_1050832 3300045051 Bacteria 853
508 Ga0466958_0001808 3300045836 Bacteria 10375
509 Ga0466967_0077551 3300045976 Bacteria 2991
510 Ga0495592_0000029 3300046454 Bacteria 131879
511 Ga0495592_0018005 3300046454 Bacteria 5366
512 Ga0495590_0093070 3300046457 Bacteria 1067
513 Ga0495629_0012580 3300046459 Bacteria 6127
514 Ga0495638_0000076 3300046460 Bacteria 158799
515 Ga0495638_0000093 3300046460 Bacteria 142356
516 Ga0495651_0000535 3300046462 Bacteria 29302
517 Ga0495651_0000635 3300046462 Bacteria 27101
518 Ga0495651_0001166 3300046462 Bacteria 20292
519 Ga0495651_0301747 3300046462 Unclassified 1074
520 Ga0495651_0331137 3300046462 Unclassified 1012
521 Ga0495653_0000045 3300046463 Bacteria 115410
522 Ga0495653_0008119 3300046463 Bacteria 8596
523 Ga0495653_0140190 3300046463 Unclassified 1702
524 Ga0495580_0005390 3300046472 Bacteria 10583
525 Ga0495580_0013306 3300046472 Bacteria 6286
526 Ga0495580_0417276 3300046472 Bacteria 903
527 Ga0495582_0000096 3300046473 Bacteria 44984
528 Ga0495582_0351190 3300046473 Unclassified 849
529 Ga0495605_0020081 3300046474 Bacteria 3554
530 Ga0495605_0060984 3300046474 Bacteria 1806
531 Ga0495639_0021847 3300046475 Bacteria 2804
532 Ga0495639_0027532 3300046475 Bacteria 2517
533 Ga0495639_0192195 3300046475 Bacteria 997
534 Ga0495662_0000642 3300046476 Bacteria 16356
535 Ga0495662_0103054 3300046476 Bacteria 1396
536 Ga0495664_0000004 3300046477 Bacteria 489411
537 Ga0495664_0029368 3300046477 Bacteria 3215
538 Ga0495585_0008481 3300046492 Bacteria 6227
539 Ga0495594_0172197 3300046499 Bacteria 1232
540 Ga0495583_0209232 3300046506 Bacteria 791
541 Ga0495606_0117698 3300046507 Bacteria 1594
542 Ga0495608_0000017 3300046511 Bacteria 192929
543 Ga0495608_0017056 3300046511 Bacteria 5026
544 Ga0495608_0212324 3300046511 Unclassified 1216
545 Ga0495610_0000763 3300046512 Bacteria 30361
546 Ga0495610_0084346 3300046512 Bacteria 1452
547 Ga0495616_0012057 3300046513 Bacteria 4921
548 Ga0495618_0000006 3300046514 Bacteria 229906
549 Ga0495618_0049977 3300046514 Bacteria 2641
550 Ga0495628_0000001 3300046516 Bacteria 917742
551 Ga0495628_0006115 3300046516 Bacteria 10528
552 Ga0495628_0023403 3300046516 Bacteria 5070
553 Ga0495630_0000303 3300046517 Bacteria 39488
554 Ga0495630_0027825 3300046517 Bacteria 4199
555 Ga0495630_0382790 3300046517 Bacteria 1078
556 Ga0495631_0000006 3300046518 Bacteria 132262
557 Ga0495631_0012249 3300046518 Bacteria 4197
558 Ga0495648_0033095 3300046524 Bacteria 3382
559 Ga0495666_0069160 3300046526 Bacteria 1680
560 Ga0495642_0061689 3300046528 Bacteria 1556
561 Ga0495652_0000002 3300046529 Bacteria 946606
562 Ga0495652_0005576 3300046529 Bacteria 11833
563 Ga0495652_0011733 3300046529 Bacteria 7915
564 Ga0495652_0151369 3300046529 Unclassified 1812
565 Ga0495652_0225505 3300046529 Unclassified 1405
566 Ga0495665_0000675 3300046531 Bacteria 17472
567 Ga0495640_0000001 3300046533 Bacteria 853827
568 Ga0495640_0098536 3300046533 Bacteria 1921
569 Ga0495586_0028194 3300046535 Bacteria 3006
570 Ga0495586_0069142 3300046535 Bacteria 1927
571 Ga0495587_0000008 3300046536 Bacteria 271097
572 Ga0495587_0007996 3300046536 Bacteria 6828
573 Ga0495587_0017423 3300046536 Bacteria 4463
574 Ga0495587_0115598 3300046536 Unclassified 1539
575 Ga0495645_0000002 3300046543 Bacteria 651644
576 Ga0495645_0001774 3300046543 Bacteria 14693
577 Ga0495645_0002759 3300046543 Bacteria 11939
578 Ga0495622_0011086 3300046557 Bacteria 4161
579 Ga0495622_0139296 3300046557 Bacteria 1102
580 Ga0495667_0000029 3300046559 Bacteria 151568
581 Ga0495667_0015240 3300046559 Bacteria 5190
582 Ga0495667_0026972 3300046559 Bacteria 3872
583 Ga0495668_0009692 3300046616 Bacteria 5887
584 Ga0495634_0000082 3300046642 Bacteria 74301
585 Ga0495634_0016509 3300046642 Bacteria 5280
586 Ga0495634_0208645 3300046642 Bacteria 1210
587 Ga0495611_0105865 3300046648 Bacteria 1308
588 Ga0495625_0029935 3300046660 Bacteria 4066
589 Ga0495635_0000002 3300046663 Bacteria 490490
590 Ga0495635_0005110 3300046663 Bacteria 9127
591 Ga0495635_0035407 3300046663 Bacteria 3461
592 Ga0495659_0091207 3300046664 Unclassified 1170
593 Ga0495588_0060542 3300046674 Bacteria 1960
594 Ga0495657_0000064 3300046675 Bacteria 94324
595 Ga0495657_0000420 3300046675 Bacteria 39523
596 Ga0495657_0129921 3300046675 Unclassified 1579
597 Ga0495599_0000064 3300046678 Bacteria 73422
598 Ga0495599_0010608 3300046678 Bacteria 5639
599 Ga0495599_0058878 3300046678 Bacteria 2403
600 Ga0495623_0000065 3300046679 Bacteria 65151
601 Ga0495623_0006958 3300046679 Bacteria 7351
602 Ga0495623_0037179 3300046679 Bacteria 3117
603 Ga0495623_0037915 3300046679 Unclassified 3082
604 Ga0495646_0000023 3300046680 Bacteria 110212
605 Ga0495646_0097833 3300046680 Bacteria 1686
606 Ga0495658_0021276 3300046683 Bacteria 3418
607 Ga0495658_0063281 3300046683 Bacteria 2128
608 Ga0495613_0007912 3300046689 Bacteria 7908
609 Ga0495613_0019379 3300046689 Bacteria 5071
610 Ga0495613_0111275 3300046689 Bacteria 1973
611 Ga0495613_0369342 3300046689 Bacteria 982
612 Ga0495624_0005364 3300046690 Bacteria 9249
613 Ga0495670_0104114 3300046691 Bacteria 1464
614 Ga0495649_0063690 3300046694 Bacteria 1981
615 Ga0495600_0000010 3300046809 Bacteria 143675
616 Ga0495600_0000655 3300046809 Bacteria 17966
617 Ga0495600_0094436 3300046809 Bacteria 1950
618 Ga0495660_0135100 3300046810 Bacteria 1233
619 Ga0495581_0050447 3300047315 Bacteria 2404
620 Ga0495581_0051738 3300047315 Bacteria 2372
621 Ga0495604_0000009 3300047317 Bacteria 326341
622 Ga0495604_0000914 3300047317 Bacteria 24538
623 Ga0495604_0096875 3300047317 Bacteria 2176
624 Ga0495604_0215644 3300047317 Bacteria 1324
625 Ga0495636_0412020 3300047318 Bacteria 645
626 Ga0495674_0000002 3300047319 Bacteria 642785
627 Ga0495674_0002660 3300047319 Bacteria 17387
628 Ga0495674_0023398 3300047319 Bacteria 5694
629 Ga0495674_0078415 3300047319 Bacteria 2838
630 Ga0495672_0064059 3300047320 Bacteria 2106
631 Ga0495680_0000263 3300047322 Bacteria 58120
632 Ga0495680_0001103 3300047322 Bacteria 29871
633 Ga0495680_0096225 3300047322 Unclassified 2212
634 Ga0495680_0155345 3300047322 Bacteria 1665
635 Ga0495675_0000178 3300047444 Bacteria 46542
636 Ga0495675_0029861 3300047444 Bacteria 3478
637 Ga0495675_0032525 3300047444 Bacteria 3328
638 Ga0495673_0009986 3300047469 Bacteria 5200
639 Ga0495684_0000006 3300047471 Bacteria 247568
640 Ga0495684_0001158 3300047471 Bacteria 21192
641 Ga0495684_0004148 3300047471 Bacteria 11317
642 Ga0495684_0028331 3300047471 Bacteria 4301
643 Ga0495686_0030748 3300047472 Bacteria 3486
644 Ga0495686_0037926 3300047472 Bacteria 3085
645 Ga0495686_0079584 3300047472 Bacteria 2004
646 Ga0495593_0000938 3300047673 Bacteria 16993
647 Ga0495602_0000005 3300048088 Bacteria 325957
648 Ga0495602_0000329 3300048088 Bacteria 43833
649 Ga0495602_0001998 3300048088 Bacteria 20493
650 Ga0495602_0037794 3300048088 Bacteria 4473
651 Ga0495615_0055062 3300048090 Bacteria 1034
652 Ga0495626_0001228 3300048091 Bacteria 21063
653 Ga0495626_0043230 3300048091 Bacteria 2115
654 Ga0496100_0091045 3300048903 Bacteria 2081
655 Ga0496100_0486239 3300048903 Bacteria 950
656 Ga0496101_0016344 3300048904 Bacteria 5011
657 Ga0496101_0119774 3300048904 Bacteria 1989
658 Ga0496102_0030887 3300048905 Bacteria 4799
659 Ga0496104_0118266 3300048907 Bacteria 2544
660 Ga0496104_0551049 3300048907 Bacteria 1064
661 Ga0496104_0726862 3300048907 Unclassified 900
662 Ga0496104_0747342 3300048907 Bacteria 885
663 Ga0496104_0782405 3300048907 Bacteria 861
664 Ga0496105_0182732 3300048908 Bacteria 1717
665 Ga0496105_0523341 3300048908 Bacteria 929
666 Ga0496106_0392346 3300048909 Bacteria 1115
667 Ga0496107_0018947 3300048910 Bacteria 4853
668 Ga0496107_0093491 3300048910 Bacteria 2199
669 Ga0496107_0673962 3300048910 Bacteria 761
670 Ga0496108_0058858 3300048911 Bacteria 3230
671 Ga0496109_0094904 3300048912 Viruses 2761
672 Ga0496109_0243748 3300048912 Unclassified 1692
673 Ga0496109_0247307 3300048912 Bacteria 1679
674 Ga0496109_0453428 3300048912 Bacteria 1211
675 Ga0496110_0078706 3300048913 Bacteria 2935
676 Ga0496110_0126727 3300048913 Bacteria 2304
677 Ga0496110_0357966 3300048913 Unclassified 1330
678 Ga0496111_0245028 3300048914 Bacteria 1331
679 Ga0496111_0325663 3300048914 Bacteria 1138
680 Ga0496112_0029379 3300048915 Bacteria 5316
681 Ga0496112_0121007 3300048915 Unclassified 2587
682 Ga0496113_0016802 3300048916 Bacteria 5063
683 Ga0496113_0322034 3300048916 Bacteria 1239
684 Ga0496114_0042977 3300048917 Bacteria 3747
685 Ga0496114_0069779 3300048917 Bacteria 2951
686 Ga0496115_0003714 3300048918 Bacteria 10980
687 Ga0496115_0012130 3300048918 Bacteria 6481
688 Ga0496115_0118344 3300048918 Bacteria 2179
689 Ga0496116_0001457 3300048919 Bacteria 26524
690 Ga0496116_0134725 3300048919 Bacteria 1401
691 Ga0496119_0097681 3300048922 Bacteria 1655
692 Ga0496119_0124990 3300048922 Unclassified 1409
693 Ga0496121_0011085 3300048924 Bacteria 10057
694 Ga0496126_0139539 3300048929 Bacteria 2088
695 Ga0501031_0000443 3300049568 Bacteria 23880
696 Ga0501036_0078356 3300049572 Bacteria 2795
697 Ga0501037_0061493 3300049573 Bacteria 2738
698 Ga0501038_0246409 3300049574 Bacteria 1417
699 Ga0501039_0000557 3300049575 Bacteria 26996
700 Ga0501040_0054577 3300049576 Bacteria 2739
701 Ga0501041_0004269 3300049577 Bacteria 8273
702 Ga0501041_0008931 3300049577 Bacteria 5897
703 Ga0501041_0366786 3300049577 Bacteria 911
704 Ga0501042_0015462 3300049578 Bacteria 5227
705 Ga0501042_0122789 3300049578 Unclassified 1870
706 Ga0501043_0150410 3300049579 Bacteria 1822
707 Ga0501046_0000618 3300049580 Bacteria 34970
708 Ga0501046_0132782 3300049580 Bacteria 1888
709 Ga0501048_0095069 3300049582 Bacteria 2102
710 Ga0501072_0072500 3300049588 Bacteria 2722
711 Ga0501075_0037384 3300049591 Bacteria 3627
712 Ga0501076_0022427 3300049592 Bacteria 4853
713 Ga0501076_0594268 3300049592 Bacteria 913
714 Ga0501077_0036587 3300049593 Bacteria 3128
715 Ga0501077_0075471 3300049593 Bacteria 2135
716 Ga0501201_006961 3300049651 Bacteria 1077
717 Ga0501211_002326 3300049658 Bacteria 2019
718 Ga0501222_014240 3300049662 Bacteria 1048
719 Ga0501223_024816 3300049663 Bacteria 1166
720 Ga0501233_012456 3300049668 Bacteria 1708
721 Ga0501235_011109 3300049669 Bacteria 1972
722 Ga0501236_033311 3300049670 Bacteria 825
723 Ga0501242_014527 3300049674 Bacteria 976
724 Ga0501258_008429 3300049687 Bacteria 1060
725 Ga0501221_002484 3300049704 Bacteria 3044
726 Ga0501079_0204719 3300049741 Bacteria 1541
727 Ga0501080_0217022 3300049742 Bacteria 1751
728 Ga0501267_000554 3300049764 Bacteria 2937
729 Ga0501045_0008831 3300049824 Bacteria 7039
730 Ga0501045_0416940 3300049824 Bacteria 999
731 nmdc:mga0yw44_61955_c1 3300050492 Bacteria 2296
732 nmdc:mga05p37_151241_c1 3300050507 Bacteria 2839
733 nmdc:mga05p37_30750_c1 3300050507 Bacteria 6553
734 nmdc:mga05p37_455017_c1 3300050507 Bacteria 1480
735 nmdc:mga05p37_629813_c1 3300050507 Bacteria 1205
736 nmdc:mga05p37_63_c1 3300050507 Bacteria 93704
737 nmdc:mga05p37_8001_c1 3300050507 Bacteria 12478
738 nmdc:mga09592_168344_c1 3300050508 Unclassified 1894
739 nmdc:mga09592_170988_c1 3300050508 Bacteria 1879
740 nmdc:mga09592_38963_c1 3300050508 Bacteria 3991
741 nmdc:mga09592_4520_c1 3300050508 Bacteria 11254
742 nmdc:mga09592_731013_c1 3300050508 Bacteria 841
743 nmdc:mga0qj67_101788_c1 3300050509 Bacteria 2316
744 nmdc:mga06r32_1020651_c1 3300050510 Bacteria 779
745 nmdc:mga06r32_137278_c1 3300050510 Bacteria 2420
746 nmdc:mga06r32_192836_c1 3300050510 Bacteria 2025
747 nmdc:mga08y16_14818_c1 3300050511 Bacteria 8198
748 nmdc:mga08y16_151853_c1 3300050511 Bacteria 2407
749 nmdc:mga0n895_118833_c1 3300050512 Bacteria 2664
750 nmdc:mga0n895_305045_c1 3300050512 Bacteria 1614
751 nmdc:mga0n895_705693_c1 3300050512 Bacteria 1004
752 nmdc:mga0n895_728641_c1 3300050512 Bacteria 986
753 nmdc:mga0rr50_8809_c1 3300050513 Bacteria 6296
754 nmdc:mga08x19_599_c1 3300050514 Bacteria 23392
755 nmdc:mga0a205_237674_c1 3300050515 Unclassified 1703
756 nmdc:mga0a205_57648_c1 3300050515 Bacteria 3750
757 nmdc:mga0sz30_22890_c1 3300050516 Bacteria 2538
758 Ga0495601_0000002 3300053077 Bacteria 528704
759 Ga0495601_0004704 3300053077 Bacteria 7908
760 Ga0495612_0000010 3300053078 Bacteria 227618
761 Ga0495612_0012369 3300053078 Bacteria 3440
762 Ga0500635_0024327 3300053080 Bacteria 1898
763 Ga0495595_0000020 3300053084 Bacteria 115983
764 Ga0495595_0088489 3300053084 Bacteria 1483
765 Ga0495595_0146971 3300053084 Bacteria 1158
766 Ga0495619_0000110 3300053085 Bacteria 61419
767 Ga0495619_0064804 3300053085 Bacteria 2437
768 Ga0495619_0651272 3300053085 Unclassified 718
769 Ga0500578_0027242 3300053086 Bacteria 3669
770 Ga0500578_0058076 3300053086 Bacteria 2473
771 Ga0500578_0064340 3300053086 Bacteria 2339
772 Ga0500651_0058931 3300053093 Bacteria 2401
773 Ga0500651_0180341 3300053093 Bacteria 1255
774 Ga0500640_011131 3300053095 Bacteria 3657
775 Ga0500650_0086107 3300053098 Bacteria 1471
776 Ga0500555_038787 3300053103 Bacteria 1331
777 Ga0500594_0001033 3300053118 Bacteria 5955
778 Ga0500595_043384 3300053119 Bacteria 1432
779 Ga0500607_008886 3300053121 Bacteria 6066
780 Ga0500608_012584 3300053122 Bacteria 3716
781 Ga0500614_071949 3300053123 Bacteria 951
782 Ga0500561_0066706 3300053137 Bacteria 1021
783 Ga0500577_0121032 3300053142 Bacteria 1089
784 Ga0500588_0125628 3300053146 Bacteria 909
785 Ga0500590_039601 3300053148 Bacteria 2429
786 Ga0500616_0002984 3300053153 Bacteria 13394
787 Ga0500622_0208092 3300053156 Bacteria 885
788 Ga0500627_0095076 3300053158 Bacteria 1335
789 Ga0500636_0000045 3300053177 Bacteria 63850
790 Ga0500636_0097394 3300053177 Bacteria 1677
791 Ga0500601_000031 3300053737 Bacteria 31512
792 Ga0501084_0091185 3300054114 Bacteria 2559
793 Ga0501084_0641928 3300054114 Bacteria 896
794 Ga0501082_0203974 3300060353 Bacteria 1720
795 Ga0530510_0006279 3300061734 Bacteria 8270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047318 Ga0495636_0412020 Ga0495636_0412020_70_603 177
2 3300046463 Ga0495653_0140190 Ga0495653_0140190_350_946 196
3 3300026142 Ga0207698_10693218 Ga0207698_106932181 199
4 3300048907 Ga0496104_0747342 Ga0496104_0747342_51_857 199
5 3300005331 Ga0070670_100453797 Ga0070670_1004537971 202
6 3300005439 Ga0070711_100331230 Ga0070711_1003312302 202
7 3300005548 Ga0070665_100090139 Ga0070665_1000901392 202
8 3300048091 Ga0495626_0001228 Ga0495626_0001228_14017_14670 202
9 3300048916 Ga0496113_0322034 Ga0496113_0322034_47_658 202
10 3300013297 Ga0157378_10816576 Ga0157378_108165761 203
11 3300026023 Ga0207677_10593620 Ga0207677_105936201 203
12 3300031616 Ga0307508_10000021 Ga0307508_1000002196 203
13 3300049592 Ga0501076_0594268 Ga0501076_0594268_287_898 203
14 3300049651 Ga0501201_006961 Ga0501201_006961_264_923 203
15 3300049668 Ga0501233_012456 Ga0501233_012456_613_1272 203
16 3300049687 Ga0501258_008429 Ga0501258_008429_71_730 203
17 3300028380 Ga0268265_10169113 Ga0268265_101691132 204
18 3300046472 Ga0495580_0417276 Ga0495580_0417276_17_631 204
19 3300049663 Ga0501223_024816 Ga0501223_024816_457_1116 204
20 3300049704 Ga0501221_002484 Ga0501221_002484_2285_2944 204
21 3300005354 Ga0070675_100033989 Ga0070675_1000339896 207
22 3300005456 Ga0070678_100093752 Ga0070678_1000937523 207
23 3300005459 Ga0068867_100062849 Ga0068867_1000628494 207
24 3300005543 Ga0070672_100024811 Ga0070672_1000248113 207
25 3300005578 Ga0068854_100759538 Ga0068854_1007595381 207
26 3300005616 Ga0068852_100321810 Ga0068852_1003218103 207
27 3300005618 Ga0068864_100750907 Ga0068864_1007509072 207
28 3300005840 Ga0068870_10318004 Ga0068870_103180042 207
29 3300009176 Ga0105242_10195875 Ga0105242_101958753 207
30 3300013105 Ga0157369_10763249 Ga0157369_107632492 207
31 3300013306 Ga0163162_10011067 Ga0163162_100110672 207
32 3300013307 Ga0157372_10034586 Ga0157372_100345867 207
33 3300013308 Ga0157375_10597604 Ga0157375_105976042 207
34 3300014326 Ga0157380_10008561 Ga0157380_100085616 207
35 3300017792 Ga0163161_10005882 Ga0163161_100058825 207
36 3300025893 Ga0207682_10001298 Ga0207682_100012987 207
37 3300025903 Ga0207680_10064063 Ga0207680_100640632 207
38 3300025926 Ga0207659_10141430 Ga0207659_101414302 207
39 3300025940 Ga0207691_10034784 Ga0207691_100347843 207
40 3300026067 Ga0207678_10028291 Ga0207678_100282914 207
41 3300026089 Ga0207648_10021824 Ga0207648_100218243 207
42 3300026121 Ga0207683_10000378 Ga0207683_1000037816 207
43 3300025981 Ga0207640_10705191 Ga0207640_107051912 208
44 3300048912 Ga0496109_0247307 Ga0496109_0247307_349_1002 208
45 3300045051 Ga0451576_0299369 Ga0451576_0299369_895_1524 209
46 3300037853 Ga0436364_0499655 Ga0436364_0499655_291_926 210
47 3300039447 Ga0436361_0958498 Ga0436361_0958498_566_1201 210
48 3300041997 Ga0439431_0010386 Ga0439431_0010386_830_1468 210
49 3300046674 Ga0495588_0060542 Ga0495588_0060542_1262_1894 210
50 3300025912 Ga0207707_10095347 Ga0207707_100953474 211
51 3300025928 Ga0207700_10334297 Ga0207700_103342972 211
52 3300044694 Ga0466963_0046998 Ga0466963_0046998_520_1167 212
53 3300045976 Ga0466967_0077551 Ga0466967_0077551_1953_2600 212
54 3300049658 Ga0501211_002326 Ga0501211_002326_1135_1794 212
55 3300049662 Ga0501222_014240 Ga0501222_014240_343_1002 212
56 3300049669 Ga0501235_011109 Ga0501235_011109_457_1116 212
57 3300049670 Ga0501236_033311 Ga0501236_033311_141_800 212
58 3300049674 Ga0501242_014527 Ga0501242_014527_155_814 212
59 3300049764 Ga0501267_000554 Ga0501267_000554_211_870 212
60 iso_pu_bacteria 2919130084 2919131899 212
61 iso_pu_bacteria 2929195423 2929197733 212
62 3300006038 Ga0075365_10205618 Ga0075365_102056183 213
63 3300031824 Ga0307413_10033250 Ga0307413_100332502 213
64 3300031852 Ga0307410_10096610 Ga0307410_100966102 213
65 3300031995 Ga0307409_100002953 Ga0307409_1000029533 213
66 3300032002 Ga0307416_100038876 Ga0307416_1000388762 213
67 3300032005 Ga0307411_10096171 Ga0307411_100961711 213
68 3300032126 Ga0307415_100058672 Ga0307415_1000586722 213
69 3300037312 Ga0395899_0355401 Ga0395899_0355401_61_735 213
70 3300037471 Ga0395905_0269750 Ga0395905_0269750_300_974 213
71 3300046475 Ga0495639_0027532 Ga0495639_0027532_1591_2235 213
72 3300050492 nmdc:mga0yw44_61955_c1 nmdc:mga0yw44_61955_c1_584_1225 213
73 iso_pu_bacteria 2619618881 2619854434 213
74 iso_pu_bacteria 2906626472 2906635137 213
75 iso_pu_bacteria 3005587118 3005594658 213
76 3300005327 Ga0070658_10024973 Ga0070658_100249734 214
77 3300005336 Ga0070680_100249716 Ga0070680_1002497162 214
78 3300005337 Ga0070682_100005081 Ga0070682_1000050812 214
79 3300005337 Ga0070682_100118182 Ga0070682_1001181822 214
80 3300005344 Ga0070661_100026941 Ga0070661_1000269416 214
81 3300005355 Ga0070671_100372922 Ga0070671_1003729221 214
82 3300005366 Ga0070659_100017169 Ga0070659_1000171692 214
83 3300005468 Ga0070707_100000239 Ga0070707_10000023946 214
84 3300005471 Ga0070698_100723730 Ga0070698_1007237301 214
85 3300005530 Ga0070679_100093100 Ga0070679_1000931002 214
86 3300005535 Ga0070684_100259545 Ga0070684_1002595453 214
87 3300005547 Ga0070693_100096813 Ga0070693_1000968132 214
88 3300005563 Ga0068855_100130656 Ga0068855_1001306563 214
89 3300005563 Ga0068855_100444100 Ga0068855_1004441002 214
90 3300005564 Ga0070664_100065958 Ga0070664_1000659582 214
91 3300005614 Ga0068856_100159430 Ga0068856_1001594303 214
92 3300006852 Ga0075433_10078796 Ga0075433_100787962 214
93 3300009093 Ga0105240_10462672 Ga0105240_104626722 214
94 3300009093 Ga0105240_11105534 Ga0105240_111055342 214
95 3300009177 Ga0105248_10107692 Ga0105248_101076924 214
96 3300013105 Ga0157369_10101650 Ga0157369_101016503 214
97 3300013296 Ga0157374_10222083 Ga0157374_102220833 214
98 3300013307 Ga0157372_10339840 Ga0157372_103398402 214
99 3300014326 Ga0157380_11124458 Ga0157380_111244581 214
100 3300020070 Ga0206356_10545819 Ga0206356_105458192 214
101 3300020082 Ga0206353_11476788 Ga0206353_114767881 214
102 3300025920 Ga0207649_10065106 Ga0207649_100651063 214
103 3300025922 Ga0207646_10000397 Ga0207646_1000039754 214
104 3300025944 Ga0207661_10485137 Ga0207661_104851372 214
105 3300025949 Ga0207667_10959175 Ga0207667_109591752 214
106 3300026078 Ga0207702_10149078 Ga0207702_101490782 214
107 3300026089 Ga0207648_10194499 Ga0207648_101944993 214
108 3300031018 Ga0265773_1007486 Ga0265773_10074861 214
109 3300046517 Ga0495630_0382790 Ga0495630_0382790_225_881 214
110 3300046557 Ga0495622_0139296 Ga0495622_0139296_437_1090 214
111 3300048090 Ga0495615_0055062 Ga0495615_0055062_193_837 214
112 3300048903 Ga0496100_0486239 Ga0496100_0486239_67_711 214
113 3300048904 Ga0496101_0016344 Ga0496101_0016344_4220_4876 214
114 3300048908 Ga0496105_0523341 Ga0496105_0523341_131_787 214
115 3300048910 Ga0496107_0093491 Ga0496107_0093491_510_1166 214
116 3300048911 Ga0496108_0058858 Ga0496108_0058858_631_1287 214
117 3300048912 Ga0496109_0453428 Ga0496109_0453428_244_888 214
118 3300048913 Ga0496110_0126727 Ga0496110_0126727_1564_2220 214
119 3300048914 Ga0496111_0245028 Ga0496111_0245028_238_894 214
120 3300048915 Ga0496112_0029379 Ga0496112_0029379_857_1513 214
121 3300048916 Ga0496113_0016802 Ga0496113_0016802_264_920 214
122 3300050512 nmdc:mga0n895_728641_c1 nmdc:mga0n895_728641_c1_236_892 214
123 3300050515 nmdc:mga0a205_57648_c1 nmdc:mga0a205_57648_c1_509_1165 214
124 iso_pu_bacteria 2913939268 2913945698 214
125 3300005331 Ga0070670_100019037 Ga0070670_1000190373 215
126 3300005339 Ga0070660_100004581 Ga0070660_1000045818 215
127 3300005354 Ga0070675_100021607 Ga0070675_1000216072 215
128 3300005365 Ga0070688_100005618 Ga0070688_1000056183 215
129 3300005436 Ga0070713_100016390 Ga0070713_1000163906 215
130 3300005466 Ga0070685_10023921 Ga0070685_100239213 215
131 3300005467 Ga0070706_100010342 Ga0070706_1000103424 215
132 3300005535 Ga0070684_100369344 Ga0070684_1003693441 215
133 3300005539 Ga0068853_100105098 Ga0068853_1001050983 215
134 3300005564 Ga0070664_100047406 Ga0070664_1000474064 215
135 3300005614 Ga0068856_100067066 Ga0068856_1000670663 215
136 3300005617 Ga0068859_100004794 Ga0068859_1000047945 215
137 3300005618 Ga0068864_100003643 Ga0068864_1000036437 215
138 3300006028 Ga0070717_10011578 Ga0070717_100115783 215
139 3300006028 Ga0070717_10059834 Ga0070717_100598342 215
140 3300006931 Ga0097620_100004794 Ga0097620_1000047947 215
141 3300009093 Ga0105240_10000649 Ga0105240_100006496 215
142 3300009174 Ga0105241_10000325 Ga0105241_1000032515 215
143 3300009545 Ga0105237_10045862 Ga0105237_100458623 215
144 3300009551 Ga0105238_10000947 Ga0105238_1000094717 215
145 3300009553 Ga0105249_10003319 Ga0105249_100033199 215
146 3300010375 Ga0105239_10042919 Ga0105239_100429194 215
147 3300013307 Ga0157372_10122700 Ga0157372_101227002 215
148 3300014325 Ga0163163_10010087 Ga0163163_100100873 215
149 3300025910 Ga0207684_10011572 Ga0207684_100115727 215
150 3300025911 Ga0207654_10009511 Ga0207654_100095116 215
151 3300025913 Ga0207695_10000795 Ga0207695_1000079534 215
152 3300025914 Ga0207671_10002410 Ga0207671_1000241014 215
153 3300025919 Ga0207657_10000952 Ga0207657_1000095213 215
154 3300025924 Ga0207694_10021828 Ga0207694_100218286 215
155 3300025925 Ga0207650_10022802 Ga0207650_100228025 215
156 3300025945 Ga0207679_10030001 Ga0207679_100300014 215
157 3300025961 Ga0207712_10052093 Ga0207712_100520932 215
158 3300026041 Ga0207639_10081121 Ga0207639_100811212 215
159 3300026095 Ga0207676_10112522 Ga0207676_101125222 215
160 3300031250 Ga0265331_10002224 Ga0265331_100022242 215
161 3300031251 Ga0265327_10000035 Ga0265327_1000003590 215
162 3300038705 Ga0237819_00071 Ga0237819_00071_30842_31495 215
163 3300039447 Ga0436361_1146288 Ga0436361_1146288_1410_2066 215
164 3300039450 Ga0436363_0414782 Ga0436363_0414782_102_755 215
165 3300039450 Ga0436363_0774788 Ga0436363_0774788_345_995 215
166 3300042876 Ga0451577_0000083 Ga0451577_0000083_2118_2768 215
167 3300044712 Ga0453684_0000533 Ga0453684_0000533_99828_100478 215
168 3300046512 Ga0495610_0000763 Ga0495610_0000763_24151_24804 215
169 3300046518 Ga0495631_0000006 Ga0495631_0000006_71309_71962 215
170 3300047322 Ga0495680_0155345 Ga0495680_0155345_990_1643 215
171 3300047472 Ga0495686_0037926 Ga0495686_0037926_1868_2521 215
172 3300048907 Ga0496104_0782405 Ga0496104_0782405_35_685 215
173 3300048919 Ga0496116_0001457 Ga0496116_0001457_13158_13811 215
174 3300053084 Ga0495595_0088489 Ga0495595_0088489_30_683 215
175 3300053085 Ga0495619_0651272 Ga0495619_0651272_36_686 215
176 3300003322 rootL2_10045889 rootL2_1004588913 216
177 3300005337 Ga0070682_100052021 Ga0070682_1000520212 216
178 3300005339 Ga0070660_100032659 Ga0070660_1000326593 216
179 3300005344 Ga0070661_100025467 Ga0070661_1000254672 216
180 3300005356 Ga0070674_100051574 Ga0070674_1000515742 216
181 3300005364 Ga0070673_100111521 Ga0070673_1001115212 216
182 3300005366 Ga0070659_100020312 Ga0070659_1000203123 216
183 3300005367 Ga0070667_100281844 Ga0070667_1002818441 216
184 3300005434 Ga0070709_10001310 Ga0070709_1000131010 216
185 3300005435 Ga0070714_100100534 Ga0070714_1001005342 216
186 3300005435 Ga0070714_100354589 Ga0070714_1003545892 216
187 3300005436 Ga0070713_100011411 Ga0070713_1000114113 216
188 3300005437 Ga0070710_10037147 Ga0070710_100371471 216
189 3300005455 Ga0070663_100060139 Ga0070663_1000601392 216
190 3300005457 Ga0070662_100139938 Ga0070662_1001399383 216
191 3300005458 Ga0070681_10014527 Ga0070681_100145273 216
192 3300005458 Ga0070681_10601079 Ga0070681_106010792 216
193 3300005530 Ga0070679_100110006 Ga0070679_1001100063 216
194 3300005535 Ga0070684_100172892 Ga0070684_1001728922 216
195 3300005539 Ga0068853_100012548 Ga0068853_1000125483 216
196 3300005539 Ga0068853_100202288 Ga0068853_1002022883 216
197 3300005539 Ga0068853_100420619 Ga0068853_1004206192 216
198 3300005545 Ga0070695_100190549 Ga0070695_1001905492 216
199 3300005563 Ga0068855_100175622 Ga0068855_1001756222 216
200 3300005564 Ga0070664_100010698 Ga0070664_1000106987 216
201 3300005564 Ga0070664_100083669 Ga0070664_1000836693 216
202 3300005577 Ga0068857_100019637 Ga0068857_1000196377 216
203 3300005577 Ga0068857_100328970 Ga0068857_1003289702 216
204 3300005618 Ga0068864_100019477 Ga0068864_1000194772 216
205 3300005983 Ga0081540_1002973 Ga0081540_100297311 216
206 3300006028 Ga0070717_10008698 Ga0070717_100086982 216
207 3300006871 Ga0075434_100082850 Ga0075434_1000828502 216
208 3300006914 Ga0075436_100000966 Ga0075436_10000096614 216
209 3300007076 Ga0075435_100002824 Ga0075435_1000028242 216
210 3300009093 Ga0105240_10296091 Ga0105240_102960912 216
211 3300009094 Ga0111539_11271653 Ga0111539_112716531 216
212 3300013100 Ga0157373_10021393 Ga0157373_100213933 216
213 3300013102 Ga0157371_10091760 Ga0157371_100917603 216
214 3300013306 Ga0163162_10039284 Ga0163162_100392844 216
215 3300013306 Ga0163162_10085424 Ga0163162_100854244 216
216 3300013307 Ga0157372_10093746 Ga0157372_100937463 216
217 3300013308 Ga0157375_10640911 Ga0157375_106409112 216
218 3300014325 Ga0163163_10054362 Ga0163163_100543627 216
219 3300014325 Ga0163163_10215476 Ga0163163_102154762 216
220 3300014325 Ga0163163_10395448 Ga0163163_103954482 216
221 3300014326 Ga0157380_10087328 Ga0157380_100873282 216
222 3300014326 Ga0157380_10808738 Ga0157380_108087382 216
223 3300014968 Ga0157379_10710492 Ga0157379_107104922 216
224 3300014969 Ga0157376_10409255 Ga0157376_104092552 216
225 3300025898 Ga0207692_10004054 Ga0207692_100040547 216
226 3300025906 Ga0207699_10000924 Ga0207699_100009243 216
227 3300025912 Ga0207707_10134888 Ga0207707_101348881 216
228 3300025917 Ga0207660_10056576 Ga0207660_100565762 216
229 3300025919 Ga0207657_10166766 Ga0207657_101667662 216
230 3300025920 Ga0207649_10010144 Ga0207649_100101442 216
231 3300025921 Ga0207652_10026809 Ga0207652_100268093 216
232 3300025925 Ga0207650_10517500 Ga0207650_105175002 216
233 3300025928 Ga0207700_10007343 Ga0207700_100073433 216
234 3300025929 Ga0207664_10311654 Ga0207664_103116542 216
235 3300025932 Ga0207690_10083797 Ga0207690_100837972 216
236 3300025933 Ga0207706_10176820 Ga0207706_101768202 216
237 3300025939 Ga0207665_10005339 Ga0207665_100053393 216
238 3300025945 Ga0207679_10544435 Ga0207679_105444352 216
239 3300025949 Ga0207667_10136611 Ga0207667_101366113 216
240 3300025960 Ga0207651_10302062 Ga0207651_103020622 216
241 3300026041 Ga0207639_10124739 Ga0207639_101247393 216
242 3300026041 Ga0207639_10321162 Ga0207639_103211622 216
243 3300026067 Ga0207678_10053897 Ga0207678_100538974 216
244 3300026078 Ga0207702_10390112 Ga0207702_103901122 216
245 3300026095 Ga0207676_10039788 Ga0207676_100397882 216
246 3300026116 Ga0207674_10000851 Ga0207674_1000085115 216
247 3300028800 Ga0265338_10007992 Ga0265338_100079927 216
248 3300031239 Ga0265328_10000019 Ga0265328_1000001985 216
249 3300031249 Ga0265339_10025010 Ga0265339_100250102 216
250 3300031456 Ga0307513_10054120 Ga0307513_100541207 216
251 3300031616 Ga0307508_10023815 Ga0307508_100238152 216
252 3300031711 Ga0265314_10018880 Ga0265314_100188807 216
253 3300035083 Ga0373926_0002060 Ga0373926_0002060_1109_1762 216
254 3300035113 Ga0373936_0079469 Ga0373936_0079469_591_1244 216
255 3300035170 Ga0373943_0036590 Ga0373943_0036590_371_1024 216
256 3300035692 Ga0373935_0004307 Ga0373935_0004307_1492_2145 216
257 3300035695 Ga0373927_0008772 Ga0373927_0008772_929_1582 216
258 3300035725 Ga0373947_0000734 Ga0373947_0000734_13866_14519 216
259 3300037068 Ga0373925_0001070 Ga0373925_0001070_18465_19118 216
260 3300037466 Ga0395898_0590991 Ga0395898_0590991_350_1003 216
261 3300037471 Ga0395905_0574021 Ga0395905_0574021_322_975 216
262 3300045051 Ga0451576_0174216 Ga0451576_0174216_490_1143 216
263 3300046472 Ga0495580_0013306 Ga0495580_0013306_4265_4918 216
264 3300046473 Ga0495582_0000096 Ga0495582_0000096_25758_26411 216
265 3300046475 Ga0495639_0021847 Ga0495639_0021847_212_865 216
266 3300046526 Ga0495666_0069160 Ga0495666_0069160_108_761 216
267 3300046531 Ga0495665_0000675 Ga0495665_0000675_7680_8333 216
268 3300047315 Ga0495581_0050447 Ga0495581_0050447_1517_2170 216
269 3300047319 Ga0495674_0078415 Ga0495674_0078415_639_1292 216
270 3300047320 Ga0495672_0064059 Ga0495672_0064059_1164_1817 216
271 3300048914 Ga0496111_0325663 Ga0496111_0325663_78_731 216
272 3300049572 Ga0501036_0078356 Ga0501036_0078356_384_1037 216
273 3300049574 Ga0501038_0246409 Ga0501038_0246409_119_772 216
274 3300049577 Ga0501041_0004269 Ga0501041_0004269_7116_7769 216
275 3300049578 Ga0501042_0122789 Ga0501042_0122789_817_1470 216
276 3300049580 Ga0501046_0132782 Ga0501046_0132782_653_1306 216
277 3300049582 Ga0501048_0095069 Ga0501048_0095069_897_1550 216
278 3300049588 Ga0501072_0072500 Ga0501072_0072500_973_1626 216
279 3300049591 Ga0501075_0037384 Ga0501075_0037384_1582_2235 216
280 3300049592 Ga0501076_0022427 Ga0501076_0022427_3087_3740 216
281 3300049593 Ga0501077_0036587 Ga0501077_0036587_1247_1900 216
282 3300049824 Ga0501045_0008831 Ga0501045_0008831_3282_3935 216
283 3300050507 nmdc:mga05p37_629813_c1 nmdc:mga05p37_629813_c1_166_819 216
284 3300050512 nmdc:mga0n895_118833_c1 nmdc:mga0n895_118833_c1_1569_2222 216
285 3300050513 nmdc:mga0rr50_8809_c1 nmdc:mga0rr50_8809_c1_1329_1982 216
286 3300050514 nmdc:mga08x19_599_c1 nmdc:mga08x19_599_c1_14270_14923 216
287 3300054114 Ga0501084_0091185 Ga0501084_0091185_1170_1823 216
288 3300061734 Ga0530510_0006279 Ga0530510_0006279_3119_3772 216
289 iso_pu_bacteria 2511231028 2511401014 216
290 iso_pu_bacteria 2824661429 2824665813 216
291 iso_pu_bacteria 2874628541 2874634556 216
292 iso_pu_bacteria 2879099564 2879109591 216
293 iso_pu_bacteria 2932784394 2932791109 216
294 iso_pu_bacteria 2932809354 2932811709 216
295 iso_pu_bacteria 2932818245 2932826575 216
296 iso_pu_bacteria 2932828146 2932834278 216
297 iso_pu_bacteria 2935616580 2935623897 216
298 iso_pu_bacteria 2935638405 2935646976 216
299 iso_pu_bacteria 2935665750 2935674044 216
300 iso_pu_bacteria 2935675223 2935679444 216
301 iso_pu_bacteria 2935684952 2935691540 216
302 iso_pu_bacteria 2935694250 2935699413 216
303 iso_pu_bacteria 2935703347 2935707643 216
304 iso_pu_bacteria 2935713505 2935719374 216
305 iso_pu_bacteria 2935722832 2935729026 216
306 iso_pu_bacteria 2935732158 2935737733 216
307 iso_pu_bacteria 2935741537 2935747109 216
308 iso_pu_bacteria 2935750917 2935758091 216
309 iso_pu_bacteria 2935760218 2935766727 216
310 iso_pu_bacteria 2935801545 2935809257 216
311 iso_pu_bacteria 2935810662 2935817850 216
312 iso_pu_bacteria 2935827899 2935836209 216
313 iso_pu_bacteria 2935837841 2935845120 216
314 iso_pu_bacteria 2935855204 2935862253 216
315 iso_pu_bacteria 2935864058 2935870820 216
316 iso_pu_bacteria 2935873716 2935881213 216
317 iso_pu_bacteria 2935992306 2935999195 216
318 iso_pu_bacteria 2936002035 2936005613 216
319 iso_pu_bacteria 2936037263 2936042142 216
320 iso_pu_bacteria 2940556831 2940563998 216
321 iso_pu_bacteria 2941538514 2941545434 216
322 iso_pu_bacteria 8016511872 8016515906 216
323 iso_pu_bacteria 8017057580 8017060605 216
324 iso_pu_bacteria 8019576017 8019580112 216
325 iso_pu_bacteria 8019586578 8019587832 216
326 iso_pu_bacteria 8019597564 8019603497 216
327 iso_pu_bacteria 8019608314 8019615033 216
328 3300002737 JGI25162J39368_1000021 JGI25162J39368_1000021140 217
329 3300005329 Ga0070683_100244370 Ga0070683_1002443702 217
330 3300005336 Ga0070680_100007785 Ga0070680_1000077858 217
331 3300005338 Ga0068868_100000525 Ga0068868_10000052515 217
332 3300005354 Ga0070675_100030163 Ga0070675_1000301633 217
333 3300005355 Ga0070671_100128317 Ga0070671_1001283173 217
334 3300005356 Ga0070674_100039663 Ga0070674_1000396632 217
335 3300005364 Ga0070673_100072012 Ga0070673_1000720122 217
336 3300005365 Ga0070688_100041178 Ga0070688_1000411781 217
337 3300005444 Ga0070694_100141269 Ga0070694_1001412692 217
338 3300005467 Ga0070706_100002050 Ga0070706_1000020508 217
339 3300005467 Ga0070706_100106436 Ga0070706_1001064362 217
340 3300005471 Ga0070698_100044407 Ga0070698_1000444073 217
341 3300005471 Ga0070698_100477253 Ga0070698_1004772532 217
342 3300005518 Ga0070699_100000537 Ga0070699_10000053720 217
343 3300005518 Ga0070699_100905235 Ga0070699_1009052351 217
344 3300005530 Ga0070679_100002001 Ga0070679_1000020017 217
345 3300005536 Ga0070697_100485789 Ga0070697_1004857892 217
346 3300005546 Ga0070696_100005655 Ga0070696_1000056553 217
347 3300005549 Ga0070704_100012085 Ga0070704_1000120853 217
348 3300005563 Ga0068855_100051207 Ga0068855_1000512074 217
349 3300005577 Ga0068857_100665212 Ga0068857_1006652122 217
350 3300005615 Ga0070702_100176784 Ga0070702_1001767841 217
351 3300005834 Ga0068851_10081585 Ga0068851_100815853 217
352 3300005840 Ga0068870_10018510 Ga0068870_100185102 217
353 3300005937 Ga0081455_10026936 Ga0081455_100269362 217
354 3300006178 Ga0075367_10063345 Ga0075367_100633453 217
355 3300006237 Ga0097621_100997034 Ga0097621_1009970342 217
356 3300006358 Ga0068871_100289320 Ga0068871_1002893202 217
357 3300006871 Ga0075434_100996338 Ga0075434_1009963381 217
358 3300006880 Ga0075429_100230223 Ga0075429_1002302232 217
359 3300006880 Ga0075429_100773110 Ga0075429_1007731101 217
360 3300009093 Ga0105240_11077015 Ga0105240_110770151 217
361 3300009094 Ga0111539_10080785 Ga0111539_100807852 217
362 3300009094 Ga0111539_10682201 Ga0111539_106822011 217
363 3300009147 Ga0114129_10000925 Ga0114129_100009258 217
364 3300009147 Ga0114129_10040003 Ga0114129_100400034 217
365 3300009545 Ga0105237_10025607 Ga0105237_100256073 217
366 3300009551 Ga0105238_10133817 Ga0105238_101338172 217
367 3300010375 Ga0105239_10017597 Ga0105239_100175977 217
368 3300010375 Ga0105239_10031131 Ga0105239_100311317 217
369 3300013308 Ga0157375_10093753 Ga0157375_100937533 217
370 3300014325 Ga0163163_10204127 Ga0163163_102041272 217
371 3300014497 Ga0182008_10193236 Ga0182008_101932362 217
372 3300014968 Ga0157379_10769308 Ga0157379_107693081 217
373 3300017792 Ga0163161_10018771 Ga0163161_100187712 217
374 3300025294 Ga0209025_1055119 Ga0209025_10551192 217
375 3300025321 Ga0207656_10114125 Ga0207656_101141252 217
376 3300025893 Ga0207682_10024997 Ga0207682_100249972 217
377 3300025910 Ga0207684_10059014 Ga0207684_100590143 217
378 3300025910 Ga0207684_10072307 Ga0207684_100723073 217
379 3300025913 Ga0207695_10965234 Ga0207695_109652341 217
380 3300025914 Ga0207671_10175540 Ga0207671_101755403 217
381 3300025917 Ga0207660_10002229 Ga0207660_100022298 217
382 3300025921 Ga0207652_10011404 Ga0207652_100114047 217
383 3300025924 Ga0207694_10091917 Ga0207694_100919173 217
384 3300025936 Ga0207670_10428244 Ga0207670_104282442 217
385 3300025940 Ga0207691_10000806 Ga0207691_1000080621 217
386 3300025944 Ga0207661_10564060 Ga0207661_105640602 217
387 3300025949 Ga0207667_10286284 Ga0207667_102862842 217
388 3300025960 Ga0207651_10149598 Ga0207651_101495983 217
389 3300026023 Ga0207677_10000069 Ga0207677_1000006931 217
390 3300026121 Ga0207683_10035444 Ga0207683_100354442 217
391 3300028381 Ga0268264_10332964 Ga0268264_103329642 217
392 3300031456 Ga0307513_10357936 Ga0307513_103579363 217
393 3300031507 Ga0307509_10385900 Ga0307509_103859002 217
394 3300031691 Ga0316579_10046638 Ga0316579_100466383 217
395 3300031727 Ga0316576_10346823 Ga0316576_103468231 217
396 3300031852 Ga0307410_10391882 Ga0307410_103918822 217
397 3300035119 Ga0373956_0181699 Ga0373956_0181699_260_916 217
398 3300035724 Ga0373933_0419084 Ga0373933_0419084_21_677 217
399 3300036401 Ga0373937_0004880 Ga0373937_0004880_6319_6975 217
400 3300036401 Ga0373937_0346310 Ga0373937_0346310_667_1326 217
401 3300036647 Ga0316582_0009233 Ga0316582_0009233_3231_3887 217
402 3300037588 Ga0316581_0002336 Ga0316581_0002336_3285_3941 217
403 3300042876 Ga0451577_0144288 Ga0451577_0144288_551_1207 217
404 3300044694 Ga0466963_0366653 Ga0466963_0366653_98_754 217
405 3300046462 Ga0495651_0001166 Ga0495651_0001166_4296_4955 217
406 3300046462 Ga0495651_0331137 Ga0495651_0331137_311_967 217
407 3300046511 Ga0495608_0212324 Ga0495608_0212324_448_1107 217
408 3300046529 Ga0495652_0225505 Ga0495652_0225505_526_1185 217
409 3300046536 Ga0495587_0017423 Ga0495587_0017423_444_1103 217
410 3300046559 Ga0495667_0026972 Ga0495667_0026972_2064_2723 217
411 3300046664 Ga0495659_0091207 Ga0495659_0091207_339_995 217
412 3300046678 Ga0495599_0058878 Ga0495599_0058878_332_991 217
413 3300046679 Ga0495623_0037179 Ga0495623_0037179_1849_2508 217
414 3300047317 Ga0495604_0215644 Ga0495604_0215644_630_1289 217
415 3300047444 Ga0495675_0032525 Ga0495675_0032525_92_751 217
416 3300047471 Ga0495684_0001158 Ga0495684_0001158_1870_2529 217
417 3300048088 Ga0495602_0000329 Ga0495602_0000329_25631_26290 217
418 3300048903 Ga0496100_0091045 Ga0496100_0091045_277_933 217
419 3300048910 Ga0496107_0018947 Ga0496107_0018947_779_1435 217
420 3300048918 Ga0496115_0003714 Ga0496115_0003714_2504_3160 217
421 3300048929 Ga0496126_0139539 Ga0496126_0139539_152_808 217
422 3300050507 nmdc:mga05p37_151241_c1 nmdc:mga05p37_151241_c1_2090_2746 217
423 3300050507 nmdc:mga05p37_63_c1 nmdc:mga05p37_63_c1_65264_65920 217
424 3300050508 nmdc:mga09592_168344_c1 nmdc:mga09592_168344_c1_19_675 217
425 3300050508 nmdc:mga09592_731013_c1 nmdc:mga09592_731013_c1_15_671 217
426 3300050511 nmdc:mga08y16_14818_c1 nmdc:mga08y16_14818_c1_4146_4802 217
427 3300053093 Ga0500651_0058931 Ga0500651_0058931_1527_2189 217
428 3300053103 Ga0500555_038787 Ga0500555_038787_277_939 217
429 3300053142 Ga0500577_0121032 Ga0500577_0121032_388_1044 217
430 3300053146 Ga0500588_0125628 Ga0500588_0125628_20_682 217
431 3300053156 Ga0500622_0208092 Ga0500622_0208092_127_789 217
432 3300002737 JGI25162J39368_1000707 JGI25162J39368_10007079 218
433 3300005336 Ga0070680_100029492 Ga0070680_1000294923 218
434 3300005354 Ga0070675_100095108 Ga0070675_1000951083 218
435 3300005354 Ga0070675_100664971 Ga0070675_1006649711 218
436 3300005365 Ga0070688_100086340 Ga0070688_1000863402 218
437 3300005406 Ga0070703_10000028 Ga0070703_1000002839 218
438 3300005434 Ga0070709_10047141 Ga0070709_100471412 218
439 3300005436 Ga0070713_100009503 Ga0070713_1000095037 218
440 3300005436 Ga0070713_100334351 Ga0070713_1003343512 218
441 3300005439 Ga0070711_100061942 Ga0070711_1000619422 218
442 3300005441 Ga0070700_100026559 Ga0070700_1000265593 218
443 3300005445 Ga0070708_100001158 Ga0070708_10000115816 218
444 3300005445 Ga0070708_100033795 Ga0070708_1000337952 218
445 3300005466 Ga0070685_10256918 Ga0070685_102569182 218
446 3300005467 Ga0070706_100000054 Ga0070706_10000005467 218
447 3300005467 Ga0070706_100242415 Ga0070706_1002424153 218
448 3300005467 Ga0070706_100632978 Ga0070706_1006329782 218
449 3300005468 Ga0070707_100854076 Ga0070707_1008540761 218
450 3300005518 Ga0070699_100268587 Ga0070699_1002685872 218
451 3300005518 Ga0070699_100837631 Ga0070699_1008376312 218
452 3300005536 Ga0070697_100082945 Ga0070697_1000829453 218
453 3300005539 Ga0068853_100000009 Ga0068853_10000000969 218
454 3300005543 Ga0070672_100160954 Ga0070672_1001609542 218
455 3300005546 Ga0070696_100081829 Ga0070696_1000818293 218
456 3300005563 Ga0068855_100615990 Ga0068855_1006159902 218
457 3300005616 Ga0068852_100301393 Ga0068852_1003013932 218
458 3300005618 Ga0068864_100008166 Ga0068864_1000081666 218
459 3300005841 Ga0068863_100015093 Ga0068863_1000150932 218
460 3300005841 Ga0068863_100393604 Ga0068863_1003936042 218
461 3300005842 Ga0068858_100875001 Ga0068858_1008750012 218
462 3300006028 Ga0070717_10205568 Ga0070717_102055683 218
463 3300006175 Ga0070712_100021750 Ga0070712_1000217502 218
464 3300006175 Ga0070712_100313185 Ga0070712_1003131852 218
465 3300006175 Ga0070712_100403787 Ga0070712_1004037872 218
466 3300006358 Ga0068871_100393601 Ga0068871_1003936011 218
467 3300006880 Ga0075429_100184828 Ga0075429_1001848283 218
468 3300006881 Ga0068865_100872312 Ga0068865_1008723121 218
469 3300006914 Ga0075436_100222643 Ga0075436_1002226433 218
470 3300009094 Ga0111539_10171353 Ga0111539_101713532 218
471 3300009094 Ga0111539_10195393 Ga0111539_101953932 218
472 3300009098 Ga0105245_10095366 Ga0105245_100953662 218
473 3300009101 Ga0105247_10653800 Ga0105247_106538001 218
474 3300009551 Ga0105238_10345425 Ga0105238_103454252 218
475 3300013104 Ga0157370_10032254 Ga0157370_100322547 218
476 3300013105 Ga0157369_10065706 Ga0157369_100657063 218
477 3300013105 Ga0157369_10136893 Ga0157369_101368934 218
478 3300013306 Ga0163162_10470983 Ga0163162_104709831 218
479 3300013307 Ga0157372_10242030 Ga0157372_102420303 218
480 3300013308 Ga0157375_10025565 Ga0157375_100255656 218
481 3300014326 Ga0157380_10184688 Ga0157380_101846882 218
482 3300014745 Ga0157377_10636794 Ga0157377_106367942 218
483 3300014969 Ga0157376_10076551 Ga0157376_100765512 218
484 3300014969 Ga0157376_10093323 Ga0157376_100933232 218
485 3300014969 Ga0157376_10339400 Ga0157376_103394002 218
486 3300014969 Ga0157376_10501507 Ga0157376_105015072 218
487 3300021384 Ga0213876_10000383 Ga0213876_100003836 218
488 3300021384 Ga0213876_10004391 Ga0213876_100043919 218
489 3300021388 Ga0213875_10132095 Ga0213875_101320952 218
490 3300025885 Ga0207653_10000047 Ga0207653_1000004717 218
491 3300025904 Ga0207647_10074137 Ga0207647_100741373 218
492 3300025908 Ga0207643_10005051 Ga0207643_100050519 218
493 3300025915 Ga0207693_10049856 Ga0207693_100498562 218
494 3300025915 Ga0207693_10264481 Ga0207693_102644812 218
495 3300025917 Ga0207660_10159362 Ga0207660_101593622 218
496 3300025927 Ga0207687_10060541 Ga0207687_100605412 218
497 3300025928 Ga0207700_10150685 Ga0207700_101506852 218
498 3300025938 Ga0207704_10048407 Ga0207704_100484073 218
499 3300025939 Ga0207665_10002211 Ga0207665_1000221110 218
500 3300025940 Ga0207691_10004233 Ga0207691_100042336 218
501 3300025949 Ga0207667_10303000 Ga0207667_103030003 218
502 3300026041 Ga0207639_10000004 Ga0207639_10000004331 218
503 3300026075 Ga0207708_10078508 Ga0207708_100785084 218
504 3300026075 Ga0207708_10109542 Ga0207708_101095422 218
505 3300026078 Ga0207702_10686070 Ga0207702_106860701 218
506 3300026088 Ga0207641_10011898 Ga0207641_100118987 218
507 3300026095 Ga0207676_10084603 Ga0207676_100846033 218
508 3300026116 Ga0207674_10095916 Ga0207674_100959162 218
509 3300026142 Ga0207698_10688074 Ga0207698_106880742 218
510 3300027907 Ga0207428_10086831 Ga0207428_100868312 218
511 3300031241 Ga0265325_10068349 Ga0265325_100683492 218
512 3300031241 Ga0265325_10074036 Ga0265325_100740361 218
513 3300035241 Ga0373961_0199730 Ga0373961_0199730_20_679 218
514 3300035692 Ga0373935_0029694 Ga0373935_0029694_1188_1850 218
515 3300035692 Ga0373935_0470381 Ga0373935_0470381_36_698 218
516 3300035695 Ga0373927_0157142 Ga0373927_0157142_291_953 218
517 3300035725 Ga0373947_0005433 Ga0373947_0005433_2783_3445 218
518 3300037068 Ga0373925_0081895 Ga0373925_0081895_1159_1821 218
519 3300037068 Ga0373925_0470317 Ga0373925_0470317_14_676 218
520 3300038443 Ga0395901_0000076 Ga0395901_0000076_118344_119000 218
521 3300039437 Ga0436365_0085465 Ga0436365_0085465_48_710 218
522 3300039437 Ga0436365_0153842 Ga0436365_0153842_257_922 218
523 3300039437 Ga0436365_1820314 Ga0436365_1820314_16447_17112 218
524 3300039438 Ga0436360_0959870 Ga0436360_0959870_336_998 218
525 3300039438 Ga0436360_1332558 Ga0436360_1332558_1147_1818 218
526 3300039447 Ga0436361_0153732 Ga0436361_0153732_305_967 218
527 3300039447 Ga0436361_1037273 Ga0436361_1037273_22_687 218
528 3300039450 Ga0436363_1105616 Ga0436363_1105616_591_1253 218
529 3300046457 Ga0495590_0093070 Ga0495590_0093070_300_959 218
530 3300046460 Ga0495638_0000076 Ga0495638_0000076_62812_63471 218
531 3300046472 Ga0495580_0005390 Ga0495580_0005390_5799_6458 218
532 3300046473 Ga0495582_0351190 Ga0495582_0351190_45_704 218
533 3300046477 Ga0495664_0029368 Ga0495664_0029368_1863_2537 218
534 3300046517 Ga0495630_0027825 Ga0495630_0027825_752_1414 218
535 3300046528 Ga0495642_0061689 Ga0495642_0061689_503_1162 218
536 3300046535 Ga0495586_0028194 Ga0495586_0028194_1088_1750 218
537 3300046642 Ga0495634_0016509 Ga0495634_0016509_195_857 218
538 3300046663 Ga0495635_0035407 Ga0495635_0035407_944_1606 218
539 3300046683 Ga0495658_0021276 Ga0495658_0021276_916_1578 218
540 3300046683 Ga0495658_0063281 Ga0495658_0063281_1179_1838 218
541 3300046689 Ga0495613_0111275 Ga0495613_0111275_628_1287 218
542 3300046689 Ga0495613_0369342 Ga0495613_0369342_260_922 218
543 3300046809 Ga0495600_0094436 Ga0495600_0094436_908_1573 218
544 3300047471 Ga0495684_0004148 Ga0495684_0004148_9012_9674 218
545 3300047472 Ga0495686_0030748 Ga0495686_0030748_1738_2394 218
546 3300048907 Ga0496104_0726862 Ga0496104_0726862_127_792 218
547 3300048912 Ga0496109_0094904 Ga0496109_0094904_21_686 218
548 3300048913 Ga0496110_0357966 Ga0496110_0357966_498_1163 218
549 3300048915 Ga0496112_0121007 Ga0496112_0121007_455_1120 218
550 3300048922 Ga0496119_0124990 Ga0496119_0124990_433_1098 218
551 3300049568 Ga0501031_0000443 Ga0501031_0000443_20424_21083 218
552 3300049573 Ga0501037_0061493 Ga0501037_0061493_1820_2479 218
553 3300049575 Ga0501039_0000557 Ga0501039_0000557_11296_11955 218
554 3300049576 Ga0501040_0054577 Ga0501040_0054577_1413_2072 218
555 3300049577 Ga0501041_0008931 Ga0501041_0008931_428_1087 218
556 3300049578 Ga0501042_0015462 Ga0501042_0015462_342_1001 218
557 3300049579 Ga0501043_0150410 Ga0501043_0150410_202_861 218
558 3300049580 Ga0501046_0000618 Ga0501046_0000618_14184_14843 218
559 3300049593 Ga0501077_0075471 Ga0501077_0075471_465_1124 218
560 3300049824 Ga0501045_0416940 Ga0501045_0416940_321_980 218
561 3300050508 nmdc:mga09592_170988_c1 nmdc:mga09592_170988_c1_1158_1823 218
562 3300050511 nmdc:mga08y16_151853_c1 nmdc:mga08y16_151853_c1_738_1397 218
563 3300050515 nmdc:mga0a205_237674_c1 nmdc:mga0a205_237674_c1_818_1480 218
564 3300053137 Ga0500561_0066706 Ga0500561_0066706_286_945 218
565 3300054114 Ga0501084_0641928 Ga0501084_0641928_50_709 218
566 3300001990 JGI24737J22298_10062575 JGI24737J22298_100625752 219
567 3300005293 Ga0065715_10350947 Ga0065715_103509471 219
568 3300005328 Ga0070676_10001365 Ga0070676_100013656 219
569 3300005328 Ga0070676_10275900 Ga0070676_102759002 219
570 3300005329 Ga0070683_100005497 Ga0070683_1000054973 219
571 3300005337 Ga0070682_100021240 Ga0070682_1000212402 219
572 3300005338 Ga0068868_100690047 Ga0068868_1006900471 219
573 3300005339 Ga0070660_100896162 Ga0070660_1008961621 219
574 3300005347 Ga0070668_100001796 Ga0070668_10000179614 219
575 3300005353 Ga0070669_100082448 Ga0070669_1000824483 219
576 3300005354 Ga0070675_100001838 Ga0070675_1000018387 219
577 3300005366 Ga0070659_100429742 Ga0070659_1004297422 219
578 3300005435 Ga0070714_100073232 Ga0070714_1000732323 219
579 3300005455 Ga0070663_100099150 Ga0070663_1000991502 219
580 3300005457 Ga0070662_100039407 Ga0070662_1000394072 219
581 3300005459 Ga0068867_100619731 Ga0068867_1006197311 219
582 3300005468 Ga0070707_100216115 Ga0070707_1002161153 219
583 3300005530 Ga0070679_100097836 Ga0070679_1000978362 219
584 3300005535 Ga0070684_100864457 Ga0070684_1008644571 219
585 3300005539 Ga0068853_100630553 Ga0068853_1006305532 219
586 3300005545 Ga0070695_100044466 Ga0070695_1000444662 219
587 3300005546 Ga0070696_100013767 Ga0070696_1000137672 219
588 3300005549 Ga0070704_100105819 Ga0070704_1001058192 219
589 3300005616 Ga0068852_100717822 Ga0068852_1007178221 219
590 3300005617 Ga0068859_101066579 Ga0068859_1010665792 219
591 3300005719 Ga0068861_100227085 Ga0068861_1002270852 219
592 3300005842 Ga0068858_100134901 Ga0068858_1001349013 219
593 3300005842 Ga0068858_100240978 Ga0068858_1002409783 219
594 3300005843 Ga0068860_100014481 Ga0068860_1000144815 219
595 3300005843 Ga0068860_100278133 Ga0068860_1002781332 219
596 3300005844 Ga0068862_100582241 Ga0068862_1005822412 219
597 3300005937 Ga0081455_10004441 Ga0081455_100044413 219
598 3300005937 Ga0081455_10155696 Ga0081455_101556962 219
599 3300005985 Ga0081539_10003337 Ga0081539_1000333715 219
600 3300006028 Ga0070717_10205125 Ga0070717_102051252 219
601 3300006175 Ga0070712_100569754 Ga0070712_1005697542 219
602 3300006844 Ga0075428_100007087 Ga0075428_1000070879 219
603 3300006846 Ga0075430_100044508 Ga0075430_1000445083 219
604 3300006847 Ga0075431_100003851 Ga0075431_1000038516 219
605 3300006847 Ga0075431_100159389 Ga0075431_1001593892 219
606 3300006880 Ga0075429_100011488 Ga0075429_1000114883 219
607 3300006880 Ga0075429_100133962 Ga0075429_1001339623 219
608 3300006931 Ga0097620_101066624 Ga0097620_1010666242 219
609 3300009147 Ga0114129_10000891 Ga0114129_100008919 219
610 3300009147 Ga0114129_10054512 Ga0114129_100545127 219
611 3300009147 Ga0114129_10064851 Ga0114129_100648513 219
612 3300009147 Ga0114129_10882256 Ga0114129_108822562 219
613 3300009174 Ga0105241_10220137 Ga0105241_102201373 219
614 3300009553 Ga0105249_10034979 Ga0105249_100349794 219
615 3300010375 Ga0105239_10075202 Ga0105239_100752022 219
616 3300010375 Ga0105239_10384936 Ga0105239_103849362 219
617 3300013105 Ga0157369_10347081 Ga0157369_103470813 219
618 3300013296 Ga0157374_10874867 Ga0157374_108748671 219
619 3300013297 Ga0157378_10081961 Ga0157378_100819612 219
620 3300013307 Ga0157372_10025291 Ga0157372_100252913 219
621 3300013308 Ga0157375_10037268 Ga0157375_100372683 219
622 3300013308 Ga0157375_10109113 Ga0157375_101091133 219
623 3300013308 Ga0157375_10171421 Ga0157375_101714212 219
624 3300014325 Ga0163163_10532846 Ga0163163_105328463 219
625 3300014745 Ga0157377_10000198 Ga0157377_1000019829 219
626 3300014968 Ga0157379_10508429 Ga0157379_105084291 219
627 3300025315 Ga0207697_10004662 Ga0207697_100046625 219
628 3300025898 Ga0207692_10083783 Ga0207692_100837832 219
629 3300025906 Ga0207699_10328238 Ga0207699_103282382 219
630 3300025907 Ga0207645_10004181 Ga0207645_100041817 219
631 3300025911 Ga0207654_10426063 Ga0207654_104260631 219
632 3300025915 Ga0207693_10036250 Ga0207693_100362503 219
633 3300025916 Ga0207663_10132285 Ga0207663_101322852 219
634 3300025921 Ga0207652_10059128 Ga0207652_100591282 219
635 3300025922 Ga0207646_10270890 Ga0207646_102708903 219
636 3300025923 Ga0207681_10018639 Ga0207681_100186394 219
637 3300025926 Ga0207659_10007179 Ga0207659_100071794 219
638 3300025929 Ga0207664_10419122 Ga0207664_104191221 219
639 3300025933 Ga0207706_10066354 Ga0207706_100663543 219
640 3300025936 Ga0207670_10100594 Ga0207670_101005943 219
641 3300025944 Ga0207661_10001181 Ga0207661_100011813 219
642 3300025945 Ga0207679_10316602 Ga0207679_103166023 219
643 3300025961 Ga0207712_10064913 Ga0207712_100649132 219
644 3300026023 Ga0207677_10630757 Ga0207677_106307572 219
645 3300026067 Ga0207678_10012175 Ga0207678_100121755 219
646 3300026075 Ga0207708_10088900 Ga0207708_100889003 219
647 3300026089 Ga0207648_10160525 Ga0207648_101605252 219
648 3300028381 Ga0268264_10012641 Ga0268264_100126416 219
649 3300028381 Ga0268264_10176766 Ga0268264_101767663 219
650 3300028556 Ga0265337_1000316 Ga0265337_10003168 219
651 3300028573 Ga0265334_10033751 Ga0265334_100337513 219
652 3300028786 Ga0307517_10165301 Ga0307517_101653011 219
653 3300028800 Ga0265338_10039682 Ga0265338_100396825 219
654 3300031344 Ga0265316_10078942 Ga0265316_100789421 219
655 3300031548 Ga0307408_100076296 Ga0307408_1000762962 219
656 3300031730 Ga0307516_10003536 Ga0307516_1000353612 219
657 3300031731 Ga0307405_10044543 Ga0307405_100445432 219
658 3300031824 Ga0307413_10036587 Ga0307413_100365872 219
659 3300031852 Ga0307410_10005296 Ga0307410_100052966 219
660 3300031901 Ga0307406_10073512 Ga0307406_100735122 219
661 3300031901 Ga0307406_10453210 Ga0307406_104532102 219
662 3300031995 Ga0307409_100013091 Ga0307409_1000130913 219
663 3300032002 Ga0307416_100009450 Ga0307416_1000094505 219
664 3300032002 Ga0307416_100549217 Ga0307416_1005492173 219
665 3300032126 Ga0307415_100602262 Ga0307415_1006022621 219
666 3300033180 Ga0307510_10014932 Ga0307510_100149326 219
667 3300035089 Ga0373944_0059718 Ga0373944_0059718_502_1164 219
668 3300035111 Ga0373923_0003042 Ga0373923_0003042_418_1080 219
669 3300035113 Ga0373936_0002263 Ga0373936_0002263_1442_2104 219
670 3300035114 Ga0373939_0110974 Ga0373939_0110974_23_685 219
671 3300035116 Ga0373945_0019842 Ga0373945_0019842_716_1378 219
672 3300035118 Ga0373954_0006708 Ga0373954_0006708_4287_4949 219
673 3300035170 Ga0373943_0001215 Ga0373943_0001215_3196_3858 219
674 3300035171 Ga0373946_0010546 Ga0373946_0010546_1928_2590 219
675 3300035172 Ga0373955_0000030 Ga0373955_0000030_19004_19666 219
676 3300035172 Ga0373955_0270189 Ga0373955_0270189_192_860 219
677 3300035410 Ga0373924_0001737 Ga0373924_0001737_3390_4052 219
678 3300035691 Ga0373931_0184243 Ga0373931_0184243_101_763 219
679 3300035692 Ga0373935_0000187 Ga0373935_0000187_16891_17553 219
680 3300035695 Ga0373927_0005916 Ga0373927_0005916_568_1230 219
681 3300035724 Ga0373933_0004479 Ga0373933_0004479_2812_3474 219
682 3300035725 Ga0373947_0009514 Ga0373947_0009514_3807_4469 219
683 3300036401 Ga0373937_0000004 Ga0373937_0000004_187191_187853 219
684 3300036401 Ga0373937_0036285 Ga0373937_0036285_2851_3519 219
685 3300036401 Ga0373937_0052754 Ga0373937_0052754_2033_2698 219
686 3300036401 Ga0373937_0690841 Ga0373937_0690841_275_940 219
687 3300037068 Ga0373925_0000095 Ga0373925_0000095_25160_25822 219
688 3300045051 Ga0451576_1050832 Ga0451576_1050832_167_826 219
689 3300045836 Ga0466958_0001808 Ga0466958_0001808_8373_9032 219
690 3300046454 Ga0495592_0000029 Ga0495592_0000029_27016_27678 219
691 3300046454 Ga0495592_0018005 Ga0495592_0018005_2383_3051 219
692 3300046459 Ga0495629_0012580 Ga0495629_0012580_5295_5957 219
693 3300046460 Ga0495638_0000093 Ga0495638_0000093_65935_66594 219
694 3300046462 Ga0495651_0000535 Ga0495651_0000535_12684_13346 219
695 3300046462 Ga0495651_0000635 Ga0495651_0000635_7021_7686 219
696 3300046462 Ga0495651_0301747 Ga0495651_0301747_49_717 219
697 3300046463 Ga0495653_0000045 Ga0495653_0000045_56669_57331 219
698 3300046463 Ga0495653_0008119 Ga0495653_0008119_119_784 219
699 3300046474 Ga0495605_0020081 Ga0495605_0020081_1846_2508 219
700 3300046474 Ga0495605_0060984 Ga0495605_0060984_376_1035 219
701 3300046475 Ga0495639_0192195 Ga0495639_0192195_121_783 219
702 3300046476 Ga0495662_0000642 Ga0495662_0000642_6194_6856 219
703 3300046476 Ga0495662_0103054 Ga0495662_0103054_105_770 219
704 3300046477 Ga0495664_0000004 Ga0495664_0000004_56680_57342 219
705 3300046492 Ga0495585_0008481 Ga0495585_0008481_70_729 219
706 3300046499 Ga0495594_0172197 Ga0495594_0172197_279_941 219
707 3300046506 Ga0495583_0209232 Ga0495583_0209232_50_715 219
708 3300046507 Ga0495606_0117698 Ga0495606_0117698_179_838 219
709 3300046511 Ga0495608_0000017 Ga0495608_0000017_56667_57329 219
710 3300046511 Ga0495608_0017056 Ga0495608_0017056_2285_2950 219
711 3300046512 Ga0495610_0084346 Ga0495610_0084346_72_737 219
712 3300046513 Ga0495616_0012057 Ga0495616_0012057_523_1182 219
713 3300046514 Ga0495618_0000006 Ga0495618_0000006_15773_16435 219
714 3300046514 Ga0495618_0049977 Ga0495618_0049977_809_1477 219
715 3300046516 Ga0495628_0000001 Ga0495628_0000001_56669_57331 219
716 3300046516 Ga0495628_0006115 Ga0495628_0006115_6919_7584 219
717 3300046516 Ga0495628_0023403 Ga0495628_0023403_3040_3708 219
718 3300046517 Ga0495630_0000303 Ga0495630_0000303_9536_10198 219
719 3300046518 Ga0495631_0012249 Ga0495631_0012249_2045_2704 219
720 3300046524 Ga0495648_0033095 Ga0495648_0033095_146_811 219
721 3300046529 Ga0495652_0000002 Ga0495652_0000002_271203_271865 219
722 3300046529 Ga0495652_0005576 Ga0495652_0005576_707_1372 219
723 3300046529 Ga0495652_0011733 Ga0495652_0011733_2382_3050 219
724 3300046529 Ga0495652_0151369 Ga0495652_0151369_13_681 219
725 3300046533 Ga0495640_0000001 Ga0495640_0000001_365207_365869 219
726 3300046533 Ga0495640_0098536 Ga0495640_0098536_944_1609 219
727 3300046535 Ga0495586_0069142 Ga0495586_0069142_1035_1697 219
728 3300046536 Ga0495587_0000008 Ga0495587_0000008_56887_57549 219
729 3300046536 Ga0495587_0007996 Ga0495587_0007996_3077_3742 219
730 3300046536 Ga0495587_0115598 Ga0495587_0115598_677_1345 219
731 3300046543 Ga0495645_0000002 Ga0495645_0000002_56682_57344 219
732 3300046543 Ga0495645_0001774 Ga0495645_0001774_10698_11363 219
733 3300046543 Ga0495645_0002759 Ga0495645_0002759_6769_7437 219
734 3300046557 Ga0495622_0011086 Ga0495622_0011086_1539_2204 219
735 3300046559 Ga0495667_0000029 Ga0495667_0000029_56678_57340 219
736 3300046559 Ga0495667_0015240 Ga0495667_0015240_3684_4349 219
737 3300046616 Ga0495668_0009692 Ga0495668_0009692_1062_1721 219
738 3300046642 Ga0495634_0000082 Ga0495634_0000082_11532_12194 219
739 3300046642 Ga0495634_0208645 Ga0495634_0208645_482_1147 219
740 3300046648 Ga0495611_0105865 Ga0495611_0105865_498_1163 219
741 3300046660 Ga0495625_0029935 Ga0495625_0029935_2887_3552 219
742 3300046663 Ga0495635_0000002 Ga0495635_0000002_429593_430255 219
743 3300046663 Ga0495635_0005110 Ga0495635_0005110_6128_6793 219
744 3300046675 Ga0495657_0000064 Ga0495657_0000064_36983_37645 219
745 3300046675 Ga0495657_0000420 Ga0495657_0000420_15785_16450 219
746 3300046675 Ga0495657_0129921 Ga0495657_0129921_502_1170 219
747 3300046678 Ga0495599_0000064 Ga0495599_0000064_56681_57343 219
748 3300046678 Ga0495599_0010608 Ga0495599_0010608_364_1032 219
749 3300046679 Ga0495623_0000065 Ga0495623_0000065_56696_57358 219
750 3300046679 Ga0495623_0006958 Ga0495623_0006958_1267_1932 219
751 3300046679 Ga0495623_0037915 Ga0495623_0037915_2221_2889 219
752 3300046680 Ga0495646_0000023 Ga0495646_0000023_56556_57218 219
753 3300046680 Ga0495646_0097833 Ga0495646_0097833_383_1051 219
754 3300046689 Ga0495613_0007912 Ga0495613_0007912_5985_6647 219
755 3300046689 Ga0495613_0019379 Ga0495613_0019379_3053_3718 219
756 3300046690 Ga0495624_0005364 Ga0495624_0005364_7300_7962 219
757 3300046691 Ga0495670_0104114 Ga0495670_0104114_10_669 219
758 3300046694 Ga0495649_0063690 Ga0495649_0063690_399_1064 219
759 3300046809 Ga0495600_0000010 Ga0495600_0000010_61918_62580 219
760 3300046809 Ga0495600_0000655 Ga0495600_0000655_14126_14791 219
761 3300046810 Ga0495660_0135100 Ga0495660_0135100_542_1201 219
762 3300047315 Ga0495581_0051738 Ga0495581_0051738_1064_1726 219
763 3300047317 Ga0495604_0000009 Ga0495604_0000009_268961_269623 219
764 3300047317 Ga0495604_0000914 Ga0495604_0000914_16760_17425 219
765 3300047317 Ga0495604_0096875 Ga0495604_0096875_88_756 219
766 3300047319 Ga0495674_0000002 Ga0495674_0000002_56670_57332 219
767 3300047319 Ga0495674_0002660 Ga0495674_0002660_15973_16638 219
768 3300047319 Ga0495674_0023398 Ga0495674_0023398_781_1449 219
769 3300047322 Ga0495680_0000263 Ga0495680_0000263_47218_47880 219
770 3300047322 Ga0495680_0001103 Ga0495680_0001103_10908_11573 219
771 3300047322 Ga0495680_0096225 Ga0495680_0096225_1208_1876 219
772 3300047444 Ga0495675_0000178 Ga0495675_0000178_26275_26937 219
773 3300047444 Ga0495675_0029861 Ga0495675_0029861_2433_3098 219
774 3300047469 Ga0495673_0009986 Ga0495673_0009986_2154_2819 219
775 3300047471 Ga0495684_0000006 Ga0495684_0000006_56629_57291 219
776 3300047471 Ga0495684_0028331 Ga0495684_0028331_680_1345 219
777 3300047472 Ga0495686_0079584 Ga0495686_0079584_1169_1834 219
778 3300047673 Ga0495593_0000938 Ga0495593_0000938_3400_4062 219
779 3300048088 Ga0495602_0000005 Ga0495602_0000005_288342_289004 219
780 3300048088 Ga0495602_0001998 Ga0495602_0001998_16255_16920 219
781 3300048088 Ga0495602_0037794 Ga0495602_0037794_373_1041 219
782 3300048091 Ga0495626_0043230 Ga0495626_0043230_1136_1795 219
783 3300048904 Ga0496101_0119774 Ga0496101_0119774_553_1221 219
784 3300048905 Ga0496102_0030887 Ga0496102_0030887_306_974 219
785 3300048907 Ga0496104_0118266 Ga0496104_0118266_538_1206 219
786 3300048907 Ga0496104_0551049 Ga0496104_0551049_20_679 219
787 3300048908 Ga0496105_0182732 Ga0496105_0182732_515_1174 219
788 3300048909 Ga0496106_0392346 Ga0496106_0392346_375_1040 219
789 3300048910 Ga0496107_0673962 Ga0496107_0673962_30_695 219
790 3300048912 Ga0496109_0243748 Ga0496109_0243748_644_1312 219
791 3300048913 Ga0496110_0078706 Ga0496110_0078706_114_782 219
792 3300048917 Ga0496114_0042977 Ga0496114_0042977_1741_2409 219
793 3300048917 Ga0496114_0069779 Ga0496114_0069779_573_1232 219
794 3300048918 Ga0496115_0012130 Ga0496115_0012130_698_1366 219
795 3300048918 Ga0496115_0118344 Ga0496115_0118344_872_1537 219
796 3300048919 Ga0496116_0134725 Ga0496116_0134725_188_853 219
797 3300048922 Ga0496119_0097681 Ga0496119_0097681_400_1065 219
798 3300048924 Ga0496121_0011085 Ga0496121_0011085_1366_2031 219
799 3300049577 Ga0501041_0366786 Ga0501041_0366786_18_680 219
800 3300049741 Ga0501079_0204719 Ga0501079_0204719_845_1507 219
801 3300049742 Ga0501080_0217022 Ga0501080_0217022_820_1482 219
802 3300050507 nmdc:mga05p37_30750_c1 nmdc:mga05p37_30750_c1_2194_2853 219
803 3300050507 nmdc:mga05p37_455017_c1 nmdc:mga05p37_455017_c1_190_852 219
804 3300050507 nmdc:mga05p37_8001_c1 nmdc:mga05p37_8001_c1_3531_4193 219
805 3300050508 nmdc:mga09592_38963_c1 nmdc:mga09592_38963_c1_189_848 219
806 3300050508 nmdc:mga09592_4520_c1 nmdc:mga09592_4520_c1_8099_8761 219
807 3300050509 nmdc:mga0qj67_101788_c1 nmdc:mga0qj67_101788_c1_639_1301 219
808 3300050510 nmdc:mga06r32_1020651_c1 nmdc:mga06r32_1020651_c1_39_701 219
809 3300050510 nmdc:mga06r32_137278_c1 nmdc:mga06r32_137278_c1_1162_1821 219
810 3300050510 nmdc:mga06r32_192836_c1 nmdc:mga06r32_192836_c1_713_1375 219
811 3300050512 nmdc:mga0n895_305045_c1 nmdc:mga0n895_305045_c1_196_858 219
812 3300050512 nmdc:mga0n895_705693_c1 nmdc:mga0n895_705693_c1_13_672 219
813 3300050516 nmdc:mga0sz30_22890_c1 nmdc:mga0sz30_22890_c1_1584_2249 219
814 3300053077 Ga0495601_0000002 Ga0495601_0000002_254130_254792 219
815 3300053077 Ga0495601_0004704 Ga0495601_0004704_1635_2303 219
816 3300053078 Ga0495612_0000010 Ga0495612_0000010_190018_190680 219
817 3300053078 Ga0495612_0012369 Ga0495612_0012369_2001_2669 219
818 3300053080 Ga0500635_0024327 Ga0500635_0024327_108_773 219
819 3300053084 Ga0495595_0000020 Ga0495595_0000020_56679_57341 219
820 3300053084 Ga0495595_0146971 Ga0495595_0146971_469_1134 219
821 3300053085 Ga0495619_0000110 Ga0495619_0000110_4099_4761 219
822 3300053085 Ga0495619_0064804 Ga0495619_0064804_1596_2261 219
823 3300053086 Ga0500578_0027242 Ga0500578_0027242_2186_2845 219
824 3300053086 Ga0500578_0058076 Ga0500578_0058076_1479_2141 219
825 3300053086 Ga0500578_0064340 Ga0500578_0064340_262_927 219
826 3300053093 Ga0500651_0180341 Ga0500651_0180341_515_1177 219
827 3300053095 Ga0500640_011131 Ga0500640_011131_1674_2339 219
828 3300053098 Ga0500650_0086107 Ga0500650_0086107_170_829 219
829 3300053118 Ga0500594_0001033 Ga0500594_0001033_3265_3924 219
830 3300053119 Ga0500595_043384 Ga0500595_043384_555_1220 219
831 3300053121 Ga0500607_008886 Ga0500607_008886_4063_4728 219
832 3300053122 Ga0500608_012584 Ga0500608_012584_1713_2378 219
833 3300053123 Ga0500614_071949 Ga0500614_071949_122_787 219
834 3300053148 Ga0500590_039601 Ga0500590_039601_1633_2298 219
835 3300053153 Ga0500616_0002984 Ga0500616_0002984_421_1080 219
836 3300053158 Ga0500627_0095076 Ga0500627_0095076_82_741 219
837 3300053177 Ga0500636_0000045 Ga0500636_0000045_36783_37448 219
838 3300053177 Ga0500636_0097394 Ga0500636_0097394_372_1037 219
839 3300053737 Ga0500601_000031 Ga0500601_000031_8167_8832 219
840 3300060353 Ga0501082_0203974 Ga0501082_0203974_675_1337 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19266

CIS_tube

Contractile injection system tube protein

36

200

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0n-assembly1.cif.gz_b cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6759 9 176
5xvq-assembly2.cif.gz_B crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) 0.665 146 174
7ble-assembly1.cif.gz_A co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the tricyclic inhibitor (3) 0.6644 146 176
6rbk-assembly1.cif.gz_A cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised 0.6613 4 175
7nbj-assembly3.cif.gz_C co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (1) 0.6608 146 176
ID Description Score Start End Superfamily
5yjfD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6556 146 176 3.40.50.150
af_Q57569_1_152_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.6039 143 176 2.30.130.40
af_B4F829_3_112_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.5771 146 173 3.30.70.330
1u8sB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.5683 146 204 3.30.70.260
af_A4IBP9_129_371_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5238 146 174 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A023XMJ8-F1-model_v4 deleted 0.9557 16 219
AF-A0A1J5PEY2-F1-model_v4 Contractile injection system tube protein N-terminal domain-containing protein 0.9451 31 219
AF-A0A023XMJ8-F1-model_v4 deleted 0.9422 16 219
AF-A0A1J5PEY2-F1-model_v4 Contractile injection system tube protein N-terminal domain-containing protein 0.9356 31 219
AF-A0A7W7XGP1-F1-model_v4 Uncharacterized protein 0.9204 6 218

Feature Viewer

pLDDT pTM Quality
87.37 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map