F483005

General Info

Members Datasets Scaffolds Average Seq Length
839 358 839 149

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10134043|rootH1_101340432
Length 170
Sequence MGSLATLYQDLILDHNRAPRNYRVIDDANRRAEGNNPICGDRLTVWLKLEDDRIRDISFQGSGCAISRASASLMTLAVAGRTKLEAEQLFDRFRQLVTGSLELADTGTLGKLAAFGGISEFPARIKCASLAWHALKAALEQPEAVVTTELPMLAADESHRHTTKASAMRN

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
103 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
104 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
178 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
179 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
183 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
234 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
238 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
239 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
242 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
245 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
246 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
247 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
297 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
298 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
325 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
326 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
327 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
328 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
329 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
330 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
331 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
337 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
338 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
342 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.62
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c011292 3300000041 Bacteria 763
2 ARSoilOldRDRAFT_c008884 3300000044 Bacteria 837
3 JGI24746J21847_1025389 3300001977 Bacteria 820
4 rootH1_10048177 3300003316 Bacteria 2495
5 rootH1_10134043 3300003316 Bacteria 1095
6 JGI25405J52794_10005174 3300003911 Unclassified 2345
7 Ga0058863_11948557 3300004799 Bacteria 1199
8 Ga0058861_12030290 3300004800 Bacteria 990
9 Ga0058862_12710135 3300004803 Bacteria 1021
10 Ga0065712_10002436 3300005290 Bacteria 5124
11 Ga0065712_10070819 3300005290 Bacteria 5683
12 Ga0065715_10002906 3300005293 Bacteria 6018
13 Ga0065715_10011887 3300005293 Bacteria 2380
14 Ga0065707_10001212 3300005295 Bacteria 11424
15 Ga0065707_10014449 3300005295 Bacteria 4625
16 Ga0065707_10118897 3300005295 Bacteria 2174
17 Ga0065707_10209214 3300005295 Bacteria 1273
18 Ga0065707_10374985 3300005295 Bacteria 866
19 Ga0065707_10889558 3300005295 Bacteria 556
20 Ga0065707_11127062 3300005295 Unclassified 510
21 Ga0070658_10403806 3300005327 Bacteria 1174
22 Ga0070676_10001668 3300005328 Bacteria 11298
23 Ga0070690_100060005 3300005330 Bacteria 2447
24 Ga0070670_100000895 3300005331 Bacteria 23505
25 Ga0070677_10011217 3300005333 Bacteria 3084
26 Ga0068869_100012510 3300005334 Bacteria 5612
27 Ga0068869_100033778 3300005334 Bacteria 3613
28 Ga0068869_100213324 3300005334 Bacteria 1527
29 Ga0070666_10006434 3300005335 Bacteria 7220
30 Ga0070680_100055317 3300005336 Bacteria 3243
31 Ga0070680_100085436 3300005336 Bacteria 2607
32 Ga0070682_100291911 3300005337 Bacteria 1193
33 Ga0068868_100026121 3300005338 Bacteria 4448
34 Ga0070689_100179721 3300005340 Bacteria 1718
35 Ga0070691_10241504 3300005341 Bacteria 965
36 Ga0070661_100007965 3300005344 Bacteria 7319
37 Ga0070661_100178960 3300005344 Bacteria 1613
38 Ga0070692_10320388 3300005345 Unclassified 953
39 Ga0070692_10324506 3300005345 Bacteria 948
40 Ga0070668_100403808 3300005347 Bacteria 1167
41 Ga0070668_100516446 3300005347 Unclassified 1036
42 Ga0070669_100006398 3300005353 Bacteria 8479
43 Ga0070669_100138670 3300005353 Bacteria 1873
44 Ga0070675_100354646 3300005354 Bacteria 1301
45 Ga0070675_100824400 3300005354 Bacteria 848
46 Ga0070675_100836674 3300005354 Unclassified 842
47 Ga0070671_100023258 3300005355 Bacteria 5070
48 Ga0070671_100087309 3300005355 Bacteria 2610
49 Ga0070674_100000031 3300005356 Bacteria 67745
50 Ga0070674_100131021 3300005356 Bacteria 1869
51 Ga0070674_101970668 3300005356 Unclassified 531
52 Ga0070673_100065674 3300005364 Bacteria 2895
53 Ga0070673_100986688 3300005364 Unclassified 784
54 Ga0070688_100230942 3300005365 Bacteria 1309
55 Ga0070667_100053227 3300005367 Bacteria 3416
56 Ga0070667_100116787 3300005367 Bacteria 2317
57 Ga0070667_100995009 3300005367 Bacteria 782
58 Ga0070705_100010188 3300005440 Bacteria 4697
59 Ga0070705_100056028 3300005440 Bacteria 2320
60 Ga0070705_100676526 3300005440 Bacteria 808
61 Ga0070700_100314512 3300005441 Unclassified 1148
62 Ga0070700_100466820 3300005441 Bacteria 964
63 Ga0070694_100003632 3300005444 Bacteria 9211
64 Ga0070694_100039671 3300005444 Bacteria 3136
65 Ga0070694_100130465 3300005444 Unclassified 1815
66 Ga0070694_101908655 3300005444 Unclassified 507
67 Ga0070708_100045977 3300005445 Bacteria 3850
68 Ga0070708_100531780 3300005445 Bacteria 1109
69 Ga0070663_100087896 3300005455 Bacteria 2298
70 Ga0070678_100018444 3300005456 Bacteria 4522
71 Ga0070678_100023971 3300005456 Bacteria 4076
72 Ga0070678_100275316 3300005456 Bacteria 1421
73 Ga0070678_101169037 3300005456 Bacteria 712
74 Ga0070662_100000206 3300005457 Bacteria 34279
75 Ga0070662_100094829 3300005457 Bacteria 2247
76 Ga0070681_10008219 3300005458 Bacteria 10212
77 Ga0070681_10034774 3300005458 Bacteria 5060
78 Ga0070681_10752289 3300005458 Bacteria 891
79 Ga0068867_100000341 3300005459 Bacteria 30850
80 Ga0068867_100412764 3300005459 Bacteria 1142
81 Ga0070706_100020198 3300005467 Bacteria 6137
82 Ga0070706_100869670 3300005467 Unclassified 833
83 Ga0070707_100906536 3300005468 Bacteria 846
84 Ga0070698_100001874 3300005471 Bacteria 23434
85 Ga0070698_100005938 3300005471 Bacteria 13314
86 Ga0070698_100199077 3300005471 Bacteria 1939
87 Ga0070698_100208185 3300005471 Bacteria 1891
88 Ga0070698_100241937 3300005471 Bacteria 1738
89 Ga0070699_100000650 3300005518 Bacteria 32523
90 Ga0070699_100112334 3300005518 Bacteria 2393
91 Ga0070699_100280178 3300005518 Bacteria 1493
92 Ga0070699_100335650 3300005518 Bacteria 1360
93 Ga0070679_100010568 3300005530 Bacteria 8757
94 Ga0070679_100147305 3300005530 Bacteria 2332
95 Ga0070679_100179187 3300005530 Bacteria 2092
96 Ga0070679_100180045 3300005530 Bacteria 2086
97 Ga0070679_100434473 3300005530 Bacteria 1258
98 Ga0070684_100271609 3300005535 Bacteria 1552
99 Ga0070697_101375882 3300005536 Unclassified 630
100 Ga0070672_100018970 3300005543 Bacteria 4984
101 Ga0070672_100086349 3300005543 Bacteria 2523
102 Ga0070672_100402568 3300005543 Unclassified 1173
103 Ga0070672_100758385 3300005543 Unclassified 852
104 Ga0070672_100865089 3300005543 Unclassified 797
105 Ga0070686_100004210 3300005544 Bacteria 7920
106 Ga0070686_100025456 3300005544 Bacteria 3561
107 Ga0070686_101624072 3300005544 Unclassified 547
108 Ga0070695_100010146 3300005545 Bacteria 5616
109 Ga0070695_100019561 3300005545 Bacteria 4123
110 Ga0070695_100100729 3300005545 Bacteria 1945
111 Ga0070695_100477556 3300005545 Bacteria 960
112 Ga0070695_100797843 3300005545 Bacteria 756
113 Ga0070696_100003810 3300005546 Bacteria 10075
114 Ga0070696_100006413 3300005546 Bacteria 7877
115 Ga0070696_100043359 3300005546 Bacteria 3112
116 Ga0070696_100095096 3300005546 Bacteria 2127
117 Ga0070693_100031570 3300005547 Bacteria 2905
118 Ga0070693_100078305 3300005547 Bacteria 1964
119 Ga0070704_100217787 3300005549 Bacteria 1550
120 Ga0070704_100281777 3300005549 Bacteria 1377
121 Ga0070704_100457423 3300005549 Bacteria 1100
122 Ga0070704_102122301 3300005549 Bacteria 522
123 Ga0068855_100352860 3300005563 Bacteria 1620
124 Ga0068855_100401737 3300005563 Bacteria 1501
125 Ga0070664_100024643 3300005564 Bacteria 4979
126 Ga0070664_100722212 3300005564 Bacteria 929
127 Ga0068857_100000784 3300005577 Bacteria 23721
128 Ga0068857_100041473 3300005577 Bacteria 4082
129 Ga0068857_100193490 3300005577 Bacteria 1853
130 Ga0068857_101266459 3300005577 Bacteria 715
131 Ga0068857_101358794 3300005577 Bacteria 690
132 Ga0068854_100007149 3300005578 Bacteria 7130
133 Ga0068854_100038940 3300005578 Bacteria 3346
134 Ga0068854_100807325 3300005578 Bacteria 818
135 Ga0070702_100008842 3300005615 Bacteria 4899
136 Ga0068852_100284920 3300005616 Bacteria 1594
137 Ga0068859_100425015 3300005617 Bacteria 1425
138 Ga0068864_100001389 3300005618 Bacteria 20065
139 Ga0068864_101170527 3300005618 Bacteria 767
140 Ga0068866_10000048 3300005718 Bacteria 46904
141 Ga0068866_10133474 3300005718 Bacteria 1415
142 Ga0068861_100009043 3300005719 Bacteria 6867
143 Ga0068861_100055073 3300005719 Bacteria 3032
144 Ga0068861_100165347 3300005719 Bacteria 1829
145 Ga0068858_100075921 3300005842 Bacteria 3122
146 Ga0068860_100019327 3300005843 Bacteria 6609
147 Ga0068860_100021349 3300005843 Bacteria 6269
148 Ga0068860_100129911 3300005843 Bacteria 2417
149 Ga0068860_100203590 3300005843 Bacteria 1919
150 Ga0068860_100709726 3300005843 Bacteria 1016
151 Ga0068862_100010499 3300005844 Bacteria 7649
152 Ga0068862_100059829 3300005844 Bacteria 3272
153 Ga0081455_10002445 3300005937 Bacteria 22116
154 Ga0081455_10015954 3300005937 Bacteria 7272
155 Ga0081455_10166060 3300005937 Unclassified 1686
156 Ga0081538_10007439 3300005981 Bacteria 9480
157 Ga0081540_1256964 3300005983 Unclassified 608
158 Ga0075432_10188339 3300006058 Bacteria 811
159 Ga0070715_10150484 3300006163 Bacteria 1140
160 Ga0070712_100186198 3300006175 Bacteria 1621
161 Ga0075427_10083609 3300006194 Bacteria 579
162 Ga0097621_100361426 3300006237 Unclassified 1293
163 Ga0068871_100105274 3300006358 Bacteria 2367
164 Ga0068871_100113984 3300006358 Bacteria 2277
165 Ga0075428_100008553 3300006844 Bacteria 11355
166 Ga0075428_100042612 3300006844 Bacteria 4991
167 Ga0075428_100186017 3300006844 Bacteria 2248
168 Ga0075428_100537780 3300006844 Bacteria 1249
169 Ga0075428_100762130 3300006844 Bacteria 1029
170 Ga0075428_101098377 3300006844 Unclassified 840
171 Ga0075428_101599307 3300006844 Bacteria 681
172 Ga0075430_100022399 3300006846 Bacteria 5376
173 Ga0075430_100123958 3300006846 Unclassified 2154
174 Ga0075430_100224214 3300006846 Unclassified 1559
175 Ga0075430_100273337 3300006846 Bacteria 1398
176 Ga0075430_100371496 3300006846 Bacteria 1181
177 Ga0075430_100596111 3300006846 Bacteria 912
178 Ga0075430_100834246 3300006846 Unclassified 760
179 Ga0075430_101007983 3300006846 Bacteria 686
180 Ga0075431_100003213 3300006847 Bacteria 15816
181 Ga0075431_100013341 3300006847 Bacteria 8303
182 Ga0075431_100058093 3300006847 Bacteria 3990
183 Ga0075431_100288153 3300006847 Unclassified 1662
184 Ga0075431_100313990 3300006847 Bacteria 1581
185 Ga0075431_100637856 3300006847 Bacteria 1047
186 Ga0075431_100744797 3300006847 Bacteria 956
187 Ga0075433_10005452 3300006852 Bacteria 9995
188 Ga0075433_10064220 3300006852 Bacteria 3218
189 Ga0075433_10472862 3300006852 Bacteria 1104
190 Ga0075434_100012929 3300006871 Bacteria 7929
191 Ga0075434_100041175 3300006871 Bacteria 4576
192 Ga0075434_100111787 3300006871 Bacteria 2743
193 Ga0075434_100168338 3300006871 Bacteria 2211
194 Ga0075434_100230029 3300006871 Bacteria 1873
195 Ga0075434_100526483 3300006871 Bacteria 1202
196 Ga0075429_100004888 3300006880 Bacteria 11552
197 Ga0075429_100021847 3300006880 Bacteria 5547
198 Ga0075429_100129218 3300006880 Bacteria 2210
199 Ga0075429_100166594 3300006880 Bacteria 1930
200 Ga0075429_100294892 3300006880 Bacteria 1420
201 Ga0075429_100886865 3300006880 Unclassified 781
202 Ga0068865_100001170 3300006881 Bacteria 15241
203 Ga0068865_101467305 3300006881 Unclassified 610
204 Ga0075436_100064240 3300006914 Bacteria 2537
205 Ga0075436_100461344 3300006914 Unclassified 926
206 Ga0075436_100548303 3300006914 Bacteria 849
207 Ga0097620_100424995 3300006931 Bacteria 1425
208 Ga0075435_100040500 3300007076 Bacteria 3720
209 Ga0075435_100045913 3300007076 Bacteria 3503
210 Ga0075435_100157057 3300007076 Bacteria 1914
211 Ga0075435_100578103 3300007076 Bacteria 974
212 Ga0075435_100833366 3300007076 Bacteria 803
213 Ga0105240_10478316 3300009093 Bacteria 1389
214 Ga0111539_10049650 3300009094 Bacteria 5002
215 Ga0111539_10281592 3300009094 Bacteria 1935
216 Ga0111539_10687601 3300009094 Bacteria 1191
217 Ga0111539_10892955 3300009094 Unclassified 1034
218 Ga0105245_10036912 3300009098 Bacteria 4343
219 Ga0105247_10691098 3300009101 Bacteria 767
220 Ga0114129_10009271 3300009147 Bacteria 14036
221 Ga0114129_10017932 3300009147 Bacteria 10078
222 Ga0114129_10071105 3300009147 Bacteria 4852
223 Ga0114129_10076366 3300009147 Bacteria 4664
224 Ga0114129_10149832 3300009147 Bacteria 3193
225 Ga0114129_10437778 3300009147 Bacteria 1717
226 Ga0114129_10714659 3300009147 Unclassified 1286
227 Ga0114129_10869065 3300009147 Bacteria 1145
228 Ga0114129_11178052 3300009147 Bacteria 955
229 Ga0105243_10003585 3300009148 Bacteria 12527
230 Ga0105243_10291017 3300009148 Bacteria 1476
231 Ga0105243_10309534 3300009148 Unclassified 1435
232 Ga0105241_10000716 3300009174 Bacteria 25098
233 Ga0105241_10094975 3300009174 Bacteria 2359
234 Ga0105241_10952002 3300009174 Bacteria 800
235 Ga0105242_10000251 3300009176 Bacteria 42425
236 Ga0105242_10076230 3300009176 Bacteria 2795
237 Ga0105242_10598567 3300009176 Bacteria 1064
238 Ga0105242_11237152 3300009176 Bacteria 767
239 Ga0105248_10001792 3300009177 Bacteria 23876
240 Ga0105248_11057579 3300009177 Bacteria 917
241 Ga0105237_10000013 3300009545 Bacteria 297699
242 Ga0105237_10066610 3300009545 Bacteria 3596
243 Ga0105238_10090873 3300009551 Bacteria 3041
244 Ga0105238_11187727 3300009551 Bacteria 787
245 Ga0105249_10023634 3300009553 Bacteria 5517
246 Ga0105249_10038687 3300009553 Bacteria 4328
247 Ga0105249_10364615 3300009553 Bacteria 1467
248 Ga0105249_10391406 3300009553 Bacteria 1418
249 Ga0105249_10896853 3300009553 Bacteria 953
250 Ga0105249_11999526 3300009553 Unclassified 652
251 Ga0105249_12164897 3300009553 Unclassified 629
252 Ga0105239_10013449 3300010375 Bacteria 9093
253 Ga0105239_10048201 3300010375 Bacteria 4671
254 Ga0105239_10298877 3300010375 Bacteria 1813
255 Ga0105239_10555303 3300010375 Unclassified 1308
256 Ga0105246_10048247 3300011119 Bacteria 2910
257 Ga0105246_10099510 3300011119 Bacteria 2114
258 Ga0105246_11209973 3300011119 Unclassified 696
259 Ga0105246_11489418 3300011119 Bacteria 635
260 Ga0157319_1008551 3300012497 Bacteria 786
261 Ga0157339_1013176 3300012505 Bacteria 787
262 Ga0157327_1002831 3300012512 Bacteria 1232
263 Ga0157327_1007215 3300012512 Bacteria 962
264 Ga0157371_10453573 3300013102 Bacteria 943
265 Ga0157374_10304285 3300013296 Bacteria 1578
266 Ga0157378_10001585 3300013297 Bacteria 20557
267 Ga0157378_10022508 3300013297 Bacteria 5546
268 Ga0157378_10319336 3300013297 Bacteria 1508
269 Ga0163162_10036701 3300013306 Bacteria 4887
270 Ga0163162_10043019 3300013306 Bacteria 4522
271 Ga0163162_10066793 3300013306 Bacteria 3645
272 Ga0163162_10179578 3300013306 Bacteria 2243
273 Ga0163162_10791231 3300013306 Bacteria 1066
274 Ga0163162_12328358 3300013306 Bacteria 615
275 Ga0157372_10114281 3300013307 Bacteria 3094
276 Ga0157372_10247607 3300013307 Bacteria 2068
277 Ga0157375_10021674 3300013308 Bacteria 5898
278 Ga0157375_10458228 3300013308 Unclassified 1441
279 Ga0157375_10572842 3300013308 Bacteria 1290
280 Ga0157375_11291773 3300013308 Bacteria 858
281 Ga0157380_10020140 3300014326 Bacteria 4983
282 Ga0157380_10194865 3300014326 Bacteria 1792
283 Ga0157380_10393544 3300014326 Bacteria 1312
284 Ga0157380_10945175 3300014326 Bacteria 891
285 Ga0157377_10542233 3300014745 Bacteria 820
286 Ga0157379_10061166 3300014968 Bacteria 3368
287 Ga0157379_10077422 3300014968 Bacteria 2978
288 Ga0157376_10009968 3300014969 Bacteria 6933
289 Ga0157376_10383762 3300014969 Bacteria 1354
290 Ga0182006_1065900 3300015261 Bacteria 1355
291 Ga0163161_10010019 3300017792 Bacteria 6561
292 Ga0163161_10271084 3300017792 Bacteria 1328
293 Ga0163161_11447129 3300017792 Unclassified 601
294 Ga0206356_11313219 3300020070 Bacteria 547
295 Ga0207697_10014166 3300025315 Bacteria 3314
296 Ga0207697_10030298 3300025315 Bacteria 2214
297 Ga0207682_10012585 3300025893 Bacteria 3301
298 Ga0207642_10005154 3300025899 Bacteria 4253
299 Ga0207688_10011366 3300025901 Bacteria 4847
300 Ga0207688_10518365 3300025901 Bacteria 748
301 Ga0207680_10047393 3300025903 Bacteria 2547
302 Ga0207647_10216848 3300025904 Bacteria 1104
303 Ga0207647_10234857 3300025904 Unclassified 1054
304 Ga0207645_10000345 3300025907 Bacteria 38809
305 Ga0207645_10001078 3300025907 Bacteria 22569
306 Ga0207645_10647224 3300025907 Bacteria 718
307 Ga0207684_10017132 3300025910 Bacteria 6218
308 Ga0207684_10287667 3300025910 Bacteria 1417
309 Ga0207684_10531218 3300025910 Bacteria 1007
310 Ga0207707_10024571 3300025912 Bacteria 5273
311 Ga0207707_10039054 3300025912 Bacteria 4149
312 Ga0207707_10205457 3300025912 Bacteria 1717
313 Ga0207707_10771292 3300025912 Unclassified 803
314 Ga0207707_10794629 3300025912 Unclassified 789
315 Ga0207695_10429902 3300025913 Bacteria 1204
316 Ga0207671_10000024 3300025914 Bacteria 274628
317 Ga0207693_10153071 3300025915 Bacteria 1814
318 Ga0207660_10074432 3300025917 Bacteria 2479
319 Ga0207660_10179396 3300025917 Bacteria 1644
320 Ga0207660_10220233 3300025917 Bacteria 1489
321 Ga0207660_10861678 3300025917 Bacteria 739
322 Ga0207660_11176302 3300025917 Bacteria 624
323 Ga0207657_10003821 3300025919 Bacteria 15994
324 Ga0207649_10164599 3300025920 Bacteria 1540
325 Ga0207652_10024310 3300025921 Bacteria 5026
326 Ga0207652_10056546 3300025921 Bacteria 3377
327 Ga0207652_10284779 3300025921 Bacteria 1491
328 Ga0207652_10320081 3300025921 Bacteria 1400
329 Ga0207652_10661306 3300025921 Bacteria 934
330 Ga0207646_10194361 3300025922 Bacteria 1832
331 Ga0207646_10942616 3300025922 Bacteria 765
332 Ga0207681_10126385 3300025923 Bacteria 1883
333 Ga0207694_10076010 3300025924 Bacteria 2630
334 Ga0207650_10000495 3300025925 Bacteria 32814
335 Ga0207659_10281826 3300025926 Bacteria 1359
336 Ga0207659_10391793 3300025926 Bacteria 1160
337 Ga0207659_11275379 3300025926 Bacteria 631
338 Ga0207690_10006635 3300025932 Bacteria 6858
339 Ga0207706_10000096 3300025933 Bacteria 92125
340 Ga0207706_10022822 3300025933 Bacteria 5614
341 Ga0207706_10135477 3300025933 Bacteria 2166
342 Ga0207686_10000112 3300025934 Bacteria 65154
343 Ga0207686_10056837 3300025934 Bacteria 2461
344 Ga0207686_11000503 3300025934 Bacteria 678
345 Ga0207709_10001243 3300025935 Bacteria 18298
346 Ga0207709_10594557 3300025935 Bacteria 875
347 Ga0207670_11083394 3300025936 Bacteria 676
348 Ga0207669_10001730 3300025937 Bacteria 9271
349 Ga0207669_10029605 3300025937 Bacteria 3031
350 Ga0207704_10001104 3300025938 Bacteria 12007
351 Ga0207704_10117499 3300025938 Bacteria 1812
352 Ga0207691_10132133 3300025940 Bacteria 2204
353 Ga0207691_10238057 3300025940 Bacteria 1574
354 Ga0207691_10269046 3300025940 Bacteria 1468
355 Ga0207711_10028313 3300025941 Bacteria 4714
356 Ga0207689_10000911 3300025942 Bacteria 28348
357 Ga0207689_10205841 3300025942 Bacteria 1625
358 Ga0207661_11563091 3300025944 Bacteria 604
359 Ga0207679_10002179 3300025945 Bacteria 12114
360 Ga0207679_10052846 3300025945 Bacteria 2981
361 Ga0207679_10233658 3300025945 Bacteria 1554
362 Ga0207667_10219097 3300025949 Bacteria 1950
363 Ga0207667_10273030 3300025949 Bacteria 1728
364 Ga0207651_10917622 3300025960 Unclassified 780
365 Ga0207712_10007741 3300025961 Bacteria 6792
366 Ga0207712_10044085 3300025961 Bacteria 3081
367 Ga0207712_10130813 3300025961 Bacteria 1912
368 Ga0207668_10776477 3300025972 Bacteria 847
369 Ga0207640_10032470 3300025981 Bacteria 3238
370 Ga0207640_11090184 3300025981 Unclassified 706
371 Ga0207658_10022058 3300025986 Bacteria 4429
372 Ga0207677_10601384 3300026023 Bacteria 965
373 Ga0207703_10740598 3300026035 Bacteria 936
374 Ga0207639_10113688 3300026041 Bacteria 2211
375 Ga0207639_10145642 3300026041 Bacteria 1978
376 Ga0207678_10096128 3300026067 Bacteria 2531
377 Ga0207678_10127303 3300026067 Bacteria 2172
378 Ga0207708_10121195 3300026075 Bacteria 2038
379 Ga0207708_10187806 3300026075 Bacteria 1643
380 Ga0207708_10569826 3300026075 Bacteria 956
381 Ga0207702_10299583 3300026078 Bacteria 1525
382 Ga0207648_10000043 3300026089 Bacteria 113682
383 Ga0207676_10019559 3300026095 Bacteria 4942
384 Ga0207676_10121075 3300026095 Bacteria 2207
385 Ga0207676_10358473 3300026095 Bacteria 1351
386 Ga0207674_10001182 3300026116 Bacteria 33900
387 Ga0207674_10251074 3300026116 Bacteria 1716
388 Ga0207674_10360661 3300026116 Bacteria 1405
389 Ga0207674_10831067 3300026116 Bacteria 891
390 Ga0207675_100009301 3300026118 Bacteria 9216
391 Ga0207675_100115253 3300026118 Bacteria 2539
392 Ga0207675_100384116 3300026118 Bacteria 1381
393 Ga0207683_10001057 3300026121 Bacteria 25089
394 Ga0207683_10003314 3300026121 Bacteria 14037
395 Ga0209973_1012454 3300027252 Bacteria 1035
396 Ga0209973_1072123 3300027252 Bacteria 542
397 Ga0209999_1040188 3300027543 Unclassified 876
398 Ga0209983_1008763 3300027665 Bacteria 2064
399 Ga0209966_1003451 3300027695 Bacteria 2658
400 Ga0209966_1023377 3300027695 Bacteria 1214
401 Ga0209974_10001329 3300027876 Bacteria 8888
402 Ga0209974_10085453 3300027876 Unclassified 1090
403 Ga0207428_10027342 3300027907 Bacteria 4750
404 Ga0268266_10125382 3300028379 Bacteria 2291
405 Ga0268265_10030120 3300028380 Bacteria 3904
406 Ga0268265_10035569 3300028380 Bacteria 3641
407 Ga0268264_10033356 3300028381 Bacteria 4228
408 Ga0268264_10245426 3300028381 Bacteria 1661
409 Ga0268264_10250049 3300028381 Bacteria 1646
410 Ga0268264_10260393 3300028381 Bacteria 1615
411 Ga0268264_10280794 3300028381 Bacteria 1560
412 Ga0265337_1001252 3300028556 Bacteria 12795
413 Ga0265337_1019898 3300028556 Bacteria 2110
414 Ga0265337_1039120 3300028556 Bacteria 1372
415 Ga0265326_10001074 3300028558 Bacteria 9741
416 Ga0265326_10003863 3300028558 Bacteria 4869
417 Ga0265326_10038215 3300028558 Bacteria 1364
418 Ga0265319_1000100 3300028563 Bacteria 66728
419 Ga0265319_1000169 3300028563 Bacteria 49406
420 Ga0265319_1009373 3300028563 Bacteria 4177
421 Ga0265319_1011555 3300028563 Bacteria 3607
422 Ga0265334_10000310 3300028573 Bacteria 26917
423 Ga0265334_10001411 3300028573 Bacteria 11555
424 Ga0265334_10049458 3300028573 Bacteria 1617
425 Ga0265334_10055984 3300028573 Bacteria 1499
426 Ga0265318_10000883 3300028577 Bacteria 19608
427 Ga0265318_10001698 3300028577 Bacteria 12642
428 Ga0265318_10071416 3300028577 Bacteria 1286
429 Ga0265323_10000218 3300028653 Bacteria 33811
430 Ga0265322_10000549 3300028654 Bacteria 14431
431 Ga0265336_10000115 3300028666 Bacteria 59960
432 Ga0265338_10001654 3300028800 Bacteria 35526
433 Ga0265338_10005397 3300028800 Bacteria 16701
434 Ga0265338_10005519 3300028800 Bacteria 16487
435 Ga0265338_10005708 3300028800 Bacteria 16097
436 Ga0265338_10016656 3300028800 Bacteria 7971
437 Ga0265338_10030059 3300028800 Bacteria 5366
438 Ga0265338_10407500 3300028800 Bacteria 968
439 Ga0265338_10884010 3300028800 Unclassified 609
440 Ga0265324_10001167 3300029957 Bacteria 15643
441 Ga0265324_10005143 3300029957 Bacteria 5711
442 Ga0265324_10005863 3300029957 Bacteria 5224
443 Ga0265330_10000319 3300031235 Bacteria 34472
444 Ga0265330_10020997 3300031235 Bacteria 2983
445 Ga0265332_10000382 3300031238 Bacteria 32426
446 Ga0265332_10001943 3300031238 Bacteria 10900
447 Ga0265328_10000950 3300031239 Bacteria 13286
448 Ga0265328_10020966 3300031239 Bacteria 2498
449 Ga0265320_10002083 3300031240 Bacteria 14085
450 Ga0265320_10002134 3300031240 Bacteria 13874
451 Ga0265320_10004768 3300031240 Bacteria 8825
452 Ga0265320_10154121 3300031240 Bacteria 1037
453 Ga0265320_10305990 3300031240 Unclassified 703
454 Ga0265325_10001011 3300031241 Bacteria 20253
455 Ga0265325_10004251 3300031241 Bacteria 9088
456 Ga0265329_10000073 3300031242 Bacteria 44995
457 Ga0265329_10012739 3300031242 Bacteria 3014
458 Ga0265340_10029476 3300031247 Bacteria 2756
459 Ga0265340_10034363 3300031247 Bacteria 2522
460 Ga0265340_10130870 3300031247 Bacteria 1151
461 Ga0265339_10000297 3300031249 Bacteria 40447
462 Ga0265339_10163305 3300031249 Bacteria 1119
463 Ga0265331_10000963 3300031250 Bacteria 22892
464 Ga0265331_10002686 3300031250 Bacteria 11855
465 Ga0265327_10216109 3300031251 Unclassified 864
466 Ga0265316_10000247 3300031344 Bacteria 62442
467 Ga0265316_10005834 3300031344 Bacteria 11873
468 Ga0265316_10016713 3300031344 Bacteria 6357
469 Ga0265316_10427338 3300031344 Unclassified 952
470 Ga0265316_11111670 3300031344 Bacteria 548
471 Ga0307408_100026942 3300031548 Bacteria 3955
472 Ga0307408_100295085 3300031548 Bacteria 1355
473 Ga0307408_100405040 3300031548 Bacteria 1172
474 Ga0307408_100543281 3300031548 Bacteria 1024
475 Ga0307408_100567973 3300031548 Bacteria 1003
476 Ga0307408_101359671 3300031548 Bacteria 667
477 Ga0265313_10000580 3300031595 Bacteria 38083
478 Ga0265313_10003350 3300031595 Bacteria 13083
479 Ga0265313_10251667 3300031595 Unclassified 720
480 Ga0316579_10047461 3300031691 Bacteria 2006
481 Ga0316579_10614889 3300031691 Unclassified 526
482 Ga0265314_10000285 3300031711 Bacteria 73539
483 Ga0265314_10004269 3300031711 Bacteria 13374
484 Ga0265314_10139006 3300031711 Bacteria 1504
485 Ga0265314_10320154 3300031711 Unclassified 863
486 Ga0265342_10000764 3300031712 Bacteria 32819
487 Ga0265342_10026274 3300031712 Bacteria 3650
488 Ga0265342_10029291 3300031712 Bacteria 3419
489 Ga0316576_10012788 3300031727 Bacteria 5555
490 Ga0307405_10004222 3300031731 Bacteria 6759
491 Ga0307405_10010584 3300031731 Bacteria 4793
492 Ga0307405_10015476 3300031731 Bacteria 4134
493 Ga0307405_10025001 3300031731 Bacteria 3422
494 Ga0307405_10084395 3300031731 Bacteria 2085
495 Ga0307413_10001012 3300031824 Bacteria 10160
496 Ga0307413_10002720 3300031824 Bacteria 7256
497 Ga0307413_10018674 3300031824 Bacteria 3644
498 Ga0307413_10064349 3300031824 Bacteria 2278
499 Ga0307413_10458476 3300031824 Bacteria 1013
500 Ga0307410_10001656 3300031852 Bacteria 10246
501 Ga0307410_10003004 3300031852 Bacteria 8326
502 Ga0307410_10015549 3300031852 Bacteria 4517
503 Ga0307410_10056473 3300031852 Bacteria 2670
504 Ga0307410_10169784 3300031852 Bacteria 1642
505 Ga0307410_10341626 3300031852 Bacteria 1193
506 Ga0307410_10865010 3300031852 Unclassified 773
507 Ga0307406_10018816 3300031901 Bacteria 4043
508 Ga0307406_10042759 3300031901 Bacteria 2830
509 Ga0307406_10077352 3300031901 Bacteria 2201
510 Ga0307406_10119280 3300031901 Bacteria 1831
511 Ga0307407_10012077 3300031903 Bacteria 4140
512 Ga0307407_10022294 3300031903 Bacteria 3282
513 Ga0307407_10062132 3300031903 Bacteria 2186
514 Ga0307407_10070217 3300031903 Bacteria 2081
515 Ga0307407_10103907 3300031903 Bacteria 1769
516 Ga0307412_10010597 3300031911 Bacteria 5312
517 Ga0307412_10023940 3300031911 Bacteria 3765
518 Ga0307412_10024997 3300031911 Bacteria 3694
519 Ga0307412_10060041 3300031911 Bacteria 2551
520 Ga0307412_10121125 3300031911 Bacteria 1884
521 Ga0307412_10307286 3300031911 Bacteria 1256
522 Ga0307412_12039389 3300031911 Unclassified 532
523 Ga0307409_100000744 3300031995 Bacteria 14663
524 Ga0307409_100001517 3300031995 Bacteria 11492
525 Ga0307409_100032484 3300031995 Bacteria 3785
526 Ga0307409_100085646 3300031995 Bacteria 2562
527 Ga0307409_100254570 3300031995 Bacteria 1607
528 Ga0307409_100515560 3300031995 Bacteria 1167
529 Ga0307409_100694547 3300031995 Bacteria 1016
530 Ga0307409_100937441 3300031995 Bacteria 881
531 Ga0307409_100994784 3300031995 Bacteria 856
532 Ga0307416_100000378 3300032002 Bacteria 23099
533 Ga0307416_100000758 3300032002 Bacteria 16898
534 Ga0307416_100011031 3300032002 Bacteria 6003
535 Ga0307416_100014401 3300032002 Bacteria 5419
536 Ga0307416_100052696 3300032002 Unclassified 3259
537 Ga0307416_100074200 3300032002 Bacteria 2840
538 Ga0307416_100079832 3300032002 Bacteria 2759
539 Ga0307416_100751757 3300032002 Bacteria 1068
540 Ga0307416_100759471 3300032002 Bacteria 1063
541 Ga0307414_10053192 3300032004 Bacteria 2823
542 Ga0307414_10064513 3300032004 Bacteria 2608
543 Ga0307414_10142132 3300032004 Bacteria 1880
544 Ga0307411_10007405 3300032005 Bacteria 5589
545 Ga0307411_10010727 3300032005 Bacteria 4901
546 Ga0307411_10020620 3300032005 Bacteria 3838
547 Ga0307411_10022178 3300032005 Bacteria 3733
548 Ga0307411_10030110 3300032005 Bacteria 3323
549 Ga0307411_10042248 3300032005 Bacteria 2907
550 Ga0307411_10092489 3300032005 Bacteria 2115
551 Ga0307415_100000254 3300032126 Bacteria 23073
552 Ga0307415_100029860 3300032126 Bacteria 3490
553 Ga0307415_100074789 3300032126 Bacteria 2395
554 Ga0307415_100122385 3300032126 Bacteria 1954
555 Ga0307415_100200103 3300032126 Bacteria 1584
556 Ga0307415_100269237 3300032126 Bacteria 1395
557 Ga0307415_100303158 3300032126 Bacteria 1324
558 Ga0373932_0093343 3300035112 Unclassified 969
559 Ga0373932_0100489 3300035112 Bacteria 940
560 Ga0373939_0012513 3300035114 Bacteria 2165
561 Ga0373939_0029267 3300035114 Bacteria 1574
562 Ga0373945_0096275 3300035116 Bacteria 1153
563 Ga0373956_0169256 3300035119 Unclassified 1031
564 Ga0373943_0019270 3300035170 Bacteria 3137
565 Ga0373946_0035499 3300035171 Bacteria 2018
566 Ga0373946_0091313 3300035171 Bacteria 1350
567 Ga0373942_0038413 3300035207 Bacteria 1298
568 Ga0373961_0065073 3300035241 Bacteria 1116
569 Ga0373931_0001299 3300035691 Bacteria 10687
570 Ga0373931_0173642 3300035691 Bacteria 1272
571 Ga0373931_0267744 3300035691 Bacteria 1045
572 Ga0373935_0042903 3300035692 Bacteria 2845
573 Ga0373927_0023785 3300035695 Bacteria 4010
574 Ga0373947_0038852 3300035725 Bacteria 2830
575 Ga0373937_0067255 3300036401 Bacteria 3301
576 Ga0373937_0429654 3300036401 Bacteria 1254
577 Ga0373937_0661370 3300036401 Bacteria 990
578 Ga0316582_0471911 3300036647 Bacteria 865
579 Ga0316584_0110326 3300036712 Bacteria 2059
580 Ga0373925_0047910 3300037068 Bacteria 3183
581 Ga0436360_1116795 3300039438 Bacteria 1180
582 Ga0439439_0023783 3300041406 Bacteria 1536
583 Ga0439439_0192220 3300041406 Unclassified 591
584 Ga0439453_0034329 3300041408 Bacteria 973
585 Ga0439461_0081065 3300041410 Bacteria 766
586 Ga0439431_0049208 3300041997 Bacteria 1090
587 Ga0439433_0077417 3300041999 Bacteria 806
588 Ga0439441_083062 3300042001 Unclassified 700
589 Ga0439442_147690 3300042002 Unclassified 522
590 Ga0439443_016264 3300042003 Bacteria 1135
591 Ga0439448_0184730 3300042005 Bacteria 729
592 Ga0439454_007832 3300042011 Bacteria 1349
593 Ga0439462_0003337 3300042015 Bacteria 3842
594 Ga0450923_003245 3300042125 Bacteria 2433
595 Ga0450891_023604 3300042129 Bacteria 614
596 Ga0450896_077762 3300042133 Bacteria 556
597 Ga0450898_006247 3300042134 Bacteria 1823
598 Ga0450905_019519 3300042142 Bacteria 993
599 Ga0450910_008626 3300042147 Bacteria 1436
600 Ga0439434_0057043 3300042435 Bacteria 1217
601 Ga0439434_0097721 3300042435 Bacteria 944
602 Ga0439434_0103774 3300042435 Bacteria 917
603 Ga0439444_0011142 3300042437 Bacteria 1451
604 Ga0439464_0128685 3300042439 Bacteria 783
605 Ga0439460_0112844 3300042461 Bacteria 883
606 Ga0450893_0044148 3300042532 Bacteria 823
607 Ga0451577_0016505 3300042876 Bacteria 6837
608 Ga0451577_0081476 3300042876 Bacteria 2887
609 Ga0451577_0261353 3300042876 Bacteria 1567
610 Ga0451577_0307972 3300042876 Bacteria 1435
611 Ga0451577_0846090 3300042876 Bacteria 825
612 Ga0451577_1096895 3300042876 Bacteria 712
613 Ga0453683_0018303 3300044673 Bacteria 4498
614 Ga0453683_0060110 3300044673 Bacteria 2376
615 Ga0453683_0583025 3300044673 Unclassified 729
616 Ga0453684_0325694 3300044712 Bacteria 1739
617 Ga0453684_0870358 3300044712 Bacteria 967
618 Ga0453684_0924218 3300044712 Unclassified 933
619 Ga0453684_2516927 3300044712 Bacteria 507
620 Ga0451576_0076699 3300045051 Bacteria 3478
621 Ga0451576_0385362 3300045051 Bacteria 1469
622 Ga0451576_0674026 3300045051 Bacteria 1086
623 Ga0451576_0804217 3300045051 Bacteria 987
624 Ga0451576_1199877 3300045051 Bacteria 792
625 Ga0495603_0071247 3300046455 Bacteria 2043
626 Ga0495641_0128048 3300046461 Unclassified 1133
627 Ga0495662_0043530 3300046476 Bacteria 2167
628 Ga0495594_0058338 3300046499 Bacteria 2132
629 Ga0495594_0075334 3300046499 Bacteria 1881
630 Ga0495618_0007472 3300046514 Bacteria 6611
631 Ga0495630_0008925 3300046517 Bacteria 7196
632 Ga0495666_0004554 3300046526 Bacteria 7004
633 Ga0495640_0121324 3300046533 Bacteria 1699
634 Ga0495586_0030773 3300046535 Bacteria 2872
635 Ga0495598_0049625 3300046537 Bacteria 1259
636 Ga0495622_0137497 3300046557 Bacteria 1110
637 Ga0495667_0084273 3300046559 Bacteria 2064
638 Ga0495656_0773534 3300046615 Bacteria 518
639 Ga0495634_0003518 3300046642 Bacteria 12547
640 Ga0495659_0012816 3300046664 Unclassified 2722
641 Ga0495657_0288249 3300046675 Bacteria 981
642 Ga0495647_0014592 3300046681 Bacteria 2739
643 Ga0495658_0177567 3300046683 Unclassified 1320
644 Ga0495658_0436905 3300046683 Bacteria 836
645 Ga0495624_0090871 3300046690 Bacteria 1884
646 Ga0495670_0478960 3300046691 Bacteria 675
647 Ga0495670_0694121 3300046691 Unclassified 555
648 Ga0495636_0154105 3300047318 Bacteria 1032
649 Ga0495674_0030082 3300047319 Bacteria 4941
650 Ga0495676_0117719 3300047321 Bacteria 1938
651 Ga0495676_0412417 3300047321 Bacteria 895
652 Ga0495680_0009004 3300047322 Bacteria 9018
653 Ga0496100_0066711 3300048903 Bacteria 2388
654 Ga0496100_0656710 3300048903 Bacteria 817
655 Ga0496101_0013792 3300048904 Bacteria 5423
656 Ga0496101_0304744 3300048904 Bacteria 1248
657 Ga0496102_0152205 3300048905 Bacteria 2174
658 Ga0496102_1592940 3300048905 Bacteria 571
659 Ga0496103_0144264 3300048906 Bacteria 1524
660 Ga0496103_0548129 3300048906 Unclassified 738
661 Ga0496105_0526059 3300048908 Bacteria 926
662 Ga0496106_0081204 3300048909 Bacteria 2491
663 Ga0496106_0095035 3300048909 Bacteria 2305
664 Ga0496106_0111191 3300048909 Bacteria 2133
665 Ga0496107_0106188 3300048910 Bacteria 2062
666 Ga0496107_0362713 3300048910 Bacteria 1078
667 Ga0496108_0155741 3300048911 Bacteria 1973
668 Ga0496109_0090192 3300048912 Bacteria 2835
669 Ga0496110_0443938 3300048913 Bacteria 1182
670 Ga0496111_0327795 3300048914 Bacteria 1134
671 Ga0496112_0002371 3300048915 Bacteria 15137
672 Ga0496112_0990775 3300048915 Bacteria 760
673 Ga0496113_0083955 3300048916 Bacteria 2445
674 Ga0496114_1197794 3300048917 Unclassified 645
675 Ga0501298_001964 3300049521 Bacteria 3070
676 Ga0501299_004376 3300049522 Bacteria 2106
677 Ga0501299_156400 3300049522 Unclassified 579
678 Ga0501301_037965 3300049524 Unclassified 536
679 Ga0501031_0007782 3300049568 Bacteria 6973
680 Ga0501032_0189213 3300049569 Bacteria 1345
681 Ga0501033_0021886 3300049570 Bacteria 4824
682 Ga0501034_0014428 3300049571 Bacteria 8135
683 Ga0501034_0634108 3300049571 Bacteria 972
684 Ga0501036_0074631 3300049572 Bacteria 2868
685 Ga0501036_0835674 3300049572 Bacteria 757
686 Ga0501036_0992464 3300049572 Unclassified 687
687 Ga0501037_0015475 3300049573 Bacteria 5614
688 Ga0501038_0040779 3300049574 Bacteria 4050
689 Ga0501039_0017431 3300049575 Bacteria 5508
690 Ga0501039_0332457 3300049575 Unclassified 1194
691 Ga0501040_0022977 3300049576 Bacteria 4178
692 Ga0501041_0004538 3300049577 Bacteria 8054
693 Ga0501042_0235411 3300049578 Bacteria 1321
694 Ga0501042_0472046 3300049578 Bacteria 910
695 Ga0501043_0006165 3300049579 Bacteria 9631
696 Ga0501046_0008905 3300049580 Bacteria 8711
697 Ga0501046_0117006 3300049580 Bacteria 2031
698 Ga0501046_0219098 3300049580 Bacteria 1410
699 Ga0501047_0158985 3300049581 Bacteria 2132
700 Ga0501047_0877196 3300049581 Bacteria 711
701 Ga0501048_0107814 3300049582 Bacteria 1966
702 Ga0501067_0528374 3300049583 Unclassified 660
703 Ga0501068_0015939 3300049584 Bacteria 4328
704 Ga0501068_0468996 3300049584 Bacteria 815
705 Ga0501068_0470400 3300049584 Bacteria 814
706 Ga0501069_0006048 3300049585 Bacteria 6319
707 Ga0501069_0142288 3300049585 Bacteria 1376
708 Ga0501069_0150444 3300049585 Bacteria 1337
709 Ga0501070_0047845 3300049586 Bacteria 3553
710 Ga0501071_0101413 3300049587 Bacteria 2122
711 Ga0501071_0383700 3300049587 Bacteria 1072
712 Ga0501071_0462426 3300049587 Bacteria 971
713 Ga0501071_0559495 3300049587 Unclassified 879
714 Ga0501071_0603719 3300049587 Bacteria 844
715 Ga0501072_0078507 3300049588 Bacteria 2614
716 Ga0501072_0312988 3300049588 Bacteria 1248
717 Ga0501072_0363037 3300049588 Bacteria 1149
718 Ga0501072_0737584 3300049588 Bacteria 773
719 Ga0501072_0845060 3300049588 Bacteria 716
720 Ga0501073_0005350 3300049589 Bacteria 9624
721 Ga0501073_0287988 3300049589 Bacteria 1133
722 Ga0501073_0963113 3300049589 Bacteria 587
723 Ga0501074_0001217 3300049590 Bacteria 16960
724 Ga0501074_0089317 3300049590 Bacteria 2207
725 Ga0501074_0699814 3300049590 Bacteria 715
726 Ga0501075_0000770 3300049591 Bacteria 19987
727 Ga0501075_0017837 3300049591 Bacteria 5127
728 Ga0501075_0079990 3300049591 Bacteria 2474
729 Ga0501076_0003602 3300049592 Bacteria 10882
730 Ga0501076_0679693 3300049592 Bacteria 850
731 Ga0501077_0013963 3300049593 Bacteria 5037
732 Ga0501077_0060619 3300049593 Bacteria 2401
733 Ga0501077_0103817 3300049593 Bacteria 1801
734 Ga0501077_0150159 3300049593 Bacteria 1478
735 Ga0501077_0907608 3300049593 Bacteria 567
736 Ga0501217_134230 3300049661 Bacteria 728
737 Ga0501233_009923 3300049668 Bacteria 1866
738 Ga0501235_012869 3300049669 Bacteria 1842
739 Ga0501243_038621 3300049675 Bacteria 833
740 Ga0501261_042851 3300049690 Bacteria 719
741 Ga0501225_0003685 3300049705 Bacteria 4611
742 Ga0501225_0020204 3300049705 Bacteria 1841
743 Ga0501229_063340 3300049706 Unclassified 567
744 Ga0501079_0085949 3300049741 Bacteria 2434
745 Ga0501079_0161057 3300049741 Bacteria 1750
746 Ga0501079_0381241 3300049741 Bacteria 1105
747 Ga0501079_0885231 3300049741 Bacteria 703
748 Ga0501080_0033059 3300049742 Bacteria 4826
749 Ga0501080_0040338 3300049742 Bacteria 4354
750 Ga0501080_1146223 3300049742 Bacteria 670
751 Ga0501081_0004872 3300049743 Bacteria 8628
752 Ga0501081_0082924 3300049743 Bacteria 2246
753 Ga0501081_0128408 3300049743 Bacteria 1810
754 Ga0501081_0472498 3300049743 Bacteria 933
755 Ga0501081_0976298 3300049743 Bacteria 640
756 Ga0501083_0012410 3300049744 Bacteria 5963
757 Ga0501083_0281463 3300049744 Bacteria 1082
758 Ga0501262_003301 3300049759 Bacteria 1843
759 Ga0501270_027755 3300049767 Bacteria 913
760 Ga0501283_117577 3300049779 Unclassified 530
761 Ga0501035_0007245 3300049822 Bacteria 10379
762 Ga0501045_0045679 3300049824 Bacteria 3188
763 Ga0501045_0082381 3300049824 Bacteria 2373
764 Ga0501045_0522748 3300049824 Unclassified 881
765 Ga0501045_0805274 3300049824 Bacteria 692
766 Ga0501045_0960141 3300049824 Unclassified 627
767 Ga0501204_005837 3300049850 Bacteria 1357
768 Ga0501212_099093 3300049851 Unclassified 546
769 nmdc:mga05p37_134390_c1 3300050507 Bacteria 3035
770 nmdc:mga05p37_16050_c1 3300050507 Bacteria 9013
771 nmdc:mga05p37_183465_c1 3300050507 Bacteria 2545
772 nmdc:mga05p37_26567_c1 3300050507 Bacteria 7040
773 nmdc:mga05p37_281151_c1 3300050507 Bacteria 1985
774 nmdc:mga05p37_455420_c1 3300050507 Bacteria 1480
775 nmdc:mga05p37_983103_c1 3300050507 Bacteria 899
776 nmdc:mga09592_1026488_c1 3300050508 Bacteria 688
777 nmdc:mga09592_11119_c1 3300050508 Bacteria 7321
778 nmdc:mga09592_1120906_c1 3300050508 Bacteria 653
779 nmdc:mga09592_17899_c1 3300050508 Bacteria 5805
780 nmdc:mga09592_254973_c1 3300050508 Bacteria 1521
781 nmdc:mga09592_30957_c1 3300050508 Bacteria 4456
782 nmdc:mga09592_377264_c1 3300050508 Bacteria 1226
783 nmdc:mga09592_67249_c1 3300050508 Bacteria 3038
784 nmdc:mga09592_705441_c1 3300050508 Bacteria 858
785 nmdc:mga0qj67_10983_c1 3300050509 Bacteria 6778
786 nmdc:mga0qj67_1545785_c1 3300050509 Bacteria 510
787 nmdc:mga0qj67_211737_c1 3300050509 Bacteria 1574
788 nmdc:mga0qj67_26559_c1 3300050509 Bacteria 4481
789 nmdc:mga0qj67_37596_c1 3300050509 Bacteria 3793
790 nmdc:mga0qj67_596887_c1 3300050509 Bacteria 883
791 nmdc:mga0qj67_829456_c1 3300050509 Bacteria 731
792 nmdc:mga06r32_18791_c1 3300050510 Bacteria 6333
793 nmdc:mga06r32_21962_c1 3300050510 Bacteria 5893
794 nmdc:mga06r32_2808_c1 3300050510 Bacteria 15600
795 nmdc:mga06r32_640155_c1 3300050510 Bacteria 1032
796 nmdc:mga08y16_20164_c1 3300050511 Bacteria 7036
797 nmdc:mga08y16_219566_c1 3300050511 Bacteria 1968
798 nmdc:mga08y16_277460_c1 3300050511 Bacteria 1729
799 nmdc:mga08y16_834158_c1 3300050511 Bacteria 912
800 nmdc:mga0n895_128487_c1 3300050512 Bacteria 2559
801 nmdc:mga0n895_282560_c1 3300050512 Bacteria 1683
802 nmdc:mga0n895_39550_c1 3300050512 Bacteria 4576
803 nmdc:mga0n895_507972_c1 3300050512 Bacteria 1214
804 nmdc:mga0n895_91896_c1 3300050512 Bacteria 3038
805 nmdc:mga0n895_93500_c1 3300050512 Bacteria 3010
806 nmdc:mga0n895_96830_c1 3300050512 Bacteria 2956
807 nmdc:mga0rr50_197921_c1 3300050513 Bacteria 1650
808 nmdc:mga0rr50_261726_c1 3300050513 Bacteria 1439
809 nmdc:mga0rr50_28277_c1 3300050513 Bacteria 3939
810 nmdc:mga0rr50_346454_c1 3300050513 Bacteria 1249
811 nmdc:mga0rr50_68051_c1 3300050513 Bacteria 2707
812 nmdc:mga08x19_24722_c1 3300050514 Bacteria 3403
813 nmdc:mga08x19_478126_c1 3300050514 Bacteria 878
814 nmdc:mga08x19_604651_c1 3300050514 Bacteria 777
815 nmdc:mga08x19_72739_c1 3300050514 Bacteria 2243
816 nmdc:mga08x19_73276_c1 3300050514 Bacteria 2235
817 nmdc:mga0a205_1486_c1 3300050515 Bacteria 19984
818 nmdc:mga0a205_148876_c1 3300050515 Bacteria 2241
819 nmdc:mga0a205_259485_c1 3300050515 Bacteria 1616
820 nmdc:mga0a205_627500_c1 3300050515 Bacteria 927
821 nmdc:mga0a205_937446_c1 3300050515 Bacteria 713
822 Ga0501084_0009832 3300054114 Bacteria 7902
823 Ga0501084_0077570 3300054114 Bacteria 2785
824 Ga0501084_0338753 3300054114 Bacteria 1270
825 Ga0501084_0397067 3300054114 Bacteria 1165
826 Ga0501084_0495337 3300054114 Bacteria 1033
827 Ga0590071_009305 3300059421 Bacteria 2306
828 Ga0590074_014529 3300059423 Bacteria 1333
829 Ga0590074_035047 3300059423 Bacteria 894
830 Ga0590075_003441 3300059424 Bacteria 3763
831 Ga0590077_007598 3300059426 Bacteria 2216
832 Ga0590077_019238 3300059426 Bacteria 1445
833 Ga0590077_063834 3300059426 Unclassified 837
834 Ga0501082_0032225 3300060353 Bacteria 4519
835 Ga0501082_0076961 3300060353 Bacteria 2876
836 Ga0530510_0042012 3300061734 Bacteria 3302
837 Ga0530510_0091974 3300061734 Bacteria 2213
838 Ga0530510_0333066 3300061734 Bacteria 1139
839 Ga0530510_0646154 3300061734 Bacteria 805

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_1197794 Ga0496114_1197794_13_390 123
2 3300041408 Ga0439453_0034329 Ga0439453_0034329_552_932 124
3 3300042002 Ga0439442_147690 Ga0439442_147690_16_396 124
4 3300044712 Ga0453684_2516927 Ga0453684_2516927_89_463 124
5 3300048903 Ga0496100_0656710 Ga0496100_0656710_428_802 124
6 3300048904 Ga0496101_0304744 Ga0496101_0304744_823_1197 124
7 3300006880 Ga0075429_100004888 Ga0075429_10000488816 125
8 3300050508 nmdc:mga09592_17899_c1 nmdc:mga09592_17899_c1_2042_2443 125
9 3300047321 Ga0495676_0412417 Ga0495676_0412417_467_847 126
10 3300049572 Ga0501036_0992464 Ga0501036_0992464_37_417 126
11 3300049851 Ga0501212_099093 Ga0501212_099093_138_521 126
12 3300050507 nmdc:mga05p37_281151_c1 nmdc:mga05p37_281151_c1_1575_1961 126
13 3300050515 nmdc:mga0a205_937446_c1 nmdc:mga0a205_937446_c1_58_444 126
14 3300028558 Ga0265326_10001074 Ga0265326_100010744 137
15 3300028563 Ga0265319_1000169 Ga0265319_100016930 137
16 3300028573 Ga0265334_10055984 Ga0265334_100559843 137
17 3300028577 Ga0265318_10071416 Ga0265318_100714162 137
18 3300028653 Ga0265323_10000218 Ga0265323_1000021819 137
19 3300028654 Ga0265322_10000549 Ga0265322_100005499 137
20 3300028800 Ga0265338_10005708 Ga0265338_1000570811 137
21 3300029957 Ga0265324_10001167 Ga0265324_1000116710 137
22 3300031235 Ga0265330_10000319 Ga0265330_1000031924 137
23 3300031238 Ga0265332_10000382 Ga0265332_1000038213 137
24 3300031239 Ga0265328_10000950 Ga0265328_1000095019 137
25 3300031240 Ga0265320_10002083 Ga0265320_1000208317 137
26 3300031242 Ga0265329_10000073 Ga0265329_1000007310 137
27 3300031247 Ga0265340_10029476 Ga0265340_100294764 137
28 3300031249 Ga0265339_10000297 Ga0265339_100002979 137
29 3300031250 Ga0265331_10000963 Ga0265331_1000096322 137
30 3300031251 Ga0265327_10216109 Ga0265327_102161092 137
31 3300031344 Ga0265316_10000247 Ga0265316_1000024724 137
32 3300031595 Ga0265313_10251667 Ga0265313_102516672 137
33 3300031711 Ga0265314_10000285 Ga0265314_1000028540 137
34 3300031712 Ga0265342_10000764 Ga0265342_1000076423 137
35 3300006880 Ga0075429_100129218 Ga0075429_1001292182 138
36 3300028556 Ga0265337_1001252 Ga0265337_10012528 138
37 3300028558 Ga0265326_10003863 Ga0265326_100038635 138
38 3300028563 Ga0265319_1000100 Ga0265319_100010033 138
39 3300028573 Ga0265334_10001411 Ga0265334_100014118 138
40 3300028577 Ga0265318_10000883 Ga0265318_100008832 138
41 3300028666 Ga0265336_10000115 Ga0265336_1000011534 138
42 3300028800 Ga0265338_10005397 Ga0265338_100053979 138
43 3300029957 Ga0265324_10005143 Ga0265324_100051434 138
44 3300031240 Ga0265320_10002134 Ga0265320_100021345 138
45 3300031241 Ga0265325_10004251 Ga0265325_100042519 138
46 3300031344 Ga0265316_10005834 Ga0265316_1000583410 138
47 3300031595 Ga0265313_10000580 Ga0265313_1000058036 138
48 3300031711 Ga0265314_10320154 Ga0265314_103201542 138
49 3300031712 Ga0265342_10026274 Ga0265342_100262743 138
50 3300050508 nmdc:mga09592_377264_c1 nmdc:mga09592_377264_c1_775_1194 138
51 3300005543 Ga0070672_100865089 Ga0070672_1008650892 139
52 3300006847 Ga0075431_100744797 Ga0075431_1007447972 139
53 3300014968 Ga0157379_10061166 Ga0157379_100611662 139
54 3300028800 Ga0265338_10005519 Ga0265338_1000551912 139
55 3300028800 Ga0265338_10884010 Ga0265338_108840101 139
56 3300029957 Ga0265324_10005863 Ga0265324_100058635 139
57 3300031240 Ga0265320_10154121 Ga0265320_101541213 139
58 3300031344 Ga0265316_10427338 Ga0265316_104273382 139
59 3300031711 Ga0265314_10139006 Ga0265314_101390062 139
60 3300036401 Ga0373937_0429654 Ga0373937_0429654_276_701 139
61 3300046461 Ga0495641_0128048 Ga0495641_0128048_684_1109 139
62 3300046476 Ga0495662_0043530 Ga0495662_0043530_1473_1898 139
63 3300046499 Ga0495594_0058338 Ga0495594_0058338_1442_1867 139
64 3300046514 Ga0495618_0007472 Ga0495618_0007472_2268_2693 139
65 3300046517 Ga0495630_0008925 Ga0495630_0008925_5221_5646 139
66 3300046526 Ga0495666_0004554 Ga0495666_0004554_3353_3778 139
67 3300046533 Ga0495640_0121324 Ga0495640_0121324_1025_1450 139
68 3300046535 Ga0495586_0030773 Ga0495586_0030773_1879_2304 139
69 3300046557 Ga0495622_0137497 Ga0495622_0137497_530_955 139
70 3300046559 Ga0495667_0084273 Ga0495667_0084273_221_646 139
71 3300046642 Ga0495634_0003518 Ga0495634_0003518_9228_9653 139
72 3300046681 Ga0495647_0014592 Ga0495647_0014592_409_834 139
73 3300046683 Ga0495658_0177567 Ga0495658_0177567_83_508 139
74 3300046690 Ga0495624_0090871 Ga0495624_0090871_602_1027 139
75 3300047319 Ga0495674_0030082 Ga0495674_0030082_2602_3027 139
76 3300047321 Ga0495676_0117719 Ga0495676_0117719_1246_1671 139
77 3300047322 Ga0495680_0009004 Ga0495680_0009004_8064_8489 139
78 3300049571 Ga0501034_0634108 Ga0501034_0634108_28_447 139
79 3300006844 Ga0075428_100042612 Ga0075428_1000426123 140
80 3300009147 Ga0114129_10071105 Ga0114129_100711055 140
81 3300025922 Ga0207646_10942616 Ga0207646_109426162 140
82 3300027695 Ga0209966_1003451 Ga0209966_10034513 140
83 3300031548 Ga0307408_100567973 Ga0307408_1005679732 140
84 3300031901 Ga0307406_10018816 Ga0307406_100188161 140
85 3300032002 Ga0307416_100079832 Ga0307416_1000798321 140
86 3300041406 Ga0439439_0192220 Ga0439439_0192220_57_482 140
87 3300049578 Ga0501042_0472046 Ga0501042_0472046_216_644 140
88 3300049824 Ga0501045_0522748 Ga0501045_0522748_185_610 140
89 3300050508 nmdc:mga09592_30957_c1 nmdc:mga09592_30957_c1_1220_1645 140
90 3300006846 Ga0075430_100834246 Ga0075430_1008342462 141
91 3300006914 Ga0075436_100461344 Ga0075436_1004613441 141
92 3300026116 Ga0207674_10831067 Ga0207674_108310671 141
93 3300036401 Ga0373937_0661370 Ga0373937_0661370_498_923 141
94 3300042876 Ga0451577_0081476 Ga0451577_0081476_1464_1895 141
95 3300044673 Ga0453683_0583025 Ga0453683_0583025_74_505 141
96 3300045051 Ga0451576_0385362 Ga0451576_0385362_232_663 141
97 3300046675 Ga0495657_0288249 Ga0495657_0288249_278_703 141
98 3300049588 Ga0501072_0845060 Ga0501072_0845060_42_473 141
99 3300049589 Ga0501073_0287988 Ga0501073_0287988_87_518 141
100 3300049593 Ga0501077_0060619 Ga0501077_0060619_577_1008 141
101 3300049744 Ga0501083_0281463 Ga0501083_0281463_343_774 141
102 3300050513 nmdc:mga0rr50_261726_c1 nmdc:mga0rr50_261726_c1_317_754 141
103 3300054114 Ga0501084_0397067 Ga0501084_0397067_132_563 141
104 3300047318 Ga0495636_0154105 Ga0495636_0154105_444_890 142
105 3300005471 Ga0070698_100005938 Ga0070698_10000593811 143
106 3300005518 Ga0070699_100280178 Ga0070699_1002801782 143
107 3300006871 Ga0075434_100041175 Ga0075434_1000411753 143
108 3300050512 nmdc:mga0n895_39550_c1 nmdc:mga0n895_39550_c1_2232_2675 143
109 3300028800 Ga0265338_10016656 Ga0265338_100166564 144
110 3300031247 Ga0265340_10130870 Ga0265340_101308702 144
111 3300046615 Ga0495656_0773534 Ga0495656_0773534_38_481 144
112 3300059423 Ga0590074_014529 Ga0590074_014529_185_625 144
113 3300005295 Ga0065707_11127062 Ga0065707_111270621 145
114 3300005444 Ga0070694_101908655 Ga0070694_1019086551 145
115 3300005471 Ga0070698_100241937 Ga0070698_1002419372 145
116 3300005518 Ga0070699_100112334 Ga0070699_1001123342 145
117 3300007076 Ga0075435_100157057 Ga0075435_1001570574 145
118 3300050513 nmdc:mga0rr50_346454_c1 nmdc:mga0rr50_346454_c1_507_947 145
119 3300005333 Ga0070677_10011217 Ga0070677_100112175 146
120 3300005334 Ga0068869_100213324 Ga0068869_1002133242 146
121 3300005355 Ga0070671_100023258 Ga0070671_1000232584 146
122 3300005445 Ga0070708_100045977 Ga0070708_1000459772 146
123 3300005467 Ga0070706_100020198 Ga0070706_1000201983 146
124 3300005471 Ga0070698_100001874 Ga0070698_10000187417 146
125 3300005518 Ga0070699_100000650 Ga0070699_10000065025 146
126 3300005543 Ga0070672_100086349 Ga0070672_1000863492 146
127 3300005546 Ga0070696_100043359 Ga0070696_1000433597 146
128 3300005549 Ga0070704_100457423 Ga0070704_1004574232 146
129 3300005564 Ga0070664_100722212 Ga0070664_1007222122 146
130 3300006844 Ga0075428_100186017 Ga0075428_1001860175 146
131 3300006844 Ga0075428_100762130 Ga0075428_1007621302 146
132 3300006847 Ga0075431_100637856 Ga0075431_1006378562 146
133 3300009094 Ga0111539_10687601 Ga0111539_106876012 146
134 3300009147 Ga0114129_10009271 Ga0114129_1000927111 146
135 3300009147 Ga0114129_10869065 Ga0114129_108690652 146
136 3300009177 Ga0105248_11057579 Ga0105248_110575791 146
137 3300025893 Ga0207682_10012585 Ga0207682_100125855 146
138 3300025907 Ga0207645_10647224 Ga0207645_106472241 146
139 3300025910 Ga0207684_10017132 Ga0207684_100171323 146
140 3300025926 Ga0207659_11275379 Ga0207659_112753791 146
141 3300025940 Ga0207691_10132133 Ga0207691_101321334 146
142 3300025945 Ga0207679_10233658 Ga0207679_102336582 146
143 3300028558 Ga0265326_10038215 Ga0265326_100382152 146
144 3300028563 Ga0265319_1009373 Ga0265319_10093732 146
145 3300028573 Ga0265334_10000310 Ga0265334_100003102 146
146 3300028577 Ga0265318_10001698 Ga0265318_100016989 146
147 3300028800 Ga0265338_10030059 Ga0265338_100300592 146
148 3300031235 Ga0265330_10020997 Ga0265330_100209973 146
149 3300031238 Ga0265332_10001943 Ga0265332_100019437 146
150 3300031239 Ga0265328_10020966 Ga0265328_100209662 146
151 3300031240 Ga0265320_10004768 Ga0265320_100047689 146
152 3300031241 Ga0265325_10001011 Ga0265325_100010112 146
153 3300031242 Ga0265329_10012739 Ga0265329_100127392 146
154 3300031247 Ga0265340_10034363 Ga0265340_100343632 146
155 3300031249 Ga0265339_10163305 Ga0265339_101633052 146
156 3300031250 Ga0265331_10002686 Ga0265331_100026864 146
157 3300031344 Ga0265316_10016713 Ga0265316_100167139 146
158 3300031548 Ga0307408_101359671 Ga0307408_1013596711 146
159 3300031595 Ga0265313_10003350 Ga0265313_1000335010 146
160 3300031711 Ga0265314_10004269 Ga0265314_100042697 146
161 3300031712 Ga0265342_10029291 Ga0265342_100292914 146
162 3300031852 Ga0307410_10169784 Ga0307410_101697843 146
163 3300031901 Ga0307406_10119280 Ga0307406_101192802 146
164 3300031911 Ga0307412_10121125 Ga0307412_101211252 146
165 3300031995 Ga0307409_100085646 Ga0307409_1000856463 146
166 3300032004 Ga0307414_10064513 Ga0307414_100645133 146
167 3300032005 Ga0307411_10042248 Ga0307411_100422486 146
168 3300032126 Ga0307415_100303158 Ga0307415_1003031582 146
169 3300035116 Ga0373945_0096275 Ga0373945_0096275_521_976 146
170 3300035170 Ga0373943_0019270 Ga0373943_0019270_726_1181 146
171 3300035171 Ga0373946_0035499 Ga0373946_0035499_107_562 146
172 3300035692 Ga0373935_0042903 Ga0373935_0042903_2227_2682 146
173 3300035695 Ga0373927_0023785 Ga0373927_0023785_651_1106 146
174 3300037068 Ga0373925_0047910 Ga0373925_0047910_463_918 146
175 3300039438 Ga0436360_1116795 Ga0436360_1116795_644_1135 146
176 3300042876 Ga0451577_0016505 Ga0451577_0016505_2032_2493 146
177 3300044712 Ga0453684_0870358 Ga0453684_0870358_93_554 146
178 3300049587 Ga0501071_0603719 Ga0501071_0603719_238_681 146
179 3300049593 Ga0501077_0907608 Ga0501077_0907608_42_485 146
180 3300050507 nmdc:mga05p37_455420_c1 nmdc:mga05p37_455420_c1_245_688 146
181 3300059421 Ga0590071_009305 Ga0590071_009305_1147_1617 146
182 3300005328 Ga0070676_10001668 Ga0070676_100016685 147
183 3300005330 Ga0070690_100060005 Ga0070690_1000600055 147
184 3300005334 Ga0068869_100012510 Ga0068869_1000125105 147
185 3300005335 Ga0070666_10006434 Ga0070666_100064345 147
186 3300005336 Ga0070680_100085436 Ga0070680_1000854362 147
187 3300005341 Ga0070691_10241504 Ga0070691_102415042 147
188 3300005347 Ga0070668_100516446 Ga0070668_1005164462 147
189 3300005353 Ga0070669_100138670 Ga0070669_1001386702 147
190 3300005354 Ga0070675_100354646 Ga0070675_1003546462 147
191 3300005356 Ga0070674_100000031 Ga0070674_10000003156 147
192 3300005364 Ga0070673_100986688 Ga0070673_1009866882 147
193 3300005367 Ga0070667_100053227 Ga0070667_1000532274 147
194 3300005440 Ga0070705_100010188 Ga0070705_1000101885 147
195 3300005441 Ga0070700_100314512 Ga0070700_1003145122 147
196 3300005444 Ga0070694_100130465 Ga0070694_1001304653 147
197 3300005456 Ga0070678_100018444 Ga0070678_1000184443 147
198 3300005457 Ga0070662_100000206 Ga0070662_10000020619 147
199 3300005458 Ga0070681_10752289 Ga0070681_107522892 147
200 3300005459 Ga0068867_100000341 Ga0068867_1000003418 147
201 3300005467 Ga0070706_100869670 Ga0070706_1008696702 147
202 3300005468 Ga0070707_100906536 Ga0070707_1009065362 147
203 3300005530 Ga0070679_100180045 Ga0070679_1001800453 147
204 3300005543 Ga0070672_100402568 Ga0070672_1004025682 147
205 3300005543 Ga0070672_100758385 Ga0070672_1007583852 147
206 3300005544 Ga0070686_100004210 Ga0070686_1000042105 147
207 3300005545 Ga0070695_100010146 Ga0070695_1000101462 147
208 3300005546 Ga0070696_100006413 Ga0070696_1000064134 147
209 3300005547 Ga0070693_100078305 Ga0070693_1000783054 147
210 3300005563 Ga0068855_100352860 Ga0068855_1003528602 147
211 3300005577 Ga0068857_100000784 Ga0068857_1000007842 147
212 3300005578 Ga0068854_100007149 Ga0068854_1000071495 147
213 3300005615 Ga0070702_100008842 Ga0070702_1000088422 147
214 3300005618 Ga0068864_100001389 Ga0068864_1000013892 147
215 3300005718 Ga0068866_10000048 Ga0068866_1000004827 147
216 3300005719 Ga0068861_100009043 Ga0068861_1000090433 147
217 3300005719 Ga0068861_100055073 Ga0068861_1000550734 147
218 3300005842 Ga0068858_100075921 Ga0068858_1000759213 147
219 3300005843 Ga0068860_100019327 Ga0068860_1000193277 147
220 3300005843 Ga0068860_100203590 Ga0068860_1002035902 147
221 3300005844 Ga0068862_100010499 Ga0068862_1000104996 147
222 3300005844 Ga0068862_100059829 Ga0068862_1000598292 147
223 3300006237 Ga0097621_100361426 Ga0097621_1003614263 147
224 3300006358 Ga0068871_100113984 Ga0068871_1001139841 147
225 3300006881 Ga0068865_100001170 Ga0068865_1000011706 147
226 3300009093 Ga0105240_10478316 Ga0105240_104783162 147
227 3300009101 Ga0105247_10691098 Ga0105247_106910981 147
228 3300009148 Ga0105243_10003585 Ga0105243_1000358513 147
229 3300009174 Ga0105241_10000716 Ga0105241_1000071614 147
230 3300009174 Ga0105241_10952002 Ga0105241_109520022 147
231 3300009176 Ga0105242_10000251 Ga0105242_1000025126 147
232 3300009177 Ga0105248_10001792 Ga0105248_100017928 147
233 3300009553 Ga0105249_10023634 Ga0105249_100236345 147
234 3300009553 Ga0105249_10038687 Ga0105249_100386876 147
235 3300009553 Ga0105249_10364615 Ga0105249_103646152 147
236 3300010375 Ga0105239_10013449 Ga0105239_100134495 147
237 3300010375 Ga0105239_10555303 Ga0105239_105553032 147
238 3300011119 Ga0105246_10099510 Ga0105246_100995105 147
239 3300013102 Ga0157371_10453573 Ga0157371_104535732 147
240 3300013297 Ga0157378_10001585 Ga0157378_1000158516 147
241 3300013306 Ga0163162_10036701 Ga0163162_100367013 147
242 3300013306 Ga0163162_10043019 Ga0163162_100430195 147
243 3300013306 Ga0163162_10791231 Ga0163162_107912312 147
244 3300013307 Ga0157372_10247607 Ga0157372_102476072 147
245 3300013308 Ga0157375_10021674 Ga0157375_100216742 147
246 3300013308 Ga0157375_10458228 Ga0157375_104582282 147
247 3300014326 Ga0157380_10020140 Ga0157380_100201403 147
248 3300014326 Ga0157380_10194865 Ga0157380_101948653 147
249 3300014968 Ga0157379_10077422 Ga0157379_100774223 147
250 3300014969 Ga0157376_10383762 Ga0157376_103837622 147
251 3300017792 Ga0163161_10010019 Ga0163161_100100194 147
252 3300025899 Ga0207642_10005154 Ga0207642_100051542 147
253 3300025903 Ga0207680_10047393 Ga0207680_100473931 147
254 3300025904 Ga0207647_10234857 Ga0207647_102348572 147
255 3300025907 Ga0207645_10001078 Ga0207645_1000107817 147
256 3300025910 Ga0207684_10531218 Ga0207684_105312182 147
257 3300025912 Ga0207707_10039054 Ga0207707_100390542 147
258 3300025913 Ga0207695_10429902 Ga0207695_104299021 147
259 3300025917 Ga0207660_10179396 Ga0207660_101793962 147
260 3300025917 Ga0207660_10220233 Ga0207660_102202333 147
261 3300025921 Ga0207652_10320081 Ga0207652_103200812 147
262 3300025923 Ga0207681_10126385 Ga0207681_101263853 147
263 3300025926 Ga0207659_10281826 Ga0207659_102818262 147
264 3300025933 Ga0207706_10000096 Ga0207706_1000009678 147
265 3300025934 Ga0207686_10000112 Ga0207686_1000011221 147
266 3300025935 Ga0207709_10001243 Ga0207709_100012433 147
267 3300025937 Ga0207669_10001730 Ga0207669_100017307 147
268 3300025938 Ga0207704_10001104 Ga0207704_100011046 147
269 3300025940 Ga0207691_10269046 Ga0207691_102690462 147
270 3300025941 Ga0207711_10028313 Ga0207711_100283136 147
271 3300025942 Ga0207689_10000911 Ga0207689_1000091118 147
272 3300025949 Ga0207667_10219097 Ga0207667_102190975 147
273 3300025960 Ga0207651_10917622 Ga0207651_109176222 147
274 3300025961 Ga0207712_10007741 Ga0207712_100077416 147
275 3300025961 Ga0207712_10044085 Ga0207712_100440852 147
276 3300025961 Ga0207712_10130813 Ga0207712_101308132 147
277 3300025981 Ga0207640_10032470 Ga0207640_100324706 147
278 3300025986 Ga0207658_10022058 Ga0207658_100220581 147
279 3300026023 Ga0207677_10601384 Ga0207677_106013841 147
280 3300026041 Ga0207639_10113688 Ga0207639_101136882 147
281 3300026067 Ga0207678_10096128 Ga0207678_100961283 147
282 3300026075 Ga0207708_10187806 Ga0207708_101878063 147
283 3300026089 Ga0207648_10000043 Ga0207648_1000004350 147
284 3300026095 Ga0207676_10019559 Ga0207676_100195592 147
285 3300026116 Ga0207674_10001182 Ga0207674_1000118231 147
286 3300026118 Ga0207675_100009301 Ga0207675_1000093013 147
287 3300026118 Ga0207675_100384116 Ga0207675_1003841162 147
288 3300026121 Ga0207683_10003314 Ga0207683_100033146 147
289 3300028380 Ga0268265_10030120 Ga0268265_100301203 147
290 3300028380 Ga0268265_10035569 Ga0268265_100355692 147
291 3300028381 Ga0268264_10033356 Ga0268264_100333562 147
292 3300028381 Ga0268264_10245426 Ga0268264_102454262 147
293 3300042876 Ga0451577_0261353 Ga0451577_0261353_462_914 147
294 3300042876 Ga0451577_1096895 Ga0451577_1096895_43_546 147
295 3300044673 Ga0453683_0018303 Ga0453683_0018303_255_707 147
296 3300044712 Ga0453684_0325694 Ga0453684_0325694_588_1091 147
297 3300046455 Ga0495603_0071247 Ga0495603_0071247_84_536 147
298 3300046499 Ga0495594_0075334 Ga0495594_0075334_864_1316 147
299 3300046664 Ga0495659_0012816 Ga0495659_0012816_385_837 147
300 3300046691 Ga0495670_0694121 Ga0495670_0694121_25_477 147
301 3300048903 Ga0496100_0066711 Ga0496100_0066711_1128_1580 147
302 3300048904 Ga0496101_0013792 Ga0496101_0013792_4618_5070 147
303 3300048906 Ga0496103_0548129 Ga0496103_0548129_222_674 147
304 3300048909 Ga0496106_0095035 Ga0496106_0095035_188_640 147
305 3300048910 Ga0496107_0106188 Ga0496107_0106188_573_1025 147
306 3300049581 Ga0501047_0877196 Ga0501047_0877196_30_476 147
307 3300049584 Ga0501068_0470400 Ga0501068_0470400_346_792 147
308 3300049585 Ga0501069_0150444 Ga0501069_0150444_369_815 147
309 3300049586 Ga0501070_0047845 Ga0501070_0047845_772_1218 147
310 3300049590 Ga0501074_0699814 Ga0501074_0699814_170_616 147
311 3300049742 Ga0501080_0040338 Ga0501080_0040338_3601_4047 147
312 3300049742 Ga0501080_1146223 Ga0501080_1146223_214_660 147
313 3300054114 Ga0501084_0338753 Ga0501084_0338753_663_1109 147
314 3300001977 JGI24746J21847_1025389 JGI24746J21847_10253891 148
315 3300004799 Ga0058863_11948557 Ga0058863_119485572 148
316 3300004800 Ga0058861_12030290 Ga0058861_120302902 148
317 3300005290 Ga0065712_10002436 Ga0065712_100024365 148
318 3300005290 Ga0065712_10070819 Ga0065712_100708195 148
319 3300005293 Ga0065715_10002906 Ga0065715_100029064 148
320 3300005293 Ga0065715_10011887 Ga0065715_100118872 148
321 3300005295 Ga0065707_10374985 Ga0065707_103749851 148
322 3300005327 Ga0070658_10403806 Ga0070658_104038062 148
323 3300005331 Ga0070670_100000895 Ga0070670_10000089519 148
324 3300005334 Ga0068869_100033778 Ga0068869_1000337782 148
325 3300005336 Ga0070680_100055317 Ga0070680_1000553173 148
326 3300005337 Ga0070682_100291911 Ga0070682_1002919112 148
327 3300005338 Ga0068868_100026121 Ga0068868_1000261212 148
328 3300005340 Ga0070689_100179721 Ga0070689_1001797213 148
329 3300005344 Ga0070661_100007965 Ga0070661_1000079659 148
330 3300005344 Ga0070661_100178960 Ga0070661_1001789601 148
331 3300005345 Ga0070692_10324506 Ga0070692_103245062 148
332 3300005353 Ga0070669_100006398 Ga0070669_1000063986 148
333 3300005354 Ga0070675_100824400 Ga0070675_1008244002 148
334 3300005355 Ga0070671_100087309 Ga0070671_1000873092 148
335 3300005356 Ga0070674_100131021 Ga0070674_1001310212 148
336 3300005364 Ga0070673_100065674 Ga0070673_1000656742 148
337 3300005365 Ga0070688_100230942 Ga0070688_1002309422 148
338 3300005367 Ga0070667_100116787 Ga0070667_1001167872 148
339 3300005440 Ga0070705_100056028 Ga0070705_1000560282 148
340 3300005441 Ga0070700_100466820 Ga0070700_1004668202 148
341 3300005444 Ga0070694_100003632 Ga0070694_1000036329 148
342 3300005455 Ga0070663_100087896 Ga0070663_1000878963 148
343 3300005456 Ga0070678_100023971 Ga0070678_1000239716 148
344 3300005456 Ga0070678_100275316 Ga0070678_1002753162 148
345 3300005457 Ga0070662_100094829 Ga0070662_1000948292 148
346 3300005458 Ga0070681_10008219 Ga0070681_100082198 148
347 3300005458 Ga0070681_10034774 Ga0070681_100347744 148
348 3300005459 Ga0068867_100412764 Ga0068867_1004127642 148
349 3300005530 Ga0070679_100010568 Ga0070679_1000105683 148
350 3300005530 Ga0070679_100179187 Ga0070679_1001791872 148
351 3300005535 Ga0070684_100271609 Ga0070684_1002716092 148
352 3300005543 Ga0070672_100018970 Ga0070672_1000189702 148
353 3300005544 Ga0070686_100025456 Ga0070686_1000254561 148
354 3300005545 Ga0070695_100019561 Ga0070695_1000195616 148
355 3300005545 Ga0070695_100100729 Ga0070695_1001007292 148
356 3300005546 Ga0070696_100003810 Ga0070696_10000381011 148
357 3300005547 Ga0070693_100031570 Ga0070693_1000315704 148
358 3300005549 Ga0070704_100217787 Ga0070704_1002177872 148
359 3300005563 Ga0068855_100401737 Ga0068855_1004017372 148
360 3300005564 Ga0070664_100024643 Ga0070664_1000246432 148
361 3300005577 Ga0068857_100041473 Ga0068857_1000414732 148
362 3300005577 Ga0068857_100193490 Ga0068857_1001934902 148
363 3300005578 Ga0068854_100038940 Ga0068854_1000389402 148
364 3300005616 Ga0068852_100284920 Ga0068852_1002849202 148
365 3300005718 Ga0068866_10133474 Ga0068866_101334742 148
366 3300005719 Ga0068861_100165347 Ga0068861_1001653472 148
367 3300005843 Ga0068860_100129911 Ga0068860_1001299112 148
368 3300006163 Ga0070715_10150484 Ga0070715_101504842 148
369 3300006175 Ga0070712_100186198 Ga0070712_1001861982 148
370 3300006358 Ga0068871_100105274 Ga0068871_1001052742 148
371 3300006844 Ga0075428_101098377 Ga0075428_1010983772 148
372 3300006852 Ga0075433_10064220 Ga0075433_100642203 148
373 3300006871 Ga0075434_100012929 Ga0075434_1000129291 148
374 3300006871 Ga0075434_100168338 Ga0075434_1001683384 148
375 3300006871 Ga0075434_100230029 Ga0075434_1002300292 148
376 3300006914 Ga0075436_100548303 Ga0075436_1005483032 148
377 3300007076 Ga0075435_100040500 Ga0075435_1000405005 148
378 3300007076 Ga0075435_100045913 Ga0075435_1000459133 148
379 3300007076 Ga0075435_100578103 Ga0075435_1005781032 148
380 3300009094 Ga0111539_10049650 Ga0111539_100496504 148
381 3300009094 Ga0111539_10281592 Ga0111539_102815922 148
382 3300009098 Ga0105245_10036912 Ga0105245_100369123 148
383 3300009147 Ga0114129_10437778 Ga0114129_104377782 148
384 3300009148 Ga0105243_10291017 Ga0105243_102910172 148
385 3300009174 Ga0105241_10094975 Ga0105241_100949755 148
386 3300009176 Ga0105242_10076230 Ga0105242_100762302 148
387 3300009545 Ga0105237_10066610 Ga0105237_100666106 148
388 3300009551 Ga0105238_11187727 Ga0105238_111877272 148
389 3300009553 Ga0105249_10391406 Ga0105249_103914062 148
390 3300009553 Ga0105249_10896853 Ga0105249_108968532 148
391 3300010375 Ga0105239_10048201 Ga0105239_100482016 148
392 3300011119 Ga0105246_10048247 Ga0105246_100482472 148
393 3300011119 Ga0105246_11489418 Ga0105246_114894181 148
394 3300012512 Ga0157327_1007215 Ga0157327_10072152 148
395 3300013296 Ga0157374_10304285 Ga0157374_103042852 148
396 3300013297 Ga0157378_10319336 Ga0157378_103193362 148
397 3300013306 Ga0163162_10179578 Ga0163162_101795782 148
398 3300013306 Ga0163162_12328358 Ga0163162_123283581 148
399 3300013307 Ga0157372_10114281 Ga0157372_101142812 148
400 3300014969 Ga0157376_10009968 Ga0157376_100099682 148
401 3300015261 Ga0182006_1065900 Ga0182006_10659002 148
402 3300020070 Ga0206356_11313219 Ga0206356_113132191 148
403 3300025315 Ga0207697_10014166 Ga0207697_100141663 148
404 3300025315 Ga0207697_10030298 Ga0207697_100302982 148
405 3300025901 Ga0207688_10011366 Ga0207688_100113666 148
406 3300025904 Ga0207647_10216848 Ga0207647_102168482 148
407 3300025907 Ga0207645_10000345 Ga0207645_1000034521 148
408 3300025912 Ga0207707_10024571 Ga0207707_100245715 148
409 3300025912 Ga0207707_10205457 Ga0207707_102054574 148
410 3300025915 Ga0207693_10153071 Ga0207693_101530711 148
411 3300025917 Ga0207660_10074432 Ga0207660_100744323 148
412 3300025917 Ga0207660_11176302 Ga0207660_111763022 148
413 3300025919 Ga0207657_10003821 Ga0207657_1000382114 148
414 3300025920 Ga0207649_10164599 Ga0207649_101645992 148
415 3300025921 Ga0207652_10024310 Ga0207652_100243107 148
416 3300025921 Ga0207652_10056546 Ga0207652_100565462 148
417 3300025925 Ga0207650_10000495 Ga0207650_1000049525 148
418 3300025926 Ga0207659_10391793 Ga0207659_103917932 148
419 3300025932 Ga0207690_10006635 Ga0207690_100066355 148
420 3300025933 Ga0207706_10022822 Ga0207706_100228225 148
421 3300025933 Ga0207706_10135477 Ga0207706_101354772 148
422 3300025934 Ga0207686_10056837 Ga0207686_100568372 148
423 3300025935 Ga0207709_10594557 Ga0207709_105945572 148
424 3300025936 Ga0207670_11083394 Ga0207670_110833941 148
425 3300025937 Ga0207669_10029605 Ga0207669_100296053 148
426 3300025940 Ga0207691_10238057 Ga0207691_102380572 148
427 3300025942 Ga0207689_10205841 Ga0207689_102058412 148
428 3300025944 Ga0207661_11563091 Ga0207661_115630911 148
429 3300025945 Ga0207679_10002179 Ga0207679_100021798 148
430 3300025945 Ga0207679_10052846 Ga0207679_100528463 148
431 3300025949 Ga0207667_10273030 Ga0207667_102730302 148
432 3300026035 Ga0207703_10740598 Ga0207703_107405982 148
433 3300026041 Ga0207639_10145642 Ga0207639_101456422 148
434 3300026075 Ga0207708_10569826 Ga0207708_105698261 148
435 3300026078 Ga0207702_10299583 Ga0207702_102995833 148
436 3300026095 Ga0207676_10121075 Ga0207676_101210752 148
437 3300026116 Ga0207674_10251074 Ga0207674_102510742 148
438 3300026116 Ga0207674_10360661 Ga0207674_103606613 148
439 3300026118 Ga0207675_100115253 Ga0207675_1001152533 148
440 3300026121 Ga0207683_10001057 Ga0207683_1000105717 148
441 3300027695 Ga0209966_1023377 Ga0209966_10233773 148
442 3300028379 Ga0268266_10125382 Ga0268266_101253822 148
443 3300028381 Ga0268264_10250049 Ga0268264_102500492 148
444 3300028800 Ga0265338_10407500 Ga0265338_104075002 148
445 3300031548 Ga0307408_100295085 Ga0307408_1002950852 148
446 3300031731 Ga0307405_10004222 Ga0307405_100042225 148
447 3300031824 Ga0307413_10018674 Ga0307413_100186743 148
448 3300031852 Ga0307410_10341626 Ga0307410_103416261 148
449 3300031903 Ga0307407_10022294 Ga0307407_100222942 148
450 3300031911 Ga0307412_10010597 Ga0307412_100105976 148
451 3300032002 Ga0307416_100074200 Ga0307416_1000742003 148
452 3300032002 Ga0307416_100751757 Ga0307416_1007517572 148
453 3300032005 Ga0307411_10030110 Ga0307411_100301104 148
454 3300032126 Ga0307415_100074789 Ga0307415_1000747893 148
455 3300035112 Ga0373932_0100489 Ga0373932_0100489_174_620 148
456 3300035114 Ga0373939_0029267 Ga0373939_0029267_538_984 148
457 3300035207 Ga0373942_0038413 Ga0373942_0038413_52_498 148
458 3300035241 Ga0373961_0065073 Ga0373961_0065073_488_934 148
459 3300035691 Ga0373931_0001299 Ga0373931_0001299_5255_5701 148
460 3300041406 Ga0439439_0023783 Ga0439439_0023783_618_1070 148
461 3300041410 Ga0439461_0081065 Ga0439461_0081065_140_592 148
462 3300041997 Ga0439431_0049208 Ga0439431_0049208_558_1010 148
463 3300041999 Ga0439433_0077417 Ga0439433_0077417_230_682 148
464 3300042001 Ga0439441_083062 Ga0439441_083062_244_690 148
465 3300042003 Ga0439443_016264 Ga0439443_016264_338_790 148
466 3300042005 Ga0439448_0184730 Ga0439448_0184730_116_562 148
467 3300042011 Ga0439454_007832 Ga0439454_007832_186_638 148
468 3300042015 Ga0439462_0003337 Ga0439462_0003337_671_1147 148
469 3300042129 Ga0450891_023604 Ga0450891_023604_43_519 148
470 3300042134 Ga0450898_006247 Ga0450898_006247_356_832 148
471 3300042142 Ga0450905_019519 Ga0450905_019519_69_545 148
472 3300042147 Ga0450910_008626 Ga0450910_008626_887_1363 148
473 3300042435 Ga0439434_0057043 Ga0439434_0057043_379_855 148
474 3300042435 Ga0439434_0103774 Ga0439434_0103774_402_854 148
475 3300042437 Ga0439444_0011142 Ga0439444_0011142_331_807 148
476 3300042439 Ga0439464_0128685 Ga0439464_0128685_145_591 148
477 3300042461 Ga0439460_0112844 Ga0439460_0112844_67_513 148
478 3300042876 Ga0451577_0307972 Ga0451577_0307972_504_950 148
479 3300045051 Ga0451576_0674026 Ga0451576_0674026_168_614 148
480 3300045051 Ga0451576_1199877 Ga0451576_1199877_159_605 148
481 3300048905 Ga0496102_0152205 Ga0496102_0152205_1452_1898 148
482 3300048905 Ga0496102_1592940 Ga0496102_1592940_64_510 148
483 3300048906 Ga0496103_0144264 Ga0496103_0144264_880_1326 148
484 3300048908 Ga0496105_0526059 Ga0496105_0526059_205_651 148
485 3300048909 Ga0496106_0111191 Ga0496106_0111191_732_1178 148
486 3300048910 Ga0496107_0362713 Ga0496107_0362713_154_600 148
487 3300048911 Ga0496108_0155741 Ga0496108_0155741_1337_1783 148
488 3300048912 Ga0496109_0090192 Ga0496109_0090192_1111_1557 148
489 3300048913 Ga0496110_0443938 Ga0496110_0443938_51_497 148
490 3300048914 Ga0496111_0327795 Ga0496111_0327795_74_520 148
491 3300048915 Ga0496112_0002371 Ga0496112_0002371_3283_3729 148
492 3300048915 Ga0496112_0990775 Ga0496112_0990775_55_501 148
493 3300048916 Ga0496113_0083955 Ga0496113_0083955_249_695 148
494 3300050511 nmdc:mga08y16_219566_c1 nmdc:mga08y16_219566_c1_579_1025 148
495 3300050511 nmdc:mga08y16_834158_c1 nmdc:mga08y16_834158_c1_398_844 148
496 3300050512 nmdc:mga0n895_128487_c1 nmdc:mga0n895_128487_c1_1515_1961 148
497 3300050512 nmdc:mga0n895_282560_c1 nmdc:mga0n895_282560_c1_1158_1604 148
498 3300050512 nmdc:mga0n895_507972_c1 nmdc:mga0n895_507972_c1_277_723 148
499 3300050512 nmdc:mga0n895_96830_c1 nmdc:mga0n895_96830_c1_1132_1578 148
500 3300050513 nmdc:mga0rr50_197921_c1 nmdc:mga0rr50_197921_c1_175_621 148
501 3300050513 nmdc:mga0rr50_28277_c1 nmdc:mga0rr50_28277_c1_2021_2467 148
502 3300050513 nmdc:mga0rr50_68051_c1 nmdc:mga0rr50_68051_c1_1056_1502 148
503 3300050514 nmdc:mga08x19_604651_c1 nmdc:mga08x19_604651_c1_275_721 148
504 3300050514 nmdc:mga08x19_73276_c1 nmdc:mga08x19_73276_c1_1167_1613 148
505 3300050515 nmdc:mga0a205_148876_c1 nmdc:mga0a205_148876_c1_396_842 148
506 3300003316 rootH1_10048177 rootH1_100481772 149
507 3300003316 rootH1_10134043 rootH1_101340432 149
508 3300004803 Ga0058862_12710135 Ga0058862_127101352 149
509 3300005295 Ga0065707_10118897 Ga0065707_101188972 149
510 3300005345 Ga0070692_10320388 Ga0070692_103203882 149
511 3300005471 Ga0070698_100199077 Ga0070698_1001990772 149
512 3300005471 Ga0070698_100208185 Ga0070698_1002081852 149
513 3300005518 Ga0070699_100335650 Ga0070699_1003356501 149
514 3300005530 Ga0070679_100147305 Ga0070679_1001473054 149
515 3300005530 Ga0070679_100434473 Ga0070679_1004344732 149
516 3300005544 Ga0070686_101624072 Ga0070686_1016240721 149
517 3300005545 Ga0070695_100477556 Ga0070695_1004775562 149
518 3300005843 Ga0068860_100021349 Ga0068860_1000213493 149
519 3300006844 Ga0075428_101599307 Ga0075428_1015993072 149
520 3300006846 Ga0075430_100224214 Ga0075430_1002242143 149
521 3300006846 Ga0075430_100596111 Ga0075430_1005961112 149
522 3300006847 Ga0075431_100003213 Ga0075431_10000321316 149
523 3300006847 Ga0075431_100288153 Ga0075431_1002881532 149
524 3300006881 Ga0068865_101467305 Ga0068865_1014673052 149
525 3300009094 Ga0111539_10892955 Ga0111539_108929552 149
526 3300009148 Ga0105243_10309534 Ga0105243_103095342 149
527 3300009176 Ga0105242_11237152 Ga0105242_112371522 149
528 3300009553 Ga0105249_11999526 Ga0105249_119995262 149
529 3300010375 Ga0105239_10298877 Ga0105239_102988772 149
530 3300011119 Ga0105246_11209973 Ga0105246_112099732 149
531 3300014745 Ga0157377_10542233 Ga0157377_105422331 149
532 3300017792 Ga0163161_11447129 Ga0163161_114471292 149
533 3300025901 Ga0207688_10518365 Ga0207688_105183652 149
534 3300025912 Ga0207707_10771292 Ga0207707_107712922 149
535 3300025912 Ga0207707_10794629 Ga0207707_107946291 149
536 3300025917 Ga0207660_10861678 Ga0207660_108616782 149
537 3300025921 Ga0207652_10284779 Ga0207652_102847791 149
538 3300025921 Ga0207652_10661306 Ga0207652_106613062 149
539 3300025938 Ga0207704_10117499 Ga0207704_101174992 149
540 3300026067 Ga0207678_10127303 Ga0207678_101273033 149
541 3300026075 Ga0207708_10121195 Ga0207708_101211952 149
542 3300027252 Ga0209973_1072123 Ga0209973_10721231 149
543 3300027543 Ga0209999_1040188 Ga0209999_10401882 149
544 3300027876 Ga0209974_10085453 Ga0209974_100854532 149
545 3300028381 Ga0268264_10260393 Ga0268264_102603932 149
546 3300031548 Ga0307408_100026942 Ga0307408_1000269422 149
547 3300031731 Ga0307405_10015476 Ga0307405_100154762 149
548 3300031731 Ga0307405_10025001 Ga0307405_100250014 149
549 3300031824 Ga0307413_10001012 Ga0307413_100010127 149
550 3300031824 Ga0307413_10064349 Ga0307413_100643494 149
551 3300031824 Ga0307413_10458476 Ga0307413_104584762 149
552 3300031852 Ga0307410_10001656 Ga0307410_100016567 149
553 3300031852 Ga0307410_10003004 Ga0307410_100030047 149
554 3300031852 Ga0307410_10015549 Ga0307410_100155494 149
555 3300031852 Ga0307410_10865010 Ga0307410_108650102 149
556 3300031901 Ga0307406_10042759 Ga0307406_100427592 149
557 3300031903 Ga0307407_10062132 Ga0307407_100621322 149
558 3300031903 Ga0307407_10070217 Ga0307407_100702172 149
559 3300031903 Ga0307407_10103907 Ga0307407_101039072 149
560 3300031911 Ga0307412_10023940 Ga0307412_100239404 149
561 3300031911 Ga0307412_10024997 Ga0307412_100249973 149
562 3300031911 Ga0307412_10060041 Ga0307412_100600412 149
563 3300031911 Ga0307412_10307286 Ga0307412_103072862 149
564 3300031995 Ga0307409_100000744 Ga0307409_1000007449 149
565 3300031995 Ga0307409_100001517 Ga0307409_1000015174 149
566 3300031995 Ga0307409_100032484 Ga0307409_1000324844 149
567 3300031995 Ga0307409_100694547 Ga0307409_1006945472 149
568 3300031995 Ga0307409_100937441 Ga0307409_1009374412 149
569 3300031995 Ga0307409_100994784 Ga0307409_1009947842 149
570 3300032002 Ga0307416_100000378 Ga0307416_10000037824 149
571 3300032002 Ga0307416_100000758 Ga0307416_1000007585 149
572 3300032002 Ga0307416_100011031 Ga0307416_1000110313 149
573 3300032002 Ga0307416_100052696 Ga0307416_1000526962 149
574 3300032002 Ga0307416_100759471 Ga0307416_1007594712 149
575 3300032004 Ga0307414_10053192 Ga0307414_100531922 149
576 3300032004 Ga0307414_10142132 Ga0307414_101421321 149
577 3300032005 Ga0307411_10007405 Ga0307411_100074054 149
578 3300032005 Ga0307411_10020620 Ga0307411_100206204 149
579 3300032005 Ga0307411_10022178 Ga0307411_100221781 149
580 3300032005 Ga0307411_10092489 Ga0307411_100924891 149
581 3300032126 Ga0307415_100000254 Ga0307415_10000025424 149
582 3300032126 Ga0307415_100122385 Ga0307415_1001223854 149
583 3300032126 Ga0307415_100200103 Ga0307415_1002001032 149
584 3300032126 Ga0307415_100269237 Ga0307415_1002692372 149
585 3300035119 Ga0373956_0169256 Ga0373956_0169256_225_677 149
586 3300036401 Ga0373937_0067255 Ga0373937_0067255_626_1078 149
587 3300044712 Ga0453684_0924218 Ga0453684_0924218_440_889 149
588 3300046537 Ga0495598_0049625 Ga0495598_0049625_600_1052 149
589 3300048909 Ga0496106_0081204 Ga0496106_0081204_391_855 149
590 3300049522 Ga0501299_156400 Ga0501299_156400_96_551 149
591 3300049524 Ga0501301_037965 Ga0501301_037965_11_463 149
592 3300049568 Ga0501031_0007782 Ga0501031_0007782_6249_6698 149
593 3300049569 Ga0501032_0189213 Ga0501032_0189213_275_724 149
594 3300049570 Ga0501033_0021886 Ga0501033_0021886_35_484 149
595 3300049571 Ga0501034_0014428 Ga0501034_0014428_5770_6219 149
596 3300049572 Ga0501036_0074631 Ga0501036_0074631_1457_1906 149
597 3300049573 Ga0501037_0015475 Ga0501037_0015475_4718_5167 149
598 3300049574 Ga0501038_0040779 Ga0501038_0040779_1091_1540 149
599 3300049575 Ga0501039_0017431 Ga0501039_0017431_3603_4052 149
600 3300049576 Ga0501040_0022977 Ga0501040_0022977_265_714 149
601 3300049579 Ga0501043_0006165 Ga0501043_0006165_4357_4806 149
602 3300049580 Ga0501046_0008905 Ga0501046_0008905_2522_2971 149
603 3300049581 Ga0501047_0158985 Ga0501047_0158985_466_915 149
604 3300049582 Ga0501048_0107814 Ga0501048_0107814_276_725 149
605 3300049583 Ga0501067_0528374 Ga0501067_0528374_157_606 149
606 3300049584 Ga0501068_0015939 Ga0501068_0015939_460_909 149
607 3300049585 Ga0501069_0006048 Ga0501069_0006048_501_950 149
608 3300049585 Ga0501069_0142288 Ga0501069_0142288_384_833 149
609 3300049587 Ga0501071_0462426 Ga0501071_0462426_247_696 149
610 3300049587 Ga0501071_0559495 Ga0501071_0559495_277_726 149
611 3300049588 Ga0501072_0312988 Ga0501072_0312988_544_993 149
612 3300049588 Ga0501072_0363037 Ga0501072_0363037_259_708 149
613 3300049588 Ga0501072_0737584 Ga0501072_0737584_67_516 149
614 3300049589 Ga0501073_0005350 Ga0501073_0005350_4952_5401 149
615 3300049590 Ga0501074_0001217 Ga0501074_0001217_8963_9412 149
616 3300049591 Ga0501075_0017837 Ga0501075_0017837_4403_4852 149
617 3300049668 Ga0501233_009923 Ga0501233_009923_1357_1806 149
618 3300049705 Ga0501225_0003685 Ga0501225_0003685_2935_3384 149
619 3300049706 Ga0501229_063340 Ga0501229_063340_28_480 149
620 3300049741 Ga0501079_0381241 Ga0501079_0381241_381_830 149
621 3300049742 Ga0501080_0033059 Ga0501080_0033059_456_905 149
622 3300049743 Ga0501081_0082924 Ga0501081_0082924_1200_1649 149
623 3300049744 Ga0501083_0012410 Ga0501083_0012410_725_1174 149
624 3300049759 Ga0501262_003301 Ga0501262_003301_145_594 149
625 3300049779 Ga0501283_117577 Ga0501283_117577_51_506 149
626 3300049822 Ga0501035_0007245 Ga0501035_0007245_5816_6265 149
627 3300049824 Ga0501045_0045679 Ga0501045_0045679_2212_2661 149
628 3300049824 Ga0501045_0960141 Ga0501045_0960141_152_601 149
629 3300050507 nmdc:mga05p37_183465_c1 nmdc:mga05p37_183465_c1_717_1190 149
630 3300050509 nmdc:mga0qj67_37596_c1 nmdc:mga0qj67_37596_c1_2853_3302 149
631 3300050510 nmdc:mga06r32_2808_c1 nmdc:mga06r32_2808_c1_1147_1596 149
632 3300050510 nmdc:mga06r32_640155_c1 nmdc:mga06r32_640155_c1_359_832 149
633 3300050511 nmdc:mga08y16_277460_c1 nmdc:mga08y16_277460_c1_469_933 149
634 3300054114 Ga0501084_0009832 Ga0501084_0009832_3922_4371 149
635 3300059423 Ga0590074_035047 Ga0590074_035047_92_577 149
636 3300059424 Ga0590075_003441 Ga0590075_003441_1054_1503 149
637 3300059426 Ga0590077_007598 Ga0590077_007598_860_1309 149
638 3300059426 Ga0590077_019238 Ga0590077_019238_702_1187 149
639 3300060353 Ga0501082_0032225 Ga0501082_0032225_3795_4244 149
640 3300061734 Ga0530510_0042012 Ga0530510_0042012_276_731 149
641 3300061734 Ga0530510_0091974 Ga0530510_0091974_523_972 149
642 3300061734 Ga0530510_0646154 Ga0530510_0646154_331_780 149
643 3300000041 ARcpr5oldR_c011292 ARcpr5oldR_0112921 150
644 3300000044 ARSoilOldRDRAFT_c008884 ARSoilOldRDRAFT_0088842 150
645 3300003911 JGI25405J52794_10005174 JGI25405J52794_100051744 150
646 3300005295 Ga0065707_10001212 Ga0065707_1000121211 150
647 3300005295 Ga0065707_10014449 Ga0065707_100144496 150
648 3300005295 Ga0065707_10209214 Ga0065707_102092142 150
649 3300005295 Ga0065707_10889558 Ga0065707_108895581 150
650 3300005347 Ga0070668_100403808 Ga0070668_1004038082 150
651 3300005354 Ga0070675_100836674 Ga0070675_1008366741 150
652 3300005356 Ga0070674_101970668 Ga0070674_1019706681 150
653 3300005367 Ga0070667_100995009 Ga0070667_1009950092 150
654 3300005440 Ga0070705_100676526 Ga0070705_1006765262 150
655 3300005444 Ga0070694_100039671 Ga0070694_1000396712 150
656 3300005445 Ga0070708_100531780 Ga0070708_1005317802 150
657 3300005456 Ga0070678_101169037 Ga0070678_1011690372 150
658 3300005536 Ga0070697_101375882 Ga0070697_1013758821 150
659 3300005545 Ga0070695_100797843 Ga0070695_1007978432 150
660 3300005546 Ga0070696_100095096 Ga0070696_1000950962 150
661 3300005549 Ga0070704_100281777 Ga0070704_1002817772 150
662 3300005549 Ga0070704_102122301 Ga0070704_1021223011 150
663 3300005577 Ga0068857_101266459 Ga0068857_1012664592 150
664 3300005577 Ga0068857_101358794 Ga0068857_1013587941 150
665 3300005578 Ga0068854_100807325 Ga0068854_1008073252 150
666 3300005617 Ga0068859_100425015 Ga0068859_1004250152 150
667 3300005618 Ga0068864_101170527 Ga0068864_1011705272 150
668 3300005843 Ga0068860_100709726 Ga0068860_1007097262 150
669 3300005937 Ga0081455_10002445 Ga0081455_1000244515 150
670 3300005937 Ga0081455_10015954 Ga0081455_100159547 150
671 3300005937 Ga0081455_10166060 Ga0081455_101660602 150
672 3300005981 Ga0081538_10007439 Ga0081538_100074397 150
673 3300005983 Ga0081540_1256964 Ga0081540_12569641 150
674 3300006058 Ga0075432_10188339 Ga0075432_101883392 150
675 3300006194 Ga0075427_10083609 Ga0075427_100836091 150
676 3300006844 Ga0075428_100008553 Ga0075428_1000085539 150
677 3300006844 Ga0075428_100537780 Ga0075428_1005377802 150
678 3300006846 Ga0075430_100022399 Ga0075430_1000223996 150
679 3300006846 Ga0075430_100123958 Ga0075430_1001239582 150
680 3300006846 Ga0075430_100273337 Ga0075430_1002733372 150
681 3300006846 Ga0075430_100371496 Ga0075430_1003714962 150
682 3300006846 Ga0075430_101007983 Ga0075430_1010079831 150
683 3300006847 Ga0075431_100013341 Ga0075431_1000133417 150
684 3300006847 Ga0075431_100058093 Ga0075431_1000580933 150
685 3300006847 Ga0075431_100313990 Ga0075431_1003139903 150
686 3300006852 Ga0075433_10005452 Ga0075433_100054528 150
687 3300006852 Ga0075433_10472862 Ga0075433_104728622 150
688 3300006871 Ga0075434_100111787 Ga0075434_1001117873 150
689 3300006871 Ga0075434_100526483 Ga0075434_1005264831 150
690 3300006880 Ga0075429_100021847 Ga0075429_1000218476 150
691 3300006880 Ga0075429_100166594 Ga0075429_1001665942 150
692 3300006880 Ga0075429_100294892 Ga0075429_1002948922 150
693 3300006880 Ga0075429_100886865 Ga0075429_1008868652 150
694 3300006914 Ga0075436_100064240 Ga0075436_1000642403 150
695 3300006931 Ga0097620_100424995 Ga0097620_1004249952 150
696 3300007076 Ga0075435_100833366 Ga0075435_1008333662 150
697 3300009147 Ga0114129_10017932 Ga0114129_100179327 150
698 3300009147 Ga0114129_10076366 Ga0114129_100763664 150
699 3300009147 Ga0114129_10149832 Ga0114129_101498325 150
700 3300009147 Ga0114129_10714659 Ga0114129_107146591 150
701 3300009147 Ga0114129_11178052 Ga0114129_111780522 150
702 3300009176 Ga0105242_10598567 Ga0105242_105985672 150
703 3300009545 Ga0105237_10000013 Ga0105237_10000013174 150
704 3300009551 Ga0105238_10090873 Ga0105238_100908733 150
705 3300009553 Ga0105249_12164897 Ga0105249_121648971 150
706 3300012497 Ga0157319_1008551 Ga0157319_10085512 150
707 3300012505 Ga0157339_1013176 Ga0157339_10131762 150
708 3300012512 Ga0157327_1002831 Ga0157327_10028312 150
709 3300013297 Ga0157378_10022508 Ga0157378_100225082 150
710 3300013306 Ga0163162_10066793 Ga0163162_100667933 150
711 3300013308 Ga0157375_10572842 Ga0157375_105728422 150
712 3300013308 Ga0157375_11291773 Ga0157375_112917732 150
713 3300014326 Ga0157380_10393544 Ga0157380_103935442 150
714 3300014326 Ga0157380_10945175 Ga0157380_109451752 150
715 3300017792 Ga0163161_10271084 Ga0163161_102710842 150
716 3300025910 Ga0207684_10287667 Ga0207684_102876672 150
717 3300025914 Ga0207671_10000024 Ga0207671_10000024206 150
718 3300025922 Ga0207646_10194361 Ga0207646_101943613 150
719 3300025924 Ga0207694_10076010 Ga0207694_100760104 150
720 3300025934 Ga0207686_11000503 Ga0207686_110005032 150
721 3300025972 Ga0207668_10776477 Ga0207668_107764772 150
722 3300025981 Ga0207640_11090184 Ga0207640_110901842 150
723 3300026095 Ga0207676_10358473 Ga0207676_103584732 150
724 3300027252 Ga0209973_1012454 Ga0209973_10124542 150
725 3300027665 Ga0209983_1008763 Ga0209983_10087632 150
726 3300027876 Ga0209974_10001329 Ga0209974_100013295 150
727 3300027907 Ga0207428_10027342 Ga0207428_100273423 150
728 3300028381 Ga0268264_10280794 Ga0268264_102807942 150
729 3300028556 Ga0265337_1019898 Ga0265337_10198982 150
730 3300028556 Ga0265337_1039120 Ga0265337_10391202 150
731 3300028563 Ga0265319_1011555 Ga0265319_10115553 150
732 3300028573 Ga0265334_10049458 Ga0265334_100494582 150
733 3300028800 Ga0265338_10001654 Ga0265338_1000165434 150
734 3300031240 Ga0265320_10305990 Ga0265320_103059902 150
735 3300031344 Ga0265316_11111670 Ga0265316_111116701 150
736 3300031548 Ga0307408_100405040 Ga0307408_1004050402 150
737 3300031548 Ga0307408_100543281 Ga0307408_1005432812 150
738 3300031691 Ga0316579_10047461 Ga0316579_100474613 150
739 3300031691 Ga0316579_10614889 Ga0316579_106148891 150
740 3300031727 Ga0316576_10012788 Ga0316576_100127881 150
741 3300031731 Ga0307405_10010584 Ga0307405_100105846 150
742 3300031731 Ga0307405_10084395 Ga0307405_100843954 150
743 3300031824 Ga0307413_10002720 Ga0307413_100027206 150
744 3300031852 Ga0307410_10056473 Ga0307410_100564735 150
745 3300031901 Ga0307406_10077352 Ga0307406_100773525 150
746 3300031903 Ga0307407_10012077 Ga0307407_100120773 150
747 3300031911 Ga0307412_12039389 Ga0307412_120393891 150
748 3300031995 Ga0307409_100254570 Ga0307409_1002545702 150
749 3300031995 Ga0307409_100515560 Ga0307409_1005155602 150
750 3300032002 Ga0307416_100014401 Ga0307416_1000144015 150
751 3300032005 Ga0307411_10010727 Ga0307411_100107272 150
752 3300032126 Ga0307415_100029860 Ga0307415_1000298604 150
753 3300035112 Ga0373932_0093343 Ga0373932_0093343_302_760 150
754 3300035114 Ga0373939_0012513 Ga0373939_0012513_778_1236 150
755 3300035171 Ga0373946_0091313 Ga0373946_0091313_556_1008 150
756 3300035691 Ga0373931_0173642 Ga0373931_0173642_668_1120 150
757 3300035691 Ga0373931_0267744 Ga0373931_0267744_531_983 150
758 3300035725 Ga0373947_0038852 Ga0373947_0038852_247_699 150
759 3300036647 Ga0316582_0471911 Ga0316582_0471911_204_659 150
760 3300036712 Ga0316584_0110326 Ga0316584_0110326_223_684 150
761 3300042125 Ga0450923_003245 Ga0450923_003245_1583_2035 150
762 3300042133 Ga0450896_077762 Ga0450896_077762_52_504 150
763 3300042435 Ga0439434_0097721 Ga0439434_0097721_214_669 150
764 3300042532 Ga0450893_0044148 Ga0450893_0044148_271_723 150
765 3300042876 Ga0451577_0846090 Ga0451577_0846090_188_640 150
766 3300044673 Ga0453683_0060110 Ga0453683_0060110_571_1023 150
767 3300045051 Ga0451576_0076699 Ga0451576_0076699_963_1415 150
768 3300045051 Ga0451576_0804217 Ga0451576_0804217_428_880 150
769 3300046683 Ga0495658_0436905 Ga0495658_0436905_223_675 150
770 3300046691 Ga0495670_0478960 Ga0495670_0478960_164_616 150
771 3300049521 Ga0501298_001964 Ga0501298_001964_850_1305 150
772 3300049522 Ga0501299_004376 Ga0501299_004376_12_467 150
773 3300049572 Ga0501036_0835674 Ga0501036_0835674_280_732 150
774 3300049575 Ga0501039_0332457 Ga0501039_0332457_617_1069 150
775 3300049577 Ga0501041_0004538 Ga0501041_0004538_1463_1915 150
776 3300049578 Ga0501042_0235411 Ga0501042_0235411_280_732 150
777 3300049580 Ga0501046_0117006 Ga0501046_0117006_731_1183 150
778 3300049580 Ga0501046_0219098 Ga0501046_0219098_232_684 150
779 3300049584 Ga0501068_0468996 Ga0501068_0468996_72_524 150
780 3300049587 Ga0501071_0101413 Ga0501071_0101413_988_1440 150
781 3300049587 Ga0501071_0383700 Ga0501071_0383700_528_980 150
782 3300049588 Ga0501072_0078507 Ga0501072_0078507_228_680 150
783 3300049589 Ga0501073_0963113 Ga0501073_0963113_91_543 150
784 3300049590 Ga0501074_0089317 Ga0501074_0089317_1265_1717 150
785 3300049591 Ga0501075_0000770 Ga0501075_0000770_14500_14952 150
786 3300049591 Ga0501075_0079990 Ga0501075_0079990_1263_1715 150
787 3300049592 Ga0501076_0003602 Ga0501076_0003602_4547_4999 150
788 3300049592 Ga0501076_0679693 Ga0501076_0679693_328_780 150
789 3300049593 Ga0501077_0013963 Ga0501077_0013963_2970_3422 150
790 3300049593 Ga0501077_0103817 Ga0501077_0103817_659_1111 150
791 3300049593 Ga0501077_0150159 Ga0501077_0150159_787_1245 150
792 3300049661 Ga0501217_134230 Ga0501217_134230_62_517 150
793 3300049669 Ga0501235_012869 Ga0501235_012869_1316_1771 150
794 3300049675 Ga0501243_038621 Ga0501243_038621_52_507 150
795 3300049690 Ga0501261_042851 Ga0501261_042851_34_489 150
796 3300049705 Ga0501225_0020204 Ga0501225_0020204_955_1410 150
797 3300049741 Ga0501079_0085949 Ga0501079_0085949_1610_2062 150
798 3300049741 Ga0501079_0161057 Ga0501079_0161057_233_685 150
799 3300049741 Ga0501079_0885231 Ga0501079_0885231_227_679 150
800 3300049743 Ga0501081_0004872 Ga0501081_0004872_1869_2321 150
801 3300049743 Ga0501081_0128408 Ga0501081_0128408_391_843 150
802 3300049743 Ga0501081_0472498 Ga0501081_0472498_305_766 150
803 3300049743 Ga0501081_0976298 Ga0501081_0976298_83_535 150
804 3300049767 Ga0501270_027755 Ga0501270_027755_166_621 150
805 3300049824 Ga0501045_0082381 Ga0501045_0082381_1783_2235 150
806 3300049824 Ga0501045_0805274 Ga0501045_0805274_185_637 150
807 3300049850 Ga0501204_005837 Ga0501204_005837_32_487 150
808 3300050507 nmdc:mga05p37_134390_c1 nmdc:mga05p37_134390_c1_989_1447 150
809 3300050507 nmdc:mga05p37_16050_c1 nmdc:mga05p37_16050_c1_5880_6332 150
810 3300050507 nmdc:mga05p37_26567_c1 nmdc:mga05p37_26567_c1_5511_5966 150
811 3300050507 nmdc:mga05p37_983103_c1 nmdc:mga05p37_983103_c1_246_698 150
812 3300050508 nmdc:mga09592_1026488_c1 nmdc:mga09592_1026488_c1_222_674 150
813 3300050508 nmdc:mga09592_11119_c1 nmdc:mga09592_11119_c1_989_1447 150
814 3300050508 nmdc:mga09592_1120906_c1 nmdc:mga09592_1120906_c1_125_583 150
815 3300050508 nmdc:mga09592_254973_c1 nmdc:mga09592_254973_c1_984_1442 150
816 3300050508 nmdc:mga09592_67249_c1 nmdc:mga09592_67249_c1_1316_1768 150
817 3300050508 nmdc:mga09592_705441_c1 nmdc:mga09592_705441_c1_112_567 150
818 3300050509 nmdc:mga0qj67_10983_c1 nmdc:mga0qj67_10983_c1_3130_3582 150
819 3300050509 nmdc:mga0qj67_1545785_c1 nmdc:mga0qj67_1545785_c1_25_480 150
820 3300050509 nmdc:mga0qj67_211737_c1 nmdc:mga0qj67_211737_c1_710_1168 150
821 3300050509 nmdc:mga0qj67_26559_c1 nmdc:mga0qj67_26559_c1_3732_4187 150
822 3300050509 nmdc:mga0qj67_596887_c1 nmdc:mga0qj67_596887_c1_309_761 150
823 3300050509 nmdc:mga0qj67_829456_c1 nmdc:mga0qj67_829456_c1_211_666 150
824 3300050510 nmdc:mga06r32_18791_c1 nmdc:mga06r32_18791_c1_5863_6315 150
825 3300050510 nmdc:mga06r32_21962_c1 nmdc:mga06r32_21962_c1_2619_3071 150
826 3300050511 nmdc:mga08y16_20164_c1 nmdc:mga08y16_20164_c1_4617_5069 150
827 3300050512 nmdc:mga0n895_91896_c1 nmdc:mga0n895_91896_c1_1597_2055 150
828 3300050512 nmdc:mga0n895_93500_c1 nmdc:mga0n895_93500_c1_1076_1528 150
829 3300050514 nmdc:mga08x19_24722_c1 nmdc:mga08x19_24722_c1_930_1382 150
830 3300050514 nmdc:mga08x19_478126_c1 nmdc:mga08x19_478126_c1_184_636 150
831 3300050514 nmdc:mga08x19_72739_c1 nmdc:mga08x19_72739_c1_341_799 150
832 3300050515 nmdc:mga0a205_1486_c1 nmdc:mga0a205_1486_c1_18711_19163 150
833 3300050515 nmdc:mga0a205_259485_c1 nmdc:mga0a205_259485_c1_264_722 150
834 3300050515 nmdc:mga0a205_627500_c1 nmdc:mga0a205_627500_c1_155_607 150
835 3300054114 Ga0501084_0077570 Ga0501084_0077570_2264_2716 150
836 3300054114 Ga0501084_0495337 Ga0501084_0495337_271_723 150
837 3300059426 Ga0590077_063834 Ga0590077_063834_338_793 150
838 3300060353 Ga0501082_0076961 Ga0501082_0076961_353_805 150
839 3300061734 Ga0530510_0333066 Ga0530510_0333066_425_886 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

7

147

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a6f-assembly1.cif.gz_B crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 0.9426 6 140
6a6g-assembly1.cif.gz_C crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1 0.9342 8 140
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9331 2 141
6a6g-assembly1.cif.gz_D crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1 0.9328 10 140
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9255 2 143
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9316 2 140 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9187 2 140 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9123 1 142 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9078 3 139 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8952 3 139 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2A5RV02-F1-model_v4 Fe-S assembly protein NifU 0.9701 12 141 GO:0005506
GO:0016226
GO:0051536
AF-A0A2V9S5W4-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.968 34 150 GO:0005506
GO:0016226
GO:0051536
AF-A0A2V8PTC4-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9679 25 150 GO:0005506
GO:0016226
GO:0051536
AF-A0A5N9B351-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9636 1 150 GO:0005506
GO:0016226
GO:0051536
AF-A0A7C5VKY7-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9611 10 140 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
90.21 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map