F483046
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 840 | 438 | 795 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100278133|Ga0068860_1002781332 |
| Length | 242 |
| Sequence | VDLEKLARSLGCKPNLADWIDMSTFPNSPRLLKGGIVLLDPETAAVRRIISLQYNPDTLTRSLQIQGVSAEGGSGDRSEILRLKGPPVETIKLDAEIDATDQLEFPDQNANAVEVGIHPQLAALEAIVYPSSNQLQSNNALAKSGTLEIIPMQSALTLFIWSKNRIIPVRLTDFSITEEAFDPNLNPIRAKVSLGMRVLSVNDVGFDAKAGSLYMTYQQQKERLAGLAPAGSFANLGIKGIT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 3 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 4 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 5 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 6 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 7 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 8 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 9 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 10 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 11 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 12 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 13 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 14 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 15 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 16 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 17 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 18 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 19 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 20 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 21 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 22 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 23 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 24 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 25 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 26 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 27 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 28 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 29 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 30 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 31 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 32 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 33 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 34 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 35 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 36 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 37 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 38 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 39 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 40 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 41 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 157 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 158 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 229 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 235 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 240 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 258 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 270 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 271 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 274 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 275 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 351 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 352 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 353 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 382 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 383 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 384 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 389 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 391 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 394 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 406 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 412 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 413 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 415 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 416 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 421 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 423 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 427 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 430 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 433 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 434 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 435 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 436 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 437 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 438 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.29 |
| Metatranscriptomes | 0.36 |
| Isolates | 5.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.69 |
| Nodule | 4.29 |
| Rhizoplane | 4.17 |
| Rhizosphere | 83.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10062575 | 3300001990 | Unclassified | 1118 |
| 2 | JGI25162J39368_1000021 | 3300002737 | Bacteria | 248155 |
| 3 | JGI25162J39368_1000707 | 3300002737 | Bacteria | 23218 |
| 4 | rootL2_10045889 | 3300003322 | Bacteria | 14944 |
| 5 | Ga0065715_10350947 | 3300005293 | Bacteria | 935 |
| 6 | Ga0070658_10024973 | 3300005327 | Bacteria | 4792 |
| 7 | Ga0070676_10001365 | 3300005328 | Bacteria | 12295 |
| 8 | Ga0070676_10275900 | 3300005328 | Bacteria | 1131 |
| 9 | Ga0070683_100005497 | 3300005329 | Bacteria | 10585 |
| 10 | Ga0070683_100244370 | 3300005329 | Unclassified | 1707 |
| 11 | Ga0070670_100019037 | 3300005331 | Bacteria | 5887 |
| 12 | Ga0070670_100453797 | 3300005331 | Unclassified | 1136 |
| 13 | Ga0070680_100007785 | 3300005336 | Bacteria | 8166 |
| 14 | Ga0070680_100029492 | 3300005336 | Bacteria | 4407 |
| 15 | Ga0070680_100249716 | 3300005336 | Bacteria | 1500 |
| 16 | Ga0070682_100005081 | 3300005337 | Bacteria | 7315 |
| 17 | Ga0070682_100021240 | 3300005337 | Unclassified | 3827 |
| 18 | Ga0070682_100052021 | 3300005337 | Unclassified | 2562 |
| 19 | Ga0070682_100118182 | 3300005337 | Bacteria | 1776 |
| 20 | Ga0068868_100000525 | 3300005338 | Bacteria | 25646 |
| 21 | Ga0068868_100690047 | 3300005338 | Bacteria | 913 |
| 22 | Ga0070660_100004581 | 3300005339 | Bacteria | 9554 |
| 23 | Ga0070660_100032659 | 3300005339 | Bacteria | 3919 |
| 24 | Ga0070660_100896162 | 3300005339 | Unclassified | 748 |
| 25 | Ga0070661_100025467 | 3300005344 | Bacteria | 4252 |
| 26 | Ga0070661_100026941 | 3300005344 | Bacteria | 4137 |
| 27 | Ga0070668_100001796 | 3300005347 | Bacteria | 15603 |
| 28 | Ga0070669_100082448 | 3300005353 | Unclassified | 2397 |
| 29 | Ga0070675_100001838 | 3300005354 | Bacteria | 15687 |
| 30 | Ga0070675_100021607 | 3300005354 | Bacteria | 5142 |
| 31 | Ga0070675_100030163 | 3300005354 | Bacteria | 4376 |
| 32 | Ga0070675_100033989 | 3300005354 | Bacteria | 4136 |
| 33 | Ga0070675_100095108 | 3300005354 | Bacteria | 2501 |
| 34 | Ga0070675_100664971 | 3300005354 | Bacteria | 947 |
| 35 | Ga0070671_100128317 | 3300005355 | Bacteria | 2135 |
| 36 | Ga0070671_100372922 | 3300005355 | Unclassified | 1219 |
| 37 | Ga0070674_100039663 | 3300005356 | Bacteria | 3181 |
| 38 | Ga0070674_100051574 | 3300005356 | Unclassified | 2836 |
| 39 | Ga0070673_100072012 | 3300005364 | Bacteria | 2778 |
| 40 | Ga0070673_100111521 | 3300005364 | Unclassified | 2269 |
| 41 | Ga0070688_100005618 | 3300005365 | Bacteria | 6617 |
| 42 | Ga0070688_100041178 | 3300005365 | Bacteria | 2834 |
| 43 | Ga0070688_100086340 | 3300005365 | Bacteria | 2041 |
| 44 | Ga0070659_100017169 | 3300005366 | Bacteria | 5440 |
| 45 | Ga0070659_100020312 | 3300005366 | Bacteria | 5044 |
| 46 | Ga0070659_100429742 | 3300005366 | Bacteria | 1118 |
| 47 | Ga0070667_100281844 | 3300005367 | Unclassified | 1492 |
| 48 | Ga0070703_10000028 | 3300005406 | Bacteria | 70844 |
| 49 | Ga0070709_10001310 | 3300005434 | Bacteria | 13561 |
| 50 | Ga0070709_10047141 | 3300005434 | Bacteria | 2683 |
| 51 | Ga0070714_100073232 | 3300005435 | Bacteria | 2968 |
| 52 | Ga0070714_100100534 | 3300005435 | Bacteria | 2547 |
| 53 | Ga0070714_100354589 | 3300005435 | Bacteria | 1378 |
| 54 | Ga0070713_100009503 | 3300005436 | Bacteria | 6966 |
| 55 | Ga0070713_100011411 | 3300005436 | Bacteria | 6472 |
| 56 | Ga0070713_100016390 | 3300005436 | Bacteria | 5571 |
| 57 | Ga0070713_100334351 | 3300005436 | Bacteria | 1402 |
| 58 | Ga0070710_10037147 | 3300005437 | Bacteria | 2667 |
| 59 | Ga0070711_100061942 | 3300005439 | Bacteria | 2606 |
| 60 | Ga0070711_100331230 | 3300005439 | Bacteria | 1219 |
| 61 | Ga0070700_100026559 | 3300005441 | Bacteria | 3421 |
| 62 | Ga0070694_100141269 | 3300005444 | Unclassified | 1749 |
| 63 | Ga0070708_100001158 | 3300005445 | Bacteria | 20294 |
| 64 | Ga0070708_100033795 | 3300005445 | Bacteria | 4444 |
| 65 | Ga0070663_100060139 | 3300005455 | Unclassified | 2732 |
| 66 | Ga0070663_100099150 | 3300005455 | Bacteria | 2171 |
| 67 | Ga0070678_100093752 | 3300005456 | Bacteria | 2309 |
| 68 | Ga0070662_100039407 | 3300005457 | Unclassified | 3360 |
| 69 | Ga0070662_100139938 | 3300005457 | Unclassified | 1874 |
| 70 | Ga0070681_10014527 | 3300005458 | Bacteria | 7836 |
| 71 | Ga0070681_10601079 | 3300005458 | Bacteria | 1014 |
| 72 | Ga0068867_100062849 | 3300005459 | Bacteria | 2759 |
| 73 | Ga0068867_100619731 | 3300005459 | Bacteria | 946 |
| 74 | Ga0070685_10023921 | 3300005466 | Unclassified | 3350 |
| 75 | Ga0070685_10256918 | 3300005466 | Bacteria | 1160 |
| 76 | Ga0070706_100000054 | 3300005467 | Bacteria | 138243 |
| 77 | Ga0070706_100002050 | 3300005467 | Bacteria | 20660 |
| 78 | Ga0070706_100010342 | 3300005467 | Bacteria | 8668 |
| 79 | Ga0070706_100106436 | 3300005467 | Unclassified | 2609 |
| 80 | Ga0070706_100242415 | 3300005467 | Unclassified | 1683 |
| 81 | Ga0070706_100632978 | 3300005467 | Unclassified | 993 |
| 82 | Ga0070707_100000239 | 3300005468 | Bacteria | 54793 |
| 83 | Ga0070707_100216115 | 3300005468 | Bacteria | 1868 |
| 84 | Ga0070707_100854076 | 3300005468 | Bacteria | 874 |
| 85 | Ga0070698_100044407 | 3300005471 | Bacteria | 4551 |
| 86 | Ga0070698_100477253 | 3300005471 | Unclassified | 1184 |
| 87 | Ga0070698_100723730 | 3300005471 | Bacteria | 938 |
| 88 | Ga0070699_100000537 | 3300005518 | Bacteria | 35816 |
| 89 | Ga0070699_100268587 | 3300005518 | Bacteria | 1526 |
| 90 | Ga0070699_100837631 | 3300005518 | Bacteria | 842 |
| 91 | Ga0070699_100905235 | 3300005518 | Bacteria | 808 |
| 92 | Ga0070679_100002001 | 3300005530 | Bacteria | 18303 |
| 93 | Ga0070679_100093100 | 3300005530 | Bacteria | 3001 |
| 94 | Ga0070679_100097836 | 3300005530 | Bacteria | 2922 |
| 95 | Ga0070679_100110006 | 3300005530 | Unclassified | 2742 |
| 96 | Ga0070684_100172892 | 3300005535 | Unclassified | 1962 |
| 97 | Ga0070684_100259545 | 3300005535 | Bacteria | 1589 |
| 98 | Ga0070684_100369344 | 3300005535 | Bacteria | 1321 |
| 99 | Ga0070684_100864457 | 3300005535 | Unclassified | 847 |
| 100 | Ga0070697_100082945 | 3300005536 | Bacteria | 2643 |
| 101 | Ga0070697_100485789 | 3300005536 | Unclassified | 1079 |
| 102 | Ga0068853_100000009 | 3300005539 | Bacteria | 257819 |
| 103 | Ga0068853_100012548 | 3300005539 | Bacteria | 6893 |
| 104 | Ga0068853_100105098 | 3300005539 | Unclassified | 2501 |
| 105 | Ga0068853_100202288 | 3300005539 | Bacteria | 1808 |
| 106 | Ga0068853_100420619 | 3300005539 | Bacteria | 1253 |
| 107 | Ga0068853_100630553 | 3300005539 | Unclassified | 1019 |
| 108 | Ga0070672_100024811 | 3300005543 | Bacteria | 4438 |
| 109 | Ga0070672_100160954 | 3300005543 | Bacteria | 1862 |
| 110 | Ga0070695_100044466 | 3300005545 | Bacteria | 2828 |
| 111 | Ga0070695_100190549 | 3300005545 | Unclassified | 1459 |
| 112 | Ga0070696_100005655 | 3300005546 | Bacteria | 8354 |
| 113 | Ga0070696_100013767 | 3300005546 | Bacteria | 5432 |
| 114 | Ga0070696_100081829 | 3300005546 | Bacteria | 2288 |
| 115 | Ga0070693_100096813 | 3300005547 | Bacteria | 1790 |
| 116 | Ga0070665_100090139 | 3300005548 | Bacteria | 3072 |
| 117 | Ga0070704_100012085 | 3300005549 | Bacteria | 5323 |
| 118 | Ga0070704_100105819 | 3300005549 | Bacteria | 2131 |
| 119 | Ga0068855_100051207 | 3300005563 | Bacteria | 4864 |
| 120 | Ga0068855_100130656 | 3300005563 | Bacteria | 2868 |
| 121 | Ga0068855_100175622 | 3300005563 | Unclassified | 2424 |
| 122 | Ga0068855_100444100 | 3300005563 | Bacteria | 1416 |
| 123 | Ga0068855_100615990 | 3300005563 | Bacteria | 1169 |
| 124 | Ga0070664_100010698 | 3300005564 | Bacteria | 7440 |
| 125 | Ga0070664_100047406 | 3300005564 | Bacteria | 3630 |
| 126 | Ga0070664_100065958 | 3300005564 | Bacteria | 3090 |
| 127 | Ga0070664_100083669 | 3300005564 | Bacteria | 2753 |
| 128 | Ga0068857_100019637 | 3300005577 | Bacteria | 5937 |
| 129 | Ga0068857_100328970 | 3300005577 | Unclassified | 1412 |
| 130 | Ga0068857_100665212 | 3300005577 | Bacteria | 988 |
| 131 | Ga0068854_100759538 | 3300005578 | Bacteria | 842 |
| 132 | Ga0068856_100067066 | 3300005614 | Bacteria | 3546 |
| 133 | Ga0068856_100159430 | 3300005614 | Bacteria | 2266 |
| 134 | Ga0070702_100176784 | 3300005615 | Bacteria | 1393 |
| 135 | Ga0068852_100301393 | 3300005616 | Bacteria | 1551 |
| 136 | Ga0068852_100321810 | 3300005616 | Bacteria | 1502 |
| 137 | Ga0068852_100717822 | 3300005616 | Bacteria | 1010 |
| 138 | Ga0068859_100004794 | 3300005617 | Bacteria | 13765 |
| 139 | Ga0068859_101066579 | 3300005617 | Bacteria | 888 |
| 140 | Ga0068864_100003643 | 3300005618 | Bacteria | 12736 |
| 141 | Ga0068864_100008166 | 3300005618 | Bacteria | 8632 |
| 142 | Ga0068864_100019477 | 3300005618 | Bacteria | 5674 |
| 143 | Ga0068864_100750907 | 3300005618 | Bacteria | 956 |
| 144 | Ga0068861_100227085 | 3300005719 | Unclassified | 1581 |
| 145 | Ga0068851_10081585 | 3300005834 | Bacteria | 1690 |
| 146 | Ga0068870_10018510 | 3300005840 | Bacteria | 3365 |
| 147 | Ga0068870_10318004 | 3300005840 | Bacteria | 988 |
| 148 | Ga0068863_100015093 | 3300005841 | Bacteria | 7421 |
| 149 | Ga0068863_100393604 | 3300005841 | Bacteria | 1354 |
| 150 | Ga0068858_100134901 | 3300005842 | Bacteria | 2316 |
| 151 | Ga0068858_100240978 | 3300005842 | Bacteria | 1716 |
| 152 | Ga0068858_100875001 | 3300005842 | Unclassified | 878 |
| 153 | Ga0068860_100014481 | 3300005843 | Bacteria | 7721 |
| 154 | Ga0068860_100278133 | 3300005843 | Unclassified | 1635 |
| 155 | Ga0068862_100582241 | 3300005844 | Unclassified | 1072 |
| 156 | Ga0081455_10004441 | 3300005937 | Bacteria | 15739 |
| 157 | Ga0081455_10026936 | 3300005937 | Bacteria | 5275 |
| 158 | Ga0081455_10155696 | 3300005937 | Unclassified | 1757 |
| 159 | Ga0081540_1002973 | 3300005983 | Bacteria | 13591 |
| 160 | Ga0081539_10003337 | 3300005985 | Bacteria | 19955 |
| 161 | Ga0070717_10008698 | 3300006028 | Bacteria | 7595 |
| 162 | Ga0070717_10011578 | 3300006028 | Bacteria | 6705 |
| 163 | Ga0070717_10059834 | 3300006028 | Bacteria | 3153 |
| 164 | Ga0070717_10205125 | 3300006028 | Bacteria | 1728 |
| 165 | Ga0070717_10205568 | 3300006028 | Bacteria | 1726 |
| 166 | Ga0075365_10205618 | 3300006038 | Bacteria | 1380 |
| 167 | Ga0070712_100021750 | 3300006175 | Bacteria | 4217 |
| 168 | Ga0070712_100313185 | 3300006175 | Unclassified | 1274 |
| 169 | Ga0070712_100403787 | 3300006175 | Bacteria | 1129 |
| 170 | Ga0070712_100569754 | 3300006175 | Unclassified | 956 |
| 171 | Ga0075367_10063345 | 3300006178 | Unclassified | 2210 |
| 172 | Ga0097621_100997034 | 3300006237 | Unclassified | 783 |
| 173 | Ga0068871_100289320 | 3300006358 | Bacteria | 1435 |
| 174 | Ga0068871_100393601 | 3300006358 | Unclassified | 1233 |
| 175 | Ga0075428_100007087 | 3300006844 | Bacteria | 12418 |
| 176 | Ga0075430_100044508 | 3300006846 | Bacteria | 3753 |
| 177 | Ga0075431_100003851 | 3300006847 | Bacteria | 14593 |
| 178 | Ga0075431_100159389 | 3300006847 | Bacteria | 2321 |
| 179 | Ga0075433_10078796 | 3300006852 | Bacteria | 2903 |
| 180 | Ga0075434_100082850 | 3300006871 | Bacteria | 3205 |
| 181 | Ga0075434_100996338 | 3300006871 | Unclassified | 852 |
| 182 | Ga0075429_100011488 | 3300006880 | Bacteria | 7678 |
| 183 | Ga0075429_100133962 | 3300006880 | Bacteria | 2168 |
| 184 | Ga0075429_100184828 | 3300006880 | Bacteria | 1826 |
| 185 | Ga0075429_100230223 | 3300006880 | Unclassified | 1623 |
| 186 | Ga0075429_100773110 | 3300006880 | Bacteria | 841 |
| 187 | Ga0068865_100872312 | 3300006881 | Bacteria | 781 |
| 188 | Ga0075436_100000966 | 3300006914 | Bacteria | 19290 |
| 189 | Ga0075436_100222643 | 3300006914 | Bacteria | 1339 |
| 190 | Ga0097620_100004794 | 3300006931 | Bacteria | 13765 |
| 191 | Ga0097620_101066624 | 3300006931 | Bacteria | 888 |
| 192 | Ga0075435_100002824 | 3300007076 | Bacteria | 11624 |
| 193 | Ga0105240_10000649 | 3300009093 | Bacteria | 64145 |
| 194 | Ga0105240_10296091 | 3300009093 | Bacteria | 1853 |
| 195 | Ga0105240_10462672 | 3300009093 | Bacteria | 1417 |
| 196 | Ga0105240_11077015 | 3300009093 | Bacteria | 856 |
| 197 | Ga0105240_11105534 | 3300009093 | Bacteria | 843 |
| 198 | Ga0111539_10080785 | 3300009094 | Bacteria | 3824 |
| 199 | Ga0111539_10171353 | 3300009094 | Bacteria | 2536 |
| 200 | Ga0111539_10195393 | 3300009094 | Bacteria | 2360 |
| 201 | Ga0111539_10682201 | 3300009094 | Bacteria | 1196 |
| 202 | Ga0111539_11271653 | 3300009094 | Bacteria | 854 |
| 203 | Ga0105245_10095366 | 3300009098 | Bacteria | 2745 |
| 204 | Ga0105247_10653800 | 3300009101 | Bacteria | 786 |
| 205 | Ga0114129_10000891 | 3300009147 | Bacteria | 38929 |
| 206 | Ga0114129_10000925 | 3300009147 | Bacteria | 38300 |
| 207 | Ga0114129_10040003 | 3300009147 | Bacteria | 6613 |
| 208 | Ga0114129_10054512 | 3300009147 | Bacteria | 5605 |
| 209 | Ga0114129_10064851 | 3300009147 | Bacteria | 5098 |
| 210 | Ga0114129_10882256 | 3300009147 | Bacteria | 1135 |
| 211 | Ga0105241_10000325 | 3300009174 | Bacteria | 36012 |
| 212 | Ga0105241_10220137 | 3300009174 | Bacteria | 1595 |
| 213 | Ga0105242_10195875 | 3300009176 | Bacteria | 1792 |
| 214 | Ga0105248_10107692 | 3300009177 | Bacteria | 3143 |
| 215 | Ga0105237_10025607 | 3300009545 | Bacteria | 6030 |
| 216 | Ga0105237_10045862 | 3300009545 | Bacteria | 4398 |
| 217 | Ga0105238_10000947 | 3300009551 | Bacteria | 29742 |
| 218 | Ga0105238_10133817 | 3300009551 | Bacteria | 2457 |
| 219 | Ga0105238_10345425 | 3300009551 | Bacteria | 1477 |
| 220 | Ga0105249_10003319 | 3300009553 | Bacteria | 13938 |
| 221 | Ga0105249_10034979 | 3300009553 | Unclassified | 4554 |
| 222 | Ga0105239_10017597 | 3300010375 | Bacteria | 7904 |
| 223 | Ga0105239_10031131 | 3300010375 | Bacteria | 5870 |
| 224 | Ga0105239_10042919 | 3300010375 | Bacteria | 4955 |
| 225 | Ga0105239_10075202 | 3300010375 | Unclassified | 3713 |
| 226 | Ga0105239_10384936 | 3300010375 | Bacteria | 1586 |
| 227 | Ga0157373_10021393 | 3300013100 | Bacteria | 4699 |
| 228 | Ga0157371_10091760 | 3300013102 | Bacteria | 2151 |
| 229 | Ga0157370_10032254 | 3300013104 | Bacteria | 5116 |
| 230 | Ga0157369_10065706 | 3300013105 | Bacteria | 3904 |
| 231 | Ga0157369_10101650 | 3300013105 | Bacteria | 3063 |
| 232 | Ga0157369_10136893 | 3300013105 | Unclassified | 2592 |
| 233 | Ga0157369_10347081 | 3300013105 | Unclassified | 1542 |
| 234 | Ga0157369_10763249 | 3300013105 | Bacteria | 994 |
| 235 | Ga0157374_10222083 | 3300013296 | Bacteria | 1854 |
| 236 | Ga0157374_10874867 | 3300013296 | Bacteria | 916 |
| 237 | Ga0157378_10081961 | 3300013297 | Bacteria | 2917 |
| 238 | Ga0157378_10816576 | 3300013297 | Bacteria | 959 |
| 239 | Ga0163162_10011067 | 3300013306 | Bacteria | 8789 |
| 240 | Ga0163162_10039284 | 3300013306 | Unclassified | 4728 |
| 241 | Ga0163162_10085424 | 3300013306 | Bacteria | 3232 |
| 242 | Ga0163162_10470983 | 3300013306 | Unclassified | 1388 |
| 243 | Ga0157372_10025291 | 3300013307 | Bacteria | 6453 |
| 244 | Ga0157372_10034586 | 3300013307 | Bacteria | 5556 |
| 245 | Ga0157372_10093746 | 3300013307 | Bacteria | 3418 |
| 246 | Ga0157372_10122700 | 3300013307 | Bacteria | 2986 |
| 247 | Ga0157372_10242030 | 3300013307 | Unclassified | 2093 |
| 248 | Ga0157372_10339840 | 3300013307 | Bacteria | 1749 |
| 249 | Ga0157375_10025565 | 3300013308 | Bacteria | 5489 |
| 250 | Ga0157375_10037268 | 3300013308 | Bacteria | 4658 |
| 251 | Ga0157375_10093753 | 3300013308 | Bacteria | 3069 |
| 252 | Ga0157375_10109113 | 3300013308 | Bacteria | 2863 |
| 253 | Ga0157375_10171421 | 3300013308 | Unclassified | 2318 |
| 254 | Ga0157375_10597604 | 3300013308 | Bacteria | 1263 |
| 255 | Ga0157375_10640911 | 3300013308 | Unclassified | 1219 |
| 256 | Ga0163163_10010087 | 3300014325 | Bacteria | 8474 |
| 257 | Ga0163163_10054362 | 3300014325 | Bacteria | 3956 |
| 258 | Ga0163163_10204127 | 3300014325 | Bacteria | 2025 |
| 259 | Ga0163163_10215476 | 3300014325 | Unclassified | 1969 |
| 260 | Ga0163163_10395448 | 3300014325 | Bacteria | 1440 |
| 261 | Ga0163163_10532846 | 3300014325 | Bacteria | 1237 |
| 262 | Ga0157380_10008561 | 3300014326 | Bacteria | 7314 |
| 263 | Ga0157380_10087328 | 3300014326 | Bacteria | 2564 |
| 264 | Ga0157380_10184688 | 3300014326 | Unclassified | 1835 |
| 265 | Ga0157380_10808738 | 3300014326 | Bacteria | 955 |
| 266 | Ga0157380_11124458 | 3300014326 | Bacteria | 826 |
| 267 | Ga0182008_10193236 | 3300014497 | Bacteria | 1033 |
| 268 | Ga0157377_10000198 | 3300014745 | Bacteria | 33472 |
| 269 | Ga0157377_10636794 | 3300014745 | Bacteria | 765 |
| 270 | Ga0157379_10508429 | 3300014968 | Bacteria | 1117 |
| 271 | Ga0157379_10710492 | 3300014968 | Unclassified | 944 |
| 272 | Ga0157379_10769308 | 3300014968 | Unclassified | 907 |
| 273 | Ga0157376_10076551 | 3300014969 | Bacteria | 2859 |
| 274 | Ga0157376_10093323 | 3300014969 | Bacteria | 2612 |
| 275 | Ga0157376_10339400 | 3300014969 | Bacteria | 1434 |
| 276 | Ga0157376_10409255 | 3300014969 | Unclassified | 1313 |
| 277 | Ga0157376_10501507 | 3300014969 | Bacteria | 1193 |
| 278 | Ga0163161_10005882 | 3300017792 | Bacteria | 8509 |
| 279 | Ga0163161_10018771 | 3300017792 | Bacteria | 4847 |
| 280 | Ga0206356_10545819 | 3300020070 | Bacteria | 2102 |
| 281 | Ga0206353_11476788 | 3300020082 | Bacteria | 1154 |
| 282 | Ga0213876_10000383 | 3300021384 | Bacteria | 37442 |
| 283 | Ga0213876_10004391 | 3300021384 | Bacteria | 7902 |
| 284 | Ga0213875_10132095 | 3300021388 | Bacteria | 1167 |
| 285 | Ga0209025_1055119 | 3300025294 | Bacteria | 1540 |
| 286 | Ga0207697_10004662 | 3300025315 | Bacteria | 6501 |
| 287 | Ga0207656_10114125 | 3300025321 | Bacteria | 1252 |
| 288 | Ga0207653_10000047 | 3300025885 | Bacteria | 91340 |
| 289 | Ga0207682_10001298 | 3300025893 | Bacteria | 11470 |
| 290 | Ga0207682_10024997 | 3300025893 | Unclassified | 2367 |
| 291 | Ga0207692_10004054 | 3300025898 | Bacteria | 5773 |
| 292 | Ga0207692_10083783 | 3300025898 | Unclassified | 1712 |
| 293 | Ga0207680_10064063 | 3300025903 | Bacteria | 2252 |
| 294 | Ga0207647_10074137 | 3300025904 | Unclassified | 2050 |
| 295 | Ga0207699_10000924 | 3300025906 | Bacteria | 14028 |
| 296 | Ga0207699_10328238 | 3300025906 | Bacteria | 1075 |
| 297 | Ga0207645_10004181 | 3300025907 | Bacteria | 10718 |
| 298 | Ga0207643_10005051 | 3300025908 | Bacteria | 7065 |
| 299 | Ga0207684_10011572 | 3300025910 | Bacteria | 7711 |
| 300 | Ga0207684_10059014 | 3300025910 | Bacteria | 3257 |
| 301 | Ga0207684_10072307 | 3300025910 | Unclassified | 2929 |
| 302 | Ga0207654_10009511 | 3300025911 | Bacteria | 4938 |
| 303 | Ga0207654_10426063 | 3300025911 | Bacteria | 927 |
| 304 | Ga0207707_10095347 | 3300025912 | Bacteria | 2600 |
| 305 | Ga0207707_10134888 | 3300025912 | Unclassified | 2158 |
| 306 | Ga0207695_10000795 | 3300025913 | Bacteria | 59172 |
| 307 | Ga0207695_10965234 | 3300025913 | Bacteria | 732 |
| 308 | Ga0207671_10002410 | 3300025914 | Bacteria | 20048 |
| 309 | Ga0207671_10175540 | 3300025914 | Bacteria | 1665 |
| 310 | Ga0207693_10036250 | 3300025915 | Bacteria | 3888 |
| 311 | Ga0207693_10049856 | 3300025915 | Bacteria | 3287 |
| 312 | Ga0207693_10264481 | 3300025915 | Unclassified | 1348 |
| 313 | Ga0207663_10132285 | 3300025916 | Unclassified | 1725 |
| 314 | Ga0207660_10002229 | 3300025917 | Bacteria | 12819 |
| 315 | Ga0207660_10056576 | 3300025917 | Bacteria | 2807 |
| 316 | Ga0207660_10159362 | 3300025917 | Unclassified | 1740 |
| 317 | Ga0207657_10000952 | 3300025919 | Bacteria | 30667 |
| 318 | Ga0207657_10166766 | 3300025919 | Unclassified | 1786 |
| 319 | Ga0207649_10010144 | 3300025920 | Bacteria | 5170 |
| 320 | Ga0207649_10065106 | 3300025920 | Bacteria | 2306 |
| 321 | Ga0207652_10011404 | 3300025921 | Bacteria | 7165 |
| 322 | Ga0207652_10026809 | 3300025921 | Bacteria | 4802 |
| 323 | Ga0207652_10059128 | 3300025921 | Bacteria | 3304 |
| 324 | Ga0207646_10000397 | 3300025922 | Bacteria | 58349 |
| 325 | Ga0207646_10270890 | 3300025922 | Bacteria | 1535 |
| 326 | Ga0207681_10018639 | 3300025923 | Viruses | 4375 |
| 327 | Ga0207694_10021828 | 3300025924 | Unclassified | 4853 |
| 328 | Ga0207694_10091917 | 3300025924 | Bacteria | 2395 |
| 329 | Ga0207650_10022802 | 3300025925 | Bacteria | 4435 |
| 330 | Ga0207650_10517500 | 3300025925 | Unclassified | 998 |
| 331 | Ga0207659_10007179 | 3300025926 | Bacteria | 6840 |
| 332 | Ga0207659_10141430 | 3300025926 | Bacteria | 1868 |
| 333 | Ga0207687_10060541 | 3300025927 | Bacteria | 2671 |
| 334 | Ga0207700_10007343 | 3300025928 | Bacteria | 6730 |
| 335 | Ga0207700_10150685 | 3300025928 | Bacteria | 1921 |
| 336 | Ga0207700_10334297 | 3300025928 | Bacteria | 1315 |
| 337 | Ga0207664_10311654 | 3300025929 | Bacteria | 1387 |
| 338 | Ga0207664_10419122 | 3300025929 | Unclassified | 1192 |
| 339 | Ga0207690_10083797 | 3300025932 | Unclassified | 2233 |
| 340 | Ga0207706_10066354 | 3300025933 | Bacteria | 3176 |
| 341 | Ga0207706_10176820 | 3300025933 | Unclassified | 1875 |
| 342 | Ga0207670_10100594 | 3300025936 | Unclassified | 2064 |
| 343 | Ga0207670_10428244 | 3300025936 | Bacteria | 1063 |
| 344 | Ga0207704_10048407 | 3300025938 | Bacteria | 2548 |
| 345 | Ga0207665_10002211 | 3300025939 | Bacteria | 13127 |
| 346 | Ga0207665_10005339 | 3300025939 | Bacteria | 8586 |
| 347 | Ga0207691_10000806 | 3300025940 | Bacteria | 31170 |
| 348 | Ga0207691_10004233 | 3300025940 | Bacteria | 13940 |
| 349 | Ga0207691_10034784 | 3300025940 | Bacteria | 4682 |
| 350 | Ga0207661_10001181 | 3300025944 | Bacteria | 17466 |
| 351 | Ga0207661_10485137 | 3300025944 | Bacteria | 1128 |
| 352 | Ga0207661_10564060 | 3300025944 | Bacteria | 1044 |
| 353 | Ga0207679_10030001 | 3300025945 | Bacteria | 3793 |
| 354 | Ga0207679_10316602 | 3300025945 | Bacteria | 1350 |
| 355 | Ga0207679_10544435 | 3300025945 | Bacteria | 1041 |
| 356 | Ga0207667_10136611 | 3300025949 | Unclassified | 2525 |
| 357 | Ga0207667_10286284 | 3300025949 | Bacteria | 1684 |
| 358 | Ga0207667_10303000 | 3300025949 | Bacteria | 1633 |
| 359 | Ga0207667_10959175 | 3300025949 | Bacteria | 844 |
| 360 | Ga0207651_10149598 | 3300025960 | Bacteria | 1815 |
| 361 | Ga0207651_10302062 | 3300025960 | Unclassified | 1331 |
| 362 | Ga0207712_10052093 | 3300025961 | Bacteria | 2866 |
| 363 | Ga0207712_10064913 | 3300025961 | Unclassified | 2604 |
| 364 | Ga0207640_10705191 | 3300025981 | Bacteria | 866 |
| 365 | Ga0207677_10000069 | 3300026023 | Bacteria | 85177 |
| 366 | Ga0207677_10593620 | 3300026023 | Bacteria | 971 |
| 367 | Ga0207677_10630757 | 3300026023 | Bacteria | 944 |
| 368 | Ga0207639_10000004 | 3300026041 | Bacteria | 698784 |
| 369 | Ga0207639_10081121 | 3300026041 | Unclassified | 2568 |
| 370 | Ga0207639_10124739 | 3300026041 | Bacteria | 2122 |
| 371 | Ga0207639_10321162 | 3300026041 | Bacteria | 1375 |
| 372 | Ga0207678_10012175 | 3300026067 | Bacteria | 7557 |
| 373 | Ga0207678_10028291 | 3300026067 | Bacteria | 4894 |
| 374 | Ga0207678_10053897 | 3300026067 | Bacteria | 3464 |
| 375 | Ga0207708_10078508 | 3300026075 | Bacteria | 2535 |
| 376 | Ga0207708_10088900 | 3300026075 | Bacteria | 2380 |
| 377 | Ga0207708_10109542 | 3300026075 | Bacteria | 2143 |
| 378 | Ga0207702_10149078 | 3300026078 | Bacteria | 2126 |
| 379 | Ga0207702_10390112 | 3300026078 | Bacteria | 1341 |
| 380 | Ga0207702_10686070 | 3300026078 | Unclassified | 1009 |
| 381 | Ga0207641_10011898 | 3300026088 | Bacteria | 7138 |
| 382 | Ga0207648_10021824 | 3300026089 | Bacteria | 5752 |
| 383 | Ga0207648_10160525 | 3300026089 | Bacteria | 1985 |
| 384 | Ga0207648_10194499 | 3300026089 | Bacteria | 1798 |
| 385 | Ga0207676_10039788 | 3300026095 | Bacteria | 3599 |
| 386 | Ga0207676_10084603 | 3300026095 | Unclassified | 2586 |
| 387 | Ga0207676_10112522 | 3300026095 | Bacteria | 2280 |
| 388 | Ga0207674_10000851 | 3300026116 | Bacteria | 39823 |
| 389 | Ga0207674_10095916 | 3300026116 | Bacteria | 2951 |
| 390 | Ga0207683_10000378 | 3300026121 | Bacteria | 41000 |
| 391 | Ga0207683_10035444 | 3300026121 | Bacteria | 4340 |
| 392 | Ga0207698_10688074 | 3300026142 | Bacteria | 1016 |
| 393 | Ga0207698_10693218 | 3300026142 | Bacteria | 1013 |
| 394 | Ga0207428_10086831 | 3300027907 | Bacteria | 2434 |
| 395 | Ga0268265_10169113 | 3300028380 | Bacteria | 1866 |
| 396 | Ga0268264_10012641 | 3300028381 | Bacteria | 6951 |
| 397 | Ga0268264_10176766 | 3300028381 | Unclassified | 1935 |
| 398 | Ga0268264_10332964 | 3300028381 | Bacteria | 1439 |
| 399 | Ga0265337_1000316 | 3300028556 | Bacteria | 25715 |
| 400 | Ga0265334_10033751 | 3300028573 | Bacteria | 2034 |
| 401 | Ga0307517_10165301 | 3300028786 | Bacteria | 1472 |
| 402 | Ga0265338_10007992 | 3300028800 | Bacteria | 12946 |
| 403 | Ga0265338_10039682 | 3300028800 | Bacteria | 4437 |
| 404 | Ga0265773_1007486 | 3300031018 | Bacteria | 853 |
| 405 | Ga0265328_10000019 | 3300031239 | Bacteria | 130536 |
| 406 | Ga0265325_10068349 | 3300031241 | Bacteria | 1788 |
| 407 | Ga0265325_10074036 | 3300031241 | Bacteria | 1704 |
| 408 | Ga0265339_10025010 | 3300031249 | Bacteria | 3434 |
| 409 | Ga0265331_10002224 | 3300031250 | Bacteria | 13297 |
| 410 | Ga0265327_10000035 | 3300031251 | Bacteria | 314419 |
| 411 | Ga0265316_10078942 | 3300031344 | Bacteria | 2526 |
| 412 | Ga0307513_10054120 | 3300031456 | Bacteria | 4306 |
| 413 | Ga0307513_10357936 | 3300031456 | Bacteria | 1205 |
| 414 | Ga0307509_10385900 | 3300031507 | Bacteria | 1112 |
| 415 | Ga0307408_100076296 | 3300031548 | Unclassified | 2493 |
| 416 | Ga0307508_10000021 | 3300031616 | Bacteria | 183823 |
| 417 | Ga0307508_10023815 | 3300031616 | Bacteria | 5559 |
| 418 | Ga0316579_10046638 | 3300031691 | Bacteria | 2022 |
| 419 | Ga0265314_10018880 | 3300031711 | Bacteria | 5354 |
| 420 | Ga0316576_10346823 | 3300031727 | Bacteria | 1105 |
| 421 | Ga0307516_10003536 | 3300031730 | Bacteria | 19989 |
| 422 | Ga0307405_10044543 | 3300031731 | Bacteria | 2714 |
| 423 | Ga0307413_10033250 | 3300031824 | Bacteria | 2934 |
| 424 | Ga0307413_10036587 | 3300031824 | Bacteria | 2827 |
| 425 | Ga0307410_10005296 | 3300031852 | Bacteria | 6809 |
| 426 | Ga0307410_10096610 | 3300031852 | Bacteria | 2109 |
| 427 | Ga0307410_10391882 | 3300031852 | Bacteria | 1120 |
| 428 | Ga0307406_10073512 | 3300031901 | Unclassified | 2248 |
| 429 | Ga0307406_10453210 | 3300031901 | Bacteria | 1030 |
| 430 | Ga0307409_100002953 | 3300031995 | Bacteria | 9051 |
| 431 | Ga0307409_100013091 | 3300031995 | Bacteria | 5320 |
| 432 | Ga0307416_100009450 | 3300032002 | Bacteria | 6384 |
| 433 | Ga0307416_100038876 | 3300032002 | Bacteria | 3676 |
| 434 | Ga0307416_100549217 | 3300032002 | Bacteria | 1228 |
| 435 | Ga0307411_10096171 | 3300032005 | Bacteria | 2081 |
| 436 | Ga0307415_100058672 | 3300032126 | Bacteria | 2650 |
| 437 | Ga0307415_100602262 | 3300032126 | Unclassified | 978 |
| 438 | Ga0307510_10014932 | 3300033180 | Bacteria | 9185 |
| 439 | Ga0373926_0002060 | 3300035083 | Bacteria | 6330 |
| 440 | Ga0373944_0059718 | 3300035089 | Bacteria | 1220 |
| 441 | Ga0373923_0003042 | 3300035111 | Bacteria | 5302 |
| 442 | Ga0373936_0002263 | 3300035113 | Bacteria | 7195 |
| 443 | Ga0373936_0079469 | 3300035113 | Bacteria | 1363 |
| 444 | Ga0373939_0110974 | 3300035114 | Bacteria | 955 |
| 445 | Ga0373945_0019842 | 3300035116 | Bacteria | 2296 |
| 446 | Ga0373954_0006708 | 3300035118 | Bacteria | 5021 |
| 447 | Ga0373956_0181699 | 3300035119 | Unclassified | 994 |
| 448 | Ga0373943_0001215 | 3300035170 | Bacteria | 11520 |
| 449 | Ga0373943_0036590 | 3300035170 | Bacteria | 2351 |
| 450 | Ga0373946_0010546 | 3300035171 | Bacteria | 3422 |
| 451 | Ga0373955_0000030 | 3300035172 | Bacteria | 56889 |
| 452 | Ga0373955_0270189 | 3300035172 | Unclassified | 1022 |
| 453 | Ga0373961_0199730 | 3300035241 | Unclassified | 705 |
| 454 | Ga0373924_0001737 | 3300035410 | Bacteria | 7193 |
| 455 | Ga0373931_0184243 | 3300035691 | Bacteria | 1238 |
| 456 | Ga0373935_0000187 | 3300035692 | Bacteria | 29255 |
| 457 | Ga0373935_0004307 | 3300035692 | Bacteria | 8349 |
| 458 | Ga0373935_0029694 | 3300035692 | Bacteria | 3384 |
| 459 | Ga0373935_0470381 | 3300035692 | Bacteria | 910 |
| 460 | Ga0373927_0005916 | 3300035695 | Bacteria | 8379 |
| 461 | Ga0373927_0008772 | 3300035695 | Bacteria | 6794 |
| 462 | Ga0373927_0157142 | 3300035695 | Bacteria | 1489 |
| 463 | Ga0373933_0004479 | 3300035724 | Bacteria | 7662 |
| 464 | Ga0373933_0419084 | 3300035724 | Unclassified | 874 |
| 465 | Ga0373947_0000734 | 3300035725 | Bacteria | 19621 |
| 466 | Ga0373947_0005433 | 3300035725 | Bacteria | 7437 |
| 467 | Ga0373947_0009514 | 3300035725 | Bacteria | 5582 |
| 468 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 469 | Ga0373937_0004880 | 3300036401 | Bacteria | 11404 |
| 470 | Ga0373937_0036285 | 3300036401 | Unclassified | 4492 |
| 471 | Ga0373937_0052754 | 3300036401 | Bacteria | 3730 |
| 472 | Ga0373937_0346310 | 3300036401 | Bacteria | 1407 |
| 473 | Ga0373937_0690841 | 3300036401 | Bacteria | 967 |
| 474 | Ga0316582_0009233 | 3300036647 | Bacteria | 5342 |
| 475 | Ga0373925_0000095 | 3300037068 | Bacteria | 95071 |
| 476 | Ga0373925_0001070 | 3300037068 | Bacteria | 24705 |
| 477 | Ga0373925_0081895 | 3300037068 | Bacteria | 2455 |
| 478 | Ga0373925_0470317 | 3300037068 | Bacteria | 1031 |
| 479 | Ga0395899_0355401 | 3300037312 | Bacteria | 979 |
| 480 | Ga0395898_0590991 | 3300037466 | Bacteria | 1053 |
| 481 | Ga0395905_0269750 | 3300037471 | Bacteria | 1588 |
| 482 | Ga0395905_0574021 | 3300037471 | Bacteria | 1029 |
| 483 | Ga0316581_0002336 | 3300037588 | Bacteria | 4513 |
| 484 | Ga0436364_0499655 | 3300037853 | Bacteria | 1706 |
| 485 | Ga0395901_0000076 | 3300038443 | Bacteria | 138169 |
| 486 | Ga0237819_00071 | 3300038705 | Bacteria | 36005 |
| 487 | Ga0436365_0085465 | 3300039437 | Bacteria | 1621 |
| 488 | Ga0436365_0153842 | 3300039437 | Bacteria | 46672 |
| 489 | Ga0436365_1820314 | 3300039437 | Bacteria | 36693 |
| 490 | Ga0436360_0959870 | 3300039438 | Bacteria | 1344 |
| 491 | Ga0436360_1332558 | 3300039438 | Bacteria | 2031 |
| 492 | Ga0436361_0153732 | 3300039447 | Bacteria | 1908 |
| 493 | Ga0436361_0958498 | 3300039447 | Unclassified | 1513 |
| 494 | Ga0436361_1037273 | 3300039447 | Unclassified | 919 |
| 495 | Ga0436361_1146288 | 3300039447 | Bacteria | 2472 |
| 496 | Ga0436363_0414782 | 3300039450 | Bacteria | 2382 |
| 497 | Ga0436363_0774788 | 3300039450 | Bacteria | 1174 |
| 498 | Ga0436363_1105616 | 3300039450 | Bacteria | 2108 |
| 499 | Ga0439431_0010386 | 3300041997 | Unclassified | 2113 |
| 500 | Ga0451577_0000083 | 3300042876 | Bacteria | 213999 |
| 501 | Ga0451577_0144288 | 3300042876 | Unclassified | 2140 |
| 502 | Ga0466963_0046998 | 3300044694 | Bacteria | 2848 |
| 503 | Ga0466963_0366653 | 3300044694 | Bacteria | 1015 |
| 504 | Ga0453684_0000533 | 3300044712 | Bacteria | 144782 |
| 505 | Ga0451576_0174216 | 3300045051 | Bacteria | 2246 |
| 506 | Ga0451576_0299369 | 3300045051 | Bacteria | 1682 |
| 507 | Ga0451576_1050832 | 3300045051 | Bacteria | 853 |
| 508 | Ga0466958_0001808 | 3300045836 | Bacteria | 10375 |
| 509 | Ga0466967_0077551 | 3300045976 | Bacteria | 2991 |
| 510 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 511 | Ga0495592_0018005 | 3300046454 | Bacteria | 5366 |
| 512 | Ga0495590_0093070 | 3300046457 | Bacteria | 1067 |
| 513 | Ga0495629_0012580 | 3300046459 | Bacteria | 6127 |
| 514 | Ga0495638_0000076 | 3300046460 | Bacteria | 158799 |
| 515 | Ga0495638_0000093 | 3300046460 | Bacteria | 142356 |
| 516 | Ga0495651_0000535 | 3300046462 | Bacteria | 29302 |
| 517 | Ga0495651_0000635 | 3300046462 | Bacteria | 27101 |
| 518 | Ga0495651_0001166 | 3300046462 | Bacteria | 20292 |
| 519 | Ga0495651_0301747 | 3300046462 | Unclassified | 1074 |
| 520 | Ga0495651_0331137 | 3300046462 | Unclassified | 1012 |
| 521 | Ga0495653_0000045 | 3300046463 | Bacteria | 115410 |
| 522 | Ga0495653_0008119 | 3300046463 | Bacteria | 8596 |
| 523 | Ga0495653_0140190 | 3300046463 | Unclassified | 1702 |
| 524 | Ga0495580_0005390 | 3300046472 | Bacteria | 10583 |
| 525 | Ga0495580_0013306 | 3300046472 | Bacteria | 6286 |
| 526 | Ga0495580_0417276 | 3300046472 | Bacteria | 903 |
| 527 | Ga0495582_0000096 | 3300046473 | Bacteria | 44984 |
| 528 | Ga0495582_0351190 | 3300046473 | Unclassified | 849 |
| 529 | Ga0495605_0020081 | 3300046474 | Bacteria | 3554 |
| 530 | Ga0495605_0060984 | 3300046474 | Bacteria | 1806 |
| 531 | Ga0495639_0021847 | 3300046475 | Bacteria | 2804 |
| 532 | Ga0495639_0027532 | 3300046475 | Bacteria | 2517 |
| 533 | Ga0495639_0192195 | 3300046475 | Bacteria | 997 |
| 534 | Ga0495662_0000642 | 3300046476 | Bacteria | 16356 |
| 535 | Ga0495662_0103054 | 3300046476 | Bacteria | 1396 |
| 536 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 537 | Ga0495664_0029368 | 3300046477 | Bacteria | 3215 |
| 538 | Ga0495585_0008481 | 3300046492 | Bacteria | 6227 |
| 539 | Ga0495594_0172197 | 3300046499 | Bacteria | 1232 |
| 540 | Ga0495583_0209232 | 3300046506 | Bacteria | 791 |
| 541 | Ga0495606_0117698 | 3300046507 | Bacteria | 1594 |
| 542 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 543 | Ga0495608_0017056 | 3300046511 | Bacteria | 5026 |
| 544 | Ga0495608_0212324 | 3300046511 | Unclassified | 1216 |
| 545 | Ga0495610_0000763 | 3300046512 | Bacteria | 30361 |
| 546 | Ga0495610_0084346 | 3300046512 | Bacteria | 1452 |
| 547 | Ga0495616_0012057 | 3300046513 | Bacteria | 4921 |
| 548 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 549 | Ga0495618_0049977 | 3300046514 | Bacteria | 2641 |
| 550 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 551 | Ga0495628_0006115 | 3300046516 | Bacteria | 10528 |
| 552 | Ga0495628_0023403 | 3300046516 | Bacteria | 5070 |
| 553 | Ga0495630_0000303 | 3300046517 | Bacteria | 39488 |
| 554 | Ga0495630_0027825 | 3300046517 | Bacteria | 4199 |
| 555 | Ga0495630_0382790 | 3300046517 | Bacteria | 1078 |
| 556 | Ga0495631_0000006 | 3300046518 | Bacteria | 132262 |
| 557 | Ga0495631_0012249 | 3300046518 | Bacteria | 4197 |
| 558 | Ga0495648_0033095 | 3300046524 | Bacteria | 3382 |
| 559 | Ga0495666_0069160 | 3300046526 | Bacteria | 1680 |
| 560 | Ga0495642_0061689 | 3300046528 | Bacteria | 1556 |
| 561 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 562 | Ga0495652_0005576 | 3300046529 | Bacteria | 11833 |
| 563 | Ga0495652_0011733 | 3300046529 | Bacteria | 7915 |
| 564 | Ga0495652_0151369 | 3300046529 | Unclassified | 1812 |
| 565 | Ga0495652_0225505 | 3300046529 | Unclassified | 1405 |
| 566 | Ga0495665_0000675 | 3300046531 | Bacteria | 17472 |
| 567 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 568 | Ga0495640_0098536 | 3300046533 | Bacteria | 1921 |
| 569 | Ga0495586_0028194 | 3300046535 | Bacteria | 3006 |
| 570 | Ga0495586_0069142 | 3300046535 | Bacteria | 1927 |
| 571 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 572 | Ga0495587_0007996 | 3300046536 | Bacteria | 6828 |
| 573 | Ga0495587_0017423 | 3300046536 | Bacteria | 4463 |
| 574 | Ga0495587_0115598 | 3300046536 | Unclassified | 1539 |
| 575 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 576 | Ga0495645_0001774 | 3300046543 | Bacteria | 14693 |
| 577 | Ga0495645_0002759 | 3300046543 | Bacteria | 11939 |
| 578 | Ga0495622_0011086 | 3300046557 | Bacteria | 4161 |
| 579 | Ga0495622_0139296 | 3300046557 | Bacteria | 1102 |
| 580 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 581 | Ga0495667_0015240 | 3300046559 | Bacteria | 5190 |
| 582 | Ga0495667_0026972 | 3300046559 | Bacteria | 3872 |
| 583 | Ga0495668_0009692 | 3300046616 | Bacteria | 5887 |
| 584 | Ga0495634_0000082 | 3300046642 | Bacteria | 74301 |
| 585 | Ga0495634_0016509 | 3300046642 | Bacteria | 5280 |
| 586 | Ga0495634_0208645 | 3300046642 | Bacteria | 1210 |
| 587 | Ga0495611_0105865 | 3300046648 | Bacteria | 1308 |
| 588 | Ga0495625_0029935 | 3300046660 | Bacteria | 4066 |
| 589 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 590 | Ga0495635_0005110 | 3300046663 | Bacteria | 9127 |
| 591 | Ga0495635_0035407 | 3300046663 | Bacteria | 3461 |
| 592 | Ga0495659_0091207 | 3300046664 | Unclassified | 1170 |
| 593 | Ga0495588_0060542 | 3300046674 | Bacteria | 1960 |
| 594 | Ga0495657_0000064 | 3300046675 | Bacteria | 94324 |
| 595 | Ga0495657_0000420 | 3300046675 | Bacteria | 39523 |
| 596 | Ga0495657_0129921 | 3300046675 | Unclassified | 1579 |
| 597 | Ga0495599_0000064 | 3300046678 | Bacteria | 73422 |
| 598 | Ga0495599_0010608 | 3300046678 | Bacteria | 5639 |
| 599 | Ga0495599_0058878 | 3300046678 | Bacteria | 2403 |
| 600 | Ga0495623_0000065 | 3300046679 | Bacteria | 65151 |
| 601 | Ga0495623_0006958 | 3300046679 | Bacteria | 7351 |
| 602 | Ga0495623_0037179 | 3300046679 | Bacteria | 3117 |
| 603 | Ga0495623_0037915 | 3300046679 | Unclassified | 3082 |
| 604 | Ga0495646_0000023 | 3300046680 | Bacteria | 110212 |
| 605 | Ga0495646_0097833 | 3300046680 | Bacteria | 1686 |
| 606 | Ga0495658_0021276 | 3300046683 | Bacteria | 3418 |
| 607 | Ga0495658_0063281 | 3300046683 | Bacteria | 2128 |
| 608 | Ga0495613_0007912 | 3300046689 | Bacteria | 7908 |
| 609 | Ga0495613_0019379 | 3300046689 | Bacteria | 5071 |
| 610 | Ga0495613_0111275 | 3300046689 | Bacteria | 1973 |
| 611 | Ga0495613_0369342 | 3300046689 | Bacteria | 982 |
| 612 | Ga0495624_0005364 | 3300046690 | Bacteria | 9249 |
| 613 | Ga0495670_0104114 | 3300046691 | Bacteria | 1464 |
| 614 | Ga0495649_0063690 | 3300046694 | Bacteria | 1981 |
| 615 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 616 | Ga0495600_0000655 | 3300046809 | Bacteria | 17966 |
| 617 | Ga0495600_0094436 | 3300046809 | Bacteria | 1950 |
| 618 | Ga0495660_0135100 | 3300046810 | Bacteria | 1233 |
| 619 | Ga0495581_0050447 | 3300047315 | Bacteria | 2404 |
| 620 | Ga0495581_0051738 | 3300047315 | Bacteria | 2372 |
| 621 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 622 | Ga0495604_0000914 | 3300047317 | Bacteria | 24538 |
| 623 | Ga0495604_0096875 | 3300047317 | Bacteria | 2176 |
| 624 | Ga0495604_0215644 | 3300047317 | Bacteria | 1324 |
| 625 | Ga0495636_0412020 | 3300047318 | Bacteria | 645 |
| 626 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 627 | Ga0495674_0002660 | 3300047319 | Bacteria | 17387 |
| 628 | Ga0495674_0023398 | 3300047319 | Bacteria | 5694 |
| 629 | Ga0495674_0078415 | 3300047319 | Bacteria | 2838 |
| 630 | Ga0495672_0064059 | 3300047320 | Bacteria | 2106 |
| 631 | Ga0495680_0000263 | 3300047322 | Bacteria | 58120 |
| 632 | Ga0495680_0001103 | 3300047322 | Bacteria | 29871 |
| 633 | Ga0495680_0096225 | 3300047322 | Unclassified | 2212 |
| 634 | Ga0495680_0155345 | 3300047322 | Bacteria | 1665 |
| 635 | Ga0495675_0000178 | 3300047444 | Bacteria | 46542 |
| 636 | Ga0495675_0029861 | 3300047444 | Bacteria | 3478 |
| 637 | Ga0495675_0032525 | 3300047444 | Bacteria | 3328 |
| 638 | Ga0495673_0009986 | 3300047469 | Bacteria | 5200 |
| 639 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 640 | Ga0495684_0001158 | 3300047471 | Bacteria | 21192 |
| 641 | Ga0495684_0004148 | 3300047471 | Bacteria | 11317 |
| 642 | Ga0495684_0028331 | 3300047471 | Bacteria | 4301 |
| 643 | Ga0495686_0030748 | 3300047472 | Bacteria | 3486 |
| 644 | Ga0495686_0037926 | 3300047472 | Bacteria | 3085 |
| 645 | Ga0495686_0079584 | 3300047472 | Bacteria | 2004 |
| 646 | Ga0495593_0000938 | 3300047673 | Bacteria | 16993 |
| 647 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 648 | Ga0495602_0000329 | 3300048088 | Bacteria | 43833 |
| 649 | Ga0495602_0001998 | 3300048088 | Bacteria | 20493 |
| 650 | Ga0495602_0037794 | 3300048088 | Bacteria | 4473 |
| 651 | Ga0495615_0055062 | 3300048090 | Bacteria | 1034 |
| 652 | Ga0495626_0001228 | 3300048091 | Bacteria | 21063 |
| 653 | Ga0495626_0043230 | 3300048091 | Bacteria | 2115 |
| 654 | Ga0496100_0091045 | 3300048903 | Bacteria | 2081 |
| 655 | Ga0496100_0486239 | 3300048903 | Bacteria | 950 |
| 656 | Ga0496101_0016344 | 3300048904 | Bacteria | 5011 |
| 657 | Ga0496101_0119774 | 3300048904 | Bacteria | 1989 |
| 658 | Ga0496102_0030887 | 3300048905 | Bacteria | 4799 |
| 659 | Ga0496104_0118266 | 3300048907 | Bacteria | 2544 |
| 660 | Ga0496104_0551049 | 3300048907 | Bacteria | 1064 |
| 661 | Ga0496104_0726862 | 3300048907 | Unclassified | 900 |
| 662 | Ga0496104_0747342 | 3300048907 | Bacteria | 885 |
| 663 | Ga0496104_0782405 | 3300048907 | Bacteria | 861 |
| 664 | Ga0496105_0182732 | 3300048908 | Bacteria | 1717 |
| 665 | Ga0496105_0523341 | 3300048908 | Bacteria | 929 |
| 666 | Ga0496106_0392346 | 3300048909 | Bacteria | 1115 |
| 667 | Ga0496107_0018947 | 3300048910 | Bacteria | 4853 |
| 668 | Ga0496107_0093491 | 3300048910 | Bacteria | 2199 |
| 669 | Ga0496107_0673962 | 3300048910 | Bacteria | 761 |
| 670 | Ga0496108_0058858 | 3300048911 | Bacteria | 3230 |
| 671 | Ga0496109_0094904 | 3300048912 | Viruses | 2761 |
| 672 | Ga0496109_0243748 | 3300048912 | Unclassified | 1692 |
| 673 | Ga0496109_0247307 | 3300048912 | Bacteria | 1679 |
| 674 | Ga0496109_0453428 | 3300048912 | Bacteria | 1211 |
| 675 | Ga0496110_0078706 | 3300048913 | Bacteria | 2935 |
| 676 | Ga0496110_0126727 | 3300048913 | Bacteria | 2304 |
| 677 | Ga0496110_0357966 | 3300048913 | Unclassified | 1330 |
| 678 | Ga0496111_0245028 | 3300048914 | Bacteria | 1331 |
| 679 | Ga0496111_0325663 | 3300048914 | Bacteria | 1138 |
| 680 | Ga0496112_0029379 | 3300048915 | Bacteria | 5316 |
| 681 | Ga0496112_0121007 | 3300048915 | Unclassified | 2587 |
| 682 | Ga0496113_0016802 | 3300048916 | Bacteria | 5063 |
| 683 | Ga0496113_0322034 | 3300048916 | Bacteria | 1239 |
| 684 | Ga0496114_0042977 | 3300048917 | Bacteria | 3747 |
| 685 | Ga0496114_0069779 | 3300048917 | Bacteria | 2951 |
| 686 | Ga0496115_0003714 | 3300048918 | Bacteria | 10980 |
| 687 | Ga0496115_0012130 | 3300048918 | Bacteria | 6481 |
| 688 | Ga0496115_0118344 | 3300048918 | Bacteria | 2179 |
| 689 | Ga0496116_0001457 | 3300048919 | Bacteria | 26524 |
| 690 | Ga0496116_0134725 | 3300048919 | Bacteria | 1401 |
| 691 | Ga0496119_0097681 | 3300048922 | Bacteria | 1655 |
| 692 | Ga0496119_0124990 | 3300048922 | Unclassified | 1409 |
| 693 | Ga0496121_0011085 | 3300048924 | Bacteria | 10057 |
| 694 | Ga0496126_0139539 | 3300048929 | Bacteria | 2088 |
| 695 | Ga0501031_0000443 | 3300049568 | Bacteria | 23880 |
| 696 | Ga0501036_0078356 | 3300049572 | Bacteria | 2795 |
| 697 | Ga0501037_0061493 | 3300049573 | Bacteria | 2738 |
| 698 | Ga0501038_0246409 | 3300049574 | Bacteria | 1417 |
| 699 | Ga0501039_0000557 | 3300049575 | Bacteria | 26996 |
| 700 | Ga0501040_0054577 | 3300049576 | Bacteria | 2739 |
| 701 | Ga0501041_0004269 | 3300049577 | Bacteria | 8273 |
| 702 | Ga0501041_0008931 | 3300049577 | Bacteria | 5897 |
| 703 | Ga0501041_0366786 | 3300049577 | Bacteria | 911 |
| 704 | Ga0501042_0015462 | 3300049578 | Bacteria | 5227 |
| 705 | Ga0501042_0122789 | 3300049578 | Unclassified | 1870 |
| 706 | Ga0501043_0150410 | 3300049579 | Bacteria | 1822 |
| 707 | Ga0501046_0000618 | 3300049580 | Bacteria | 34970 |
| 708 | Ga0501046_0132782 | 3300049580 | Bacteria | 1888 |
| 709 | Ga0501048_0095069 | 3300049582 | Bacteria | 2102 |
| 710 | Ga0501072_0072500 | 3300049588 | Bacteria | 2722 |
| 711 | Ga0501075_0037384 | 3300049591 | Bacteria | 3627 |
| 712 | Ga0501076_0022427 | 3300049592 | Bacteria | 4853 |
| 713 | Ga0501076_0594268 | 3300049592 | Bacteria | 913 |
| 714 | Ga0501077_0036587 | 3300049593 | Bacteria | 3128 |
| 715 | Ga0501077_0075471 | 3300049593 | Bacteria | 2135 |
| 716 | Ga0501201_006961 | 3300049651 | Bacteria | 1077 |
| 717 | Ga0501211_002326 | 3300049658 | Bacteria | 2019 |
| 718 | Ga0501222_014240 | 3300049662 | Bacteria | 1048 |
| 719 | Ga0501223_024816 | 3300049663 | Bacteria | 1166 |
| 720 | Ga0501233_012456 | 3300049668 | Bacteria | 1708 |
| 721 | Ga0501235_011109 | 3300049669 | Bacteria | 1972 |
| 722 | Ga0501236_033311 | 3300049670 | Bacteria | 825 |
| 723 | Ga0501242_014527 | 3300049674 | Bacteria | 976 |
| 724 | Ga0501258_008429 | 3300049687 | Bacteria | 1060 |
| 725 | Ga0501221_002484 | 3300049704 | Bacteria | 3044 |
| 726 | Ga0501079_0204719 | 3300049741 | Bacteria | 1541 |
| 727 | Ga0501080_0217022 | 3300049742 | Bacteria | 1751 |
| 728 | Ga0501267_000554 | 3300049764 | Bacteria | 2937 |
| 729 | Ga0501045_0008831 | 3300049824 | Bacteria | 7039 |
| 730 | Ga0501045_0416940 | 3300049824 | Bacteria | 999 |
| 731 | nmdc:mga0yw44_61955_c1 | 3300050492 | Bacteria | 2296 |
| 732 | nmdc:mga05p37_151241_c1 | 3300050507 | Bacteria | 2839 |
| 733 | nmdc:mga05p37_30750_c1 | 3300050507 | Bacteria | 6553 |
| 734 | nmdc:mga05p37_455017_c1 | 3300050507 | Bacteria | 1480 |
| 735 | nmdc:mga05p37_629813_c1 | 3300050507 | Bacteria | 1205 |
| 736 | nmdc:mga05p37_63_c1 | 3300050507 | Bacteria | 93704 |
| 737 | nmdc:mga05p37_8001_c1 | 3300050507 | Bacteria | 12478 |
| 738 | nmdc:mga09592_168344_c1 | 3300050508 | Unclassified | 1894 |
| 739 | nmdc:mga09592_170988_c1 | 3300050508 | Bacteria | 1879 |
| 740 | nmdc:mga09592_38963_c1 | 3300050508 | Bacteria | 3991 |
| 741 | nmdc:mga09592_4520_c1 | 3300050508 | Bacteria | 11254 |
| 742 | nmdc:mga09592_731013_c1 | 3300050508 | Bacteria | 841 |
| 743 | nmdc:mga0qj67_101788_c1 | 3300050509 | Bacteria | 2316 |
| 744 | nmdc:mga06r32_1020651_c1 | 3300050510 | Bacteria | 779 |
| 745 | nmdc:mga06r32_137278_c1 | 3300050510 | Bacteria | 2420 |
| 746 | nmdc:mga06r32_192836_c1 | 3300050510 | Bacteria | 2025 |
| 747 | nmdc:mga08y16_14818_c1 | 3300050511 | Bacteria | 8198 |
| 748 | nmdc:mga08y16_151853_c1 | 3300050511 | Bacteria | 2407 |
| 749 | nmdc:mga0n895_118833_c1 | 3300050512 | Bacteria | 2664 |
| 750 | nmdc:mga0n895_305045_c1 | 3300050512 | Bacteria | 1614 |
| 751 | nmdc:mga0n895_705693_c1 | 3300050512 | Bacteria | 1004 |
| 752 | nmdc:mga0n895_728641_c1 | 3300050512 | Bacteria | 986 |
| 753 | nmdc:mga0rr50_8809_c1 | 3300050513 | Bacteria | 6296 |
| 754 | nmdc:mga08x19_599_c1 | 3300050514 | Bacteria | 23392 |
| 755 | nmdc:mga0a205_237674_c1 | 3300050515 | Unclassified | 1703 |
| 756 | nmdc:mga0a205_57648_c1 | 3300050515 | Bacteria | 3750 |
| 757 | nmdc:mga0sz30_22890_c1 | 3300050516 | Bacteria | 2538 |
| 758 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 759 | Ga0495601_0004704 | 3300053077 | Bacteria | 7908 |
| 760 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 761 | Ga0495612_0012369 | 3300053078 | Bacteria | 3440 |
| 762 | Ga0500635_0024327 | 3300053080 | Bacteria | 1898 |
| 763 | Ga0495595_0000020 | 3300053084 | Bacteria | 115983 |
| 764 | Ga0495595_0088489 | 3300053084 | Bacteria | 1483 |
| 765 | Ga0495595_0146971 | 3300053084 | Bacteria | 1158 |
| 766 | Ga0495619_0000110 | 3300053085 | Bacteria | 61419 |
| 767 | Ga0495619_0064804 | 3300053085 | Bacteria | 2437 |
| 768 | Ga0495619_0651272 | 3300053085 | Unclassified | 718 |
| 769 | Ga0500578_0027242 | 3300053086 | Bacteria | 3669 |
| 770 | Ga0500578_0058076 | 3300053086 | Bacteria | 2473 |
| 771 | Ga0500578_0064340 | 3300053086 | Bacteria | 2339 |
| 772 | Ga0500651_0058931 | 3300053093 | Bacteria | 2401 |
| 773 | Ga0500651_0180341 | 3300053093 | Bacteria | 1255 |
| 774 | Ga0500640_011131 | 3300053095 | Bacteria | 3657 |
| 775 | Ga0500650_0086107 | 3300053098 | Bacteria | 1471 |
| 776 | Ga0500555_038787 | 3300053103 | Bacteria | 1331 |
| 777 | Ga0500594_0001033 | 3300053118 | Bacteria | 5955 |
| 778 | Ga0500595_043384 | 3300053119 | Bacteria | 1432 |
| 779 | Ga0500607_008886 | 3300053121 | Bacteria | 6066 |
| 780 | Ga0500608_012584 | 3300053122 | Bacteria | 3716 |
| 781 | Ga0500614_071949 | 3300053123 | Bacteria | 951 |
| 782 | Ga0500561_0066706 | 3300053137 | Bacteria | 1021 |
| 783 | Ga0500577_0121032 | 3300053142 | Bacteria | 1089 |
| 784 | Ga0500588_0125628 | 3300053146 | Bacteria | 909 |
| 785 | Ga0500590_039601 | 3300053148 | Bacteria | 2429 |
| 786 | Ga0500616_0002984 | 3300053153 | Bacteria | 13394 |
| 787 | Ga0500622_0208092 | 3300053156 | Bacteria | 885 |
| 788 | Ga0500627_0095076 | 3300053158 | Bacteria | 1335 |
| 789 | Ga0500636_0000045 | 3300053177 | Bacteria | 63850 |
| 790 | Ga0500636_0097394 | 3300053177 | Bacteria | 1677 |
| 791 | Ga0500601_000031 | 3300053737 | Bacteria | 31512 |
| 792 | Ga0501084_0091185 | 3300054114 | Bacteria | 2559 |
| 793 | Ga0501084_0641928 | 3300054114 | Bacteria | 896 |
| 794 | Ga0501082_0203974 | 3300060353 | Bacteria | 1720 |
| 795 | Ga0530510_0006279 | 3300061734 | Bacteria | 8270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047318 | Ga0495636_0412020 | Ga0495636_0412020_70_603 | 177 |
| 2 | 3300046463 | Ga0495653_0140190 | Ga0495653_0140190_350_946 | 196 |
| 3 | 3300026142 | Ga0207698_10693218 | Ga0207698_106932181 | 199 |
| 4 | 3300048907 | Ga0496104_0747342 | Ga0496104_0747342_51_857 | 199 |
| 5 | 3300005331 | Ga0070670_100453797 | Ga0070670_1004537971 | 202 |
| 6 | 3300005439 | Ga0070711_100331230 | Ga0070711_1003312302 | 202 |
| 7 | 3300005548 | Ga0070665_100090139 | Ga0070665_1000901392 | 202 |
| 8 | 3300048091 | Ga0495626_0001228 | Ga0495626_0001228_14017_14670 | 202 |
| 9 | 3300048916 | Ga0496113_0322034 | Ga0496113_0322034_47_658 | 202 |
| 10 | 3300013297 | Ga0157378_10816576 | Ga0157378_108165761 | 203 |
| 11 | 3300026023 | Ga0207677_10593620 | Ga0207677_105936201 | 203 |
| 12 | 3300031616 | Ga0307508_10000021 | Ga0307508_1000002196 | 203 |
| 13 | 3300049592 | Ga0501076_0594268 | Ga0501076_0594268_287_898 | 203 |
| 14 | 3300049651 | Ga0501201_006961 | Ga0501201_006961_264_923 | 203 |
| 15 | 3300049668 | Ga0501233_012456 | Ga0501233_012456_613_1272 | 203 |
| 16 | 3300049687 | Ga0501258_008429 | Ga0501258_008429_71_730 | 203 |
| 17 | 3300028380 | Ga0268265_10169113 | Ga0268265_101691132 | 204 |
| 18 | 3300046472 | Ga0495580_0417276 | Ga0495580_0417276_17_631 | 204 |
| 19 | 3300049663 | Ga0501223_024816 | Ga0501223_024816_457_1116 | 204 |
| 20 | 3300049704 | Ga0501221_002484 | Ga0501221_002484_2285_2944 | 204 |
| 21 | 3300005354 | Ga0070675_100033989 | Ga0070675_1000339896 | 207 |
| 22 | 3300005456 | Ga0070678_100093752 | Ga0070678_1000937523 | 207 |
| 23 | 3300005459 | Ga0068867_100062849 | Ga0068867_1000628494 | 207 |
| 24 | 3300005543 | Ga0070672_100024811 | Ga0070672_1000248113 | 207 |
| 25 | 3300005578 | Ga0068854_100759538 | Ga0068854_1007595381 | 207 |
| 26 | 3300005616 | Ga0068852_100321810 | Ga0068852_1003218103 | 207 |
| 27 | 3300005618 | Ga0068864_100750907 | Ga0068864_1007509072 | 207 |
| 28 | 3300005840 | Ga0068870_10318004 | Ga0068870_103180042 | 207 |
| 29 | 3300009176 | Ga0105242_10195875 | Ga0105242_101958753 | 207 |
| 30 | 3300013105 | Ga0157369_10763249 | Ga0157369_107632492 | 207 |
| 31 | 3300013306 | Ga0163162_10011067 | Ga0163162_100110672 | 207 |
| 32 | 3300013307 | Ga0157372_10034586 | Ga0157372_100345867 | 207 |
| 33 | 3300013308 | Ga0157375_10597604 | Ga0157375_105976042 | 207 |
| 34 | 3300014326 | Ga0157380_10008561 | Ga0157380_100085616 | 207 |
| 35 | 3300017792 | Ga0163161_10005882 | Ga0163161_100058825 | 207 |
| 36 | 3300025893 | Ga0207682_10001298 | Ga0207682_100012987 | 207 |
| 37 | 3300025903 | Ga0207680_10064063 | Ga0207680_100640632 | 207 |
| 38 | 3300025926 | Ga0207659_10141430 | Ga0207659_101414302 | 207 |
| 39 | 3300025940 | Ga0207691_10034784 | Ga0207691_100347843 | 207 |
| 40 | 3300026067 | Ga0207678_10028291 | Ga0207678_100282914 | 207 |
| 41 | 3300026089 | Ga0207648_10021824 | Ga0207648_100218243 | 207 |
| 42 | 3300026121 | Ga0207683_10000378 | Ga0207683_1000037816 | 207 |
| 43 | 3300025981 | Ga0207640_10705191 | Ga0207640_107051912 | 208 |
| 44 | 3300048912 | Ga0496109_0247307 | Ga0496109_0247307_349_1002 | 208 |
| 45 | 3300045051 | Ga0451576_0299369 | Ga0451576_0299369_895_1524 | 209 |
| 46 | 3300037853 | Ga0436364_0499655 | Ga0436364_0499655_291_926 | 210 |
| 47 | 3300039447 | Ga0436361_0958498 | Ga0436361_0958498_566_1201 | 210 |
| 48 | 3300041997 | Ga0439431_0010386 | Ga0439431_0010386_830_1468 | 210 |
| 49 | 3300046674 | Ga0495588_0060542 | Ga0495588_0060542_1262_1894 | 210 |
| 50 | 3300025912 | Ga0207707_10095347 | Ga0207707_100953474 | 211 |
| 51 | 3300025928 | Ga0207700_10334297 | Ga0207700_103342972 | 211 |
| 52 | 3300044694 | Ga0466963_0046998 | Ga0466963_0046998_520_1167 | 212 |
| 53 | 3300045976 | Ga0466967_0077551 | Ga0466967_0077551_1953_2600 | 212 |
| 54 | 3300049658 | Ga0501211_002326 | Ga0501211_002326_1135_1794 | 212 |
| 55 | 3300049662 | Ga0501222_014240 | Ga0501222_014240_343_1002 | 212 |
| 56 | 3300049669 | Ga0501235_011109 | Ga0501235_011109_457_1116 | 212 |
| 57 | 3300049670 | Ga0501236_033311 | Ga0501236_033311_141_800 | 212 |
| 58 | 3300049674 | Ga0501242_014527 | Ga0501242_014527_155_814 | 212 |
| 59 | 3300049764 | Ga0501267_000554 | Ga0501267_000554_211_870 | 212 |
| 60 | iso_pu_bacteria | 2919130084 | 2919131899 | 212 |
| 61 | iso_pu_bacteria | 2929195423 | 2929197733 | 212 |
| 62 | 3300006038 | Ga0075365_10205618 | Ga0075365_102056183 | 213 |
| 63 | 3300031824 | Ga0307413_10033250 | Ga0307413_100332502 | 213 |
| 64 | 3300031852 | Ga0307410_10096610 | Ga0307410_100966102 | 213 |
| 65 | 3300031995 | Ga0307409_100002953 | Ga0307409_1000029533 | 213 |
| 66 | 3300032002 | Ga0307416_100038876 | Ga0307416_1000388762 | 213 |
| 67 | 3300032005 | Ga0307411_10096171 | Ga0307411_100961711 | 213 |
| 68 | 3300032126 | Ga0307415_100058672 | Ga0307415_1000586722 | 213 |
| 69 | 3300037312 | Ga0395899_0355401 | Ga0395899_0355401_61_735 | 213 |
| 70 | 3300037471 | Ga0395905_0269750 | Ga0395905_0269750_300_974 | 213 |
| 71 | 3300046475 | Ga0495639_0027532 | Ga0495639_0027532_1591_2235 | 213 |
| 72 | 3300050492 | nmdc:mga0yw44_61955_c1 | nmdc:mga0yw44_61955_c1_584_1225 | 213 |
| 73 | iso_pu_bacteria | 2619618881 | 2619854434 | 213 |
| 74 | iso_pu_bacteria | 2906626472 | 2906635137 | 213 |
| 75 | iso_pu_bacteria | 3005587118 | 3005594658 | 213 |
| 76 | 3300005327 | Ga0070658_10024973 | Ga0070658_100249734 | 214 |
| 77 | 3300005336 | Ga0070680_100249716 | Ga0070680_1002497162 | 214 |
| 78 | 3300005337 | Ga0070682_100005081 | Ga0070682_1000050812 | 214 |
| 79 | 3300005337 | Ga0070682_100118182 | Ga0070682_1001181822 | 214 |
| 80 | 3300005344 | Ga0070661_100026941 | Ga0070661_1000269416 | 214 |
| 81 | 3300005355 | Ga0070671_100372922 | Ga0070671_1003729221 | 214 |
| 82 | 3300005366 | Ga0070659_100017169 | Ga0070659_1000171692 | 214 |
| 83 | 3300005468 | Ga0070707_100000239 | Ga0070707_10000023946 | 214 |
| 84 | 3300005471 | Ga0070698_100723730 | Ga0070698_1007237301 | 214 |
| 85 | 3300005530 | Ga0070679_100093100 | Ga0070679_1000931002 | 214 |
| 86 | 3300005535 | Ga0070684_100259545 | Ga0070684_1002595453 | 214 |
| 87 | 3300005547 | Ga0070693_100096813 | Ga0070693_1000968132 | 214 |
| 88 | 3300005563 | Ga0068855_100130656 | Ga0068855_1001306563 | 214 |
| 89 | 3300005563 | Ga0068855_100444100 | Ga0068855_1004441002 | 214 |
| 90 | 3300005564 | Ga0070664_100065958 | Ga0070664_1000659582 | 214 |
| 91 | 3300005614 | Ga0068856_100159430 | Ga0068856_1001594303 | 214 |
| 92 | 3300006852 | Ga0075433_10078796 | Ga0075433_100787962 | 214 |
| 93 | 3300009093 | Ga0105240_10462672 | Ga0105240_104626722 | 214 |
| 94 | 3300009093 | Ga0105240_11105534 | Ga0105240_111055342 | 214 |
| 95 | 3300009177 | Ga0105248_10107692 | Ga0105248_101076924 | 214 |
| 96 | 3300013105 | Ga0157369_10101650 | Ga0157369_101016503 | 214 |
| 97 | 3300013296 | Ga0157374_10222083 | Ga0157374_102220833 | 214 |
| 98 | 3300013307 | Ga0157372_10339840 | Ga0157372_103398402 | 214 |
| 99 | 3300014326 | Ga0157380_11124458 | Ga0157380_111244581 | 214 |
| 100 | 3300020070 | Ga0206356_10545819 | Ga0206356_105458192 | 214 |
| 101 | 3300020082 | Ga0206353_11476788 | Ga0206353_114767881 | 214 |
| 102 | 3300025920 | Ga0207649_10065106 | Ga0207649_100651063 | 214 |
| 103 | 3300025922 | Ga0207646_10000397 | Ga0207646_1000039754 | 214 |
| 104 | 3300025944 | Ga0207661_10485137 | Ga0207661_104851372 | 214 |
| 105 | 3300025949 | Ga0207667_10959175 | Ga0207667_109591752 | 214 |
| 106 | 3300026078 | Ga0207702_10149078 | Ga0207702_101490782 | 214 |
| 107 | 3300026089 | Ga0207648_10194499 | Ga0207648_101944993 | 214 |
| 108 | 3300031018 | Ga0265773_1007486 | Ga0265773_10074861 | 214 |
| 109 | 3300046517 | Ga0495630_0382790 | Ga0495630_0382790_225_881 | 214 |
| 110 | 3300046557 | Ga0495622_0139296 | Ga0495622_0139296_437_1090 | 214 |
| 111 | 3300048090 | Ga0495615_0055062 | Ga0495615_0055062_193_837 | 214 |
| 112 | 3300048903 | Ga0496100_0486239 | Ga0496100_0486239_67_711 | 214 |
| 113 | 3300048904 | Ga0496101_0016344 | Ga0496101_0016344_4220_4876 | 214 |
| 114 | 3300048908 | Ga0496105_0523341 | Ga0496105_0523341_131_787 | 214 |
| 115 | 3300048910 | Ga0496107_0093491 | Ga0496107_0093491_510_1166 | 214 |
| 116 | 3300048911 | Ga0496108_0058858 | Ga0496108_0058858_631_1287 | 214 |
| 117 | 3300048912 | Ga0496109_0453428 | Ga0496109_0453428_244_888 | 214 |
| 118 | 3300048913 | Ga0496110_0126727 | Ga0496110_0126727_1564_2220 | 214 |
| 119 | 3300048914 | Ga0496111_0245028 | Ga0496111_0245028_238_894 | 214 |
| 120 | 3300048915 | Ga0496112_0029379 | Ga0496112_0029379_857_1513 | 214 |
| 121 | 3300048916 | Ga0496113_0016802 | Ga0496113_0016802_264_920 | 214 |
| 122 | 3300050512 | nmdc:mga0n895_728641_c1 | nmdc:mga0n895_728641_c1_236_892 | 214 |
| 123 | 3300050515 | nmdc:mga0a205_57648_c1 | nmdc:mga0a205_57648_c1_509_1165 | 214 |
| 124 | iso_pu_bacteria | 2913939268 | 2913945698 | 214 |
| 125 | 3300005331 | Ga0070670_100019037 | Ga0070670_1000190373 | 215 |
| 126 | 3300005339 | Ga0070660_100004581 | Ga0070660_1000045818 | 215 |
| 127 | 3300005354 | Ga0070675_100021607 | Ga0070675_1000216072 | 215 |
| 128 | 3300005365 | Ga0070688_100005618 | Ga0070688_1000056183 | 215 |
| 129 | 3300005436 | Ga0070713_100016390 | Ga0070713_1000163906 | 215 |
| 130 | 3300005466 | Ga0070685_10023921 | Ga0070685_100239213 | 215 |
| 131 | 3300005467 | Ga0070706_100010342 | Ga0070706_1000103424 | 215 |
| 132 | 3300005535 | Ga0070684_100369344 | Ga0070684_1003693441 | 215 |
| 133 | 3300005539 | Ga0068853_100105098 | Ga0068853_1001050983 | 215 |
| 134 | 3300005564 | Ga0070664_100047406 | Ga0070664_1000474064 | 215 |
| 135 | 3300005614 | Ga0068856_100067066 | Ga0068856_1000670663 | 215 |
| 136 | 3300005617 | Ga0068859_100004794 | Ga0068859_1000047945 | 215 |
| 137 | 3300005618 | Ga0068864_100003643 | Ga0068864_1000036437 | 215 |
| 138 | 3300006028 | Ga0070717_10011578 | Ga0070717_100115783 | 215 |
| 139 | 3300006028 | Ga0070717_10059834 | Ga0070717_100598342 | 215 |
| 140 | 3300006931 | Ga0097620_100004794 | Ga0097620_1000047947 | 215 |
| 141 | 3300009093 | Ga0105240_10000649 | Ga0105240_100006496 | 215 |
| 142 | 3300009174 | Ga0105241_10000325 | Ga0105241_1000032515 | 215 |
| 143 | 3300009545 | Ga0105237_10045862 | Ga0105237_100458623 | 215 |
| 144 | 3300009551 | Ga0105238_10000947 | Ga0105238_1000094717 | 215 |
| 145 | 3300009553 | Ga0105249_10003319 | Ga0105249_100033199 | 215 |
| 146 | 3300010375 | Ga0105239_10042919 | Ga0105239_100429194 | 215 |
| 147 | 3300013307 | Ga0157372_10122700 | Ga0157372_101227002 | 215 |
| 148 | 3300014325 | Ga0163163_10010087 | Ga0163163_100100873 | 215 |
| 149 | 3300025910 | Ga0207684_10011572 | Ga0207684_100115727 | 215 |
| 150 | 3300025911 | Ga0207654_10009511 | Ga0207654_100095116 | 215 |
| 151 | 3300025913 | Ga0207695_10000795 | Ga0207695_1000079534 | 215 |
| 152 | 3300025914 | Ga0207671_10002410 | Ga0207671_1000241014 | 215 |
| 153 | 3300025919 | Ga0207657_10000952 | Ga0207657_1000095213 | 215 |
| 154 | 3300025924 | Ga0207694_10021828 | Ga0207694_100218286 | 215 |
| 155 | 3300025925 | Ga0207650_10022802 | Ga0207650_100228025 | 215 |
| 156 | 3300025945 | Ga0207679_10030001 | Ga0207679_100300014 | 215 |
| 157 | 3300025961 | Ga0207712_10052093 | Ga0207712_100520932 | 215 |
| 158 | 3300026041 | Ga0207639_10081121 | Ga0207639_100811212 | 215 |
| 159 | 3300026095 | Ga0207676_10112522 | Ga0207676_101125222 | 215 |
| 160 | 3300031250 | Ga0265331_10002224 | Ga0265331_100022242 | 215 |
| 161 | 3300031251 | Ga0265327_10000035 | Ga0265327_1000003590 | 215 |
| 162 | 3300038705 | Ga0237819_00071 | Ga0237819_00071_30842_31495 | 215 |
| 163 | 3300039447 | Ga0436361_1146288 | Ga0436361_1146288_1410_2066 | 215 |
| 164 | 3300039450 | Ga0436363_0414782 | Ga0436363_0414782_102_755 | 215 |
| 165 | 3300039450 | Ga0436363_0774788 | Ga0436363_0774788_345_995 | 215 |
| 166 | 3300042876 | Ga0451577_0000083 | Ga0451577_0000083_2118_2768 | 215 |
| 167 | 3300044712 | Ga0453684_0000533 | Ga0453684_0000533_99828_100478 | 215 |
| 168 | 3300046512 | Ga0495610_0000763 | Ga0495610_0000763_24151_24804 | 215 |
| 169 | 3300046518 | Ga0495631_0000006 | Ga0495631_0000006_71309_71962 | 215 |
| 170 | 3300047322 | Ga0495680_0155345 | Ga0495680_0155345_990_1643 | 215 |
| 171 | 3300047472 | Ga0495686_0037926 | Ga0495686_0037926_1868_2521 | 215 |
| 172 | 3300048907 | Ga0496104_0782405 | Ga0496104_0782405_35_685 | 215 |
| 173 | 3300048919 | Ga0496116_0001457 | Ga0496116_0001457_13158_13811 | 215 |
| 174 | 3300053084 | Ga0495595_0088489 | Ga0495595_0088489_30_683 | 215 |
| 175 | 3300053085 | Ga0495619_0651272 | Ga0495619_0651272_36_686 | 215 |
| 176 | 3300003322 | rootL2_10045889 | rootL2_1004588913 | 216 |
| 177 | 3300005337 | Ga0070682_100052021 | Ga0070682_1000520212 | 216 |
| 178 | 3300005339 | Ga0070660_100032659 | Ga0070660_1000326593 | 216 |
| 179 | 3300005344 | Ga0070661_100025467 | Ga0070661_1000254672 | 216 |
| 180 | 3300005356 | Ga0070674_100051574 | Ga0070674_1000515742 | 216 |
| 181 | 3300005364 | Ga0070673_100111521 | Ga0070673_1001115212 | 216 |
| 182 | 3300005366 | Ga0070659_100020312 | Ga0070659_1000203123 | 216 |
| 183 | 3300005367 | Ga0070667_100281844 | Ga0070667_1002818441 | 216 |
| 184 | 3300005434 | Ga0070709_10001310 | Ga0070709_1000131010 | 216 |
| 185 | 3300005435 | Ga0070714_100100534 | Ga0070714_1001005342 | 216 |
| 186 | 3300005435 | Ga0070714_100354589 | Ga0070714_1003545892 | 216 |
| 187 | 3300005436 | Ga0070713_100011411 | Ga0070713_1000114113 | 216 |
| 188 | 3300005437 | Ga0070710_10037147 | Ga0070710_100371471 | 216 |
| 189 | 3300005455 | Ga0070663_100060139 | Ga0070663_1000601392 | 216 |
| 190 | 3300005457 | Ga0070662_100139938 | Ga0070662_1001399383 | 216 |
| 191 | 3300005458 | Ga0070681_10014527 | Ga0070681_100145273 | 216 |
| 192 | 3300005458 | Ga0070681_10601079 | Ga0070681_106010792 | 216 |
| 193 | 3300005530 | Ga0070679_100110006 | Ga0070679_1001100063 | 216 |
| 194 | 3300005535 | Ga0070684_100172892 | Ga0070684_1001728922 | 216 |
| 195 | 3300005539 | Ga0068853_100012548 | Ga0068853_1000125483 | 216 |
| 196 | 3300005539 | Ga0068853_100202288 | Ga0068853_1002022883 | 216 |
| 197 | 3300005539 | Ga0068853_100420619 | Ga0068853_1004206192 | 216 |
| 198 | 3300005545 | Ga0070695_100190549 | Ga0070695_1001905492 | 216 |
| 199 | 3300005563 | Ga0068855_100175622 | Ga0068855_1001756222 | 216 |
| 200 | 3300005564 | Ga0070664_100010698 | Ga0070664_1000106987 | 216 |
| 201 | 3300005564 | Ga0070664_100083669 | Ga0070664_1000836693 | 216 |
| 202 | 3300005577 | Ga0068857_100019637 | Ga0068857_1000196377 | 216 |
| 203 | 3300005577 | Ga0068857_100328970 | Ga0068857_1003289702 | 216 |
| 204 | 3300005618 | Ga0068864_100019477 | Ga0068864_1000194772 | 216 |
| 205 | 3300005983 | Ga0081540_1002973 | Ga0081540_100297311 | 216 |
| 206 | 3300006028 | Ga0070717_10008698 | Ga0070717_100086982 | 216 |
| 207 | 3300006871 | Ga0075434_100082850 | Ga0075434_1000828502 | 216 |
| 208 | 3300006914 | Ga0075436_100000966 | Ga0075436_10000096614 | 216 |
| 209 | 3300007076 | Ga0075435_100002824 | Ga0075435_1000028242 | 216 |
| 210 | 3300009093 | Ga0105240_10296091 | Ga0105240_102960912 | 216 |
| 211 | 3300009094 | Ga0111539_11271653 | Ga0111539_112716531 | 216 |
| 212 | 3300013100 | Ga0157373_10021393 | Ga0157373_100213933 | 216 |
| 213 | 3300013102 | Ga0157371_10091760 | Ga0157371_100917603 | 216 |
| 214 | 3300013306 | Ga0163162_10039284 | Ga0163162_100392844 | 216 |
| 215 | 3300013306 | Ga0163162_10085424 | Ga0163162_100854244 | 216 |
| 216 | 3300013307 | Ga0157372_10093746 | Ga0157372_100937463 | 216 |
| 217 | 3300013308 | Ga0157375_10640911 | Ga0157375_106409112 | 216 |
| 218 | 3300014325 | Ga0163163_10054362 | Ga0163163_100543627 | 216 |
| 219 | 3300014325 | Ga0163163_10215476 | Ga0163163_102154762 | 216 |
| 220 | 3300014325 | Ga0163163_10395448 | Ga0163163_103954482 | 216 |
| 221 | 3300014326 | Ga0157380_10087328 | Ga0157380_100873282 | 216 |
| 222 | 3300014326 | Ga0157380_10808738 | Ga0157380_108087382 | 216 |
| 223 | 3300014968 | Ga0157379_10710492 | Ga0157379_107104922 | 216 |
| 224 | 3300014969 | Ga0157376_10409255 | Ga0157376_104092552 | 216 |
| 225 | 3300025898 | Ga0207692_10004054 | Ga0207692_100040547 | 216 |
| 226 | 3300025906 | Ga0207699_10000924 | Ga0207699_100009243 | 216 |
| 227 | 3300025912 | Ga0207707_10134888 | Ga0207707_101348881 | 216 |
| 228 | 3300025917 | Ga0207660_10056576 | Ga0207660_100565762 | 216 |
| 229 | 3300025919 | Ga0207657_10166766 | Ga0207657_101667662 | 216 |
| 230 | 3300025920 | Ga0207649_10010144 | Ga0207649_100101442 | 216 |
| 231 | 3300025921 | Ga0207652_10026809 | Ga0207652_100268093 | 216 |
| 232 | 3300025925 | Ga0207650_10517500 | Ga0207650_105175002 | 216 |
| 233 | 3300025928 | Ga0207700_10007343 | Ga0207700_100073433 | 216 |
| 234 | 3300025929 | Ga0207664_10311654 | Ga0207664_103116542 | 216 |
| 235 | 3300025932 | Ga0207690_10083797 | Ga0207690_100837972 | 216 |
| 236 | 3300025933 | Ga0207706_10176820 | Ga0207706_101768202 | 216 |
| 237 | 3300025939 | Ga0207665_10005339 | Ga0207665_100053393 | 216 |
| 238 | 3300025945 | Ga0207679_10544435 | Ga0207679_105444352 | 216 |
| 239 | 3300025949 | Ga0207667_10136611 | Ga0207667_101366113 | 216 |
| 240 | 3300025960 | Ga0207651_10302062 | Ga0207651_103020622 | 216 |
| 241 | 3300026041 | Ga0207639_10124739 | Ga0207639_101247393 | 216 |
| 242 | 3300026041 | Ga0207639_10321162 | Ga0207639_103211622 | 216 |
| 243 | 3300026067 | Ga0207678_10053897 | Ga0207678_100538974 | 216 |
| 244 | 3300026078 | Ga0207702_10390112 | Ga0207702_103901122 | 216 |
| 245 | 3300026095 | Ga0207676_10039788 | Ga0207676_100397882 | 216 |
| 246 | 3300026116 | Ga0207674_10000851 | Ga0207674_1000085115 | 216 |
| 247 | 3300028800 | Ga0265338_10007992 | Ga0265338_100079927 | 216 |
| 248 | 3300031239 | Ga0265328_10000019 | Ga0265328_1000001985 | 216 |
| 249 | 3300031249 | Ga0265339_10025010 | Ga0265339_100250102 | 216 |
| 250 | 3300031456 | Ga0307513_10054120 | Ga0307513_100541207 | 216 |
| 251 | 3300031616 | Ga0307508_10023815 | Ga0307508_100238152 | 216 |
| 252 | 3300031711 | Ga0265314_10018880 | Ga0265314_100188807 | 216 |
| 253 | 3300035083 | Ga0373926_0002060 | Ga0373926_0002060_1109_1762 | 216 |
| 254 | 3300035113 | Ga0373936_0079469 | Ga0373936_0079469_591_1244 | 216 |
| 255 | 3300035170 | Ga0373943_0036590 | Ga0373943_0036590_371_1024 | 216 |
| 256 | 3300035692 | Ga0373935_0004307 | Ga0373935_0004307_1492_2145 | 216 |
| 257 | 3300035695 | Ga0373927_0008772 | Ga0373927_0008772_929_1582 | 216 |
| 258 | 3300035725 | Ga0373947_0000734 | Ga0373947_0000734_13866_14519 | 216 |
| 259 | 3300037068 | Ga0373925_0001070 | Ga0373925_0001070_18465_19118 | 216 |
| 260 | 3300037466 | Ga0395898_0590991 | Ga0395898_0590991_350_1003 | 216 |
| 261 | 3300037471 | Ga0395905_0574021 | Ga0395905_0574021_322_975 | 216 |
| 262 | 3300045051 | Ga0451576_0174216 | Ga0451576_0174216_490_1143 | 216 |
| 263 | 3300046472 | Ga0495580_0013306 | Ga0495580_0013306_4265_4918 | 216 |
| 264 | 3300046473 | Ga0495582_0000096 | Ga0495582_0000096_25758_26411 | 216 |
| 265 | 3300046475 | Ga0495639_0021847 | Ga0495639_0021847_212_865 | 216 |
| 266 | 3300046526 | Ga0495666_0069160 | Ga0495666_0069160_108_761 | 216 |
| 267 | 3300046531 | Ga0495665_0000675 | Ga0495665_0000675_7680_8333 | 216 |
| 268 | 3300047315 | Ga0495581_0050447 | Ga0495581_0050447_1517_2170 | 216 |
| 269 | 3300047319 | Ga0495674_0078415 | Ga0495674_0078415_639_1292 | 216 |
| 270 | 3300047320 | Ga0495672_0064059 | Ga0495672_0064059_1164_1817 | 216 |
| 271 | 3300048914 | Ga0496111_0325663 | Ga0496111_0325663_78_731 | 216 |
| 272 | 3300049572 | Ga0501036_0078356 | Ga0501036_0078356_384_1037 | 216 |
| 273 | 3300049574 | Ga0501038_0246409 | Ga0501038_0246409_119_772 | 216 |
| 274 | 3300049577 | Ga0501041_0004269 | Ga0501041_0004269_7116_7769 | 216 |
| 275 | 3300049578 | Ga0501042_0122789 | Ga0501042_0122789_817_1470 | 216 |
| 276 | 3300049580 | Ga0501046_0132782 | Ga0501046_0132782_653_1306 | 216 |
| 277 | 3300049582 | Ga0501048_0095069 | Ga0501048_0095069_897_1550 | 216 |
| 278 | 3300049588 | Ga0501072_0072500 | Ga0501072_0072500_973_1626 | 216 |
| 279 | 3300049591 | Ga0501075_0037384 | Ga0501075_0037384_1582_2235 | 216 |
| 280 | 3300049592 | Ga0501076_0022427 | Ga0501076_0022427_3087_3740 | 216 |
| 281 | 3300049593 | Ga0501077_0036587 | Ga0501077_0036587_1247_1900 | 216 |
| 282 | 3300049824 | Ga0501045_0008831 | Ga0501045_0008831_3282_3935 | 216 |
| 283 | 3300050507 | nmdc:mga05p37_629813_c1 | nmdc:mga05p37_629813_c1_166_819 | 216 |
| 284 | 3300050512 | nmdc:mga0n895_118833_c1 | nmdc:mga0n895_118833_c1_1569_2222 | 216 |
| 285 | 3300050513 | nmdc:mga0rr50_8809_c1 | nmdc:mga0rr50_8809_c1_1329_1982 | 216 |
| 286 | 3300050514 | nmdc:mga08x19_599_c1 | nmdc:mga08x19_599_c1_14270_14923 | 216 |
| 287 | 3300054114 | Ga0501084_0091185 | Ga0501084_0091185_1170_1823 | 216 |
| 288 | 3300061734 | Ga0530510_0006279 | Ga0530510_0006279_3119_3772 | 216 |
| 289 | iso_pu_bacteria | 2511231028 | 2511401014 | 216 |
| 290 | iso_pu_bacteria | 2824661429 | 2824665813 | 216 |
| 291 | iso_pu_bacteria | 2874628541 | 2874634556 | 216 |
| 292 | iso_pu_bacteria | 2879099564 | 2879109591 | 216 |
| 293 | iso_pu_bacteria | 2932784394 | 2932791109 | 216 |
| 294 | iso_pu_bacteria | 2932809354 | 2932811709 | 216 |
| 295 | iso_pu_bacteria | 2932818245 | 2932826575 | 216 |
| 296 | iso_pu_bacteria | 2932828146 | 2932834278 | 216 |
| 297 | iso_pu_bacteria | 2935616580 | 2935623897 | 216 |
| 298 | iso_pu_bacteria | 2935638405 | 2935646976 | 216 |
| 299 | iso_pu_bacteria | 2935665750 | 2935674044 | 216 |
| 300 | iso_pu_bacteria | 2935675223 | 2935679444 | 216 |
| 301 | iso_pu_bacteria | 2935684952 | 2935691540 | 216 |
| 302 | iso_pu_bacteria | 2935694250 | 2935699413 | 216 |
| 303 | iso_pu_bacteria | 2935703347 | 2935707643 | 216 |
| 304 | iso_pu_bacteria | 2935713505 | 2935719374 | 216 |
| 305 | iso_pu_bacteria | 2935722832 | 2935729026 | 216 |
| 306 | iso_pu_bacteria | 2935732158 | 2935737733 | 216 |
| 307 | iso_pu_bacteria | 2935741537 | 2935747109 | 216 |
| 308 | iso_pu_bacteria | 2935750917 | 2935758091 | 216 |
| 309 | iso_pu_bacteria | 2935760218 | 2935766727 | 216 |
| 310 | iso_pu_bacteria | 2935801545 | 2935809257 | 216 |
| 311 | iso_pu_bacteria | 2935810662 | 2935817850 | 216 |
| 312 | iso_pu_bacteria | 2935827899 | 2935836209 | 216 |
| 313 | iso_pu_bacteria | 2935837841 | 2935845120 | 216 |
| 314 | iso_pu_bacteria | 2935855204 | 2935862253 | 216 |
| 315 | iso_pu_bacteria | 2935864058 | 2935870820 | 216 |
| 316 | iso_pu_bacteria | 2935873716 | 2935881213 | 216 |
| 317 | iso_pu_bacteria | 2935992306 | 2935999195 | 216 |
| 318 | iso_pu_bacteria | 2936002035 | 2936005613 | 216 |
| 319 | iso_pu_bacteria | 2936037263 | 2936042142 | 216 |
| 320 | iso_pu_bacteria | 2940556831 | 2940563998 | 216 |
| 321 | iso_pu_bacteria | 2941538514 | 2941545434 | 216 |
| 322 | iso_pu_bacteria | 8016511872 | 8016515906 | 216 |
| 323 | iso_pu_bacteria | 8017057580 | 8017060605 | 216 |
| 324 | iso_pu_bacteria | 8019576017 | 8019580112 | 216 |
| 325 | iso_pu_bacteria | 8019586578 | 8019587832 | 216 |
| 326 | iso_pu_bacteria | 8019597564 | 8019603497 | 216 |
| 327 | iso_pu_bacteria | 8019608314 | 8019615033 | 216 |
| 328 | 3300002737 | JGI25162J39368_1000021 | JGI25162J39368_1000021140 | 217 |
| 329 | 3300005329 | Ga0070683_100244370 | Ga0070683_1002443702 | 217 |
| 330 | 3300005336 | Ga0070680_100007785 | Ga0070680_1000077858 | 217 |
| 331 | 3300005338 | Ga0068868_100000525 | Ga0068868_10000052515 | 217 |
| 332 | 3300005354 | Ga0070675_100030163 | Ga0070675_1000301633 | 217 |
| 333 | 3300005355 | Ga0070671_100128317 | Ga0070671_1001283173 | 217 |
| 334 | 3300005356 | Ga0070674_100039663 | Ga0070674_1000396632 | 217 |
| 335 | 3300005364 | Ga0070673_100072012 | Ga0070673_1000720122 | 217 |
| 336 | 3300005365 | Ga0070688_100041178 | Ga0070688_1000411781 | 217 |
| 337 | 3300005444 | Ga0070694_100141269 | Ga0070694_1001412692 | 217 |
| 338 | 3300005467 | Ga0070706_100002050 | Ga0070706_1000020508 | 217 |
| 339 | 3300005467 | Ga0070706_100106436 | Ga0070706_1001064362 | 217 |
| 340 | 3300005471 | Ga0070698_100044407 | Ga0070698_1000444073 | 217 |
| 341 | 3300005471 | Ga0070698_100477253 | Ga0070698_1004772532 | 217 |
| 342 | 3300005518 | Ga0070699_100000537 | Ga0070699_10000053720 | 217 |
| 343 | 3300005518 | Ga0070699_100905235 | Ga0070699_1009052351 | 217 |
| 344 | 3300005530 | Ga0070679_100002001 | Ga0070679_1000020017 | 217 |
| 345 | 3300005536 | Ga0070697_100485789 | Ga0070697_1004857892 | 217 |
| 346 | 3300005546 | Ga0070696_100005655 | Ga0070696_1000056553 | 217 |
| 347 | 3300005549 | Ga0070704_100012085 | Ga0070704_1000120853 | 217 |
| 348 | 3300005563 | Ga0068855_100051207 | Ga0068855_1000512074 | 217 |
| 349 | 3300005577 | Ga0068857_100665212 | Ga0068857_1006652122 | 217 |
| 350 | 3300005615 | Ga0070702_100176784 | Ga0070702_1001767841 | 217 |
| 351 | 3300005834 | Ga0068851_10081585 | Ga0068851_100815853 | 217 |
| 352 | 3300005840 | Ga0068870_10018510 | Ga0068870_100185102 | 217 |
| 353 | 3300005937 | Ga0081455_10026936 | Ga0081455_100269362 | 217 |
| 354 | 3300006178 | Ga0075367_10063345 | Ga0075367_100633453 | 217 |
| 355 | 3300006237 | Ga0097621_100997034 | Ga0097621_1009970342 | 217 |
| 356 | 3300006358 | Ga0068871_100289320 | Ga0068871_1002893202 | 217 |
| 357 | 3300006871 | Ga0075434_100996338 | Ga0075434_1009963381 | 217 |
| 358 | 3300006880 | Ga0075429_100230223 | Ga0075429_1002302232 | 217 |
| 359 | 3300006880 | Ga0075429_100773110 | Ga0075429_1007731101 | 217 |
| 360 | 3300009093 | Ga0105240_11077015 | Ga0105240_110770151 | 217 |
| 361 | 3300009094 | Ga0111539_10080785 | Ga0111539_100807852 | 217 |
| 362 | 3300009094 | Ga0111539_10682201 | Ga0111539_106822011 | 217 |
| 363 | 3300009147 | Ga0114129_10000925 | Ga0114129_100009258 | 217 |
| 364 | 3300009147 | Ga0114129_10040003 | Ga0114129_100400034 | 217 |
| 365 | 3300009545 | Ga0105237_10025607 | Ga0105237_100256073 | 217 |
| 366 | 3300009551 | Ga0105238_10133817 | Ga0105238_101338172 | 217 |
| 367 | 3300010375 | Ga0105239_10017597 | Ga0105239_100175977 | 217 |
| 368 | 3300010375 | Ga0105239_10031131 | Ga0105239_100311317 | 217 |
| 369 | 3300013308 | Ga0157375_10093753 | Ga0157375_100937533 | 217 |
| 370 | 3300014325 | Ga0163163_10204127 | Ga0163163_102041272 | 217 |
| 371 | 3300014497 | Ga0182008_10193236 | Ga0182008_101932362 | 217 |
| 372 | 3300014968 | Ga0157379_10769308 | Ga0157379_107693081 | 217 |
| 373 | 3300017792 | Ga0163161_10018771 | Ga0163161_100187712 | 217 |
| 374 | 3300025294 | Ga0209025_1055119 | Ga0209025_10551192 | 217 |
| 375 | 3300025321 | Ga0207656_10114125 | Ga0207656_101141252 | 217 |
| 376 | 3300025893 | Ga0207682_10024997 | Ga0207682_100249972 | 217 |
| 377 | 3300025910 | Ga0207684_10059014 | Ga0207684_100590143 | 217 |
| 378 | 3300025910 | Ga0207684_10072307 | Ga0207684_100723073 | 217 |
| 379 | 3300025913 | Ga0207695_10965234 | Ga0207695_109652341 | 217 |
| 380 | 3300025914 | Ga0207671_10175540 | Ga0207671_101755403 | 217 |
| 381 | 3300025917 | Ga0207660_10002229 | Ga0207660_100022298 | 217 |
| 382 | 3300025921 | Ga0207652_10011404 | Ga0207652_100114047 | 217 |
| 383 | 3300025924 | Ga0207694_10091917 | Ga0207694_100919173 | 217 |
| 384 | 3300025936 | Ga0207670_10428244 | Ga0207670_104282442 | 217 |
| 385 | 3300025940 | Ga0207691_10000806 | Ga0207691_1000080621 | 217 |
| 386 | 3300025944 | Ga0207661_10564060 | Ga0207661_105640602 | 217 |
| 387 | 3300025949 | Ga0207667_10286284 | Ga0207667_102862842 | 217 |
| 388 | 3300025960 | Ga0207651_10149598 | Ga0207651_101495983 | 217 |
| 389 | 3300026023 | Ga0207677_10000069 | Ga0207677_1000006931 | 217 |
| 390 | 3300026121 | Ga0207683_10035444 | Ga0207683_100354442 | 217 |
| 391 | 3300028381 | Ga0268264_10332964 | Ga0268264_103329642 | 217 |
| 392 | 3300031456 | Ga0307513_10357936 | Ga0307513_103579363 | 217 |
| 393 | 3300031507 | Ga0307509_10385900 | Ga0307509_103859002 | 217 |
| 394 | 3300031691 | Ga0316579_10046638 | Ga0316579_100466383 | 217 |
| 395 | 3300031727 | Ga0316576_10346823 | Ga0316576_103468231 | 217 |
| 396 | 3300031852 | Ga0307410_10391882 | Ga0307410_103918822 | 217 |
| 397 | 3300035119 | Ga0373956_0181699 | Ga0373956_0181699_260_916 | 217 |
| 398 | 3300035724 | Ga0373933_0419084 | Ga0373933_0419084_21_677 | 217 |
| 399 | 3300036401 | Ga0373937_0004880 | Ga0373937_0004880_6319_6975 | 217 |
| 400 | 3300036401 | Ga0373937_0346310 | Ga0373937_0346310_667_1326 | 217 |
| 401 | 3300036647 | Ga0316582_0009233 | Ga0316582_0009233_3231_3887 | 217 |
| 402 | 3300037588 | Ga0316581_0002336 | Ga0316581_0002336_3285_3941 | 217 |
| 403 | 3300042876 | Ga0451577_0144288 | Ga0451577_0144288_551_1207 | 217 |
| 404 | 3300044694 | Ga0466963_0366653 | Ga0466963_0366653_98_754 | 217 |
| 405 | 3300046462 | Ga0495651_0001166 | Ga0495651_0001166_4296_4955 | 217 |
| 406 | 3300046462 | Ga0495651_0331137 | Ga0495651_0331137_311_967 | 217 |
| 407 | 3300046511 | Ga0495608_0212324 | Ga0495608_0212324_448_1107 | 217 |
| 408 | 3300046529 | Ga0495652_0225505 | Ga0495652_0225505_526_1185 | 217 |
| 409 | 3300046536 | Ga0495587_0017423 | Ga0495587_0017423_444_1103 | 217 |
| 410 | 3300046559 | Ga0495667_0026972 | Ga0495667_0026972_2064_2723 | 217 |
| 411 | 3300046664 | Ga0495659_0091207 | Ga0495659_0091207_339_995 | 217 |
| 412 | 3300046678 | Ga0495599_0058878 | Ga0495599_0058878_332_991 | 217 |
| 413 | 3300046679 | Ga0495623_0037179 | Ga0495623_0037179_1849_2508 | 217 |
| 414 | 3300047317 | Ga0495604_0215644 | Ga0495604_0215644_630_1289 | 217 |
| 415 | 3300047444 | Ga0495675_0032525 | Ga0495675_0032525_92_751 | 217 |
| 416 | 3300047471 | Ga0495684_0001158 | Ga0495684_0001158_1870_2529 | 217 |
| 417 | 3300048088 | Ga0495602_0000329 | Ga0495602_0000329_25631_26290 | 217 |
| 418 | 3300048903 | Ga0496100_0091045 | Ga0496100_0091045_277_933 | 217 |
| 419 | 3300048910 | Ga0496107_0018947 | Ga0496107_0018947_779_1435 | 217 |
| 420 | 3300048918 | Ga0496115_0003714 | Ga0496115_0003714_2504_3160 | 217 |
| 421 | 3300048929 | Ga0496126_0139539 | Ga0496126_0139539_152_808 | 217 |
| 422 | 3300050507 | nmdc:mga05p37_151241_c1 | nmdc:mga05p37_151241_c1_2090_2746 | 217 |
| 423 | 3300050507 | nmdc:mga05p37_63_c1 | nmdc:mga05p37_63_c1_65264_65920 | 217 |
| 424 | 3300050508 | nmdc:mga09592_168344_c1 | nmdc:mga09592_168344_c1_19_675 | 217 |
| 425 | 3300050508 | nmdc:mga09592_731013_c1 | nmdc:mga09592_731013_c1_15_671 | 217 |
| 426 | 3300050511 | nmdc:mga08y16_14818_c1 | nmdc:mga08y16_14818_c1_4146_4802 | 217 |
| 427 | 3300053093 | Ga0500651_0058931 | Ga0500651_0058931_1527_2189 | 217 |
| 428 | 3300053103 | Ga0500555_038787 | Ga0500555_038787_277_939 | 217 |
| 429 | 3300053142 | Ga0500577_0121032 | Ga0500577_0121032_388_1044 | 217 |
| 430 | 3300053146 | Ga0500588_0125628 | Ga0500588_0125628_20_682 | 217 |
| 431 | 3300053156 | Ga0500622_0208092 | Ga0500622_0208092_127_789 | 217 |
| 432 | 3300002737 | JGI25162J39368_1000707 | JGI25162J39368_10007079 | 218 |
| 433 | 3300005336 | Ga0070680_100029492 | Ga0070680_1000294923 | 218 |
| 434 | 3300005354 | Ga0070675_100095108 | Ga0070675_1000951083 | 218 |
| 435 | 3300005354 | Ga0070675_100664971 | Ga0070675_1006649711 | 218 |
| 436 | 3300005365 | Ga0070688_100086340 | Ga0070688_1000863402 | 218 |
| 437 | 3300005406 | Ga0070703_10000028 | Ga0070703_1000002839 | 218 |
| 438 | 3300005434 | Ga0070709_10047141 | Ga0070709_100471412 | 218 |
| 439 | 3300005436 | Ga0070713_100009503 | Ga0070713_1000095037 | 218 |
| 440 | 3300005436 | Ga0070713_100334351 | Ga0070713_1003343512 | 218 |
| 441 | 3300005439 | Ga0070711_100061942 | Ga0070711_1000619422 | 218 |
| 442 | 3300005441 | Ga0070700_100026559 | Ga0070700_1000265593 | 218 |
| 443 | 3300005445 | Ga0070708_100001158 | Ga0070708_10000115816 | 218 |
| 444 | 3300005445 | Ga0070708_100033795 | Ga0070708_1000337952 | 218 |
| 445 | 3300005466 | Ga0070685_10256918 | Ga0070685_102569182 | 218 |
| 446 | 3300005467 | Ga0070706_100000054 | Ga0070706_10000005467 | 218 |
| 447 | 3300005467 | Ga0070706_100242415 | Ga0070706_1002424153 | 218 |
| 448 | 3300005467 | Ga0070706_100632978 | Ga0070706_1006329782 | 218 |
| 449 | 3300005468 | Ga0070707_100854076 | Ga0070707_1008540761 | 218 |
| 450 | 3300005518 | Ga0070699_100268587 | Ga0070699_1002685872 | 218 |
| 451 | 3300005518 | Ga0070699_100837631 | Ga0070699_1008376312 | 218 |
| 452 | 3300005536 | Ga0070697_100082945 | Ga0070697_1000829453 | 218 |
| 453 | 3300005539 | Ga0068853_100000009 | Ga0068853_10000000969 | 218 |
| 454 | 3300005543 | Ga0070672_100160954 | Ga0070672_1001609542 | 218 |
| 455 | 3300005546 | Ga0070696_100081829 | Ga0070696_1000818293 | 218 |
| 456 | 3300005563 | Ga0068855_100615990 | Ga0068855_1006159902 | 218 |
| 457 | 3300005616 | Ga0068852_100301393 | Ga0068852_1003013932 | 218 |
| 458 | 3300005618 | Ga0068864_100008166 | Ga0068864_1000081666 | 218 |
| 459 | 3300005841 | Ga0068863_100015093 | Ga0068863_1000150932 | 218 |
| 460 | 3300005841 | Ga0068863_100393604 | Ga0068863_1003936042 | 218 |
| 461 | 3300005842 | Ga0068858_100875001 | Ga0068858_1008750012 | 218 |
| 462 | 3300006028 | Ga0070717_10205568 | Ga0070717_102055683 | 218 |
| 463 | 3300006175 | Ga0070712_100021750 | Ga0070712_1000217502 | 218 |
| 464 | 3300006175 | Ga0070712_100313185 | Ga0070712_1003131852 | 218 |
| 465 | 3300006175 | Ga0070712_100403787 | Ga0070712_1004037872 | 218 |
| 466 | 3300006358 | Ga0068871_100393601 | Ga0068871_1003936011 | 218 |
| 467 | 3300006880 | Ga0075429_100184828 | Ga0075429_1001848283 | 218 |
| 468 | 3300006881 | Ga0068865_100872312 | Ga0068865_1008723121 | 218 |
| 469 | 3300006914 | Ga0075436_100222643 | Ga0075436_1002226433 | 218 |
| 470 | 3300009094 | Ga0111539_10171353 | Ga0111539_101713532 | 218 |
| 471 | 3300009094 | Ga0111539_10195393 | Ga0111539_101953932 | 218 |
| 472 | 3300009098 | Ga0105245_10095366 | Ga0105245_100953662 | 218 |
| 473 | 3300009101 | Ga0105247_10653800 | Ga0105247_106538001 | 218 |
| 474 | 3300009551 | Ga0105238_10345425 | Ga0105238_103454252 | 218 |
| 475 | 3300013104 | Ga0157370_10032254 | Ga0157370_100322547 | 218 |
| 476 | 3300013105 | Ga0157369_10065706 | Ga0157369_100657063 | 218 |
| 477 | 3300013105 | Ga0157369_10136893 | Ga0157369_101368934 | 218 |
| 478 | 3300013306 | Ga0163162_10470983 | Ga0163162_104709831 | 218 |
| 479 | 3300013307 | Ga0157372_10242030 | Ga0157372_102420303 | 218 |
| 480 | 3300013308 | Ga0157375_10025565 | Ga0157375_100255656 | 218 |
| 481 | 3300014326 | Ga0157380_10184688 | Ga0157380_101846882 | 218 |
| 482 | 3300014745 | Ga0157377_10636794 | Ga0157377_106367942 | 218 |
| 483 | 3300014969 | Ga0157376_10076551 | Ga0157376_100765512 | 218 |
| 484 | 3300014969 | Ga0157376_10093323 | Ga0157376_100933232 | 218 |
| 485 | 3300014969 | Ga0157376_10339400 | Ga0157376_103394002 | 218 |
| 486 | 3300014969 | Ga0157376_10501507 | Ga0157376_105015072 | 218 |
| 487 | 3300021384 | Ga0213876_10000383 | Ga0213876_100003836 | 218 |
| 488 | 3300021384 | Ga0213876_10004391 | Ga0213876_100043919 | 218 |
| 489 | 3300021388 | Ga0213875_10132095 | Ga0213875_101320952 | 218 |
| 490 | 3300025885 | Ga0207653_10000047 | Ga0207653_1000004717 | 218 |
| 491 | 3300025904 | Ga0207647_10074137 | Ga0207647_100741373 | 218 |
| 492 | 3300025908 | Ga0207643_10005051 | Ga0207643_100050519 | 218 |
| 493 | 3300025915 | Ga0207693_10049856 | Ga0207693_100498562 | 218 |
| 494 | 3300025915 | Ga0207693_10264481 | Ga0207693_102644812 | 218 |
| 495 | 3300025917 | Ga0207660_10159362 | Ga0207660_101593622 | 218 |
| 496 | 3300025927 | Ga0207687_10060541 | Ga0207687_100605412 | 218 |
| 497 | 3300025928 | Ga0207700_10150685 | Ga0207700_101506852 | 218 |
| 498 | 3300025938 | Ga0207704_10048407 | Ga0207704_100484073 | 218 |
| 499 | 3300025939 | Ga0207665_10002211 | Ga0207665_1000221110 | 218 |
| 500 | 3300025940 | Ga0207691_10004233 | Ga0207691_100042336 | 218 |
| 501 | 3300025949 | Ga0207667_10303000 | Ga0207667_103030003 | 218 |
| 502 | 3300026041 | Ga0207639_10000004 | Ga0207639_10000004331 | 218 |
| 503 | 3300026075 | Ga0207708_10078508 | Ga0207708_100785084 | 218 |
| 504 | 3300026075 | Ga0207708_10109542 | Ga0207708_101095422 | 218 |
| 505 | 3300026078 | Ga0207702_10686070 | Ga0207702_106860701 | 218 |
| 506 | 3300026088 | Ga0207641_10011898 | Ga0207641_100118987 | 218 |
| 507 | 3300026095 | Ga0207676_10084603 | Ga0207676_100846033 | 218 |
| 508 | 3300026116 | Ga0207674_10095916 | Ga0207674_100959162 | 218 |
| 509 | 3300026142 | Ga0207698_10688074 | Ga0207698_106880742 | 218 |
| 510 | 3300027907 | Ga0207428_10086831 | Ga0207428_100868312 | 218 |
| 511 | 3300031241 | Ga0265325_10068349 | Ga0265325_100683492 | 218 |
| 512 | 3300031241 | Ga0265325_10074036 | Ga0265325_100740361 | 218 |
| 513 | 3300035241 | Ga0373961_0199730 | Ga0373961_0199730_20_679 | 218 |
| 514 | 3300035692 | Ga0373935_0029694 | Ga0373935_0029694_1188_1850 | 218 |
| 515 | 3300035692 | Ga0373935_0470381 | Ga0373935_0470381_36_698 | 218 |
| 516 | 3300035695 | Ga0373927_0157142 | Ga0373927_0157142_291_953 | 218 |
| 517 | 3300035725 | Ga0373947_0005433 | Ga0373947_0005433_2783_3445 | 218 |
| 518 | 3300037068 | Ga0373925_0081895 | Ga0373925_0081895_1159_1821 | 218 |
| 519 | 3300037068 | Ga0373925_0470317 | Ga0373925_0470317_14_676 | 218 |
| 520 | 3300038443 | Ga0395901_0000076 | Ga0395901_0000076_118344_119000 | 218 |
| 521 | 3300039437 | Ga0436365_0085465 | Ga0436365_0085465_48_710 | 218 |
| 522 | 3300039437 | Ga0436365_0153842 | Ga0436365_0153842_257_922 | 218 |
| 523 | 3300039437 | Ga0436365_1820314 | Ga0436365_1820314_16447_17112 | 218 |
| 524 | 3300039438 | Ga0436360_0959870 | Ga0436360_0959870_336_998 | 218 |
| 525 | 3300039438 | Ga0436360_1332558 | Ga0436360_1332558_1147_1818 | 218 |
| 526 | 3300039447 | Ga0436361_0153732 | Ga0436361_0153732_305_967 | 218 |
| 527 | 3300039447 | Ga0436361_1037273 | Ga0436361_1037273_22_687 | 218 |
| 528 | 3300039450 | Ga0436363_1105616 | Ga0436363_1105616_591_1253 | 218 |
| 529 | 3300046457 | Ga0495590_0093070 | Ga0495590_0093070_300_959 | 218 |
| 530 | 3300046460 | Ga0495638_0000076 | Ga0495638_0000076_62812_63471 | 218 |
| 531 | 3300046472 | Ga0495580_0005390 | Ga0495580_0005390_5799_6458 | 218 |
| 532 | 3300046473 | Ga0495582_0351190 | Ga0495582_0351190_45_704 | 218 |
| 533 | 3300046477 | Ga0495664_0029368 | Ga0495664_0029368_1863_2537 | 218 |
| 534 | 3300046517 | Ga0495630_0027825 | Ga0495630_0027825_752_1414 | 218 |
| 535 | 3300046528 | Ga0495642_0061689 | Ga0495642_0061689_503_1162 | 218 |
| 536 | 3300046535 | Ga0495586_0028194 | Ga0495586_0028194_1088_1750 | 218 |
| 537 | 3300046642 | Ga0495634_0016509 | Ga0495634_0016509_195_857 | 218 |
| 538 | 3300046663 | Ga0495635_0035407 | Ga0495635_0035407_944_1606 | 218 |
| 539 | 3300046683 | Ga0495658_0021276 | Ga0495658_0021276_916_1578 | 218 |
| 540 | 3300046683 | Ga0495658_0063281 | Ga0495658_0063281_1179_1838 | 218 |
| 541 | 3300046689 | Ga0495613_0111275 | Ga0495613_0111275_628_1287 | 218 |
| 542 | 3300046689 | Ga0495613_0369342 | Ga0495613_0369342_260_922 | 218 |
| 543 | 3300046809 | Ga0495600_0094436 | Ga0495600_0094436_908_1573 | 218 |
| 544 | 3300047471 | Ga0495684_0004148 | Ga0495684_0004148_9012_9674 | 218 |
| 545 | 3300047472 | Ga0495686_0030748 | Ga0495686_0030748_1738_2394 | 218 |
| 546 | 3300048907 | Ga0496104_0726862 | Ga0496104_0726862_127_792 | 218 |
| 547 | 3300048912 | Ga0496109_0094904 | Ga0496109_0094904_21_686 | 218 |
| 548 | 3300048913 | Ga0496110_0357966 | Ga0496110_0357966_498_1163 | 218 |
| 549 | 3300048915 | Ga0496112_0121007 | Ga0496112_0121007_455_1120 | 218 |
| 550 | 3300048922 | Ga0496119_0124990 | Ga0496119_0124990_433_1098 | 218 |
| 551 | 3300049568 | Ga0501031_0000443 | Ga0501031_0000443_20424_21083 | 218 |
| 552 | 3300049573 | Ga0501037_0061493 | Ga0501037_0061493_1820_2479 | 218 |
| 553 | 3300049575 | Ga0501039_0000557 | Ga0501039_0000557_11296_11955 | 218 |
| 554 | 3300049576 | Ga0501040_0054577 | Ga0501040_0054577_1413_2072 | 218 |
| 555 | 3300049577 | Ga0501041_0008931 | Ga0501041_0008931_428_1087 | 218 |
| 556 | 3300049578 | Ga0501042_0015462 | Ga0501042_0015462_342_1001 | 218 |
| 557 | 3300049579 | Ga0501043_0150410 | Ga0501043_0150410_202_861 | 218 |
| 558 | 3300049580 | Ga0501046_0000618 | Ga0501046_0000618_14184_14843 | 218 |
| 559 | 3300049593 | Ga0501077_0075471 | Ga0501077_0075471_465_1124 | 218 |
| 560 | 3300049824 | Ga0501045_0416940 | Ga0501045_0416940_321_980 | 218 |
| 561 | 3300050508 | nmdc:mga09592_170988_c1 | nmdc:mga09592_170988_c1_1158_1823 | 218 |
| 562 | 3300050511 | nmdc:mga08y16_151853_c1 | nmdc:mga08y16_151853_c1_738_1397 | 218 |
| 563 | 3300050515 | nmdc:mga0a205_237674_c1 | nmdc:mga0a205_237674_c1_818_1480 | 218 |
| 564 | 3300053137 | Ga0500561_0066706 | Ga0500561_0066706_286_945 | 218 |
| 565 | 3300054114 | Ga0501084_0641928 | Ga0501084_0641928_50_709 | 218 |
| 566 | 3300001990 | JGI24737J22298_10062575 | JGI24737J22298_100625752 | 219 |
| 567 | 3300005293 | Ga0065715_10350947 | Ga0065715_103509471 | 219 |
| 568 | 3300005328 | Ga0070676_10001365 | Ga0070676_100013656 | 219 |
| 569 | 3300005328 | Ga0070676_10275900 | Ga0070676_102759002 | 219 |
| 570 | 3300005329 | Ga0070683_100005497 | Ga0070683_1000054973 | 219 |
| 571 | 3300005337 | Ga0070682_100021240 | Ga0070682_1000212402 | 219 |
| 572 | 3300005338 | Ga0068868_100690047 | Ga0068868_1006900471 | 219 |
| 573 | 3300005339 | Ga0070660_100896162 | Ga0070660_1008961621 | 219 |
| 574 | 3300005347 | Ga0070668_100001796 | Ga0070668_10000179614 | 219 |
| 575 | 3300005353 | Ga0070669_100082448 | Ga0070669_1000824483 | 219 |
| 576 | 3300005354 | Ga0070675_100001838 | Ga0070675_1000018387 | 219 |
| 577 | 3300005366 | Ga0070659_100429742 | Ga0070659_1004297422 | 219 |
| 578 | 3300005435 | Ga0070714_100073232 | Ga0070714_1000732323 | 219 |
| 579 | 3300005455 | Ga0070663_100099150 | Ga0070663_1000991502 | 219 |
| 580 | 3300005457 | Ga0070662_100039407 | Ga0070662_1000394072 | 219 |
| 581 | 3300005459 | Ga0068867_100619731 | Ga0068867_1006197311 | 219 |
| 582 | 3300005468 | Ga0070707_100216115 | Ga0070707_1002161153 | 219 |
| 583 | 3300005530 | Ga0070679_100097836 | Ga0070679_1000978362 | 219 |
| 584 | 3300005535 | Ga0070684_100864457 | Ga0070684_1008644571 | 219 |
| 585 | 3300005539 | Ga0068853_100630553 | Ga0068853_1006305532 | 219 |
| 586 | 3300005545 | Ga0070695_100044466 | Ga0070695_1000444662 | 219 |
| 587 | 3300005546 | Ga0070696_100013767 | Ga0070696_1000137672 | 219 |
| 588 | 3300005549 | Ga0070704_100105819 | Ga0070704_1001058192 | 219 |
| 589 | 3300005616 | Ga0068852_100717822 | Ga0068852_1007178221 | 219 |
| 590 | 3300005617 | Ga0068859_101066579 | Ga0068859_1010665792 | 219 |
| 591 | 3300005719 | Ga0068861_100227085 | Ga0068861_1002270852 | 219 |
| 592 | 3300005842 | Ga0068858_100134901 | Ga0068858_1001349013 | 219 |
| 593 | 3300005842 | Ga0068858_100240978 | Ga0068858_1002409783 | 219 |
| 594 | 3300005843 | Ga0068860_100014481 | Ga0068860_1000144815 | 219 |
| 595 | 3300005843 | Ga0068860_100278133 | Ga0068860_1002781332 | 219 |
| 596 | 3300005844 | Ga0068862_100582241 | Ga0068862_1005822412 | 219 |
| 597 | 3300005937 | Ga0081455_10004441 | Ga0081455_100044413 | 219 |
| 598 | 3300005937 | Ga0081455_10155696 | Ga0081455_101556962 | 219 |
| 599 | 3300005985 | Ga0081539_10003337 | Ga0081539_1000333715 | 219 |
| 600 | 3300006028 | Ga0070717_10205125 | Ga0070717_102051252 | 219 |
| 601 | 3300006175 | Ga0070712_100569754 | Ga0070712_1005697542 | 219 |
| 602 | 3300006844 | Ga0075428_100007087 | Ga0075428_1000070879 | 219 |
| 603 | 3300006846 | Ga0075430_100044508 | Ga0075430_1000445083 | 219 |
| 604 | 3300006847 | Ga0075431_100003851 | Ga0075431_1000038516 | 219 |
| 605 | 3300006847 | Ga0075431_100159389 | Ga0075431_1001593892 | 219 |
| 606 | 3300006880 | Ga0075429_100011488 | Ga0075429_1000114883 | 219 |
| 607 | 3300006880 | Ga0075429_100133962 | Ga0075429_1001339623 | 219 |
| 608 | 3300006931 | Ga0097620_101066624 | Ga0097620_1010666242 | 219 |
| 609 | 3300009147 | Ga0114129_10000891 | Ga0114129_100008919 | 219 |
| 610 | 3300009147 | Ga0114129_10054512 | Ga0114129_100545127 | 219 |
| 611 | 3300009147 | Ga0114129_10064851 | Ga0114129_100648513 | 219 |
| 612 | 3300009147 | Ga0114129_10882256 | Ga0114129_108822562 | 219 |
| 613 | 3300009174 | Ga0105241_10220137 | Ga0105241_102201373 | 219 |
| 614 | 3300009553 | Ga0105249_10034979 | Ga0105249_100349794 | 219 |
| 615 | 3300010375 | Ga0105239_10075202 | Ga0105239_100752022 | 219 |
| 616 | 3300010375 | Ga0105239_10384936 | Ga0105239_103849362 | 219 |
| 617 | 3300013105 | Ga0157369_10347081 | Ga0157369_103470813 | 219 |
| 618 | 3300013296 | Ga0157374_10874867 | Ga0157374_108748671 | 219 |
| 619 | 3300013297 | Ga0157378_10081961 | Ga0157378_100819612 | 219 |
| 620 | 3300013307 | Ga0157372_10025291 | Ga0157372_100252913 | 219 |
| 621 | 3300013308 | Ga0157375_10037268 | Ga0157375_100372683 | 219 |
| 622 | 3300013308 | Ga0157375_10109113 | Ga0157375_101091133 | 219 |
| 623 | 3300013308 | Ga0157375_10171421 | Ga0157375_101714212 | 219 |
| 624 | 3300014325 | Ga0163163_10532846 | Ga0163163_105328463 | 219 |
| 625 | 3300014745 | Ga0157377_10000198 | Ga0157377_1000019829 | 219 |
| 626 | 3300014968 | Ga0157379_10508429 | Ga0157379_105084291 | 219 |
| 627 | 3300025315 | Ga0207697_10004662 | Ga0207697_100046625 | 219 |
| 628 | 3300025898 | Ga0207692_10083783 | Ga0207692_100837832 | 219 |
| 629 | 3300025906 | Ga0207699_10328238 | Ga0207699_103282382 | 219 |
| 630 | 3300025907 | Ga0207645_10004181 | Ga0207645_100041817 | 219 |
| 631 | 3300025911 | Ga0207654_10426063 | Ga0207654_104260631 | 219 |
| 632 | 3300025915 | Ga0207693_10036250 | Ga0207693_100362503 | 219 |
| 633 | 3300025916 | Ga0207663_10132285 | Ga0207663_101322852 | 219 |
| 634 | 3300025921 | Ga0207652_10059128 | Ga0207652_100591282 | 219 |
| 635 | 3300025922 | Ga0207646_10270890 | Ga0207646_102708903 | 219 |
| 636 | 3300025923 | Ga0207681_10018639 | Ga0207681_100186394 | 219 |
| 637 | 3300025926 | Ga0207659_10007179 | Ga0207659_100071794 | 219 |
| 638 | 3300025929 | Ga0207664_10419122 | Ga0207664_104191221 | 219 |
| 639 | 3300025933 | Ga0207706_10066354 | Ga0207706_100663543 | 219 |
| 640 | 3300025936 | Ga0207670_10100594 | Ga0207670_101005943 | 219 |
| 641 | 3300025944 | Ga0207661_10001181 | Ga0207661_100011813 | 219 |
| 642 | 3300025945 | Ga0207679_10316602 | Ga0207679_103166023 | 219 |
| 643 | 3300025961 | Ga0207712_10064913 | Ga0207712_100649132 | 219 |
| 644 | 3300026023 | Ga0207677_10630757 | Ga0207677_106307572 | 219 |
| 645 | 3300026067 | Ga0207678_10012175 | Ga0207678_100121755 | 219 |
| 646 | 3300026075 | Ga0207708_10088900 | Ga0207708_100889003 | 219 |
| 647 | 3300026089 | Ga0207648_10160525 | Ga0207648_101605252 | 219 |
| 648 | 3300028381 | Ga0268264_10012641 | Ga0268264_100126416 | 219 |
| 649 | 3300028381 | Ga0268264_10176766 | Ga0268264_101767663 | 219 |
| 650 | 3300028556 | Ga0265337_1000316 | Ga0265337_10003168 | 219 |
| 651 | 3300028573 | Ga0265334_10033751 | Ga0265334_100337513 | 219 |
| 652 | 3300028786 | Ga0307517_10165301 | Ga0307517_101653011 | 219 |
| 653 | 3300028800 | Ga0265338_10039682 | Ga0265338_100396825 | 219 |
| 654 | 3300031344 | Ga0265316_10078942 | Ga0265316_100789421 | 219 |
| 655 | 3300031548 | Ga0307408_100076296 | Ga0307408_1000762962 | 219 |
| 656 | 3300031730 | Ga0307516_10003536 | Ga0307516_1000353612 | 219 |
| 657 | 3300031731 | Ga0307405_10044543 | Ga0307405_100445432 | 219 |
| 658 | 3300031824 | Ga0307413_10036587 | Ga0307413_100365872 | 219 |
| 659 | 3300031852 | Ga0307410_10005296 | Ga0307410_100052966 | 219 |
| 660 | 3300031901 | Ga0307406_10073512 | Ga0307406_100735122 | 219 |
| 661 | 3300031901 | Ga0307406_10453210 | Ga0307406_104532102 | 219 |
| 662 | 3300031995 | Ga0307409_100013091 | Ga0307409_1000130913 | 219 |
| 663 | 3300032002 | Ga0307416_100009450 | Ga0307416_1000094505 | 219 |
| 664 | 3300032002 | Ga0307416_100549217 | Ga0307416_1005492173 | 219 |
| 665 | 3300032126 | Ga0307415_100602262 | Ga0307415_1006022621 | 219 |
| 666 | 3300033180 | Ga0307510_10014932 | Ga0307510_100149326 | 219 |
| 667 | 3300035089 | Ga0373944_0059718 | Ga0373944_0059718_502_1164 | 219 |
| 668 | 3300035111 | Ga0373923_0003042 | Ga0373923_0003042_418_1080 | 219 |
| 669 | 3300035113 | Ga0373936_0002263 | Ga0373936_0002263_1442_2104 | 219 |
| 670 | 3300035114 | Ga0373939_0110974 | Ga0373939_0110974_23_685 | 219 |
| 671 | 3300035116 | Ga0373945_0019842 | Ga0373945_0019842_716_1378 | 219 |
| 672 | 3300035118 | Ga0373954_0006708 | Ga0373954_0006708_4287_4949 | 219 |
| 673 | 3300035170 | Ga0373943_0001215 | Ga0373943_0001215_3196_3858 | 219 |
| 674 | 3300035171 | Ga0373946_0010546 | Ga0373946_0010546_1928_2590 | 219 |
| 675 | 3300035172 | Ga0373955_0000030 | Ga0373955_0000030_19004_19666 | 219 |
| 676 | 3300035172 | Ga0373955_0270189 | Ga0373955_0270189_192_860 | 219 |
| 677 | 3300035410 | Ga0373924_0001737 | Ga0373924_0001737_3390_4052 | 219 |
| 678 | 3300035691 | Ga0373931_0184243 | Ga0373931_0184243_101_763 | 219 |
| 679 | 3300035692 | Ga0373935_0000187 | Ga0373935_0000187_16891_17553 | 219 |
| 680 | 3300035695 | Ga0373927_0005916 | Ga0373927_0005916_568_1230 | 219 |
| 681 | 3300035724 | Ga0373933_0004479 | Ga0373933_0004479_2812_3474 | 219 |
| 682 | 3300035725 | Ga0373947_0009514 | Ga0373947_0009514_3807_4469 | 219 |
| 683 | 3300036401 | Ga0373937_0000004 | Ga0373937_0000004_187191_187853 | 219 |
| 684 | 3300036401 | Ga0373937_0036285 | Ga0373937_0036285_2851_3519 | 219 |
| 685 | 3300036401 | Ga0373937_0052754 | Ga0373937_0052754_2033_2698 | 219 |
| 686 | 3300036401 | Ga0373937_0690841 | Ga0373937_0690841_275_940 | 219 |
| 687 | 3300037068 | Ga0373925_0000095 | Ga0373925_0000095_25160_25822 | 219 |
| 688 | 3300045051 | Ga0451576_1050832 | Ga0451576_1050832_167_826 | 219 |
| 689 | 3300045836 | Ga0466958_0001808 | Ga0466958_0001808_8373_9032 | 219 |
| 690 | 3300046454 | Ga0495592_0000029 | Ga0495592_0000029_27016_27678 | 219 |
| 691 | 3300046454 | Ga0495592_0018005 | Ga0495592_0018005_2383_3051 | 219 |
| 692 | 3300046459 | Ga0495629_0012580 | Ga0495629_0012580_5295_5957 | 219 |
| 693 | 3300046460 | Ga0495638_0000093 | Ga0495638_0000093_65935_66594 | 219 |
| 694 | 3300046462 | Ga0495651_0000535 | Ga0495651_0000535_12684_13346 | 219 |
| 695 | 3300046462 | Ga0495651_0000635 | Ga0495651_0000635_7021_7686 | 219 |
| 696 | 3300046462 | Ga0495651_0301747 | Ga0495651_0301747_49_717 | 219 |
| 697 | 3300046463 | Ga0495653_0000045 | Ga0495653_0000045_56669_57331 | 219 |
| 698 | 3300046463 | Ga0495653_0008119 | Ga0495653_0008119_119_784 | 219 |
| 699 | 3300046474 | Ga0495605_0020081 | Ga0495605_0020081_1846_2508 | 219 |
| 700 | 3300046474 | Ga0495605_0060984 | Ga0495605_0060984_376_1035 | 219 |
| 701 | 3300046475 | Ga0495639_0192195 | Ga0495639_0192195_121_783 | 219 |
| 702 | 3300046476 | Ga0495662_0000642 | Ga0495662_0000642_6194_6856 | 219 |
| 703 | 3300046476 | Ga0495662_0103054 | Ga0495662_0103054_105_770 | 219 |
| 704 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_56680_57342 | 219 |
| 705 | 3300046492 | Ga0495585_0008481 | Ga0495585_0008481_70_729 | 219 |
| 706 | 3300046499 | Ga0495594_0172197 | Ga0495594_0172197_279_941 | 219 |
| 707 | 3300046506 | Ga0495583_0209232 | Ga0495583_0209232_50_715 | 219 |
| 708 | 3300046507 | Ga0495606_0117698 | Ga0495606_0117698_179_838 | 219 |
| 709 | 3300046511 | Ga0495608_0000017 | Ga0495608_0000017_56667_57329 | 219 |
| 710 | 3300046511 | Ga0495608_0017056 | Ga0495608_0017056_2285_2950 | 219 |
| 711 | 3300046512 | Ga0495610_0084346 | Ga0495610_0084346_72_737 | 219 |
| 712 | 3300046513 | Ga0495616_0012057 | Ga0495616_0012057_523_1182 | 219 |
| 713 | 3300046514 | Ga0495618_0000006 | Ga0495618_0000006_15773_16435 | 219 |
| 714 | 3300046514 | Ga0495618_0049977 | Ga0495618_0049977_809_1477 | 219 |
| 715 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_56669_57331 | 219 |
| 716 | 3300046516 | Ga0495628_0006115 | Ga0495628_0006115_6919_7584 | 219 |
| 717 | 3300046516 | Ga0495628_0023403 | Ga0495628_0023403_3040_3708 | 219 |
| 718 | 3300046517 | Ga0495630_0000303 | Ga0495630_0000303_9536_10198 | 219 |
| 719 | 3300046518 | Ga0495631_0012249 | Ga0495631_0012249_2045_2704 | 219 |
| 720 | 3300046524 | Ga0495648_0033095 | Ga0495648_0033095_146_811 | 219 |
| 721 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_271203_271865 | 219 |
| 722 | 3300046529 | Ga0495652_0005576 | Ga0495652_0005576_707_1372 | 219 |
| 723 | 3300046529 | Ga0495652_0011733 | Ga0495652_0011733_2382_3050 | 219 |
| 724 | 3300046529 | Ga0495652_0151369 | Ga0495652_0151369_13_681 | 219 |
| 725 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_365207_365869 | 219 |
| 726 | 3300046533 | Ga0495640_0098536 | Ga0495640_0098536_944_1609 | 219 |
| 727 | 3300046535 | Ga0495586_0069142 | Ga0495586_0069142_1035_1697 | 219 |
| 728 | 3300046536 | Ga0495587_0000008 | Ga0495587_0000008_56887_57549 | 219 |
| 729 | 3300046536 | Ga0495587_0007996 | Ga0495587_0007996_3077_3742 | 219 |
| 730 | 3300046536 | Ga0495587_0115598 | Ga0495587_0115598_677_1345 | 219 |
| 731 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_56682_57344 | 219 |
| 732 | 3300046543 | Ga0495645_0001774 | Ga0495645_0001774_10698_11363 | 219 |
| 733 | 3300046543 | Ga0495645_0002759 | Ga0495645_0002759_6769_7437 | 219 |
| 734 | 3300046557 | Ga0495622_0011086 | Ga0495622_0011086_1539_2204 | 219 |
| 735 | 3300046559 | Ga0495667_0000029 | Ga0495667_0000029_56678_57340 | 219 |
| 736 | 3300046559 | Ga0495667_0015240 | Ga0495667_0015240_3684_4349 | 219 |
| 737 | 3300046616 | Ga0495668_0009692 | Ga0495668_0009692_1062_1721 | 219 |
| 738 | 3300046642 | Ga0495634_0000082 | Ga0495634_0000082_11532_12194 | 219 |
| 739 | 3300046642 | Ga0495634_0208645 | Ga0495634_0208645_482_1147 | 219 |
| 740 | 3300046648 | Ga0495611_0105865 | Ga0495611_0105865_498_1163 | 219 |
| 741 | 3300046660 | Ga0495625_0029935 | Ga0495625_0029935_2887_3552 | 219 |
| 742 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_429593_430255 | 219 |
| 743 | 3300046663 | Ga0495635_0005110 | Ga0495635_0005110_6128_6793 | 219 |
| 744 | 3300046675 | Ga0495657_0000064 | Ga0495657_0000064_36983_37645 | 219 |
| 745 | 3300046675 | Ga0495657_0000420 | Ga0495657_0000420_15785_16450 | 219 |
| 746 | 3300046675 | Ga0495657_0129921 | Ga0495657_0129921_502_1170 | 219 |
| 747 | 3300046678 | Ga0495599_0000064 | Ga0495599_0000064_56681_57343 | 219 |
| 748 | 3300046678 | Ga0495599_0010608 | Ga0495599_0010608_364_1032 | 219 |
| 749 | 3300046679 | Ga0495623_0000065 | Ga0495623_0000065_56696_57358 | 219 |
| 750 | 3300046679 | Ga0495623_0006958 | Ga0495623_0006958_1267_1932 | 219 |
| 751 | 3300046679 | Ga0495623_0037915 | Ga0495623_0037915_2221_2889 | 219 |
| 752 | 3300046680 | Ga0495646_0000023 | Ga0495646_0000023_56556_57218 | 219 |
| 753 | 3300046680 | Ga0495646_0097833 | Ga0495646_0097833_383_1051 | 219 |
| 754 | 3300046689 | Ga0495613_0007912 | Ga0495613_0007912_5985_6647 | 219 |
| 755 | 3300046689 | Ga0495613_0019379 | Ga0495613_0019379_3053_3718 | 219 |
| 756 | 3300046690 | Ga0495624_0005364 | Ga0495624_0005364_7300_7962 | 219 |
| 757 | 3300046691 | Ga0495670_0104114 | Ga0495670_0104114_10_669 | 219 |
| 758 | 3300046694 | Ga0495649_0063690 | Ga0495649_0063690_399_1064 | 219 |
| 759 | 3300046809 | Ga0495600_0000010 | Ga0495600_0000010_61918_62580 | 219 |
| 760 | 3300046809 | Ga0495600_0000655 | Ga0495600_0000655_14126_14791 | 219 |
| 761 | 3300046810 | Ga0495660_0135100 | Ga0495660_0135100_542_1201 | 219 |
| 762 | 3300047315 | Ga0495581_0051738 | Ga0495581_0051738_1064_1726 | 219 |
| 763 | 3300047317 | Ga0495604_0000009 | Ga0495604_0000009_268961_269623 | 219 |
| 764 | 3300047317 | Ga0495604_0000914 | Ga0495604_0000914_16760_17425 | 219 |
| 765 | 3300047317 | Ga0495604_0096875 | Ga0495604_0096875_88_756 | 219 |
| 766 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_56670_57332 | 219 |
| 767 | 3300047319 | Ga0495674_0002660 | Ga0495674_0002660_15973_16638 | 219 |
| 768 | 3300047319 | Ga0495674_0023398 | Ga0495674_0023398_781_1449 | 219 |
| 769 | 3300047322 | Ga0495680_0000263 | Ga0495680_0000263_47218_47880 | 219 |
| 770 | 3300047322 | Ga0495680_0001103 | Ga0495680_0001103_10908_11573 | 219 |
| 771 | 3300047322 | Ga0495680_0096225 | Ga0495680_0096225_1208_1876 | 219 |
| 772 | 3300047444 | Ga0495675_0000178 | Ga0495675_0000178_26275_26937 | 219 |
| 773 | 3300047444 | Ga0495675_0029861 | Ga0495675_0029861_2433_3098 | 219 |
| 774 | 3300047469 | Ga0495673_0009986 | Ga0495673_0009986_2154_2819 | 219 |
| 775 | 3300047471 | Ga0495684_0000006 | Ga0495684_0000006_56629_57291 | 219 |
| 776 | 3300047471 | Ga0495684_0028331 | Ga0495684_0028331_680_1345 | 219 |
| 777 | 3300047472 | Ga0495686_0079584 | Ga0495686_0079584_1169_1834 | 219 |
| 778 | 3300047673 | Ga0495593_0000938 | Ga0495593_0000938_3400_4062 | 219 |
| 779 | 3300048088 | Ga0495602_0000005 | Ga0495602_0000005_288342_289004 | 219 |
| 780 | 3300048088 | Ga0495602_0001998 | Ga0495602_0001998_16255_16920 | 219 |
| 781 | 3300048088 | Ga0495602_0037794 | Ga0495602_0037794_373_1041 | 219 |
| 782 | 3300048091 | Ga0495626_0043230 | Ga0495626_0043230_1136_1795 | 219 |
| 783 | 3300048904 | Ga0496101_0119774 | Ga0496101_0119774_553_1221 | 219 |
| 784 | 3300048905 | Ga0496102_0030887 | Ga0496102_0030887_306_974 | 219 |
| 785 | 3300048907 | Ga0496104_0118266 | Ga0496104_0118266_538_1206 | 219 |
| 786 | 3300048907 | Ga0496104_0551049 | Ga0496104_0551049_20_679 | 219 |
| 787 | 3300048908 | Ga0496105_0182732 | Ga0496105_0182732_515_1174 | 219 |
| 788 | 3300048909 | Ga0496106_0392346 | Ga0496106_0392346_375_1040 | 219 |
| 789 | 3300048910 | Ga0496107_0673962 | Ga0496107_0673962_30_695 | 219 |
| 790 | 3300048912 | Ga0496109_0243748 | Ga0496109_0243748_644_1312 | 219 |
| 791 | 3300048913 | Ga0496110_0078706 | Ga0496110_0078706_114_782 | 219 |
| 792 | 3300048917 | Ga0496114_0042977 | Ga0496114_0042977_1741_2409 | 219 |
| 793 | 3300048917 | Ga0496114_0069779 | Ga0496114_0069779_573_1232 | 219 |
| 794 | 3300048918 | Ga0496115_0012130 | Ga0496115_0012130_698_1366 | 219 |
| 795 | 3300048918 | Ga0496115_0118344 | Ga0496115_0118344_872_1537 | 219 |
| 796 | 3300048919 | Ga0496116_0134725 | Ga0496116_0134725_188_853 | 219 |
| 797 | 3300048922 | Ga0496119_0097681 | Ga0496119_0097681_400_1065 | 219 |
| 798 | 3300048924 | Ga0496121_0011085 | Ga0496121_0011085_1366_2031 | 219 |
| 799 | 3300049577 | Ga0501041_0366786 | Ga0501041_0366786_18_680 | 219 |
| 800 | 3300049741 | Ga0501079_0204719 | Ga0501079_0204719_845_1507 | 219 |
| 801 | 3300049742 | Ga0501080_0217022 | Ga0501080_0217022_820_1482 | 219 |
| 802 | 3300050507 | nmdc:mga05p37_30750_c1 | nmdc:mga05p37_30750_c1_2194_2853 | 219 |
| 803 | 3300050507 | nmdc:mga05p37_455017_c1 | nmdc:mga05p37_455017_c1_190_852 | 219 |
| 804 | 3300050507 | nmdc:mga05p37_8001_c1 | nmdc:mga05p37_8001_c1_3531_4193 | 219 |
| 805 | 3300050508 | nmdc:mga09592_38963_c1 | nmdc:mga09592_38963_c1_189_848 | 219 |
| 806 | 3300050508 | nmdc:mga09592_4520_c1 | nmdc:mga09592_4520_c1_8099_8761 | 219 |
| 807 | 3300050509 | nmdc:mga0qj67_101788_c1 | nmdc:mga0qj67_101788_c1_639_1301 | 219 |
| 808 | 3300050510 | nmdc:mga06r32_1020651_c1 | nmdc:mga06r32_1020651_c1_39_701 | 219 |
| 809 | 3300050510 | nmdc:mga06r32_137278_c1 | nmdc:mga06r32_137278_c1_1162_1821 | 219 |
| 810 | 3300050510 | nmdc:mga06r32_192836_c1 | nmdc:mga06r32_192836_c1_713_1375 | 219 |
| 811 | 3300050512 | nmdc:mga0n895_305045_c1 | nmdc:mga0n895_305045_c1_196_858 | 219 |
| 812 | 3300050512 | nmdc:mga0n895_705693_c1 | nmdc:mga0n895_705693_c1_13_672 | 219 |
| 813 | 3300050516 | nmdc:mga0sz30_22890_c1 | nmdc:mga0sz30_22890_c1_1584_2249 | 219 |
| 814 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_254130_254792 | 219 |
| 815 | 3300053077 | Ga0495601_0004704 | Ga0495601_0004704_1635_2303 | 219 |
| 816 | 3300053078 | Ga0495612_0000010 | Ga0495612_0000010_190018_190680 | 219 |
| 817 | 3300053078 | Ga0495612_0012369 | Ga0495612_0012369_2001_2669 | 219 |
| 818 | 3300053080 | Ga0500635_0024327 | Ga0500635_0024327_108_773 | 219 |
| 819 | 3300053084 | Ga0495595_0000020 | Ga0495595_0000020_56679_57341 | 219 |
| 820 | 3300053084 | Ga0495595_0146971 | Ga0495595_0146971_469_1134 | 219 |
| 821 | 3300053085 | Ga0495619_0000110 | Ga0495619_0000110_4099_4761 | 219 |
| 822 | 3300053085 | Ga0495619_0064804 | Ga0495619_0064804_1596_2261 | 219 |
| 823 | 3300053086 | Ga0500578_0027242 | Ga0500578_0027242_2186_2845 | 219 |
| 824 | 3300053086 | Ga0500578_0058076 | Ga0500578_0058076_1479_2141 | 219 |
| 825 | 3300053086 | Ga0500578_0064340 | Ga0500578_0064340_262_927 | 219 |
| 826 | 3300053093 | Ga0500651_0180341 | Ga0500651_0180341_515_1177 | 219 |
| 827 | 3300053095 | Ga0500640_011131 | Ga0500640_011131_1674_2339 | 219 |
| 828 | 3300053098 | Ga0500650_0086107 | Ga0500650_0086107_170_829 | 219 |
| 829 | 3300053118 | Ga0500594_0001033 | Ga0500594_0001033_3265_3924 | 219 |
| 830 | 3300053119 | Ga0500595_043384 | Ga0500595_043384_555_1220 | 219 |
| 831 | 3300053121 | Ga0500607_008886 | Ga0500607_008886_4063_4728 | 219 |
| 832 | 3300053122 | Ga0500608_012584 | Ga0500608_012584_1713_2378 | 219 |
| 833 | 3300053123 | Ga0500614_071949 | Ga0500614_071949_122_787 | 219 |
| 834 | 3300053148 | Ga0500590_039601 | Ga0500590_039601_1633_2298 | 219 |
| 835 | 3300053153 | Ga0500616_0002984 | Ga0500616_0002984_421_1080 | 219 |
| 836 | 3300053158 | Ga0500627_0095076 | Ga0500627_0095076_82_741 | 219 |
| 837 | 3300053177 | Ga0500636_0000045 | Ga0500636_0000045_36783_37448 | 219 |
| 838 | 3300053177 | Ga0500636_0097394 | Ga0500636_0097394_372_1037 | 219 |
| 839 | 3300053737 | Ga0500601_000031 | Ga0500601_000031_8167_8832 | 219 |
| 840 | 3300060353 | Ga0501082_0203974 | Ga0501082_0203974_675_1337 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j0n-assembly1.cif.gz_b | cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry | 0.6759 | 9 | 176 |
| 5xvq-assembly2.cif.gz_B | crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) | 0.665 | 146 | 174 |
| 7ble-assembly1.cif.gz_A | co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the tricyclic inhibitor (3) | 0.6644 | 146 | 176 |
| 6rbk-assembly1.cif.gz_A | cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised | 0.6613 | 4 | 175 |
| 7nbj-assembly3.cif.gz_C | co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (1) | 0.6608 | 146 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5yjfD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.6556 | 146 | 176 | 3.40.50.150 |
| af_Q57569_1_152_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.6039 | 143 | 176 | 2.30.130.40 |
| af_B4F829_3_112_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.5771 | 146 | 173 | 3.30.70.330 |
| 1u8sB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.5683 | 146 | 204 | 3.30.70.260 |
| af_A4IBP9_129_371_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.5238 | 146 | 174 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A023XMJ8-F1-model_v4 | deleted | 0.9557 | 16 | 219 |
|
| AF-A0A1J5PEY2-F1-model_v4 | Contractile injection system tube protein N-terminal domain-containing protein | 0.9451 | 31 | 219 |
|
| AF-A0A023XMJ8-F1-model_v4 | deleted | 0.9422 | 16 | 219 |
|
| AF-A0A1J5PEY2-F1-model_v4 | Contractile injection system tube protein N-terminal domain-containing protein | 0.9356 | 31 | 219 |
|
| AF-A0A7W7XGP1-F1-model_v4 | Uncharacterized protein | 0.9204 | 6 | 218 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar