F483005
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 839 | 358 | 839 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300003316|rootH1_10134043|rootH1_101340432 |
| Length | 170 |
| Sequence | MGSLATLYQDLILDHNRAPRNYRVIDDANRRAEGNNPICGDRLTVWLKLEDDRIRDISFQGSGCAISRASASLMTLAVAGRTKLEAEQLFDRFRQLVTGSLELADTGTLGKLAAFGGISEFPARIKCASLAWHALKAALEQPEAVVTTELPMLAADESHRHTTKASAMRN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 103 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 104 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 234 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 238 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 239 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 240 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 241 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 242 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 243 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 244 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 245 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 246 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 247 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 248 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 249 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 250 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 251 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 252 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 253 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 254 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 255 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 297 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 298 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 299 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 326 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 327 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 329 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 330 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 342 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 354 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 356 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.62 |
| Rhizosphere | 97.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c011292 | 3300000041 | Bacteria | 763 |
| 2 | ARSoilOldRDRAFT_c008884 | 3300000044 | Bacteria | 837 |
| 3 | JGI24746J21847_1025389 | 3300001977 | Bacteria | 820 |
| 4 | rootH1_10048177 | 3300003316 | Bacteria | 2495 |
| 5 | rootH1_10134043 | 3300003316 | Bacteria | 1095 |
| 6 | JGI25405J52794_10005174 | 3300003911 | Unclassified | 2345 |
| 7 | Ga0058863_11948557 | 3300004799 | Bacteria | 1199 |
| 8 | Ga0058861_12030290 | 3300004800 | Bacteria | 990 |
| 9 | Ga0058862_12710135 | 3300004803 | Bacteria | 1021 |
| 10 | Ga0065712_10002436 | 3300005290 | Bacteria | 5124 |
| 11 | Ga0065712_10070819 | 3300005290 | Bacteria | 5683 |
| 12 | Ga0065715_10002906 | 3300005293 | Bacteria | 6018 |
| 13 | Ga0065715_10011887 | 3300005293 | Bacteria | 2380 |
| 14 | Ga0065707_10001212 | 3300005295 | Bacteria | 11424 |
| 15 | Ga0065707_10014449 | 3300005295 | Bacteria | 4625 |
| 16 | Ga0065707_10118897 | 3300005295 | Bacteria | 2174 |
| 17 | Ga0065707_10209214 | 3300005295 | Bacteria | 1273 |
| 18 | Ga0065707_10374985 | 3300005295 | Bacteria | 866 |
| 19 | Ga0065707_10889558 | 3300005295 | Bacteria | 556 |
| 20 | Ga0065707_11127062 | 3300005295 | Unclassified | 510 |
| 21 | Ga0070658_10403806 | 3300005327 | Bacteria | 1174 |
| 22 | Ga0070676_10001668 | 3300005328 | Bacteria | 11298 |
| 23 | Ga0070690_100060005 | 3300005330 | Bacteria | 2447 |
| 24 | Ga0070670_100000895 | 3300005331 | Bacteria | 23505 |
| 25 | Ga0070677_10011217 | 3300005333 | Bacteria | 3084 |
| 26 | Ga0068869_100012510 | 3300005334 | Bacteria | 5612 |
| 27 | Ga0068869_100033778 | 3300005334 | Bacteria | 3613 |
| 28 | Ga0068869_100213324 | 3300005334 | Bacteria | 1527 |
| 29 | Ga0070666_10006434 | 3300005335 | Bacteria | 7220 |
| 30 | Ga0070680_100055317 | 3300005336 | Bacteria | 3243 |
| 31 | Ga0070680_100085436 | 3300005336 | Bacteria | 2607 |
| 32 | Ga0070682_100291911 | 3300005337 | Bacteria | 1193 |
| 33 | Ga0068868_100026121 | 3300005338 | Bacteria | 4448 |
| 34 | Ga0070689_100179721 | 3300005340 | Bacteria | 1718 |
| 35 | Ga0070691_10241504 | 3300005341 | Bacteria | 965 |
| 36 | Ga0070661_100007965 | 3300005344 | Bacteria | 7319 |
| 37 | Ga0070661_100178960 | 3300005344 | Bacteria | 1613 |
| 38 | Ga0070692_10320388 | 3300005345 | Unclassified | 953 |
| 39 | Ga0070692_10324506 | 3300005345 | Bacteria | 948 |
| 40 | Ga0070668_100403808 | 3300005347 | Bacteria | 1167 |
| 41 | Ga0070668_100516446 | 3300005347 | Unclassified | 1036 |
| 42 | Ga0070669_100006398 | 3300005353 | Bacteria | 8479 |
| 43 | Ga0070669_100138670 | 3300005353 | Bacteria | 1873 |
| 44 | Ga0070675_100354646 | 3300005354 | Bacteria | 1301 |
| 45 | Ga0070675_100824400 | 3300005354 | Bacteria | 848 |
| 46 | Ga0070675_100836674 | 3300005354 | Unclassified | 842 |
| 47 | Ga0070671_100023258 | 3300005355 | Bacteria | 5070 |
| 48 | Ga0070671_100087309 | 3300005355 | Bacteria | 2610 |
| 49 | Ga0070674_100000031 | 3300005356 | Bacteria | 67745 |
| 50 | Ga0070674_100131021 | 3300005356 | Bacteria | 1869 |
| 51 | Ga0070674_101970668 | 3300005356 | Unclassified | 531 |
| 52 | Ga0070673_100065674 | 3300005364 | Bacteria | 2895 |
| 53 | Ga0070673_100986688 | 3300005364 | Unclassified | 784 |
| 54 | Ga0070688_100230942 | 3300005365 | Bacteria | 1309 |
| 55 | Ga0070667_100053227 | 3300005367 | Bacteria | 3416 |
| 56 | Ga0070667_100116787 | 3300005367 | Bacteria | 2317 |
| 57 | Ga0070667_100995009 | 3300005367 | Bacteria | 782 |
| 58 | Ga0070705_100010188 | 3300005440 | Bacteria | 4697 |
| 59 | Ga0070705_100056028 | 3300005440 | Bacteria | 2320 |
| 60 | Ga0070705_100676526 | 3300005440 | Bacteria | 808 |
| 61 | Ga0070700_100314512 | 3300005441 | Unclassified | 1148 |
| 62 | Ga0070700_100466820 | 3300005441 | Bacteria | 964 |
| 63 | Ga0070694_100003632 | 3300005444 | Bacteria | 9211 |
| 64 | Ga0070694_100039671 | 3300005444 | Bacteria | 3136 |
| 65 | Ga0070694_100130465 | 3300005444 | Unclassified | 1815 |
| 66 | Ga0070694_101908655 | 3300005444 | Unclassified | 507 |
| 67 | Ga0070708_100045977 | 3300005445 | Bacteria | 3850 |
| 68 | Ga0070708_100531780 | 3300005445 | Bacteria | 1109 |
| 69 | Ga0070663_100087896 | 3300005455 | Bacteria | 2298 |
| 70 | Ga0070678_100018444 | 3300005456 | Bacteria | 4522 |
| 71 | Ga0070678_100023971 | 3300005456 | Bacteria | 4076 |
| 72 | Ga0070678_100275316 | 3300005456 | Bacteria | 1421 |
| 73 | Ga0070678_101169037 | 3300005456 | Bacteria | 712 |
| 74 | Ga0070662_100000206 | 3300005457 | Bacteria | 34279 |
| 75 | Ga0070662_100094829 | 3300005457 | Bacteria | 2247 |
| 76 | Ga0070681_10008219 | 3300005458 | Bacteria | 10212 |
| 77 | Ga0070681_10034774 | 3300005458 | Bacteria | 5060 |
| 78 | Ga0070681_10752289 | 3300005458 | Bacteria | 891 |
| 79 | Ga0068867_100000341 | 3300005459 | Bacteria | 30850 |
| 80 | Ga0068867_100412764 | 3300005459 | Bacteria | 1142 |
| 81 | Ga0070706_100020198 | 3300005467 | Bacteria | 6137 |
| 82 | Ga0070706_100869670 | 3300005467 | Unclassified | 833 |
| 83 | Ga0070707_100906536 | 3300005468 | Bacteria | 846 |
| 84 | Ga0070698_100001874 | 3300005471 | Bacteria | 23434 |
| 85 | Ga0070698_100005938 | 3300005471 | Bacteria | 13314 |
| 86 | Ga0070698_100199077 | 3300005471 | Bacteria | 1939 |
| 87 | Ga0070698_100208185 | 3300005471 | Bacteria | 1891 |
| 88 | Ga0070698_100241937 | 3300005471 | Bacteria | 1738 |
| 89 | Ga0070699_100000650 | 3300005518 | Bacteria | 32523 |
| 90 | Ga0070699_100112334 | 3300005518 | Bacteria | 2393 |
| 91 | Ga0070699_100280178 | 3300005518 | Bacteria | 1493 |
| 92 | Ga0070699_100335650 | 3300005518 | Bacteria | 1360 |
| 93 | Ga0070679_100010568 | 3300005530 | Bacteria | 8757 |
| 94 | Ga0070679_100147305 | 3300005530 | Bacteria | 2332 |
| 95 | Ga0070679_100179187 | 3300005530 | Bacteria | 2092 |
| 96 | Ga0070679_100180045 | 3300005530 | Bacteria | 2086 |
| 97 | Ga0070679_100434473 | 3300005530 | Bacteria | 1258 |
| 98 | Ga0070684_100271609 | 3300005535 | Bacteria | 1552 |
| 99 | Ga0070697_101375882 | 3300005536 | Unclassified | 630 |
| 100 | Ga0070672_100018970 | 3300005543 | Bacteria | 4984 |
| 101 | Ga0070672_100086349 | 3300005543 | Bacteria | 2523 |
| 102 | Ga0070672_100402568 | 3300005543 | Unclassified | 1173 |
| 103 | Ga0070672_100758385 | 3300005543 | Unclassified | 852 |
| 104 | Ga0070672_100865089 | 3300005543 | Unclassified | 797 |
| 105 | Ga0070686_100004210 | 3300005544 | Bacteria | 7920 |
| 106 | Ga0070686_100025456 | 3300005544 | Bacteria | 3561 |
| 107 | Ga0070686_101624072 | 3300005544 | Unclassified | 547 |
| 108 | Ga0070695_100010146 | 3300005545 | Bacteria | 5616 |
| 109 | Ga0070695_100019561 | 3300005545 | Bacteria | 4123 |
| 110 | Ga0070695_100100729 | 3300005545 | Bacteria | 1945 |
| 111 | Ga0070695_100477556 | 3300005545 | Bacteria | 960 |
| 112 | Ga0070695_100797843 | 3300005545 | Bacteria | 756 |
| 113 | Ga0070696_100003810 | 3300005546 | Bacteria | 10075 |
| 114 | Ga0070696_100006413 | 3300005546 | Bacteria | 7877 |
| 115 | Ga0070696_100043359 | 3300005546 | Bacteria | 3112 |
| 116 | Ga0070696_100095096 | 3300005546 | Bacteria | 2127 |
| 117 | Ga0070693_100031570 | 3300005547 | Bacteria | 2905 |
| 118 | Ga0070693_100078305 | 3300005547 | Bacteria | 1964 |
| 119 | Ga0070704_100217787 | 3300005549 | Bacteria | 1550 |
| 120 | Ga0070704_100281777 | 3300005549 | Bacteria | 1377 |
| 121 | Ga0070704_100457423 | 3300005549 | Bacteria | 1100 |
| 122 | Ga0070704_102122301 | 3300005549 | Bacteria | 522 |
| 123 | Ga0068855_100352860 | 3300005563 | Bacteria | 1620 |
| 124 | Ga0068855_100401737 | 3300005563 | Bacteria | 1501 |
| 125 | Ga0070664_100024643 | 3300005564 | Bacteria | 4979 |
| 126 | Ga0070664_100722212 | 3300005564 | Bacteria | 929 |
| 127 | Ga0068857_100000784 | 3300005577 | Bacteria | 23721 |
| 128 | Ga0068857_100041473 | 3300005577 | Bacteria | 4082 |
| 129 | Ga0068857_100193490 | 3300005577 | Bacteria | 1853 |
| 130 | Ga0068857_101266459 | 3300005577 | Bacteria | 715 |
| 131 | Ga0068857_101358794 | 3300005577 | Bacteria | 690 |
| 132 | Ga0068854_100007149 | 3300005578 | Bacteria | 7130 |
| 133 | Ga0068854_100038940 | 3300005578 | Bacteria | 3346 |
| 134 | Ga0068854_100807325 | 3300005578 | Bacteria | 818 |
| 135 | Ga0070702_100008842 | 3300005615 | Bacteria | 4899 |
| 136 | Ga0068852_100284920 | 3300005616 | Bacteria | 1594 |
| 137 | Ga0068859_100425015 | 3300005617 | Bacteria | 1425 |
| 138 | Ga0068864_100001389 | 3300005618 | Bacteria | 20065 |
| 139 | Ga0068864_101170527 | 3300005618 | Bacteria | 767 |
| 140 | Ga0068866_10000048 | 3300005718 | Bacteria | 46904 |
| 141 | Ga0068866_10133474 | 3300005718 | Bacteria | 1415 |
| 142 | Ga0068861_100009043 | 3300005719 | Bacteria | 6867 |
| 143 | Ga0068861_100055073 | 3300005719 | Bacteria | 3032 |
| 144 | Ga0068861_100165347 | 3300005719 | Bacteria | 1829 |
| 145 | Ga0068858_100075921 | 3300005842 | Bacteria | 3122 |
| 146 | Ga0068860_100019327 | 3300005843 | Bacteria | 6609 |
| 147 | Ga0068860_100021349 | 3300005843 | Bacteria | 6269 |
| 148 | Ga0068860_100129911 | 3300005843 | Bacteria | 2417 |
| 149 | Ga0068860_100203590 | 3300005843 | Bacteria | 1919 |
| 150 | Ga0068860_100709726 | 3300005843 | Bacteria | 1016 |
| 151 | Ga0068862_100010499 | 3300005844 | Bacteria | 7649 |
| 152 | Ga0068862_100059829 | 3300005844 | Bacteria | 3272 |
| 153 | Ga0081455_10002445 | 3300005937 | Bacteria | 22116 |
| 154 | Ga0081455_10015954 | 3300005937 | Bacteria | 7272 |
| 155 | Ga0081455_10166060 | 3300005937 | Unclassified | 1686 |
| 156 | Ga0081538_10007439 | 3300005981 | Bacteria | 9480 |
| 157 | Ga0081540_1256964 | 3300005983 | Unclassified | 608 |
| 158 | Ga0075432_10188339 | 3300006058 | Bacteria | 811 |
| 159 | Ga0070715_10150484 | 3300006163 | Bacteria | 1140 |
| 160 | Ga0070712_100186198 | 3300006175 | Bacteria | 1621 |
| 161 | Ga0075427_10083609 | 3300006194 | Bacteria | 579 |
| 162 | Ga0097621_100361426 | 3300006237 | Unclassified | 1293 |
| 163 | Ga0068871_100105274 | 3300006358 | Bacteria | 2367 |
| 164 | Ga0068871_100113984 | 3300006358 | Bacteria | 2277 |
| 165 | Ga0075428_100008553 | 3300006844 | Bacteria | 11355 |
| 166 | Ga0075428_100042612 | 3300006844 | Bacteria | 4991 |
| 167 | Ga0075428_100186017 | 3300006844 | Bacteria | 2248 |
| 168 | Ga0075428_100537780 | 3300006844 | Bacteria | 1249 |
| 169 | Ga0075428_100762130 | 3300006844 | Bacteria | 1029 |
| 170 | Ga0075428_101098377 | 3300006844 | Unclassified | 840 |
| 171 | Ga0075428_101599307 | 3300006844 | Bacteria | 681 |
| 172 | Ga0075430_100022399 | 3300006846 | Bacteria | 5376 |
| 173 | Ga0075430_100123958 | 3300006846 | Unclassified | 2154 |
| 174 | Ga0075430_100224214 | 3300006846 | Unclassified | 1559 |
| 175 | Ga0075430_100273337 | 3300006846 | Bacteria | 1398 |
| 176 | Ga0075430_100371496 | 3300006846 | Bacteria | 1181 |
| 177 | Ga0075430_100596111 | 3300006846 | Bacteria | 912 |
| 178 | Ga0075430_100834246 | 3300006846 | Unclassified | 760 |
| 179 | Ga0075430_101007983 | 3300006846 | Bacteria | 686 |
| 180 | Ga0075431_100003213 | 3300006847 | Bacteria | 15816 |
| 181 | Ga0075431_100013341 | 3300006847 | Bacteria | 8303 |
| 182 | Ga0075431_100058093 | 3300006847 | Bacteria | 3990 |
| 183 | Ga0075431_100288153 | 3300006847 | Unclassified | 1662 |
| 184 | Ga0075431_100313990 | 3300006847 | Bacteria | 1581 |
| 185 | Ga0075431_100637856 | 3300006847 | Bacteria | 1047 |
| 186 | Ga0075431_100744797 | 3300006847 | Bacteria | 956 |
| 187 | Ga0075433_10005452 | 3300006852 | Bacteria | 9995 |
| 188 | Ga0075433_10064220 | 3300006852 | Bacteria | 3218 |
| 189 | Ga0075433_10472862 | 3300006852 | Bacteria | 1104 |
| 190 | Ga0075434_100012929 | 3300006871 | Bacteria | 7929 |
| 191 | Ga0075434_100041175 | 3300006871 | Bacteria | 4576 |
| 192 | Ga0075434_100111787 | 3300006871 | Bacteria | 2743 |
| 193 | Ga0075434_100168338 | 3300006871 | Bacteria | 2211 |
| 194 | Ga0075434_100230029 | 3300006871 | Bacteria | 1873 |
| 195 | Ga0075434_100526483 | 3300006871 | Bacteria | 1202 |
| 196 | Ga0075429_100004888 | 3300006880 | Bacteria | 11552 |
| 197 | Ga0075429_100021847 | 3300006880 | Bacteria | 5547 |
| 198 | Ga0075429_100129218 | 3300006880 | Bacteria | 2210 |
| 199 | Ga0075429_100166594 | 3300006880 | Bacteria | 1930 |
| 200 | Ga0075429_100294892 | 3300006880 | Bacteria | 1420 |
| 201 | Ga0075429_100886865 | 3300006880 | Unclassified | 781 |
| 202 | Ga0068865_100001170 | 3300006881 | Bacteria | 15241 |
| 203 | Ga0068865_101467305 | 3300006881 | Unclassified | 610 |
| 204 | Ga0075436_100064240 | 3300006914 | Bacteria | 2537 |
| 205 | Ga0075436_100461344 | 3300006914 | Unclassified | 926 |
| 206 | Ga0075436_100548303 | 3300006914 | Bacteria | 849 |
| 207 | Ga0097620_100424995 | 3300006931 | Bacteria | 1425 |
| 208 | Ga0075435_100040500 | 3300007076 | Bacteria | 3720 |
| 209 | Ga0075435_100045913 | 3300007076 | Bacteria | 3503 |
| 210 | Ga0075435_100157057 | 3300007076 | Bacteria | 1914 |
| 211 | Ga0075435_100578103 | 3300007076 | Bacteria | 974 |
| 212 | Ga0075435_100833366 | 3300007076 | Bacteria | 803 |
| 213 | Ga0105240_10478316 | 3300009093 | Bacteria | 1389 |
| 214 | Ga0111539_10049650 | 3300009094 | Bacteria | 5002 |
| 215 | Ga0111539_10281592 | 3300009094 | Bacteria | 1935 |
| 216 | Ga0111539_10687601 | 3300009094 | Bacteria | 1191 |
| 217 | Ga0111539_10892955 | 3300009094 | Unclassified | 1034 |
| 218 | Ga0105245_10036912 | 3300009098 | Bacteria | 4343 |
| 219 | Ga0105247_10691098 | 3300009101 | Bacteria | 767 |
| 220 | Ga0114129_10009271 | 3300009147 | Bacteria | 14036 |
| 221 | Ga0114129_10017932 | 3300009147 | Bacteria | 10078 |
| 222 | Ga0114129_10071105 | 3300009147 | Bacteria | 4852 |
| 223 | Ga0114129_10076366 | 3300009147 | Bacteria | 4664 |
| 224 | Ga0114129_10149832 | 3300009147 | Bacteria | 3193 |
| 225 | Ga0114129_10437778 | 3300009147 | Bacteria | 1717 |
| 226 | Ga0114129_10714659 | 3300009147 | Unclassified | 1286 |
| 227 | Ga0114129_10869065 | 3300009147 | Bacteria | 1145 |
| 228 | Ga0114129_11178052 | 3300009147 | Bacteria | 955 |
| 229 | Ga0105243_10003585 | 3300009148 | Bacteria | 12527 |
| 230 | Ga0105243_10291017 | 3300009148 | Bacteria | 1476 |
| 231 | Ga0105243_10309534 | 3300009148 | Unclassified | 1435 |
| 232 | Ga0105241_10000716 | 3300009174 | Bacteria | 25098 |
| 233 | Ga0105241_10094975 | 3300009174 | Bacteria | 2359 |
| 234 | Ga0105241_10952002 | 3300009174 | Bacteria | 800 |
| 235 | Ga0105242_10000251 | 3300009176 | Bacteria | 42425 |
| 236 | Ga0105242_10076230 | 3300009176 | Bacteria | 2795 |
| 237 | Ga0105242_10598567 | 3300009176 | Bacteria | 1064 |
| 238 | Ga0105242_11237152 | 3300009176 | Bacteria | 767 |
| 239 | Ga0105248_10001792 | 3300009177 | Bacteria | 23876 |
| 240 | Ga0105248_11057579 | 3300009177 | Bacteria | 917 |
| 241 | Ga0105237_10000013 | 3300009545 | Bacteria | 297699 |
| 242 | Ga0105237_10066610 | 3300009545 | Bacteria | 3596 |
| 243 | Ga0105238_10090873 | 3300009551 | Bacteria | 3041 |
| 244 | Ga0105238_11187727 | 3300009551 | Bacteria | 787 |
| 245 | Ga0105249_10023634 | 3300009553 | Bacteria | 5517 |
| 246 | Ga0105249_10038687 | 3300009553 | Bacteria | 4328 |
| 247 | Ga0105249_10364615 | 3300009553 | Bacteria | 1467 |
| 248 | Ga0105249_10391406 | 3300009553 | Bacteria | 1418 |
| 249 | Ga0105249_10896853 | 3300009553 | Bacteria | 953 |
| 250 | Ga0105249_11999526 | 3300009553 | Unclassified | 652 |
| 251 | Ga0105249_12164897 | 3300009553 | Unclassified | 629 |
| 252 | Ga0105239_10013449 | 3300010375 | Bacteria | 9093 |
| 253 | Ga0105239_10048201 | 3300010375 | Bacteria | 4671 |
| 254 | Ga0105239_10298877 | 3300010375 | Bacteria | 1813 |
| 255 | Ga0105239_10555303 | 3300010375 | Unclassified | 1308 |
| 256 | Ga0105246_10048247 | 3300011119 | Bacteria | 2910 |
| 257 | Ga0105246_10099510 | 3300011119 | Bacteria | 2114 |
| 258 | Ga0105246_11209973 | 3300011119 | Unclassified | 696 |
| 259 | Ga0105246_11489418 | 3300011119 | Bacteria | 635 |
| 260 | Ga0157319_1008551 | 3300012497 | Bacteria | 786 |
| 261 | Ga0157339_1013176 | 3300012505 | Bacteria | 787 |
| 262 | Ga0157327_1002831 | 3300012512 | Bacteria | 1232 |
| 263 | Ga0157327_1007215 | 3300012512 | Bacteria | 962 |
| 264 | Ga0157371_10453573 | 3300013102 | Bacteria | 943 |
| 265 | Ga0157374_10304285 | 3300013296 | Bacteria | 1578 |
| 266 | Ga0157378_10001585 | 3300013297 | Bacteria | 20557 |
| 267 | Ga0157378_10022508 | 3300013297 | Bacteria | 5546 |
| 268 | Ga0157378_10319336 | 3300013297 | Bacteria | 1508 |
| 269 | Ga0163162_10036701 | 3300013306 | Bacteria | 4887 |
| 270 | Ga0163162_10043019 | 3300013306 | Bacteria | 4522 |
| 271 | Ga0163162_10066793 | 3300013306 | Bacteria | 3645 |
| 272 | Ga0163162_10179578 | 3300013306 | Bacteria | 2243 |
| 273 | Ga0163162_10791231 | 3300013306 | Bacteria | 1066 |
| 274 | Ga0163162_12328358 | 3300013306 | Bacteria | 615 |
| 275 | Ga0157372_10114281 | 3300013307 | Bacteria | 3094 |
| 276 | Ga0157372_10247607 | 3300013307 | Bacteria | 2068 |
| 277 | Ga0157375_10021674 | 3300013308 | Bacteria | 5898 |
| 278 | Ga0157375_10458228 | 3300013308 | Unclassified | 1441 |
| 279 | Ga0157375_10572842 | 3300013308 | Bacteria | 1290 |
| 280 | Ga0157375_11291773 | 3300013308 | Bacteria | 858 |
| 281 | Ga0157380_10020140 | 3300014326 | Bacteria | 4983 |
| 282 | Ga0157380_10194865 | 3300014326 | Bacteria | 1792 |
| 283 | Ga0157380_10393544 | 3300014326 | Bacteria | 1312 |
| 284 | Ga0157380_10945175 | 3300014326 | Bacteria | 891 |
| 285 | Ga0157377_10542233 | 3300014745 | Bacteria | 820 |
| 286 | Ga0157379_10061166 | 3300014968 | Bacteria | 3368 |
| 287 | Ga0157379_10077422 | 3300014968 | Bacteria | 2978 |
| 288 | Ga0157376_10009968 | 3300014969 | Bacteria | 6933 |
| 289 | Ga0157376_10383762 | 3300014969 | Bacteria | 1354 |
| 290 | Ga0182006_1065900 | 3300015261 | Bacteria | 1355 |
| 291 | Ga0163161_10010019 | 3300017792 | Bacteria | 6561 |
| 292 | Ga0163161_10271084 | 3300017792 | Bacteria | 1328 |
| 293 | Ga0163161_11447129 | 3300017792 | Unclassified | 601 |
| 294 | Ga0206356_11313219 | 3300020070 | Bacteria | 547 |
| 295 | Ga0207697_10014166 | 3300025315 | Bacteria | 3314 |
| 296 | Ga0207697_10030298 | 3300025315 | Bacteria | 2214 |
| 297 | Ga0207682_10012585 | 3300025893 | Bacteria | 3301 |
| 298 | Ga0207642_10005154 | 3300025899 | Bacteria | 4253 |
| 299 | Ga0207688_10011366 | 3300025901 | Bacteria | 4847 |
| 300 | Ga0207688_10518365 | 3300025901 | Bacteria | 748 |
| 301 | Ga0207680_10047393 | 3300025903 | Bacteria | 2547 |
| 302 | Ga0207647_10216848 | 3300025904 | Bacteria | 1104 |
| 303 | Ga0207647_10234857 | 3300025904 | Unclassified | 1054 |
| 304 | Ga0207645_10000345 | 3300025907 | Bacteria | 38809 |
| 305 | Ga0207645_10001078 | 3300025907 | Bacteria | 22569 |
| 306 | Ga0207645_10647224 | 3300025907 | Bacteria | 718 |
| 307 | Ga0207684_10017132 | 3300025910 | Bacteria | 6218 |
| 308 | Ga0207684_10287667 | 3300025910 | Bacteria | 1417 |
| 309 | Ga0207684_10531218 | 3300025910 | Bacteria | 1007 |
| 310 | Ga0207707_10024571 | 3300025912 | Bacteria | 5273 |
| 311 | Ga0207707_10039054 | 3300025912 | Bacteria | 4149 |
| 312 | Ga0207707_10205457 | 3300025912 | Bacteria | 1717 |
| 313 | Ga0207707_10771292 | 3300025912 | Unclassified | 803 |
| 314 | Ga0207707_10794629 | 3300025912 | Unclassified | 789 |
| 315 | Ga0207695_10429902 | 3300025913 | Bacteria | 1204 |
| 316 | Ga0207671_10000024 | 3300025914 | Bacteria | 274628 |
| 317 | Ga0207693_10153071 | 3300025915 | Bacteria | 1814 |
| 318 | Ga0207660_10074432 | 3300025917 | Bacteria | 2479 |
| 319 | Ga0207660_10179396 | 3300025917 | Bacteria | 1644 |
| 320 | Ga0207660_10220233 | 3300025917 | Bacteria | 1489 |
| 321 | Ga0207660_10861678 | 3300025917 | Bacteria | 739 |
| 322 | Ga0207660_11176302 | 3300025917 | Bacteria | 624 |
| 323 | Ga0207657_10003821 | 3300025919 | Bacteria | 15994 |
| 324 | Ga0207649_10164599 | 3300025920 | Bacteria | 1540 |
| 325 | Ga0207652_10024310 | 3300025921 | Bacteria | 5026 |
| 326 | Ga0207652_10056546 | 3300025921 | Bacteria | 3377 |
| 327 | Ga0207652_10284779 | 3300025921 | Bacteria | 1491 |
| 328 | Ga0207652_10320081 | 3300025921 | Bacteria | 1400 |
| 329 | Ga0207652_10661306 | 3300025921 | Bacteria | 934 |
| 330 | Ga0207646_10194361 | 3300025922 | Bacteria | 1832 |
| 331 | Ga0207646_10942616 | 3300025922 | Bacteria | 765 |
| 332 | Ga0207681_10126385 | 3300025923 | Bacteria | 1883 |
| 333 | Ga0207694_10076010 | 3300025924 | Bacteria | 2630 |
| 334 | Ga0207650_10000495 | 3300025925 | Bacteria | 32814 |
| 335 | Ga0207659_10281826 | 3300025926 | Bacteria | 1359 |
| 336 | Ga0207659_10391793 | 3300025926 | Bacteria | 1160 |
| 337 | Ga0207659_11275379 | 3300025926 | Bacteria | 631 |
| 338 | Ga0207690_10006635 | 3300025932 | Bacteria | 6858 |
| 339 | Ga0207706_10000096 | 3300025933 | Bacteria | 92125 |
| 340 | Ga0207706_10022822 | 3300025933 | Bacteria | 5614 |
| 341 | Ga0207706_10135477 | 3300025933 | Bacteria | 2166 |
| 342 | Ga0207686_10000112 | 3300025934 | Bacteria | 65154 |
| 343 | Ga0207686_10056837 | 3300025934 | Bacteria | 2461 |
| 344 | Ga0207686_11000503 | 3300025934 | Bacteria | 678 |
| 345 | Ga0207709_10001243 | 3300025935 | Bacteria | 18298 |
| 346 | Ga0207709_10594557 | 3300025935 | Bacteria | 875 |
| 347 | Ga0207670_11083394 | 3300025936 | Bacteria | 676 |
| 348 | Ga0207669_10001730 | 3300025937 | Bacteria | 9271 |
| 349 | Ga0207669_10029605 | 3300025937 | Bacteria | 3031 |
| 350 | Ga0207704_10001104 | 3300025938 | Bacteria | 12007 |
| 351 | Ga0207704_10117499 | 3300025938 | Bacteria | 1812 |
| 352 | Ga0207691_10132133 | 3300025940 | Bacteria | 2204 |
| 353 | Ga0207691_10238057 | 3300025940 | Bacteria | 1574 |
| 354 | Ga0207691_10269046 | 3300025940 | Bacteria | 1468 |
| 355 | Ga0207711_10028313 | 3300025941 | Bacteria | 4714 |
| 356 | Ga0207689_10000911 | 3300025942 | Bacteria | 28348 |
| 357 | Ga0207689_10205841 | 3300025942 | Bacteria | 1625 |
| 358 | Ga0207661_11563091 | 3300025944 | Bacteria | 604 |
| 359 | Ga0207679_10002179 | 3300025945 | Bacteria | 12114 |
| 360 | Ga0207679_10052846 | 3300025945 | Bacteria | 2981 |
| 361 | Ga0207679_10233658 | 3300025945 | Bacteria | 1554 |
| 362 | Ga0207667_10219097 | 3300025949 | Bacteria | 1950 |
| 363 | Ga0207667_10273030 | 3300025949 | Bacteria | 1728 |
| 364 | Ga0207651_10917622 | 3300025960 | Unclassified | 780 |
| 365 | Ga0207712_10007741 | 3300025961 | Bacteria | 6792 |
| 366 | Ga0207712_10044085 | 3300025961 | Bacteria | 3081 |
| 367 | Ga0207712_10130813 | 3300025961 | Bacteria | 1912 |
| 368 | Ga0207668_10776477 | 3300025972 | Bacteria | 847 |
| 369 | Ga0207640_10032470 | 3300025981 | Bacteria | 3238 |
| 370 | Ga0207640_11090184 | 3300025981 | Unclassified | 706 |
| 371 | Ga0207658_10022058 | 3300025986 | Bacteria | 4429 |
| 372 | Ga0207677_10601384 | 3300026023 | Bacteria | 965 |
| 373 | Ga0207703_10740598 | 3300026035 | Bacteria | 936 |
| 374 | Ga0207639_10113688 | 3300026041 | Bacteria | 2211 |
| 375 | Ga0207639_10145642 | 3300026041 | Bacteria | 1978 |
| 376 | Ga0207678_10096128 | 3300026067 | Bacteria | 2531 |
| 377 | Ga0207678_10127303 | 3300026067 | Bacteria | 2172 |
| 378 | Ga0207708_10121195 | 3300026075 | Bacteria | 2038 |
| 379 | Ga0207708_10187806 | 3300026075 | Bacteria | 1643 |
| 380 | Ga0207708_10569826 | 3300026075 | Bacteria | 956 |
| 381 | Ga0207702_10299583 | 3300026078 | Bacteria | 1525 |
| 382 | Ga0207648_10000043 | 3300026089 | Bacteria | 113682 |
| 383 | Ga0207676_10019559 | 3300026095 | Bacteria | 4942 |
| 384 | Ga0207676_10121075 | 3300026095 | Bacteria | 2207 |
| 385 | Ga0207676_10358473 | 3300026095 | Bacteria | 1351 |
| 386 | Ga0207674_10001182 | 3300026116 | Bacteria | 33900 |
| 387 | Ga0207674_10251074 | 3300026116 | Bacteria | 1716 |
| 388 | Ga0207674_10360661 | 3300026116 | Bacteria | 1405 |
| 389 | Ga0207674_10831067 | 3300026116 | Bacteria | 891 |
| 390 | Ga0207675_100009301 | 3300026118 | Bacteria | 9216 |
| 391 | Ga0207675_100115253 | 3300026118 | Bacteria | 2539 |
| 392 | Ga0207675_100384116 | 3300026118 | Bacteria | 1381 |
| 393 | Ga0207683_10001057 | 3300026121 | Bacteria | 25089 |
| 394 | Ga0207683_10003314 | 3300026121 | Bacteria | 14037 |
| 395 | Ga0209973_1012454 | 3300027252 | Bacteria | 1035 |
| 396 | Ga0209973_1072123 | 3300027252 | Bacteria | 542 |
| 397 | Ga0209999_1040188 | 3300027543 | Unclassified | 876 |
| 398 | Ga0209983_1008763 | 3300027665 | Bacteria | 2064 |
| 399 | Ga0209966_1003451 | 3300027695 | Bacteria | 2658 |
| 400 | Ga0209966_1023377 | 3300027695 | Bacteria | 1214 |
| 401 | Ga0209974_10001329 | 3300027876 | Bacteria | 8888 |
| 402 | Ga0209974_10085453 | 3300027876 | Unclassified | 1090 |
| 403 | Ga0207428_10027342 | 3300027907 | Bacteria | 4750 |
| 404 | Ga0268266_10125382 | 3300028379 | Bacteria | 2291 |
| 405 | Ga0268265_10030120 | 3300028380 | Bacteria | 3904 |
| 406 | Ga0268265_10035569 | 3300028380 | Bacteria | 3641 |
| 407 | Ga0268264_10033356 | 3300028381 | Bacteria | 4228 |
| 408 | Ga0268264_10245426 | 3300028381 | Bacteria | 1661 |
| 409 | Ga0268264_10250049 | 3300028381 | Bacteria | 1646 |
| 410 | Ga0268264_10260393 | 3300028381 | Bacteria | 1615 |
| 411 | Ga0268264_10280794 | 3300028381 | Bacteria | 1560 |
| 412 | Ga0265337_1001252 | 3300028556 | Bacteria | 12795 |
| 413 | Ga0265337_1019898 | 3300028556 | Bacteria | 2110 |
| 414 | Ga0265337_1039120 | 3300028556 | Bacteria | 1372 |
| 415 | Ga0265326_10001074 | 3300028558 | Bacteria | 9741 |
| 416 | Ga0265326_10003863 | 3300028558 | Bacteria | 4869 |
| 417 | Ga0265326_10038215 | 3300028558 | Bacteria | 1364 |
| 418 | Ga0265319_1000100 | 3300028563 | Bacteria | 66728 |
| 419 | Ga0265319_1000169 | 3300028563 | Bacteria | 49406 |
| 420 | Ga0265319_1009373 | 3300028563 | Bacteria | 4177 |
| 421 | Ga0265319_1011555 | 3300028563 | Bacteria | 3607 |
| 422 | Ga0265334_10000310 | 3300028573 | Bacteria | 26917 |
| 423 | Ga0265334_10001411 | 3300028573 | Bacteria | 11555 |
| 424 | Ga0265334_10049458 | 3300028573 | Bacteria | 1617 |
| 425 | Ga0265334_10055984 | 3300028573 | Bacteria | 1499 |
| 426 | Ga0265318_10000883 | 3300028577 | Bacteria | 19608 |
| 427 | Ga0265318_10001698 | 3300028577 | Bacteria | 12642 |
| 428 | Ga0265318_10071416 | 3300028577 | Bacteria | 1286 |
| 429 | Ga0265323_10000218 | 3300028653 | Bacteria | 33811 |
| 430 | Ga0265322_10000549 | 3300028654 | Bacteria | 14431 |
| 431 | Ga0265336_10000115 | 3300028666 | Bacteria | 59960 |
| 432 | Ga0265338_10001654 | 3300028800 | Bacteria | 35526 |
| 433 | Ga0265338_10005397 | 3300028800 | Bacteria | 16701 |
| 434 | Ga0265338_10005519 | 3300028800 | Bacteria | 16487 |
| 435 | Ga0265338_10005708 | 3300028800 | Bacteria | 16097 |
| 436 | Ga0265338_10016656 | 3300028800 | Bacteria | 7971 |
| 437 | Ga0265338_10030059 | 3300028800 | Bacteria | 5366 |
| 438 | Ga0265338_10407500 | 3300028800 | Bacteria | 968 |
| 439 | Ga0265338_10884010 | 3300028800 | Unclassified | 609 |
| 440 | Ga0265324_10001167 | 3300029957 | Bacteria | 15643 |
| 441 | Ga0265324_10005143 | 3300029957 | Bacteria | 5711 |
| 442 | Ga0265324_10005863 | 3300029957 | Bacteria | 5224 |
| 443 | Ga0265330_10000319 | 3300031235 | Bacteria | 34472 |
| 444 | Ga0265330_10020997 | 3300031235 | Bacteria | 2983 |
| 445 | Ga0265332_10000382 | 3300031238 | Bacteria | 32426 |
| 446 | Ga0265332_10001943 | 3300031238 | Bacteria | 10900 |
| 447 | Ga0265328_10000950 | 3300031239 | Bacteria | 13286 |
| 448 | Ga0265328_10020966 | 3300031239 | Bacteria | 2498 |
| 449 | Ga0265320_10002083 | 3300031240 | Bacteria | 14085 |
| 450 | Ga0265320_10002134 | 3300031240 | Bacteria | 13874 |
| 451 | Ga0265320_10004768 | 3300031240 | Bacteria | 8825 |
| 452 | Ga0265320_10154121 | 3300031240 | Bacteria | 1037 |
| 453 | Ga0265320_10305990 | 3300031240 | Unclassified | 703 |
| 454 | Ga0265325_10001011 | 3300031241 | Bacteria | 20253 |
| 455 | Ga0265325_10004251 | 3300031241 | Bacteria | 9088 |
| 456 | Ga0265329_10000073 | 3300031242 | Bacteria | 44995 |
| 457 | Ga0265329_10012739 | 3300031242 | Bacteria | 3014 |
| 458 | Ga0265340_10029476 | 3300031247 | Bacteria | 2756 |
| 459 | Ga0265340_10034363 | 3300031247 | Bacteria | 2522 |
| 460 | Ga0265340_10130870 | 3300031247 | Bacteria | 1151 |
| 461 | Ga0265339_10000297 | 3300031249 | Bacteria | 40447 |
| 462 | Ga0265339_10163305 | 3300031249 | Bacteria | 1119 |
| 463 | Ga0265331_10000963 | 3300031250 | Bacteria | 22892 |
| 464 | Ga0265331_10002686 | 3300031250 | Bacteria | 11855 |
| 465 | Ga0265327_10216109 | 3300031251 | Unclassified | 864 |
| 466 | Ga0265316_10000247 | 3300031344 | Bacteria | 62442 |
| 467 | Ga0265316_10005834 | 3300031344 | Bacteria | 11873 |
| 468 | Ga0265316_10016713 | 3300031344 | Bacteria | 6357 |
| 469 | Ga0265316_10427338 | 3300031344 | Unclassified | 952 |
| 470 | Ga0265316_11111670 | 3300031344 | Bacteria | 548 |
| 471 | Ga0307408_100026942 | 3300031548 | Bacteria | 3955 |
| 472 | Ga0307408_100295085 | 3300031548 | Bacteria | 1355 |
| 473 | Ga0307408_100405040 | 3300031548 | Bacteria | 1172 |
| 474 | Ga0307408_100543281 | 3300031548 | Bacteria | 1024 |
| 475 | Ga0307408_100567973 | 3300031548 | Bacteria | 1003 |
| 476 | Ga0307408_101359671 | 3300031548 | Bacteria | 667 |
| 477 | Ga0265313_10000580 | 3300031595 | Bacteria | 38083 |
| 478 | Ga0265313_10003350 | 3300031595 | Bacteria | 13083 |
| 479 | Ga0265313_10251667 | 3300031595 | Unclassified | 720 |
| 480 | Ga0316579_10047461 | 3300031691 | Bacteria | 2006 |
| 481 | Ga0316579_10614889 | 3300031691 | Unclassified | 526 |
| 482 | Ga0265314_10000285 | 3300031711 | Bacteria | 73539 |
| 483 | Ga0265314_10004269 | 3300031711 | Bacteria | 13374 |
| 484 | Ga0265314_10139006 | 3300031711 | Bacteria | 1504 |
| 485 | Ga0265314_10320154 | 3300031711 | Unclassified | 863 |
| 486 | Ga0265342_10000764 | 3300031712 | Bacteria | 32819 |
| 487 | Ga0265342_10026274 | 3300031712 | Bacteria | 3650 |
| 488 | Ga0265342_10029291 | 3300031712 | Bacteria | 3419 |
| 489 | Ga0316576_10012788 | 3300031727 | Bacteria | 5555 |
| 490 | Ga0307405_10004222 | 3300031731 | Bacteria | 6759 |
| 491 | Ga0307405_10010584 | 3300031731 | Bacteria | 4793 |
| 492 | Ga0307405_10015476 | 3300031731 | Bacteria | 4134 |
| 493 | Ga0307405_10025001 | 3300031731 | Bacteria | 3422 |
| 494 | Ga0307405_10084395 | 3300031731 | Bacteria | 2085 |
| 495 | Ga0307413_10001012 | 3300031824 | Bacteria | 10160 |
| 496 | Ga0307413_10002720 | 3300031824 | Bacteria | 7256 |
| 497 | Ga0307413_10018674 | 3300031824 | Bacteria | 3644 |
| 498 | Ga0307413_10064349 | 3300031824 | Bacteria | 2278 |
| 499 | Ga0307413_10458476 | 3300031824 | Bacteria | 1013 |
| 500 | Ga0307410_10001656 | 3300031852 | Bacteria | 10246 |
| 501 | Ga0307410_10003004 | 3300031852 | Bacteria | 8326 |
| 502 | Ga0307410_10015549 | 3300031852 | Bacteria | 4517 |
| 503 | Ga0307410_10056473 | 3300031852 | Bacteria | 2670 |
| 504 | Ga0307410_10169784 | 3300031852 | Bacteria | 1642 |
| 505 | Ga0307410_10341626 | 3300031852 | Bacteria | 1193 |
| 506 | Ga0307410_10865010 | 3300031852 | Unclassified | 773 |
| 507 | Ga0307406_10018816 | 3300031901 | Bacteria | 4043 |
| 508 | Ga0307406_10042759 | 3300031901 | Bacteria | 2830 |
| 509 | Ga0307406_10077352 | 3300031901 | Bacteria | 2201 |
| 510 | Ga0307406_10119280 | 3300031901 | Bacteria | 1831 |
| 511 | Ga0307407_10012077 | 3300031903 | Bacteria | 4140 |
| 512 | Ga0307407_10022294 | 3300031903 | Bacteria | 3282 |
| 513 | Ga0307407_10062132 | 3300031903 | Bacteria | 2186 |
| 514 | Ga0307407_10070217 | 3300031903 | Bacteria | 2081 |
| 515 | Ga0307407_10103907 | 3300031903 | Bacteria | 1769 |
| 516 | Ga0307412_10010597 | 3300031911 | Bacteria | 5312 |
| 517 | Ga0307412_10023940 | 3300031911 | Bacteria | 3765 |
| 518 | Ga0307412_10024997 | 3300031911 | Bacteria | 3694 |
| 519 | Ga0307412_10060041 | 3300031911 | Bacteria | 2551 |
| 520 | Ga0307412_10121125 | 3300031911 | Bacteria | 1884 |
| 521 | Ga0307412_10307286 | 3300031911 | Bacteria | 1256 |
| 522 | Ga0307412_12039389 | 3300031911 | Unclassified | 532 |
| 523 | Ga0307409_100000744 | 3300031995 | Bacteria | 14663 |
| 524 | Ga0307409_100001517 | 3300031995 | Bacteria | 11492 |
| 525 | Ga0307409_100032484 | 3300031995 | Bacteria | 3785 |
| 526 | Ga0307409_100085646 | 3300031995 | Bacteria | 2562 |
| 527 | Ga0307409_100254570 | 3300031995 | Bacteria | 1607 |
| 528 | Ga0307409_100515560 | 3300031995 | Bacteria | 1167 |
| 529 | Ga0307409_100694547 | 3300031995 | Bacteria | 1016 |
| 530 | Ga0307409_100937441 | 3300031995 | Bacteria | 881 |
| 531 | Ga0307409_100994784 | 3300031995 | Bacteria | 856 |
| 532 | Ga0307416_100000378 | 3300032002 | Bacteria | 23099 |
| 533 | Ga0307416_100000758 | 3300032002 | Bacteria | 16898 |
| 534 | Ga0307416_100011031 | 3300032002 | Bacteria | 6003 |
| 535 | Ga0307416_100014401 | 3300032002 | Bacteria | 5419 |
| 536 | Ga0307416_100052696 | 3300032002 | Unclassified | 3259 |
| 537 | Ga0307416_100074200 | 3300032002 | Bacteria | 2840 |
| 538 | Ga0307416_100079832 | 3300032002 | Bacteria | 2759 |
| 539 | Ga0307416_100751757 | 3300032002 | Bacteria | 1068 |
| 540 | Ga0307416_100759471 | 3300032002 | Bacteria | 1063 |
| 541 | Ga0307414_10053192 | 3300032004 | Bacteria | 2823 |
| 542 | Ga0307414_10064513 | 3300032004 | Bacteria | 2608 |
| 543 | Ga0307414_10142132 | 3300032004 | Bacteria | 1880 |
| 544 | Ga0307411_10007405 | 3300032005 | Bacteria | 5589 |
| 545 | Ga0307411_10010727 | 3300032005 | Bacteria | 4901 |
| 546 | Ga0307411_10020620 | 3300032005 | Bacteria | 3838 |
| 547 | Ga0307411_10022178 | 3300032005 | Bacteria | 3733 |
| 548 | Ga0307411_10030110 | 3300032005 | Bacteria | 3323 |
| 549 | Ga0307411_10042248 | 3300032005 | Bacteria | 2907 |
| 550 | Ga0307411_10092489 | 3300032005 | Bacteria | 2115 |
| 551 | Ga0307415_100000254 | 3300032126 | Bacteria | 23073 |
| 552 | Ga0307415_100029860 | 3300032126 | Bacteria | 3490 |
| 553 | Ga0307415_100074789 | 3300032126 | Bacteria | 2395 |
| 554 | Ga0307415_100122385 | 3300032126 | Bacteria | 1954 |
| 555 | Ga0307415_100200103 | 3300032126 | Bacteria | 1584 |
| 556 | Ga0307415_100269237 | 3300032126 | Bacteria | 1395 |
| 557 | Ga0307415_100303158 | 3300032126 | Bacteria | 1324 |
| 558 | Ga0373932_0093343 | 3300035112 | Unclassified | 969 |
| 559 | Ga0373932_0100489 | 3300035112 | Bacteria | 940 |
| 560 | Ga0373939_0012513 | 3300035114 | Bacteria | 2165 |
| 561 | Ga0373939_0029267 | 3300035114 | Bacteria | 1574 |
| 562 | Ga0373945_0096275 | 3300035116 | Bacteria | 1153 |
| 563 | Ga0373956_0169256 | 3300035119 | Unclassified | 1031 |
| 564 | Ga0373943_0019270 | 3300035170 | Bacteria | 3137 |
| 565 | Ga0373946_0035499 | 3300035171 | Bacteria | 2018 |
| 566 | Ga0373946_0091313 | 3300035171 | Bacteria | 1350 |
| 567 | Ga0373942_0038413 | 3300035207 | Bacteria | 1298 |
| 568 | Ga0373961_0065073 | 3300035241 | Bacteria | 1116 |
| 569 | Ga0373931_0001299 | 3300035691 | Bacteria | 10687 |
| 570 | Ga0373931_0173642 | 3300035691 | Bacteria | 1272 |
| 571 | Ga0373931_0267744 | 3300035691 | Bacteria | 1045 |
| 572 | Ga0373935_0042903 | 3300035692 | Bacteria | 2845 |
| 573 | Ga0373927_0023785 | 3300035695 | Bacteria | 4010 |
| 574 | Ga0373947_0038852 | 3300035725 | Bacteria | 2830 |
| 575 | Ga0373937_0067255 | 3300036401 | Bacteria | 3301 |
| 576 | Ga0373937_0429654 | 3300036401 | Bacteria | 1254 |
| 577 | Ga0373937_0661370 | 3300036401 | Bacteria | 990 |
| 578 | Ga0316582_0471911 | 3300036647 | Bacteria | 865 |
| 579 | Ga0316584_0110326 | 3300036712 | Bacteria | 2059 |
| 580 | Ga0373925_0047910 | 3300037068 | Bacteria | 3183 |
| 581 | Ga0436360_1116795 | 3300039438 | Bacteria | 1180 |
| 582 | Ga0439439_0023783 | 3300041406 | Bacteria | 1536 |
| 583 | Ga0439439_0192220 | 3300041406 | Unclassified | 591 |
| 584 | Ga0439453_0034329 | 3300041408 | Bacteria | 973 |
| 585 | Ga0439461_0081065 | 3300041410 | Bacteria | 766 |
| 586 | Ga0439431_0049208 | 3300041997 | Bacteria | 1090 |
| 587 | Ga0439433_0077417 | 3300041999 | Bacteria | 806 |
| 588 | Ga0439441_083062 | 3300042001 | Unclassified | 700 |
| 589 | Ga0439442_147690 | 3300042002 | Unclassified | 522 |
| 590 | Ga0439443_016264 | 3300042003 | Bacteria | 1135 |
| 591 | Ga0439448_0184730 | 3300042005 | Bacteria | 729 |
| 592 | Ga0439454_007832 | 3300042011 | Bacteria | 1349 |
| 593 | Ga0439462_0003337 | 3300042015 | Bacteria | 3842 |
| 594 | Ga0450923_003245 | 3300042125 | Bacteria | 2433 |
| 595 | Ga0450891_023604 | 3300042129 | Bacteria | 614 |
| 596 | Ga0450896_077762 | 3300042133 | Bacteria | 556 |
| 597 | Ga0450898_006247 | 3300042134 | Bacteria | 1823 |
| 598 | Ga0450905_019519 | 3300042142 | Bacteria | 993 |
| 599 | Ga0450910_008626 | 3300042147 | Bacteria | 1436 |
| 600 | Ga0439434_0057043 | 3300042435 | Bacteria | 1217 |
| 601 | Ga0439434_0097721 | 3300042435 | Bacteria | 944 |
| 602 | Ga0439434_0103774 | 3300042435 | Bacteria | 917 |
| 603 | Ga0439444_0011142 | 3300042437 | Bacteria | 1451 |
| 604 | Ga0439464_0128685 | 3300042439 | Bacteria | 783 |
| 605 | Ga0439460_0112844 | 3300042461 | Bacteria | 883 |
| 606 | Ga0450893_0044148 | 3300042532 | Bacteria | 823 |
| 607 | Ga0451577_0016505 | 3300042876 | Bacteria | 6837 |
| 608 | Ga0451577_0081476 | 3300042876 | Bacteria | 2887 |
| 609 | Ga0451577_0261353 | 3300042876 | Bacteria | 1567 |
| 610 | Ga0451577_0307972 | 3300042876 | Bacteria | 1435 |
| 611 | Ga0451577_0846090 | 3300042876 | Bacteria | 825 |
| 612 | Ga0451577_1096895 | 3300042876 | Bacteria | 712 |
| 613 | Ga0453683_0018303 | 3300044673 | Bacteria | 4498 |
| 614 | Ga0453683_0060110 | 3300044673 | Bacteria | 2376 |
| 615 | Ga0453683_0583025 | 3300044673 | Unclassified | 729 |
| 616 | Ga0453684_0325694 | 3300044712 | Bacteria | 1739 |
| 617 | Ga0453684_0870358 | 3300044712 | Bacteria | 967 |
| 618 | Ga0453684_0924218 | 3300044712 | Unclassified | 933 |
| 619 | Ga0453684_2516927 | 3300044712 | Bacteria | 507 |
| 620 | Ga0451576_0076699 | 3300045051 | Bacteria | 3478 |
| 621 | Ga0451576_0385362 | 3300045051 | Bacteria | 1469 |
| 622 | Ga0451576_0674026 | 3300045051 | Bacteria | 1086 |
| 623 | Ga0451576_0804217 | 3300045051 | Bacteria | 987 |
| 624 | Ga0451576_1199877 | 3300045051 | Bacteria | 792 |
| 625 | Ga0495603_0071247 | 3300046455 | Bacteria | 2043 |
| 626 | Ga0495641_0128048 | 3300046461 | Unclassified | 1133 |
| 627 | Ga0495662_0043530 | 3300046476 | Bacteria | 2167 |
| 628 | Ga0495594_0058338 | 3300046499 | Bacteria | 2132 |
| 629 | Ga0495594_0075334 | 3300046499 | Bacteria | 1881 |
| 630 | Ga0495618_0007472 | 3300046514 | Bacteria | 6611 |
| 631 | Ga0495630_0008925 | 3300046517 | Bacteria | 7196 |
| 632 | Ga0495666_0004554 | 3300046526 | Bacteria | 7004 |
| 633 | Ga0495640_0121324 | 3300046533 | Bacteria | 1699 |
| 634 | Ga0495586_0030773 | 3300046535 | Bacteria | 2872 |
| 635 | Ga0495598_0049625 | 3300046537 | Bacteria | 1259 |
| 636 | Ga0495622_0137497 | 3300046557 | Bacteria | 1110 |
| 637 | Ga0495667_0084273 | 3300046559 | Bacteria | 2064 |
| 638 | Ga0495656_0773534 | 3300046615 | Bacteria | 518 |
| 639 | Ga0495634_0003518 | 3300046642 | Bacteria | 12547 |
| 640 | Ga0495659_0012816 | 3300046664 | Unclassified | 2722 |
| 641 | Ga0495657_0288249 | 3300046675 | Bacteria | 981 |
| 642 | Ga0495647_0014592 | 3300046681 | Bacteria | 2739 |
| 643 | Ga0495658_0177567 | 3300046683 | Unclassified | 1320 |
| 644 | Ga0495658_0436905 | 3300046683 | Bacteria | 836 |
| 645 | Ga0495624_0090871 | 3300046690 | Bacteria | 1884 |
| 646 | Ga0495670_0478960 | 3300046691 | Bacteria | 675 |
| 647 | Ga0495670_0694121 | 3300046691 | Unclassified | 555 |
| 648 | Ga0495636_0154105 | 3300047318 | Bacteria | 1032 |
| 649 | Ga0495674_0030082 | 3300047319 | Bacteria | 4941 |
| 650 | Ga0495676_0117719 | 3300047321 | Bacteria | 1938 |
| 651 | Ga0495676_0412417 | 3300047321 | Bacteria | 895 |
| 652 | Ga0495680_0009004 | 3300047322 | Bacteria | 9018 |
| 653 | Ga0496100_0066711 | 3300048903 | Bacteria | 2388 |
| 654 | Ga0496100_0656710 | 3300048903 | Bacteria | 817 |
| 655 | Ga0496101_0013792 | 3300048904 | Bacteria | 5423 |
| 656 | Ga0496101_0304744 | 3300048904 | Bacteria | 1248 |
| 657 | Ga0496102_0152205 | 3300048905 | Bacteria | 2174 |
| 658 | Ga0496102_1592940 | 3300048905 | Bacteria | 571 |
| 659 | Ga0496103_0144264 | 3300048906 | Bacteria | 1524 |
| 660 | Ga0496103_0548129 | 3300048906 | Unclassified | 738 |
| 661 | Ga0496105_0526059 | 3300048908 | Bacteria | 926 |
| 662 | Ga0496106_0081204 | 3300048909 | Bacteria | 2491 |
| 663 | Ga0496106_0095035 | 3300048909 | Bacteria | 2305 |
| 664 | Ga0496106_0111191 | 3300048909 | Bacteria | 2133 |
| 665 | Ga0496107_0106188 | 3300048910 | Bacteria | 2062 |
| 666 | Ga0496107_0362713 | 3300048910 | Bacteria | 1078 |
| 667 | Ga0496108_0155741 | 3300048911 | Bacteria | 1973 |
| 668 | Ga0496109_0090192 | 3300048912 | Bacteria | 2835 |
| 669 | Ga0496110_0443938 | 3300048913 | Bacteria | 1182 |
| 670 | Ga0496111_0327795 | 3300048914 | Bacteria | 1134 |
| 671 | Ga0496112_0002371 | 3300048915 | Bacteria | 15137 |
| 672 | Ga0496112_0990775 | 3300048915 | Bacteria | 760 |
| 673 | Ga0496113_0083955 | 3300048916 | Bacteria | 2445 |
| 674 | Ga0496114_1197794 | 3300048917 | Unclassified | 645 |
| 675 | Ga0501298_001964 | 3300049521 | Bacteria | 3070 |
| 676 | Ga0501299_004376 | 3300049522 | Bacteria | 2106 |
| 677 | Ga0501299_156400 | 3300049522 | Unclassified | 579 |
| 678 | Ga0501301_037965 | 3300049524 | Unclassified | 536 |
| 679 | Ga0501031_0007782 | 3300049568 | Bacteria | 6973 |
| 680 | Ga0501032_0189213 | 3300049569 | Bacteria | 1345 |
| 681 | Ga0501033_0021886 | 3300049570 | Bacteria | 4824 |
| 682 | Ga0501034_0014428 | 3300049571 | Bacteria | 8135 |
| 683 | Ga0501034_0634108 | 3300049571 | Bacteria | 972 |
| 684 | Ga0501036_0074631 | 3300049572 | Bacteria | 2868 |
| 685 | Ga0501036_0835674 | 3300049572 | Bacteria | 757 |
| 686 | Ga0501036_0992464 | 3300049572 | Unclassified | 687 |
| 687 | Ga0501037_0015475 | 3300049573 | Bacteria | 5614 |
| 688 | Ga0501038_0040779 | 3300049574 | Bacteria | 4050 |
| 689 | Ga0501039_0017431 | 3300049575 | Bacteria | 5508 |
| 690 | Ga0501039_0332457 | 3300049575 | Unclassified | 1194 |
| 691 | Ga0501040_0022977 | 3300049576 | Bacteria | 4178 |
| 692 | Ga0501041_0004538 | 3300049577 | Bacteria | 8054 |
| 693 | Ga0501042_0235411 | 3300049578 | Bacteria | 1321 |
| 694 | Ga0501042_0472046 | 3300049578 | Bacteria | 910 |
| 695 | Ga0501043_0006165 | 3300049579 | Bacteria | 9631 |
| 696 | Ga0501046_0008905 | 3300049580 | Bacteria | 8711 |
| 697 | Ga0501046_0117006 | 3300049580 | Bacteria | 2031 |
| 698 | Ga0501046_0219098 | 3300049580 | Bacteria | 1410 |
| 699 | Ga0501047_0158985 | 3300049581 | Bacteria | 2132 |
| 700 | Ga0501047_0877196 | 3300049581 | Bacteria | 711 |
| 701 | Ga0501048_0107814 | 3300049582 | Bacteria | 1966 |
| 702 | Ga0501067_0528374 | 3300049583 | Unclassified | 660 |
| 703 | Ga0501068_0015939 | 3300049584 | Bacteria | 4328 |
| 704 | Ga0501068_0468996 | 3300049584 | Bacteria | 815 |
| 705 | Ga0501068_0470400 | 3300049584 | Bacteria | 814 |
| 706 | Ga0501069_0006048 | 3300049585 | Bacteria | 6319 |
| 707 | Ga0501069_0142288 | 3300049585 | Bacteria | 1376 |
| 708 | Ga0501069_0150444 | 3300049585 | Bacteria | 1337 |
| 709 | Ga0501070_0047845 | 3300049586 | Bacteria | 3553 |
| 710 | Ga0501071_0101413 | 3300049587 | Bacteria | 2122 |
| 711 | Ga0501071_0383700 | 3300049587 | Bacteria | 1072 |
| 712 | Ga0501071_0462426 | 3300049587 | Bacteria | 971 |
| 713 | Ga0501071_0559495 | 3300049587 | Unclassified | 879 |
| 714 | Ga0501071_0603719 | 3300049587 | Bacteria | 844 |
| 715 | Ga0501072_0078507 | 3300049588 | Bacteria | 2614 |
| 716 | Ga0501072_0312988 | 3300049588 | Bacteria | 1248 |
| 717 | Ga0501072_0363037 | 3300049588 | Bacteria | 1149 |
| 718 | Ga0501072_0737584 | 3300049588 | Bacteria | 773 |
| 719 | Ga0501072_0845060 | 3300049588 | Bacteria | 716 |
| 720 | Ga0501073_0005350 | 3300049589 | Bacteria | 9624 |
| 721 | Ga0501073_0287988 | 3300049589 | Bacteria | 1133 |
| 722 | Ga0501073_0963113 | 3300049589 | Bacteria | 587 |
| 723 | Ga0501074_0001217 | 3300049590 | Bacteria | 16960 |
| 724 | Ga0501074_0089317 | 3300049590 | Bacteria | 2207 |
| 725 | Ga0501074_0699814 | 3300049590 | Bacteria | 715 |
| 726 | Ga0501075_0000770 | 3300049591 | Bacteria | 19987 |
| 727 | Ga0501075_0017837 | 3300049591 | Bacteria | 5127 |
| 728 | Ga0501075_0079990 | 3300049591 | Bacteria | 2474 |
| 729 | Ga0501076_0003602 | 3300049592 | Bacteria | 10882 |
| 730 | Ga0501076_0679693 | 3300049592 | Bacteria | 850 |
| 731 | Ga0501077_0013963 | 3300049593 | Bacteria | 5037 |
| 732 | Ga0501077_0060619 | 3300049593 | Bacteria | 2401 |
| 733 | Ga0501077_0103817 | 3300049593 | Bacteria | 1801 |
| 734 | Ga0501077_0150159 | 3300049593 | Bacteria | 1478 |
| 735 | Ga0501077_0907608 | 3300049593 | Bacteria | 567 |
| 736 | Ga0501217_134230 | 3300049661 | Bacteria | 728 |
| 737 | Ga0501233_009923 | 3300049668 | Bacteria | 1866 |
| 738 | Ga0501235_012869 | 3300049669 | Bacteria | 1842 |
| 739 | Ga0501243_038621 | 3300049675 | Bacteria | 833 |
| 740 | Ga0501261_042851 | 3300049690 | Bacteria | 719 |
| 741 | Ga0501225_0003685 | 3300049705 | Bacteria | 4611 |
| 742 | Ga0501225_0020204 | 3300049705 | Bacteria | 1841 |
| 743 | Ga0501229_063340 | 3300049706 | Unclassified | 567 |
| 744 | Ga0501079_0085949 | 3300049741 | Bacteria | 2434 |
| 745 | Ga0501079_0161057 | 3300049741 | Bacteria | 1750 |
| 746 | Ga0501079_0381241 | 3300049741 | Bacteria | 1105 |
| 747 | Ga0501079_0885231 | 3300049741 | Bacteria | 703 |
| 748 | Ga0501080_0033059 | 3300049742 | Bacteria | 4826 |
| 749 | Ga0501080_0040338 | 3300049742 | Bacteria | 4354 |
| 750 | Ga0501080_1146223 | 3300049742 | Bacteria | 670 |
| 751 | Ga0501081_0004872 | 3300049743 | Bacteria | 8628 |
| 752 | Ga0501081_0082924 | 3300049743 | Bacteria | 2246 |
| 753 | Ga0501081_0128408 | 3300049743 | Bacteria | 1810 |
| 754 | Ga0501081_0472498 | 3300049743 | Bacteria | 933 |
| 755 | Ga0501081_0976298 | 3300049743 | Bacteria | 640 |
| 756 | Ga0501083_0012410 | 3300049744 | Bacteria | 5963 |
| 757 | Ga0501083_0281463 | 3300049744 | Bacteria | 1082 |
| 758 | Ga0501262_003301 | 3300049759 | Bacteria | 1843 |
| 759 | Ga0501270_027755 | 3300049767 | Bacteria | 913 |
| 760 | Ga0501283_117577 | 3300049779 | Unclassified | 530 |
| 761 | Ga0501035_0007245 | 3300049822 | Bacteria | 10379 |
| 762 | Ga0501045_0045679 | 3300049824 | Bacteria | 3188 |
| 763 | Ga0501045_0082381 | 3300049824 | Bacteria | 2373 |
| 764 | Ga0501045_0522748 | 3300049824 | Unclassified | 881 |
| 765 | Ga0501045_0805274 | 3300049824 | Bacteria | 692 |
| 766 | Ga0501045_0960141 | 3300049824 | Unclassified | 627 |
| 767 | Ga0501204_005837 | 3300049850 | Bacteria | 1357 |
| 768 | Ga0501212_099093 | 3300049851 | Unclassified | 546 |
| 769 | nmdc:mga05p37_134390_c1 | 3300050507 | Bacteria | 3035 |
| 770 | nmdc:mga05p37_16050_c1 | 3300050507 | Bacteria | 9013 |
| 771 | nmdc:mga05p37_183465_c1 | 3300050507 | Bacteria | 2545 |
| 772 | nmdc:mga05p37_26567_c1 | 3300050507 | Bacteria | 7040 |
| 773 | nmdc:mga05p37_281151_c1 | 3300050507 | Bacteria | 1985 |
| 774 | nmdc:mga05p37_455420_c1 | 3300050507 | Bacteria | 1480 |
| 775 | nmdc:mga05p37_983103_c1 | 3300050507 | Bacteria | 899 |
| 776 | nmdc:mga09592_1026488_c1 | 3300050508 | Bacteria | 688 |
| 777 | nmdc:mga09592_11119_c1 | 3300050508 | Bacteria | 7321 |
| 778 | nmdc:mga09592_1120906_c1 | 3300050508 | Bacteria | 653 |
| 779 | nmdc:mga09592_17899_c1 | 3300050508 | Bacteria | 5805 |
| 780 | nmdc:mga09592_254973_c1 | 3300050508 | Bacteria | 1521 |
| 781 | nmdc:mga09592_30957_c1 | 3300050508 | Bacteria | 4456 |
| 782 | nmdc:mga09592_377264_c1 | 3300050508 | Bacteria | 1226 |
| 783 | nmdc:mga09592_67249_c1 | 3300050508 | Bacteria | 3038 |
| 784 | nmdc:mga09592_705441_c1 | 3300050508 | Bacteria | 858 |
| 785 | nmdc:mga0qj67_10983_c1 | 3300050509 | Bacteria | 6778 |
| 786 | nmdc:mga0qj67_1545785_c1 | 3300050509 | Bacteria | 510 |
| 787 | nmdc:mga0qj67_211737_c1 | 3300050509 | Bacteria | 1574 |
| 788 | nmdc:mga0qj67_26559_c1 | 3300050509 | Bacteria | 4481 |
| 789 | nmdc:mga0qj67_37596_c1 | 3300050509 | Bacteria | 3793 |
| 790 | nmdc:mga0qj67_596887_c1 | 3300050509 | Bacteria | 883 |
| 791 | nmdc:mga0qj67_829456_c1 | 3300050509 | Bacteria | 731 |
| 792 | nmdc:mga06r32_18791_c1 | 3300050510 | Bacteria | 6333 |
| 793 | nmdc:mga06r32_21962_c1 | 3300050510 | Bacteria | 5893 |
| 794 | nmdc:mga06r32_2808_c1 | 3300050510 | Bacteria | 15600 |
| 795 | nmdc:mga06r32_640155_c1 | 3300050510 | Bacteria | 1032 |
| 796 | nmdc:mga08y16_20164_c1 | 3300050511 | Bacteria | 7036 |
| 797 | nmdc:mga08y16_219566_c1 | 3300050511 | Bacteria | 1968 |
| 798 | nmdc:mga08y16_277460_c1 | 3300050511 | Bacteria | 1729 |
| 799 | nmdc:mga08y16_834158_c1 | 3300050511 | Bacteria | 912 |
| 800 | nmdc:mga0n895_128487_c1 | 3300050512 | Bacteria | 2559 |
| 801 | nmdc:mga0n895_282560_c1 | 3300050512 | Bacteria | 1683 |
| 802 | nmdc:mga0n895_39550_c1 | 3300050512 | Bacteria | 4576 |
| 803 | nmdc:mga0n895_507972_c1 | 3300050512 | Bacteria | 1214 |
| 804 | nmdc:mga0n895_91896_c1 | 3300050512 | Bacteria | 3038 |
| 805 | nmdc:mga0n895_93500_c1 | 3300050512 | Bacteria | 3010 |
| 806 | nmdc:mga0n895_96830_c1 | 3300050512 | Bacteria | 2956 |
| 807 | nmdc:mga0rr50_197921_c1 | 3300050513 | Bacteria | 1650 |
| 808 | nmdc:mga0rr50_261726_c1 | 3300050513 | Bacteria | 1439 |
| 809 | nmdc:mga0rr50_28277_c1 | 3300050513 | Bacteria | 3939 |
| 810 | nmdc:mga0rr50_346454_c1 | 3300050513 | Bacteria | 1249 |
| 811 | nmdc:mga0rr50_68051_c1 | 3300050513 | Bacteria | 2707 |
| 812 | nmdc:mga08x19_24722_c1 | 3300050514 | Bacteria | 3403 |
| 813 | nmdc:mga08x19_478126_c1 | 3300050514 | Bacteria | 878 |
| 814 | nmdc:mga08x19_604651_c1 | 3300050514 | Bacteria | 777 |
| 815 | nmdc:mga08x19_72739_c1 | 3300050514 | Bacteria | 2243 |
| 816 | nmdc:mga08x19_73276_c1 | 3300050514 | Bacteria | 2235 |
| 817 | nmdc:mga0a205_1486_c1 | 3300050515 | Bacteria | 19984 |
| 818 | nmdc:mga0a205_148876_c1 | 3300050515 | Bacteria | 2241 |
| 819 | nmdc:mga0a205_259485_c1 | 3300050515 | Bacteria | 1616 |
| 820 | nmdc:mga0a205_627500_c1 | 3300050515 | Bacteria | 927 |
| 821 | nmdc:mga0a205_937446_c1 | 3300050515 | Bacteria | 713 |
| 822 | Ga0501084_0009832 | 3300054114 | Bacteria | 7902 |
| 823 | Ga0501084_0077570 | 3300054114 | Bacteria | 2785 |
| 824 | Ga0501084_0338753 | 3300054114 | Bacteria | 1270 |
| 825 | Ga0501084_0397067 | 3300054114 | Bacteria | 1165 |
| 826 | Ga0501084_0495337 | 3300054114 | Bacteria | 1033 |
| 827 | Ga0590071_009305 | 3300059421 | Bacteria | 2306 |
| 828 | Ga0590074_014529 | 3300059423 | Bacteria | 1333 |
| 829 | Ga0590074_035047 | 3300059423 | Bacteria | 894 |
| 830 | Ga0590075_003441 | 3300059424 | Bacteria | 3763 |
| 831 | Ga0590077_007598 | 3300059426 | Bacteria | 2216 |
| 832 | Ga0590077_019238 | 3300059426 | Bacteria | 1445 |
| 833 | Ga0590077_063834 | 3300059426 | Unclassified | 837 |
| 834 | Ga0501082_0032225 | 3300060353 | Bacteria | 4519 |
| 835 | Ga0501082_0076961 | 3300060353 | Bacteria | 2876 |
| 836 | Ga0530510_0042012 | 3300061734 | Bacteria | 3302 |
| 837 | Ga0530510_0091974 | 3300061734 | Bacteria | 2213 |
| 838 | Ga0530510_0333066 | 3300061734 | Bacteria | 1139 |
| 839 | Ga0530510_0646154 | 3300061734 | Bacteria | 805 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_1197794 | Ga0496114_1197794_13_390 | 123 |
| 2 | 3300041408 | Ga0439453_0034329 | Ga0439453_0034329_552_932 | 124 |
| 3 | 3300042002 | Ga0439442_147690 | Ga0439442_147690_16_396 | 124 |
| 4 | 3300044712 | Ga0453684_2516927 | Ga0453684_2516927_89_463 | 124 |
| 5 | 3300048903 | Ga0496100_0656710 | Ga0496100_0656710_428_802 | 124 |
| 6 | 3300048904 | Ga0496101_0304744 | Ga0496101_0304744_823_1197 | 124 |
| 7 | 3300006880 | Ga0075429_100004888 | Ga0075429_10000488816 | 125 |
| 8 | 3300050508 | nmdc:mga09592_17899_c1 | nmdc:mga09592_17899_c1_2042_2443 | 125 |
| 9 | 3300047321 | Ga0495676_0412417 | Ga0495676_0412417_467_847 | 126 |
| 10 | 3300049572 | Ga0501036_0992464 | Ga0501036_0992464_37_417 | 126 |
| 11 | 3300049851 | Ga0501212_099093 | Ga0501212_099093_138_521 | 126 |
| 12 | 3300050507 | nmdc:mga05p37_281151_c1 | nmdc:mga05p37_281151_c1_1575_1961 | 126 |
| 13 | 3300050515 | nmdc:mga0a205_937446_c1 | nmdc:mga0a205_937446_c1_58_444 | 126 |
| 14 | 3300028558 | Ga0265326_10001074 | Ga0265326_100010744 | 137 |
| 15 | 3300028563 | Ga0265319_1000169 | Ga0265319_100016930 | 137 |
| 16 | 3300028573 | Ga0265334_10055984 | Ga0265334_100559843 | 137 |
| 17 | 3300028577 | Ga0265318_10071416 | Ga0265318_100714162 | 137 |
| 18 | 3300028653 | Ga0265323_10000218 | Ga0265323_1000021819 | 137 |
| 19 | 3300028654 | Ga0265322_10000549 | Ga0265322_100005499 | 137 |
| 20 | 3300028800 | Ga0265338_10005708 | Ga0265338_1000570811 | 137 |
| 21 | 3300029957 | Ga0265324_10001167 | Ga0265324_1000116710 | 137 |
| 22 | 3300031235 | Ga0265330_10000319 | Ga0265330_1000031924 | 137 |
| 23 | 3300031238 | Ga0265332_10000382 | Ga0265332_1000038213 | 137 |
| 24 | 3300031239 | Ga0265328_10000950 | Ga0265328_1000095019 | 137 |
| 25 | 3300031240 | Ga0265320_10002083 | Ga0265320_1000208317 | 137 |
| 26 | 3300031242 | Ga0265329_10000073 | Ga0265329_1000007310 | 137 |
| 27 | 3300031247 | Ga0265340_10029476 | Ga0265340_100294764 | 137 |
| 28 | 3300031249 | Ga0265339_10000297 | Ga0265339_100002979 | 137 |
| 29 | 3300031250 | Ga0265331_10000963 | Ga0265331_1000096322 | 137 |
| 30 | 3300031251 | Ga0265327_10216109 | Ga0265327_102161092 | 137 |
| 31 | 3300031344 | Ga0265316_10000247 | Ga0265316_1000024724 | 137 |
| 32 | 3300031595 | Ga0265313_10251667 | Ga0265313_102516672 | 137 |
| 33 | 3300031711 | Ga0265314_10000285 | Ga0265314_1000028540 | 137 |
| 34 | 3300031712 | Ga0265342_10000764 | Ga0265342_1000076423 | 137 |
| 35 | 3300006880 | Ga0075429_100129218 | Ga0075429_1001292182 | 138 |
| 36 | 3300028556 | Ga0265337_1001252 | Ga0265337_10012528 | 138 |
| 37 | 3300028558 | Ga0265326_10003863 | Ga0265326_100038635 | 138 |
| 38 | 3300028563 | Ga0265319_1000100 | Ga0265319_100010033 | 138 |
| 39 | 3300028573 | Ga0265334_10001411 | Ga0265334_100014118 | 138 |
| 40 | 3300028577 | Ga0265318_10000883 | Ga0265318_100008832 | 138 |
| 41 | 3300028666 | Ga0265336_10000115 | Ga0265336_1000011534 | 138 |
| 42 | 3300028800 | Ga0265338_10005397 | Ga0265338_100053979 | 138 |
| 43 | 3300029957 | Ga0265324_10005143 | Ga0265324_100051434 | 138 |
| 44 | 3300031240 | Ga0265320_10002134 | Ga0265320_100021345 | 138 |
| 45 | 3300031241 | Ga0265325_10004251 | Ga0265325_100042519 | 138 |
| 46 | 3300031344 | Ga0265316_10005834 | Ga0265316_1000583410 | 138 |
| 47 | 3300031595 | Ga0265313_10000580 | Ga0265313_1000058036 | 138 |
| 48 | 3300031711 | Ga0265314_10320154 | Ga0265314_103201542 | 138 |
| 49 | 3300031712 | Ga0265342_10026274 | Ga0265342_100262743 | 138 |
| 50 | 3300050508 | nmdc:mga09592_377264_c1 | nmdc:mga09592_377264_c1_775_1194 | 138 |
| 51 | 3300005543 | Ga0070672_100865089 | Ga0070672_1008650892 | 139 |
| 52 | 3300006847 | Ga0075431_100744797 | Ga0075431_1007447972 | 139 |
| 53 | 3300014968 | Ga0157379_10061166 | Ga0157379_100611662 | 139 |
| 54 | 3300028800 | Ga0265338_10005519 | Ga0265338_1000551912 | 139 |
| 55 | 3300028800 | Ga0265338_10884010 | Ga0265338_108840101 | 139 |
| 56 | 3300029957 | Ga0265324_10005863 | Ga0265324_100058635 | 139 |
| 57 | 3300031240 | Ga0265320_10154121 | Ga0265320_101541213 | 139 |
| 58 | 3300031344 | Ga0265316_10427338 | Ga0265316_104273382 | 139 |
| 59 | 3300031711 | Ga0265314_10139006 | Ga0265314_101390062 | 139 |
| 60 | 3300036401 | Ga0373937_0429654 | Ga0373937_0429654_276_701 | 139 |
| 61 | 3300046461 | Ga0495641_0128048 | Ga0495641_0128048_684_1109 | 139 |
| 62 | 3300046476 | Ga0495662_0043530 | Ga0495662_0043530_1473_1898 | 139 |
| 63 | 3300046499 | Ga0495594_0058338 | Ga0495594_0058338_1442_1867 | 139 |
| 64 | 3300046514 | Ga0495618_0007472 | Ga0495618_0007472_2268_2693 | 139 |
| 65 | 3300046517 | Ga0495630_0008925 | Ga0495630_0008925_5221_5646 | 139 |
| 66 | 3300046526 | Ga0495666_0004554 | Ga0495666_0004554_3353_3778 | 139 |
| 67 | 3300046533 | Ga0495640_0121324 | Ga0495640_0121324_1025_1450 | 139 |
| 68 | 3300046535 | Ga0495586_0030773 | Ga0495586_0030773_1879_2304 | 139 |
| 69 | 3300046557 | Ga0495622_0137497 | Ga0495622_0137497_530_955 | 139 |
| 70 | 3300046559 | Ga0495667_0084273 | Ga0495667_0084273_221_646 | 139 |
| 71 | 3300046642 | Ga0495634_0003518 | Ga0495634_0003518_9228_9653 | 139 |
| 72 | 3300046681 | Ga0495647_0014592 | Ga0495647_0014592_409_834 | 139 |
| 73 | 3300046683 | Ga0495658_0177567 | Ga0495658_0177567_83_508 | 139 |
| 74 | 3300046690 | Ga0495624_0090871 | Ga0495624_0090871_602_1027 | 139 |
| 75 | 3300047319 | Ga0495674_0030082 | Ga0495674_0030082_2602_3027 | 139 |
| 76 | 3300047321 | Ga0495676_0117719 | Ga0495676_0117719_1246_1671 | 139 |
| 77 | 3300047322 | Ga0495680_0009004 | Ga0495680_0009004_8064_8489 | 139 |
| 78 | 3300049571 | Ga0501034_0634108 | Ga0501034_0634108_28_447 | 139 |
| 79 | 3300006844 | Ga0075428_100042612 | Ga0075428_1000426123 | 140 |
| 80 | 3300009147 | Ga0114129_10071105 | Ga0114129_100711055 | 140 |
| 81 | 3300025922 | Ga0207646_10942616 | Ga0207646_109426162 | 140 |
| 82 | 3300027695 | Ga0209966_1003451 | Ga0209966_10034513 | 140 |
| 83 | 3300031548 | Ga0307408_100567973 | Ga0307408_1005679732 | 140 |
| 84 | 3300031901 | Ga0307406_10018816 | Ga0307406_100188161 | 140 |
| 85 | 3300032002 | Ga0307416_100079832 | Ga0307416_1000798321 | 140 |
| 86 | 3300041406 | Ga0439439_0192220 | Ga0439439_0192220_57_482 | 140 |
| 87 | 3300049578 | Ga0501042_0472046 | Ga0501042_0472046_216_644 | 140 |
| 88 | 3300049824 | Ga0501045_0522748 | Ga0501045_0522748_185_610 | 140 |
| 89 | 3300050508 | nmdc:mga09592_30957_c1 | nmdc:mga09592_30957_c1_1220_1645 | 140 |
| 90 | 3300006846 | Ga0075430_100834246 | Ga0075430_1008342462 | 141 |
| 91 | 3300006914 | Ga0075436_100461344 | Ga0075436_1004613441 | 141 |
| 92 | 3300026116 | Ga0207674_10831067 | Ga0207674_108310671 | 141 |
| 93 | 3300036401 | Ga0373937_0661370 | Ga0373937_0661370_498_923 | 141 |
| 94 | 3300042876 | Ga0451577_0081476 | Ga0451577_0081476_1464_1895 | 141 |
| 95 | 3300044673 | Ga0453683_0583025 | Ga0453683_0583025_74_505 | 141 |
| 96 | 3300045051 | Ga0451576_0385362 | Ga0451576_0385362_232_663 | 141 |
| 97 | 3300046675 | Ga0495657_0288249 | Ga0495657_0288249_278_703 | 141 |
| 98 | 3300049588 | Ga0501072_0845060 | Ga0501072_0845060_42_473 | 141 |
| 99 | 3300049589 | Ga0501073_0287988 | Ga0501073_0287988_87_518 | 141 |
| 100 | 3300049593 | Ga0501077_0060619 | Ga0501077_0060619_577_1008 | 141 |
| 101 | 3300049744 | Ga0501083_0281463 | Ga0501083_0281463_343_774 | 141 |
| 102 | 3300050513 | nmdc:mga0rr50_261726_c1 | nmdc:mga0rr50_261726_c1_317_754 | 141 |
| 103 | 3300054114 | Ga0501084_0397067 | Ga0501084_0397067_132_563 | 141 |
| 104 | 3300047318 | Ga0495636_0154105 | Ga0495636_0154105_444_890 | 142 |
| 105 | 3300005471 | Ga0070698_100005938 | Ga0070698_10000593811 | 143 |
| 106 | 3300005518 | Ga0070699_100280178 | Ga0070699_1002801782 | 143 |
| 107 | 3300006871 | Ga0075434_100041175 | Ga0075434_1000411753 | 143 |
| 108 | 3300050512 | nmdc:mga0n895_39550_c1 | nmdc:mga0n895_39550_c1_2232_2675 | 143 |
| 109 | 3300028800 | Ga0265338_10016656 | Ga0265338_100166564 | 144 |
| 110 | 3300031247 | Ga0265340_10130870 | Ga0265340_101308702 | 144 |
| 111 | 3300046615 | Ga0495656_0773534 | Ga0495656_0773534_38_481 | 144 |
| 112 | 3300059423 | Ga0590074_014529 | Ga0590074_014529_185_625 | 144 |
| 113 | 3300005295 | Ga0065707_11127062 | Ga0065707_111270621 | 145 |
| 114 | 3300005444 | Ga0070694_101908655 | Ga0070694_1019086551 | 145 |
| 115 | 3300005471 | Ga0070698_100241937 | Ga0070698_1002419372 | 145 |
| 116 | 3300005518 | Ga0070699_100112334 | Ga0070699_1001123342 | 145 |
| 117 | 3300007076 | Ga0075435_100157057 | Ga0075435_1001570574 | 145 |
| 118 | 3300050513 | nmdc:mga0rr50_346454_c1 | nmdc:mga0rr50_346454_c1_507_947 | 145 |
| 119 | 3300005333 | Ga0070677_10011217 | Ga0070677_100112175 | 146 |
| 120 | 3300005334 | Ga0068869_100213324 | Ga0068869_1002133242 | 146 |
| 121 | 3300005355 | Ga0070671_100023258 | Ga0070671_1000232584 | 146 |
| 122 | 3300005445 | Ga0070708_100045977 | Ga0070708_1000459772 | 146 |
| 123 | 3300005467 | Ga0070706_100020198 | Ga0070706_1000201983 | 146 |
| 124 | 3300005471 | Ga0070698_100001874 | Ga0070698_10000187417 | 146 |
| 125 | 3300005518 | Ga0070699_100000650 | Ga0070699_10000065025 | 146 |
| 126 | 3300005543 | Ga0070672_100086349 | Ga0070672_1000863492 | 146 |
| 127 | 3300005546 | Ga0070696_100043359 | Ga0070696_1000433597 | 146 |
| 128 | 3300005549 | Ga0070704_100457423 | Ga0070704_1004574232 | 146 |
| 129 | 3300005564 | Ga0070664_100722212 | Ga0070664_1007222122 | 146 |
| 130 | 3300006844 | Ga0075428_100186017 | Ga0075428_1001860175 | 146 |
| 131 | 3300006844 | Ga0075428_100762130 | Ga0075428_1007621302 | 146 |
| 132 | 3300006847 | Ga0075431_100637856 | Ga0075431_1006378562 | 146 |
| 133 | 3300009094 | Ga0111539_10687601 | Ga0111539_106876012 | 146 |
| 134 | 3300009147 | Ga0114129_10009271 | Ga0114129_1000927111 | 146 |
| 135 | 3300009147 | Ga0114129_10869065 | Ga0114129_108690652 | 146 |
| 136 | 3300009177 | Ga0105248_11057579 | Ga0105248_110575791 | 146 |
| 137 | 3300025893 | Ga0207682_10012585 | Ga0207682_100125855 | 146 |
| 138 | 3300025907 | Ga0207645_10647224 | Ga0207645_106472241 | 146 |
| 139 | 3300025910 | Ga0207684_10017132 | Ga0207684_100171323 | 146 |
| 140 | 3300025926 | Ga0207659_11275379 | Ga0207659_112753791 | 146 |
| 141 | 3300025940 | Ga0207691_10132133 | Ga0207691_101321334 | 146 |
| 142 | 3300025945 | Ga0207679_10233658 | Ga0207679_102336582 | 146 |
| 143 | 3300028558 | Ga0265326_10038215 | Ga0265326_100382152 | 146 |
| 144 | 3300028563 | Ga0265319_1009373 | Ga0265319_10093732 | 146 |
| 145 | 3300028573 | Ga0265334_10000310 | Ga0265334_100003102 | 146 |
| 146 | 3300028577 | Ga0265318_10001698 | Ga0265318_100016989 | 146 |
| 147 | 3300028800 | Ga0265338_10030059 | Ga0265338_100300592 | 146 |
| 148 | 3300031235 | Ga0265330_10020997 | Ga0265330_100209973 | 146 |
| 149 | 3300031238 | Ga0265332_10001943 | Ga0265332_100019437 | 146 |
| 150 | 3300031239 | Ga0265328_10020966 | Ga0265328_100209662 | 146 |
| 151 | 3300031240 | Ga0265320_10004768 | Ga0265320_100047689 | 146 |
| 152 | 3300031241 | Ga0265325_10001011 | Ga0265325_100010112 | 146 |
| 153 | 3300031242 | Ga0265329_10012739 | Ga0265329_100127392 | 146 |
| 154 | 3300031247 | Ga0265340_10034363 | Ga0265340_100343632 | 146 |
| 155 | 3300031249 | Ga0265339_10163305 | Ga0265339_101633052 | 146 |
| 156 | 3300031250 | Ga0265331_10002686 | Ga0265331_100026864 | 146 |
| 157 | 3300031344 | Ga0265316_10016713 | Ga0265316_100167139 | 146 |
| 158 | 3300031548 | Ga0307408_101359671 | Ga0307408_1013596711 | 146 |
| 159 | 3300031595 | Ga0265313_10003350 | Ga0265313_1000335010 | 146 |
| 160 | 3300031711 | Ga0265314_10004269 | Ga0265314_100042697 | 146 |
| 161 | 3300031712 | Ga0265342_10029291 | Ga0265342_100292914 | 146 |
| 162 | 3300031852 | Ga0307410_10169784 | Ga0307410_101697843 | 146 |
| 163 | 3300031901 | Ga0307406_10119280 | Ga0307406_101192802 | 146 |
| 164 | 3300031911 | Ga0307412_10121125 | Ga0307412_101211252 | 146 |
| 165 | 3300031995 | Ga0307409_100085646 | Ga0307409_1000856463 | 146 |
| 166 | 3300032004 | Ga0307414_10064513 | Ga0307414_100645133 | 146 |
| 167 | 3300032005 | Ga0307411_10042248 | Ga0307411_100422486 | 146 |
| 168 | 3300032126 | Ga0307415_100303158 | Ga0307415_1003031582 | 146 |
| 169 | 3300035116 | Ga0373945_0096275 | Ga0373945_0096275_521_976 | 146 |
| 170 | 3300035170 | Ga0373943_0019270 | Ga0373943_0019270_726_1181 | 146 |
| 171 | 3300035171 | Ga0373946_0035499 | Ga0373946_0035499_107_562 | 146 |
| 172 | 3300035692 | Ga0373935_0042903 | Ga0373935_0042903_2227_2682 | 146 |
| 173 | 3300035695 | Ga0373927_0023785 | Ga0373927_0023785_651_1106 | 146 |
| 174 | 3300037068 | Ga0373925_0047910 | Ga0373925_0047910_463_918 | 146 |
| 175 | 3300039438 | Ga0436360_1116795 | Ga0436360_1116795_644_1135 | 146 |
| 176 | 3300042876 | Ga0451577_0016505 | Ga0451577_0016505_2032_2493 | 146 |
| 177 | 3300044712 | Ga0453684_0870358 | Ga0453684_0870358_93_554 | 146 |
| 178 | 3300049587 | Ga0501071_0603719 | Ga0501071_0603719_238_681 | 146 |
| 179 | 3300049593 | Ga0501077_0907608 | Ga0501077_0907608_42_485 | 146 |
| 180 | 3300050507 | nmdc:mga05p37_455420_c1 | nmdc:mga05p37_455420_c1_245_688 | 146 |
| 181 | 3300059421 | Ga0590071_009305 | Ga0590071_009305_1147_1617 | 146 |
| 182 | 3300005328 | Ga0070676_10001668 | Ga0070676_100016685 | 147 |
| 183 | 3300005330 | Ga0070690_100060005 | Ga0070690_1000600055 | 147 |
| 184 | 3300005334 | Ga0068869_100012510 | Ga0068869_1000125105 | 147 |
| 185 | 3300005335 | Ga0070666_10006434 | Ga0070666_100064345 | 147 |
| 186 | 3300005336 | Ga0070680_100085436 | Ga0070680_1000854362 | 147 |
| 187 | 3300005341 | Ga0070691_10241504 | Ga0070691_102415042 | 147 |
| 188 | 3300005347 | Ga0070668_100516446 | Ga0070668_1005164462 | 147 |
| 189 | 3300005353 | Ga0070669_100138670 | Ga0070669_1001386702 | 147 |
| 190 | 3300005354 | Ga0070675_100354646 | Ga0070675_1003546462 | 147 |
| 191 | 3300005356 | Ga0070674_100000031 | Ga0070674_10000003156 | 147 |
| 192 | 3300005364 | Ga0070673_100986688 | Ga0070673_1009866882 | 147 |
| 193 | 3300005367 | Ga0070667_100053227 | Ga0070667_1000532274 | 147 |
| 194 | 3300005440 | Ga0070705_100010188 | Ga0070705_1000101885 | 147 |
| 195 | 3300005441 | Ga0070700_100314512 | Ga0070700_1003145122 | 147 |
| 196 | 3300005444 | Ga0070694_100130465 | Ga0070694_1001304653 | 147 |
| 197 | 3300005456 | Ga0070678_100018444 | Ga0070678_1000184443 | 147 |
| 198 | 3300005457 | Ga0070662_100000206 | Ga0070662_10000020619 | 147 |
| 199 | 3300005458 | Ga0070681_10752289 | Ga0070681_107522892 | 147 |
| 200 | 3300005459 | Ga0068867_100000341 | Ga0068867_1000003418 | 147 |
| 201 | 3300005467 | Ga0070706_100869670 | Ga0070706_1008696702 | 147 |
| 202 | 3300005468 | Ga0070707_100906536 | Ga0070707_1009065362 | 147 |
| 203 | 3300005530 | Ga0070679_100180045 | Ga0070679_1001800453 | 147 |
| 204 | 3300005543 | Ga0070672_100402568 | Ga0070672_1004025682 | 147 |
| 205 | 3300005543 | Ga0070672_100758385 | Ga0070672_1007583852 | 147 |
| 206 | 3300005544 | Ga0070686_100004210 | Ga0070686_1000042105 | 147 |
| 207 | 3300005545 | Ga0070695_100010146 | Ga0070695_1000101462 | 147 |
| 208 | 3300005546 | Ga0070696_100006413 | Ga0070696_1000064134 | 147 |
| 209 | 3300005547 | Ga0070693_100078305 | Ga0070693_1000783054 | 147 |
| 210 | 3300005563 | Ga0068855_100352860 | Ga0068855_1003528602 | 147 |
| 211 | 3300005577 | Ga0068857_100000784 | Ga0068857_1000007842 | 147 |
| 212 | 3300005578 | Ga0068854_100007149 | Ga0068854_1000071495 | 147 |
| 213 | 3300005615 | Ga0070702_100008842 | Ga0070702_1000088422 | 147 |
| 214 | 3300005618 | Ga0068864_100001389 | Ga0068864_1000013892 | 147 |
| 215 | 3300005718 | Ga0068866_10000048 | Ga0068866_1000004827 | 147 |
| 216 | 3300005719 | Ga0068861_100009043 | Ga0068861_1000090433 | 147 |
| 217 | 3300005719 | Ga0068861_100055073 | Ga0068861_1000550734 | 147 |
| 218 | 3300005842 | Ga0068858_100075921 | Ga0068858_1000759213 | 147 |
| 219 | 3300005843 | Ga0068860_100019327 | Ga0068860_1000193277 | 147 |
| 220 | 3300005843 | Ga0068860_100203590 | Ga0068860_1002035902 | 147 |
| 221 | 3300005844 | Ga0068862_100010499 | Ga0068862_1000104996 | 147 |
| 222 | 3300005844 | Ga0068862_100059829 | Ga0068862_1000598292 | 147 |
| 223 | 3300006237 | Ga0097621_100361426 | Ga0097621_1003614263 | 147 |
| 224 | 3300006358 | Ga0068871_100113984 | Ga0068871_1001139841 | 147 |
| 225 | 3300006881 | Ga0068865_100001170 | Ga0068865_1000011706 | 147 |
| 226 | 3300009093 | Ga0105240_10478316 | Ga0105240_104783162 | 147 |
| 227 | 3300009101 | Ga0105247_10691098 | Ga0105247_106910981 | 147 |
| 228 | 3300009148 | Ga0105243_10003585 | Ga0105243_1000358513 | 147 |
| 229 | 3300009174 | Ga0105241_10000716 | Ga0105241_1000071614 | 147 |
| 230 | 3300009174 | Ga0105241_10952002 | Ga0105241_109520022 | 147 |
| 231 | 3300009176 | Ga0105242_10000251 | Ga0105242_1000025126 | 147 |
| 232 | 3300009177 | Ga0105248_10001792 | Ga0105248_100017928 | 147 |
| 233 | 3300009553 | Ga0105249_10023634 | Ga0105249_100236345 | 147 |
| 234 | 3300009553 | Ga0105249_10038687 | Ga0105249_100386876 | 147 |
| 235 | 3300009553 | Ga0105249_10364615 | Ga0105249_103646152 | 147 |
| 236 | 3300010375 | Ga0105239_10013449 | Ga0105239_100134495 | 147 |
| 237 | 3300010375 | Ga0105239_10555303 | Ga0105239_105553032 | 147 |
| 238 | 3300011119 | Ga0105246_10099510 | Ga0105246_100995105 | 147 |
| 239 | 3300013102 | Ga0157371_10453573 | Ga0157371_104535732 | 147 |
| 240 | 3300013297 | Ga0157378_10001585 | Ga0157378_1000158516 | 147 |
| 241 | 3300013306 | Ga0163162_10036701 | Ga0163162_100367013 | 147 |
| 242 | 3300013306 | Ga0163162_10043019 | Ga0163162_100430195 | 147 |
| 243 | 3300013306 | Ga0163162_10791231 | Ga0163162_107912312 | 147 |
| 244 | 3300013307 | Ga0157372_10247607 | Ga0157372_102476072 | 147 |
| 245 | 3300013308 | Ga0157375_10021674 | Ga0157375_100216742 | 147 |
| 246 | 3300013308 | Ga0157375_10458228 | Ga0157375_104582282 | 147 |
| 247 | 3300014326 | Ga0157380_10020140 | Ga0157380_100201403 | 147 |
| 248 | 3300014326 | Ga0157380_10194865 | Ga0157380_101948653 | 147 |
| 249 | 3300014968 | Ga0157379_10077422 | Ga0157379_100774223 | 147 |
| 250 | 3300014969 | Ga0157376_10383762 | Ga0157376_103837622 | 147 |
| 251 | 3300017792 | Ga0163161_10010019 | Ga0163161_100100194 | 147 |
| 252 | 3300025899 | Ga0207642_10005154 | Ga0207642_100051542 | 147 |
| 253 | 3300025903 | Ga0207680_10047393 | Ga0207680_100473931 | 147 |
| 254 | 3300025904 | Ga0207647_10234857 | Ga0207647_102348572 | 147 |
| 255 | 3300025907 | Ga0207645_10001078 | Ga0207645_1000107817 | 147 |
| 256 | 3300025910 | Ga0207684_10531218 | Ga0207684_105312182 | 147 |
| 257 | 3300025912 | Ga0207707_10039054 | Ga0207707_100390542 | 147 |
| 258 | 3300025913 | Ga0207695_10429902 | Ga0207695_104299021 | 147 |
| 259 | 3300025917 | Ga0207660_10179396 | Ga0207660_101793962 | 147 |
| 260 | 3300025917 | Ga0207660_10220233 | Ga0207660_102202333 | 147 |
| 261 | 3300025921 | Ga0207652_10320081 | Ga0207652_103200812 | 147 |
| 262 | 3300025923 | Ga0207681_10126385 | Ga0207681_101263853 | 147 |
| 263 | 3300025926 | Ga0207659_10281826 | Ga0207659_102818262 | 147 |
| 264 | 3300025933 | Ga0207706_10000096 | Ga0207706_1000009678 | 147 |
| 265 | 3300025934 | Ga0207686_10000112 | Ga0207686_1000011221 | 147 |
| 266 | 3300025935 | Ga0207709_10001243 | Ga0207709_100012433 | 147 |
| 267 | 3300025937 | Ga0207669_10001730 | Ga0207669_100017307 | 147 |
| 268 | 3300025938 | Ga0207704_10001104 | Ga0207704_100011046 | 147 |
| 269 | 3300025940 | Ga0207691_10269046 | Ga0207691_102690462 | 147 |
| 270 | 3300025941 | Ga0207711_10028313 | Ga0207711_100283136 | 147 |
| 271 | 3300025942 | Ga0207689_10000911 | Ga0207689_1000091118 | 147 |
| 272 | 3300025949 | Ga0207667_10219097 | Ga0207667_102190975 | 147 |
| 273 | 3300025960 | Ga0207651_10917622 | Ga0207651_109176222 | 147 |
| 274 | 3300025961 | Ga0207712_10007741 | Ga0207712_100077416 | 147 |
| 275 | 3300025961 | Ga0207712_10044085 | Ga0207712_100440852 | 147 |
| 276 | 3300025961 | Ga0207712_10130813 | Ga0207712_101308132 | 147 |
| 277 | 3300025981 | Ga0207640_10032470 | Ga0207640_100324706 | 147 |
| 278 | 3300025986 | Ga0207658_10022058 | Ga0207658_100220581 | 147 |
| 279 | 3300026023 | Ga0207677_10601384 | Ga0207677_106013841 | 147 |
| 280 | 3300026041 | Ga0207639_10113688 | Ga0207639_101136882 | 147 |
| 281 | 3300026067 | Ga0207678_10096128 | Ga0207678_100961283 | 147 |
| 282 | 3300026075 | Ga0207708_10187806 | Ga0207708_101878063 | 147 |
| 283 | 3300026089 | Ga0207648_10000043 | Ga0207648_1000004350 | 147 |
| 284 | 3300026095 | Ga0207676_10019559 | Ga0207676_100195592 | 147 |
| 285 | 3300026116 | Ga0207674_10001182 | Ga0207674_1000118231 | 147 |
| 286 | 3300026118 | Ga0207675_100009301 | Ga0207675_1000093013 | 147 |
| 287 | 3300026118 | Ga0207675_100384116 | Ga0207675_1003841162 | 147 |
| 288 | 3300026121 | Ga0207683_10003314 | Ga0207683_100033146 | 147 |
| 289 | 3300028380 | Ga0268265_10030120 | Ga0268265_100301203 | 147 |
| 290 | 3300028380 | Ga0268265_10035569 | Ga0268265_100355692 | 147 |
| 291 | 3300028381 | Ga0268264_10033356 | Ga0268264_100333562 | 147 |
| 292 | 3300028381 | Ga0268264_10245426 | Ga0268264_102454262 | 147 |
| 293 | 3300042876 | Ga0451577_0261353 | Ga0451577_0261353_462_914 | 147 |
| 294 | 3300042876 | Ga0451577_1096895 | Ga0451577_1096895_43_546 | 147 |
| 295 | 3300044673 | Ga0453683_0018303 | Ga0453683_0018303_255_707 | 147 |
| 296 | 3300044712 | Ga0453684_0325694 | Ga0453684_0325694_588_1091 | 147 |
| 297 | 3300046455 | Ga0495603_0071247 | Ga0495603_0071247_84_536 | 147 |
| 298 | 3300046499 | Ga0495594_0075334 | Ga0495594_0075334_864_1316 | 147 |
| 299 | 3300046664 | Ga0495659_0012816 | Ga0495659_0012816_385_837 | 147 |
| 300 | 3300046691 | Ga0495670_0694121 | Ga0495670_0694121_25_477 | 147 |
| 301 | 3300048903 | Ga0496100_0066711 | Ga0496100_0066711_1128_1580 | 147 |
| 302 | 3300048904 | Ga0496101_0013792 | Ga0496101_0013792_4618_5070 | 147 |
| 303 | 3300048906 | Ga0496103_0548129 | Ga0496103_0548129_222_674 | 147 |
| 304 | 3300048909 | Ga0496106_0095035 | Ga0496106_0095035_188_640 | 147 |
| 305 | 3300048910 | Ga0496107_0106188 | Ga0496107_0106188_573_1025 | 147 |
| 306 | 3300049581 | Ga0501047_0877196 | Ga0501047_0877196_30_476 | 147 |
| 307 | 3300049584 | Ga0501068_0470400 | Ga0501068_0470400_346_792 | 147 |
| 308 | 3300049585 | Ga0501069_0150444 | Ga0501069_0150444_369_815 | 147 |
| 309 | 3300049586 | Ga0501070_0047845 | Ga0501070_0047845_772_1218 | 147 |
| 310 | 3300049590 | Ga0501074_0699814 | Ga0501074_0699814_170_616 | 147 |
| 311 | 3300049742 | Ga0501080_0040338 | Ga0501080_0040338_3601_4047 | 147 |
| 312 | 3300049742 | Ga0501080_1146223 | Ga0501080_1146223_214_660 | 147 |
| 313 | 3300054114 | Ga0501084_0338753 | Ga0501084_0338753_663_1109 | 147 |
| 314 | 3300001977 | JGI24746J21847_1025389 | JGI24746J21847_10253891 | 148 |
| 315 | 3300004799 | Ga0058863_11948557 | Ga0058863_119485572 | 148 |
| 316 | 3300004800 | Ga0058861_12030290 | Ga0058861_120302902 | 148 |
| 317 | 3300005290 | Ga0065712_10002436 | Ga0065712_100024365 | 148 |
| 318 | 3300005290 | Ga0065712_10070819 | Ga0065712_100708195 | 148 |
| 319 | 3300005293 | Ga0065715_10002906 | Ga0065715_100029064 | 148 |
| 320 | 3300005293 | Ga0065715_10011887 | Ga0065715_100118872 | 148 |
| 321 | 3300005295 | Ga0065707_10374985 | Ga0065707_103749851 | 148 |
| 322 | 3300005327 | Ga0070658_10403806 | Ga0070658_104038062 | 148 |
| 323 | 3300005331 | Ga0070670_100000895 | Ga0070670_10000089519 | 148 |
| 324 | 3300005334 | Ga0068869_100033778 | Ga0068869_1000337782 | 148 |
| 325 | 3300005336 | Ga0070680_100055317 | Ga0070680_1000553173 | 148 |
| 326 | 3300005337 | Ga0070682_100291911 | Ga0070682_1002919112 | 148 |
| 327 | 3300005338 | Ga0068868_100026121 | Ga0068868_1000261212 | 148 |
| 328 | 3300005340 | Ga0070689_100179721 | Ga0070689_1001797213 | 148 |
| 329 | 3300005344 | Ga0070661_100007965 | Ga0070661_1000079659 | 148 |
| 330 | 3300005344 | Ga0070661_100178960 | Ga0070661_1001789601 | 148 |
| 331 | 3300005345 | Ga0070692_10324506 | Ga0070692_103245062 | 148 |
| 332 | 3300005353 | Ga0070669_100006398 | Ga0070669_1000063986 | 148 |
| 333 | 3300005354 | Ga0070675_100824400 | Ga0070675_1008244002 | 148 |
| 334 | 3300005355 | Ga0070671_100087309 | Ga0070671_1000873092 | 148 |
| 335 | 3300005356 | Ga0070674_100131021 | Ga0070674_1001310212 | 148 |
| 336 | 3300005364 | Ga0070673_100065674 | Ga0070673_1000656742 | 148 |
| 337 | 3300005365 | Ga0070688_100230942 | Ga0070688_1002309422 | 148 |
| 338 | 3300005367 | Ga0070667_100116787 | Ga0070667_1001167872 | 148 |
| 339 | 3300005440 | Ga0070705_100056028 | Ga0070705_1000560282 | 148 |
| 340 | 3300005441 | Ga0070700_100466820 | Ga0070700_1004668202 | 148 |
| 341 | 3300005444 | Ga0070694_100003632 | Ga0070694_1000036329 | 148 |
| 342 | 3300005455 | Ga0070663_100087896 | Ga0070663_1000878963 | 148 |
| 343 | 3300005456 | Ga0070678_100023971 | Ga0070678_1000239716 | 148 |
| 344 | 3300005456 | Ga0070678_100275316 | Ga0070678_1002753162 | 148 |
| 345 | 3300005457 | Ga0070662_100094829 | Ga0070662_1000948292 | 148 |
| 346 | 3300005458 | Ga0070681_10008219 | Ga0070681_100082198 | 148 |
| 347 | 3300005458 | Ga0070681_10034774 | Ga0070681_100347744 | 148 |
| 348 | 3300005459 | Ga0068867_100412764 | Ga0068867_1004127642 | 148 |
| 349 | 3300005530 | Ga0070679_100010568 | Ga0070679_1000105683 | 148 |
| 350 | 3300005530 | Ga0070679_100179187 | Ga0070679_1001791872 | 148 |
| 351 | 3300005535 | Ga0070684_100271609 | Ga0070684_1002716092 | 148 |
| 352 | 3300005543 | Ga0070672_100018970 | Ga0070672_1000189702 | 148 |
| 353 | 3300005544 | Ga0070686_100025456 | Ga0070686_1000254561 | 148 |
| 354 | 3300005545 | Ga0070695_100019561 | Ga0070695_1000195616 | 148 |
| 355 | 3300005545 | Ga0070695_100100729 | Ga0070695_1001007292 | 148 |
| 356 | 3300005546 | Ga0070696_100003810 | Ga0070696_10000381011 | 148 |
| 357 | 3300005547 | Ga0070693_100031570 | Ga0070693_1000315704 | 148 |
| 358 | 3300005549 | Ga0070704_100217787 | Ga0070704_1002177872 | 148 |
| 359 | 3300005563 | Ga0068855_100401737 | Ga0068855_1004017372 | 148 |
| 360 | 3300005564 | Ga0070664_100024643 | Ga0070664_1000246432 | 148 |
| 361 | 3300005577 | Ga0068857_100041473 | Ga0068857_1000414732 | 148 |
| 362 | 3300005577 | Ga0068857_100193490 | Ga0068857_1001934902 | 148 |
| 363 | 3300005578 | Ga0068854_100038940 | Ga0068854_1000389402 | 148 |
| 364 | 3300005616 | Ga0068852_100284920 | Ga0068852_1002849202 | 148 |
| 365 | 3300005718 | Ga0068866_10133474 | Ga0068866_101334742 | 148 |
| 366 | 3300005719 | Ga0068861_100165347 | Ga0068861_1001653472 | 148 |
| 367 | 3300005843 | Ga0068860_100129911 | Ga0068860_1001299112 | 148 |
| 368 | 3300006163 | Ga0070715_10150484 | Ga0070715_101504842 | 148 |
| 369 | 3300006175 | Ga0070712_100186198 | Ga0070712_1001861982 | 148 |
| 370 | 3300006358 | Ga0068871_100105274 | Ga0068871_1001052742 | 148 |
| 371 | 3300006844 | Ga0075428_101098377 | Ga0075428_1010983772 | 148 |
| 372 | 3300006852 | Ga0075433_10064220 | Ga0075433_100642203 | 148 |
| 373 | 3300006871 | Ga0075434_100012929 | Ga0075434_1000129291 | 148 |
| 374 | 3300006871 | Ga0075434_100168338 | Ga0075434_1001683384 | 148 |
| 375 | 3300006871 | Ga0075434_100230029 | Ga0075434_1002300292 | 148 |
| 376 | 3300006914 | Ga0075436_100548303 | Ga0075436_1005483032 | 148 |
| 377 | 3300007076 | Ga0075435_100040500 | Ga0075435_1000405005 | 148 |
| 378 | 3300007076 | Ga0075435_100045913 | Ga0075435_1000459133 | 148 |
| 379 | 3300007076 | Ga0075435_100578103 | Ga0075435_1005781032 | 148 |
| 380 | 3300009094 | Ga0111539_10049650 | Ga0111539_100496504 | 148 |
| 381 | 3300009094 | Ga0111539_10281592 | Ga0111539_102815922 | 148 |
| 382 | 3300009098 | Ga0105245_10036912 | Ga0105245_100369123 | 148 |
| 383 | 3300009147 | Ga0114129_10437778 | Ga0114129_104377782 | 148 |
| 384 | 3300009148 | Ga0105243_10291017 | Ga0105243_102910172 | 148 |
| 385 | 3300009174 | Ga0105241_10094975 | Ga0105241_100949755 | 148 |
| 386 | 3300009176 | Ga0105242_10076230 | Ga0105242_100762302 | 148 |
| 387 | 3300009545 | Ga0105237_10066610 | Ga0105237_100666106 | 148 |
| 388 | 3300009551 | Ga0105238_11187727 | Ga0105238_111877272 | 148 |
| 389 | 3300009553 | Ga0105249_10391406 | Ga0105249_103914062 | 148 |
| 390 | 3300009553 | Ga0105249_10896853 | Ga0105249_108968532 | 148 |
| 391 | 3300010375 | Ga0105239_10048201 | Ga0105239_100482016 | 148 |
| 392 | 3300011119 | Ga0105246_10048247 | Ga0105246_100482472 | 148 |
| 393 | 3300011119 | Ga0105246_11489418 | Ga0105246_114894181 | 148 |
| 394 | 3300012512 | Ga0157327_1007215 | Ga0157327_10072152 | 148 |
| 395 | 3300013296 | Ga0157374_10304285 | Ga0157374_103042852 | 148 |
| 396 | 3300013297 | Ga0157378_10319336 | Ga0157378_103193362 | 148 |
| 397 | 3300013306 | Ga0163162_10179578 | Ga0163162_101795782 | 148 |
| 398 | 3300013306 | Ga0163162_12328358 | Ga0163162_123283581 | 148 |
| 399 | 3300013307 | Ga0157372_10114281 | Ga0157372_101142812 | 148 |
| 400 | 3300014969 | Ga0157376_10009968 | Ga0157376_100099682 | 148 |
| 401 | 3300015261 | Ga0182006_1065900 | Ga0182006_10659002 | 148 |
| 402 | 3300020070 | Ga0206356_11313219 | Ga0206356_113132191 | 148 |
| 403 | 3300025315 | Ga0207697_10014166 | Ga0207697_100141663 | 148 |
| 404 | 3300025315 | Ga0207697_10030298 | Ga0207697_100302982 | 148 |
| 405 | 3300025901 | Ga0207688_10011366 | Ga0207688_100113666 | 148 |
| 406 | 3300025904 | Ga0207647_10216848 | Ga0207647_102168482 | 148 |
| 407 | 3300025907 | Ga0207645_10000345 | Ga0207645_1000034521 | 148 |
| 408 | 3300025912 | Ga0207707_10024571 | Ga0207707_100245715 | 148 |
| 409 | 3300025912 | Ga0207707_10205457 | Ga0207707_102054574 | 148 |
| 410 | 3300025915 | Ga0207693_10153071 | Ga0207693_101530711 | 148 |
| 411 | 3300025917 | Ga0207660_10074432 | Ga0207660_100744323 | 148 |
| 412 | 3300025917 | Ga0207660_11176302 | Ga0207660_111763022 | 148 |
| 413 | 3300025919 | Ga0207657_10003821 | Ga0207657_1000382114 | 148 |
| 414 | 3300025920 | Ga0207649_10164599 | Ga0207649_101645992 | 148 |
| 415 | 3300025921 | Ga0207652_10024310 | Ga0207652_100243107 | 148 |
| 416 | 3300025921 | Ga0207652_10056546 | Ga0207652_100565462 | 148 |
| 417 | 3300025925 | Ga0207650_10000495 | Ga0207650_1000049525 | 148 |
| 418 | 3300025926 | Ga0207659_10391793 | Ga0207659_103917932 | 148 |
| 419 | 3300025932 | Ga0207690_10006635 | Ga0207690_100066355 | 148 |
| 420 | 3300025933 | Ga0207706_10022822 | Ga0207706_100228225 | 148 |
| 421 | 3300025933 | Ga0207706_10135477 | Ga0207706_101354772 | 148 |
| 422 | 3300025934 | Ga0207686_10056837 | Ga0207686_100568372 | 148 |
| 423 | 3300025935 | Ga0207709_10594557 | Ga0207709_105945572 | 148 |
| 424 | 3300025936 | Ga0207670_11083394 | Ga0207670_110833941 | 148 |
| 425 | 3300025937 | Ga0207669_10029605 | Ga0207669_100296053 | 148 |
| 426 | 3300025940 | Ga0207691_10238057 | Ga0207691_102380572 | 148 |
| 427 | 3300025942 | Ga0207689_10205841 | Ga0207689_102058412 | 148 |
| 428 | 3300025944 | Ga0207661_11563091 | Ga0207661_115630911 | 148 |
| 429 | 3300025945 | Ga0207679_10002179 | Ga0207679_100021798 | 148 |
| 430 | 3300025945 | Ga0207679_10052846 | Ga0207679_100528463 | 148 |
| 431 | 3300025949 | Ga0207667_10273030 | Ga0207667_102730302 | 148 |
| 432 | 3300026035 | Ga0207703_10740598 | Ga0207703_107405982 | 148 |
| 433 | 3300026041 | Ga0207639_10145642 | Ga0207639_101456422 | 148 |
| 434 | 3300026075 | Ga0207708_10569826 | Ga0207708_105698261 | 148 |
| 435 | 3300026078 | Ga0207702_10299583 | Ga0207702_102995833 | 148 |
| 436 | 3300026095 | Ga0207676_10121075 | Ga0207676_101210752 | 148 |
| 437 | 3300026116 | Ga0207674_10251074 | Ga0207674_102510742 | 148 |
| 438 | 3300026116 | Ga0207674_10360661 | Ga0207674_103606613 | 148 |
| 439 | 3300026118 | Ga0207675_100115253 | Ga0207675_1001152533 | 148 |
| 440 | 3300026121 | Ga0207683_10001057 | Ga0207683_1000105717 | 148 |
| 441 | 3300027695 | Ga0209966_1023377 | Ga0209966_10233773 | 148 |
| 442 | 3300028379 | Ga0268266_10125382 | Ga0268266_101253822 | 148 |
| 443 | 3300028381 | Ga0268264_10250049 | Ga0268264_102500492 | 148 |
| 444 | 3300028800 | Ga0265338_10407500 | Ga0265338_104075002 | 148 |
| 445 | 3300031548 | Ga0307408_100295085 | Ga0307408_1002950852 | 148 |
| 446 | 3300031731 | Ga0307405_10004222 | Ga0307405_100042225 | 148 |
| 447 | 3300031824 | Ga0307413_10018674 | Ga0307413_100186743 | 148 |
| 448 | 3300031852 | Ga0307410_10341626 | Ga0307410_103416261 | 148 |
| 449 | 3300031903 | Ga0307407_10022294 | Ga0307407_100222942 | 148 |
| 450 | 3300031911 | Ga0307412_10010597 | Ga0307412_100105976 | 148 |
| 451 | 3300032002 | Ga0307416_100074200 | Ga0307416_1000742003 | 148 |
| 452 | 3300032002 | Ga0307416_100751757 | Ga0307416_1007517572 | 148 |
| 453 | 3300032005 | Ga0307411_10030110 | Ga0307411_100301104 | 148 |
| 454 | 3300032126 | Ga0307415_100074789 | Ga0307415_1000747893 | 148 |
| 455 | 3300035112 | Ga0373932_0100489 | Ga0373932_0100489_174_620 | 148 |
| 456 | 3300035114 | Ga0373939_0029267 | Ga0373939_0029267_538_984 | 148 |
| 457 | 3300035207 | Ga0373942_0038413 | Ga0373942_0038413_52_498 | 148 |
| 458 | 3300035241 | Ga0373961_0065073 | Ga0373961_0065073_488_934 | 148 |
| 459 | 3300035691 | Ga0373931_0001299 | Ga0373931_0001299_5255_5701 | 148 |
| 460 | 3300041406 | Ga0439439_0023783 | Ga0439439_0023783_618_1070 | 148 |
| 461 | 3300041410 | Ga0439461_0081065 | Ga0439461_0081065_140_592 | 148 |
| 462 | 3300041997 | Ga0439431_0049208 | Ga0439431_0049208_558_1010 | 148 |
| 463 | 3300041999 | Ga0439433_0077417 | Ga0439433_0077417_230_682 | 148 |
| 464 | 3300042001 | Ga0439441_083062 | Ga0439441_083062_244_690 | 148 |
| 465 | 3300042003 | Ga0439443_016264 | Ga0439443_016264_338_790 | 148 |
| 466 | 3300042005 | Ga0439448_0184730 | Ga0439448_0184730_116_562 | 148 |
| 467 | 3300042011 | Ga0439454_007832 | Ga0439454_007832_186_638 | 148 |
| 468 | 3300042015 | Ga0439462_0003337 | Ga0439462_0003337_671_1147 | 148 |
| 469 | 3300042129 | Ga0450891_023604 | Ga0450891_023604_43_519 | 148 |
| 470 | 3300042134 | Ga0450898_006247 | Ga0450898_006247_356_832 | 148 |
| 471 | 3300042142 | Ga0450905_019519 | Ga0450905_019519_69_545 | 148 |
| 472 | 3300042147 | Ga0450910_008626 | Ga0450910_008626_887_1363 | 148 |
| 473 | 3300042435 | Ga0439434_0057043 | Ga0439434_0057043_379_855 | 148 |
| 474 | 3300042435 | Ga0439434_0103774 | Ga0439434_0103774_402_854 | 148 |
| 475 | 3300042437 | Ga0439444_0011142 | Ga0439444_0011142_331_807 | 148 |
| 476 | 3300042439 | Ga0439464_0128685 | Ga0439464_0128685_145_591 | 148 |
| 477 | 3300042461 | Ga0439460_0112844 | Ga0439460_0112844_67_513 | 148 |
| 478 | 3300042876 | Ga0451577_0307972 | Ga0451577_0307972_504_950 | 148 |
| 479 | 3300045051 | Ga0451576_0674026 | Ga0451576_0674026_168_614 | 148 |
| 480 | 3300045051 | Ga0451576_1199877 | Ga0451576_1199877_159_605 | 148 |
| 481 | 3300048905 | Ga0496102_0152205 | Ga0496102_0152205_1452_1898 | 148 |
| 482 | 3300048905 | Ga0496102_1592940 | Ga0496102_1592940_64_510 | 148 |
| 483 | 3300048906 | Ga0496103_0144264 | Ga0496103_0144264_880_1326 | 148 |
| 484 | 3300048908 | Ga0496105_0526059 | Ga0496105_0526059_205_651 | 148 |
| 485 | 3300048909 | Ga0496106_0111191 | Ga0496106_0111191_732_1178 | 148 |
| 486 | 3300048910 | Ga0496107_0362713 | Ga0496107_0362713_154_600 | 148 |
| 487 | 3300048911 | Ga0496108_0155741 | Ga0496108_0155741_1337_1783 | 148 |
| 488 | 3300048912 | Ga0496109_0090192 | Ga0496109_0090192_1111_1557 | 148 |
| 489 | 3300048913 | Ga0496110_0443938 | Ga0496110_0443938_51_497 | 148 |
| 490 | 3300048914 | Ga0496111_0327795 | Ga0496111_0327795_74_520 | 148 |
| 491 | 3300048915 | Ga0496112_0002371 | Ga0496112_0002371_3283_3729 | 148 |
| 492 | 3300048915 | Ga0496112_0990775 | Ga0496112_0990775_55_501 | 148 |
| 493 | 3300048916 | Ga0496113_0083955 | Ga0496113_0083955_249_695 | 148 |
| 494 | 3300050511 | nmdc:mga08y16_219566_c1 | nmdc:mga08y16_219566_c1_579_1025 | 148 |
| 495 | 3300050511 | nmdc:mga08y16_834158_c1 | nmdc:mga08y16_834158_c1_398_844 | 148 |
| 496 | 3300050512 | nmdc:mga0n895_128487_c1 | nmdc:mga0n895_128487_c1_1515_1961 | 148 |
| 497 | 3300050512 | nmdc:mga0n895_282560_c1 | nmdc:mga0n895_282560_c1_1158_1604 | 148 |
| 498 | 3300050512 | nmdc:mga0n895_507972_c1 | nmdc:mga0n895_507972_c1_277_723 | 148 |
| 499 | 3300050512 | nmdc:mga0n895_96830_c1 | nmdc:mga0n895_96830_c1_1132_1578 | 148 |
| 500 | 3300050513 | nmdc:mga0rr50_197921_c1 | nmdc:mga0rr50_197921_c1_175_621 | 148 |
| 501 | 3300050513 | nmdc:mga0rr50_28277_c1 | nmdc:mga0rr50_28277_c1_2021_2467 | 148 |
| 502 | 3300050513 | nmdc:mga0rr50_68051_c1 | nmdc:mga0rr50_68051_c1_1056_1502 | 148 |
| 503 | 3300050514 | nmdc:mga08x19_604651_c1 | nmdc:mga08x19_604651_c1_275_721 | 148 |
| 504 | 3300050514 | nmdc:mga08x19_73276_c1 | nmdc:mga08x19_73276_c1_1167_1613 | 148 |
| 505 | 3300050515 | nmdc:mga0a205_148876_c1 | nmdc:mga0a205_148876_c1_396_842 | 148 |
| 506 | 3300003316 | rootH1_10048177 | rootH1_100481772 | 149 |
| 507 | 3300003316 | rootH1_10134043 | rootH1_101340432 | 149 |
| 508 | 3300004803 | Ga0058862_12710135 | Ga0058862_127101352 | 149 |
| 509 | 3300005295 | Ga0065707_10118897 | Ga0065707_101188972 | 149 |
| 510 | 3300005345 | Ga0070692_10320388 | Ga0070692_103203882 | 149 |
| 511 | 3300005471 | Ga0070698_100199077 | Ga0070698_1001990772 | 149 |
| 512 | 3300005471 | Ga0070698_100208185 | Ga0070698_1002081852 | 149 |
| 513 | 3300005518 | Ga0070699_100335650 | Ga0070699_1003356501 | 149 |
| 514 | 3300005530 | Ga0070679_100147305 | Ga0070679_1001473054 | 149 |
| 515 | 3300005530 | Ga0070679_100434473 | Ga0070679_1004344732 | 149 |
| 516 | 3300005544 | Ga0070686_101624072 | Ga0070686_1016240721 | 149 |
| 517 | 3300005545 | Ga0070695_100477556 | Ga0070695_1004775562 | 149 |
| 518 | 3300005843 | Ga0068860_100021349 | Ga0068860_1000213493 | 149 |
| 519 | 3300006844 | Ga0075428_101599307 | Ga0075428_1015993072 | 149 |
| 520 | 3300006846 | Ga0075430_100224214 | Ga0075430_1002242143 | 149 |
| 521 | 3300006846 | Ga0075430_100596111 | Ga0075430_1005961112 | 149 |
| 522 | 3300006847 | Ga0075431_100003213 | Ga0075431_10000321316 | 149 |
| 523 | 3300006847 | Ga0075431_100288153 | Ga0075431_1002881532 | 149 |
| 524 | 3300006881 | Ga0068865_101467305 | Ga0068865_1014673052 | 149 |
| 525 | 3300009094 | Ga0111539_10892955 | Ga0111539_108929552 | 149 |
| 526 | 3300009148 | Ga0105243_10309534 | Ga0105243_103095342 | 149 |
| 527 | 3300009176 | Ga0105242_11237152 | Ga0105242_112371522 | 149 |
| 528 | 3300009553 | Ga0105249_11999526 | Ga0105249_119995262 | 149 |
| 529 | 3300010375 | Ga0105239_10298877 | Ga0105239_102988772 | 149 |
| 530 | 3300011119 | Ga0105246_11209973 | Ga0105246_112099732 | 149 |
| 531 | 3300014745 | Ga0157377_10542233 | Ga0157377_105422331 | 149 |
| 532 | 3300017792 | Ga0163161_11447129 | Ga0163161_114471292 | 149 |
| 533 | 3300025901 | Ga0207688_10518365 | Ga0207688_105183652 | 149 |
| 534 | 3300025912 | Ga0207707_10771292 | Ga0207707_107712922 | 149 |
| 535 | 3300025912 | Ga0207707_10794629 | Ga0207707_107946291 | 149 |
| 536 | 3300025917 | Ga0207660_10861678 | Ga0207660_108616782 | 149 |
| 537 | 3300025921 | Ga0207652_10284779 | Ga0207652_102847791 | 149 |
| 538 | 3300025921 | Ga0207652_10661306 | Ga0207652_106613062 | 149 |
| 539 | 3300025938 | Ga0207704_10117499 | Ga0207704_101174992 | 149 |
| 540 | 3300026067 | Ga0207678_10127303 | Ga0207678_101273033 | 149 |
| 541 | 3300026075 | Ga0207708_10121195 | Ga0207708_101211952 | 149 |
| 542 | 3300027252 | Ga0209973_1072123 | Ga0209973_10721231 | 149 |
| 543 | 3300027543 | Ga0209999_1040188 | Ga0209999_10401882 | 149 |
| 544 | 3300027876 | Ga0209974_10085453 | Ga0209974_100854532 | 149 |
| 545 | 3300028381 | Ga0268264_10260393 | Ga0268264_102603932 | 149 |
| 546 | 3300031548 | Ga0307408_100026942 | Ga0307408_1000269422 | 149 |
| 547 | 3300031731 | Ga0307405_10015476 | Ga0307405_100154762 | 149 |
| 548 | 3300031731 | Ga0307405_10025001 | Ga0307405_100250014 | 149 |
| 549 | 3300031824 | Ga0307413_10001012 | Ga0307413_100010127 | 149 |
| 550 | 3300031824 | Ga0307413_10064349 | Ga0307413_100643494 | 149 |
| 551 | 3300031824 | Ga0307413_10458476 | Ga0307413_104584762 | 149 |
| 552 | 3300031852 | Ga0307410_10001656 | Ga0307410_100016567 | 149 |
| 553 | 3300031852 | Ga0307410_10003004 | Ga0307410_100030047 | 149 |
| 554 | 3300031852 | Ga0307410_10015549 | Ga0307410_100155494 | 149 |
| 555 | 3300031852 | Ga0307410_10865010 | Ga0307410_108650102 | 149 |
| 556 | 3300031901 | Ga0307406_10042759 | Ga0307406_100427592 | 149 |
| 557 | 3300031903 | Ga0307407_10062132 | Ga0307407_100621322 | 149 |
| 558 | 3300031903 | Ga0307407_10070217 | Ga0307407_100702172 | 149 |
| 559 | 3300031903 | Ga0307407_10103907 | Ga0307407_101039072 | 149 |
| 560 | 3300031911 | Ga0307412_10023940 | Ga0307412_100239404 | 149 |
| 561 | 3300031911 | Ga0307412_10024997 | Ga0307412_100249973 | 149 |
| 562 | 3300031911 | Ga0307412_10060041 | Ga0307412_100600412 | 149 |
| 563 | 3300031911 | Ga0307412_10307286 | Ga0307412_103072862 | 149 |
| 564 | 3300031995 | Ga0307409_100000744 | Ga0307409_1000007449 | 149 |
| 565 | 3300031995 | Ga0307409_100001517 | Ga0307409_1000015174 | 149 |
| 566 | 3300031995 | Ga0307409_100032484 | Ga0307409_1000324844 | 149 |
| 567 | 3300031995 | Ga0307409_100694547 | Ga0307409_1006945472 | 149 |
| 568 | 3300031995 | Ga0307409_100937441 | Ga0307409_1009374412 | 149 |
| 569 | 3300031995 | Ga0307409_100994784 | Ga0307409_1009947842 | 149 |
| 570 | 3300032002 | Ga0307416_100000378 | Ga0307416_10000037824 | 149 |
| 571 | 3300032002 | Ga0307416_100000758 | Ga0307416_1000007585 | 149 |
| 572 | 3300032002 | Ga0307416_100011031 | Ga0307416_1000110313 | 149 |
| 573 | 3300032002 | Ga0307416_100052696 | Ga0307416_1000526962 | 149 |
| 574 | 3300032002 | Ga0307416_100759471 | Ga0307416_1007594712 | 149 |
| 575 | 3300032004 | Ga0307414_10053192 | Ga0307414_100531922 | 149 |
| 576 | 3300032004 | Ga0307414_10142132 | Ga0307414_101421321 | 149 |
| 577 | 3300032005 | Ga0307411_10007405 | Ga0307411_100074054 | 149 |
| 578 | 3300032005 | Ga0307411_10020620 | Ga0307411_100206204 | 149 |
| 579 | 3300032005 | Ga0307411_10022178 | Ga0307411_100221781 | 149 |
| 580 | 3300032005 | Ga0307411_10092489 | Ga0307411_100924891 | 149 |
| 581 | 3300032126 | Ga0307415_100000254 | Ga0307415_10000025424 | 149 |
| 582 | 3300032126 | Ga0307415_100122385 | Ga0307415_1001223854 | 149 |
| 583 | 3300032126 | Ga0307415_100200103 | Ga0307415_1002001032 | 149 |
| 584 | 3300032126 | Ga0307415_100269237 | Ga0307415_1002692372 | 149 |
| 585 | 3300035119 | Ga0373956_0169256 | Ga0373956_0169256_225_677 | 149 |
| 586 | 3300036401 | Ga0373937_0067255 | Ga0373937_0067255_626_1078 | 149 |
| 587 | 3300044712 | Ga0453684_0924218 | Ga0453684_0924218_440_889 | 149 |
| 588 | 3300046537 | Ga0495598_0049625 | Ga0495598_0049625_600_1052 | 149 |
| 589 | 3300048909 | Ga0496106_0081204 | Ga0496106_0081204_391_855 | 149 |
| 590 | 3300049522 | Ga0501299_156400 | Ga0501299_156400_96_551 | 149 |
| 591 | 3300049524 | Ga0501301_037965 | Ga0501301_037965_11_463 | 149 |
| 592 | 3300049568 | Ga0501031_0007782 | Ga0501031_0007782_6249_6698 | 149 |
| 593 | 3300049569 | Ga0501032_0189213 | Ga0501032_0189213_275_724 | 149 |
| 594 | 3300049570 | Ga0501033_0021886 | Ga0501033_0021886_35_484 | 149 |
| 595 | 3300049571 | Ga0501034_0014428 | Ga0501034_0014428_5770_6219 | 149 |
| 596 | 3300049572 | Ga0501036_0074631 | Ga0501036_0074631_1457_1906 | 149 |
| 597 | 3300049573 | Ga0501037_0015475 | Ga0501037_0015475_4718_5167 | 149 |
| 598 | 3300049574 | Ga0501038_0040779 | Ga0501038_0040779_1091_1540 | 149 |
| 599 | 3300049575 | Ga0501039_0017431 | Ga0501039_0017431_3603_4052 | 149 |
| 600 | 3300049576 | Ga0501040_0022977 | Ga0501040_0022977_265_714 | 149 |
| 601 | 3300049579 | Ga0501043_0006165 | Ga0501043_0006165_4357_4806 | 149 |
| 602 | 3300049580 | Ga0501046_0008905 | Ga0501046_0008905_2522_2971 | 149 |
| 603 | 3300049581 | Ga0501047_0158985 | Ga0501047_0158985_466_915 | 149 |
| 604 | 3300049582 | Ga0501048_0107814 | Ga0501048_0107814_276_725 | 149 |
| 605 | 3300049583 | Ga0501067_0528374 | Ga0501067_0528374_157_606 | 149 |
| 606 | 3300049584 | Ga0501068_0015939 | Ga0501068_0015939_460_909 | 149 |
| 607 | 3300049585 | Ga0501069_0006048 | Ga0501069_0006048_501_950 | 149 |
| 608 | 3300049585 | Ga0501069_0142288 | Ga0501069_0142288_384_833 | 149 |
| 609 | 3300049587 | Ga0501071_0462426 | Ga0501071_0462426_247_696 | 149 |
| 610 | 3300049587 | Ga0501071_0559495 | Ga0501071_0559495_277_726 | 149 |
| 611 | 3300049588 | Ga0501072_0312988 | Ga0501072_0312988_544_993 | 149 |
| 612 | 3300049588 | Ga0501072_0363037 | Ga0501072_0363037_259_708 | 149 |
| 613 | 3300049588 | Ga0501072_0737584 | Ga0501072_0737584_67_516 | 149 |
| 614 | 3300049589 | Ga0501073_0005350 | Ga0501073_0005350_4952_5401 | 149 |
| 615 | 3300049590 | Ga0501074_0001217 | Ga0501074_0001217_8963_9412 | 149 |
| 616 | 3300049591 | Ga0501075_0017837 | Ga0501075_0017837_4403_4852 | 149 |
| 617 | 3300049668 | Ga0501233_009923 | Ga0501233_009923_1357_1806 | 149 |
| 618 | 3300049705 | Ga0501225_0003685 | Ga0501225_0003685_2935_3384 | 149 |
| 619 | 3300049706 | Ga0501229_063340 | Ga0501229_063340_28_480 | 149 |
| 620 | 3300049741 | Ga0501079_0381241 | Ga0501079_0381241_381_830 | 149 |
| 621 | 3300049742 | Ga0501080_0033059 | Ga0501080_0033059_456_905 | 149 |
| 622 | 3300049743 | Ga0501081_0082924 | Ga0501081_0082924_1200_1649 | 149 |
| 623 | 3300049744 | Ga0501083_0012410 | Ga0501083_0012410_725_1174 | 149 |
| 624 | 3300049759 | Ga0501262_003301 | Ga0501262_003301_145_594 | 149 |
| 625 | 3300049779 | Ga0501283_117577 | Ga0501283_117577_51_506 | 149 |
| 626 | 3300049822 | Ga0501035_0007245 | Ga0501035_0007245_5816_6265 | 149 |
| 627 | 3300049824 | Ga0501045_0045679 | Ga0501045_0045679_2212_2661 | 149 |
| 628 | 3300049824 | Ga0501045_0960141 | Ga0501045_0960141_152_601 | 149 |
| 629 | 3300050507 | nmdc:mga05p37_183465_c1 | nmdc:mga05p37_183465_c1_717_1190 | 149 |
| 630 | 3300050509 | nmdc:mga0qj67_37596_c1 | nmdc:mga0qj67_37596_c1_2853_3302 | 149 |
| 631 | 3300050510 | nmdc:mga06r32_2808_c1 | nmdc:mga06r32_2808_c1_1147_1596 | 149 |
| 632 | 3300050510 | nmdc:mga06r32_640155_c1 | nmdc:mga06r32_640155_c1_359_832 | 149 |
| 633 | 3300050511 | nmdc:mga08y16_277460_c1 | nmdc:mga08y16_277460_c1_469_933 | 149 |
| 634 | 3300054114 | Ga0501084_0009832 | Ga0501084_0009832_3922_4371 | 149 |
| 635 | 3300059423 | Ga0590074_035047 | Ga0590074_035047_92_577 | 149 |
| 636 | 3300059424 | Ga0590075_003441 | Ga0590075_003441_1054_1503 | 149 |
| 637 | 3300059426 | Ga0590077_007598 | Ga0590077_007598_860_1309 | 149 |
| 638 | 3300059426 | Ga0590077_019238 | Ga0590077_019238_702_1187 | 149 |
| 639 | 3300060353 | Ga0501082_0032225 | Ga0501082_0032225_3795_4244 | 149 |
| 640 | 3300061734 | Ga0530510_0042012 | Ga0530510_0042012_276_731 | 149 |
| 641 | 3300061734 | Ga0530510_0091974 | Ga0530510_0091974_523_972 | 149 |
| 642 | 3300061734 | Ga0530510_0646154 | Ga0530510_0646154_331_780 | 149 |
| 643 | 3300000041 | ARcpr5oldR_c011292 | ARcpr5oldR_0112921 | 150 |
| 644 | 3300000044 | ARSoilOldRDRAFT_c008884 | ARSoilOldRDRAFT_0088842 | 150 |
| 645 | 3300003911 | JGI25405J52794_10005174 | JGI25405J52794_100051744 | 150 |
| 646 | 3300005295 | Ga0065707_10001212 | Ga0065707_1000121211 | 150 |
| 647 | 3300005295 | Ga0065707_10014449 | Ga0065707_100144496 | 150 |
| 648 | 3300005295 | Ga0065707_10209214 | Ga0065707_102092142 | 150 |
| 649 | 3300005295 | Ga0065707_10889558 | Ga0065707_108895581 | 150 |
| 650 | 3300005347 | Ga0070668_100403808 | Ga0070668_1004038082 | 150 |
| 651 | 3300005354 | Ga0070675_100836674 | Ga0070675_1008366741 | 150 |
| 652 | 3300005356 | Ga0070674_101970668 | Ga0070674_1019706681 | 150 |
| 653 | 3300005367 | Ga0070667_100995009 | Ga0070667_1009950092 | 150 |
| 654 | 3300005440 | Ga0070705_100676526 | Ga0070705_1006765262 | 150 |
| 655 | 3300005444 | Ga0070694_100039671 | Ga0070694_1000396712 | 150 |
| 656 | 3300005445 | Ga0070708_100531780 | Ga0070708_1005317802 | 150 |
| 657 | 3300005456 | Ga0070678_101169037 | Ga0070678_1011690372 | 150 |
| 658 | 3300005536 | Ga0070697_101375882 | Ga0070697_1013758821 | 150 |
| 659 | 3300005545 | Ga0070695_100797843 | Ga0070695_1007978432 | 150 |
| 660 | 3300005546 | Ga0070696_100095096 | Ga0070696_1000950962 | 150 |
| 661 | 3300005549 | Ga0070704_100281777 | Ga0070704_1002817772 | 150 |
| 662 | 3300005549 | Ga0070704_102122301 | Ga0070704_1021223011 | 150 |
| 663 | 3300005577 | Ga0068857_101266459 | Ga0068857_1012664592 | 150 |
| 664 | 3300005577 | Ga0068857_101358794 | Ga0068857_1013587941 | 150 |
| 665 | 3300005578 | Ga0068854_100807325 | Ga0068854_1008073252 | 150 |
| 666 | 3300005617 | Ga0068859_100425015 | Ga0068859_1004250152 | 150 |
| 667 | 3300005618 | Ga0068864_101170527 | Ga0068864_1011705272 | 150 |
| 668 | 3300005843 | Ga0068860_100709726 | Ga0068860_1007097262 | 150 |
| 669 | 3300005937 | Ga0081455_10002445 | Ga0081455_1000244515 | 150 |
| 670 | 3300005937 | Ga0081455_10015954 | Ga0081455_100159547 | 150 |
| 671 | 3300005937 | Ga0081455_10166060 | Ga0081455_101660602 | 150 |
| 672 | 3300005981 | Ga0081538_10007439 | Ga0081538_100074397 | 150 |
| 673 | 3300005983 | Ga0081540_1256964 | Ga0081540_12569641 | 150 |
| 674 | 3300006058 | Ga0075432_10188339 | Ga0075432_101883392 | 150 |
| 675 | 3300006194 | Ga0075427_10083609 | Ga0075427_100836091 | 150 |
| 676 | 3300006844 | Ga0075428_100008553 | Ga0075428_1000085539 | 150 |
| 677 | 3300006844 | Ga0075428_100537780 | Ga0075428_1005377802 | 150 |
| 678 | 3300006846 | Ga0075430_100022399 | Ga0075430_1000223996 | 150 |
| 679 | 3300006846 | Ga0075430_100123958 | Ga0075430_1001239582 | 150 |
| 680 | 3300006846 | Ga0075430_100273337 | Ga0075430_1002733372 | 150 |
| 681 | 3300006846 | Ga0075430_100371496 | Ga0075430_1003714962 | 150 |
| 682 | 3300006846 | Ga0075430_101007983 | Ga0075430_1010079831 | 150 |
| 683 | 3300006847 | Ga0075431_100013341 | Ga0075431_1000133417 | 150 |
| 684 | 3300006847 | Ga0075431_100058093 | Ga0075431_1000580933 | 150 |
| 685 | 3300006847 | Ga0075431_100313990 | Ga0075431_1003139903 | 150 |
| 686 | 3300006852 | Ga0075433_10005452 | Ga0075433_100054528 | 150 |
| 687 | 3300006852 | Ga0075433_10472862 | Ga0075433_104728622 | 150 |
| 688 | 3300006871 | Ga0075434_100111787 | Ga0075434_1001117873 | 150 |
| 689 | 3300006871 | Ga0075434_100526483 | Ga0075434_1005264831 | 150 |
| 690 | 3300006880 | Ga0075429_100021847 | Ga0075429_1000218476 | 150 |
| 691 | 3300006880 | Ga0075429_100166594 | Ga0075429_1001665942 | 150 |
| 692 | 3300006880 | Ga0075429_100294892 | Ga0075429_1002948922 | 150 |
| 693 | 3300006880 | Ga0075429_100886865 | Ga0075429_1008868652 | 150 |
| 694 | 3300006914 | Ga0075436_100064240 | Ga0075436_1000642403 | 150 |
| 695 | 3300006931 | Ga0097620_100424995 | Ga0097620_1004249952 | 150 |
| 696 | 3300007076 | Ga0075435_100833366 | Ga0075435_1008333662 | 150 |
| 697 | 3300009147 | Ga0114129_10017932 | Ga0114129_100179327 | 150 |
| 698 | 3300009147 | Ga0114129_10076366 | Ga0114129_100763664 | 150 |
| 699 | 3300009147 | Ga0114129_10149832 | Ga0114129_101498325 | 150 |
| 700 | 3300009147 | Ga0114129_10714659 | Ga0114129_107146591 | 150 |
| 701 | 3300009147 | Ga0114129_11178052 | Ga0114129_111780522 | 150 |
| 702 | 3300009176 | Ga0105242_10598567 | Ga0105242_105985672 | 150 |
| 703 | 3300009545 | Ga0105237_10000013 | Ga0105237_10000013174 | 150 |
| 704 | 3300009551 | Ga0105238_10090873 | Ga0105238_100908733 | 150 |
| 705 | 3300009553 | Ga0105249_12164897 | Ga0105249_121648971 | 150 |
| 706 | 3300012497 | Ga0157319_1008551 | Ga0157319_10085512 | 150 |
| 707 | 3300012505 | Ga0157339_1013176 | Ga0157339_10131762 | 150 |
| 708 | 3300012512 | Ga0157327_1002831 | Ga0157327_10028312 | 150 |
| 709 | 3300013297 | Ga0157378_10022508 | Ga0157378_100225082 | 150 |
| 710 | 3300013306 | Ga0163162_10066793 | Ga0163162_100667933 | 150 |
| 711 | 3300013308 | Ga0157375_10572842 | Ga0157375_105728422 | 150 |
| 712 | 3300013308 | Ga0157375_11291773 | Ga0157375_112917732 | 150 |
| 713 | 3300014326 | Ga0157380_10393544 | Ga0157380_103935442 | 150 |
| 714 | 3300014326 | Ga0157380_10945175 | Ga0157380_109451752 | 150 |
| 715 | 3300017792 | Ga0163161_10271084 | Ga0163161_102710842 | 150 |
| 716 | 3300025910 | Ga0207684_10287667 | Ga0207684_102876672 | 150 |
| 717 | 3300025914 | Ga0207671_10000024 | Ga0207671_10000024206 | 150 |
| 718 | 3300025922 | Ga0207646_10194361 | Ga0207646_101943613 | 150 |
| 719 | 3300025924 | Ga0207694_10076010 | Ga0207694_100760104 | 150 |
| 720 | 3300025934 | Ga0207686_11000503 | Ga0207686_110005032 | 150 |
| 721 | 3300025972 | Ga0207668_10776477 | Ga0207668_107764772 | 150 |
| 722 | 3300025981 | Ga0207640_11090184 | Ga0207640_110901842 | 150 |
| 723 | 3300026095 | Ga0207676_10358473 | Ga0207676_103584732 | 150 |
| 724 | 3300027252 | Ga0209973_1012454 | Ga0209973_10124542 | 150 |
| 725 | 3300027665 | Ga0209983_1008763 | Ga0209983_10087632 | 150 |
| 726 | 3300027876 | Ga0209974_10001329 | Ga0209974_100013295 | 150 |
| 727 | 3300027907 | Ga0207428_10027342 | Ga0207428_100273423 | 150 |
| 728 | 3300028381 | Ga0268264_10280794 | Ga0268264_102807942 | 150 |
| 729 | 3300028556 | Ga0265337_1019898 | Ga0265337_10198982 | 150 |
| 730 | 3300028556 | Ga0265337_1039120 | Ga0265337_10391202 | 150 |
| 731 | 3300028563 | Ga0265319_1011555 | Ga0265319_10115553 | 150 |
| 732 | 3300028573 | Ga0265334_10049458 | Ga0265334_100494582 | 150 |
| 733 | 3300028800 | Ga0265338_10001654 | Ga0265338_1000165434 | 150 |
| 734 | 3300031240 | Ga0265320_10305990 | Ga0265320_103059902 | 150 |
| 735 | 3300031344 | Ga0265316_11111670 | Ga0265316_111116701 | 150 |
| 736 | 3300031548 | Ga0307408_100405040 | Ga0307408_1004050402 | 150 |
| 737 | 3300031548 | Ga0307408_100543281 | Ga0307408_1005432812 | 150 |
| 738 | 3300031691 | Ga0316579_10047461 | Ga0316579_100474613 | 150 |
| 739 | 3300031691 | Ga0316579_10614889 | Ga0316579_106148891 | 150 |
| 740 | 3300031727 | Ga0316576_10012788 | Ga0316576_100127881 | 150 |
| 741 | 3300031731 | Ga0307405_10010584 | Ga0307405_100105846 | 150 |
| 742 | 3300031731 | Ga0307405_10084395 | Ga0307405_100843954 | 150 |
| 743 | 3300031824 | Ga0307413_10002720 | Ga0307413_100027206 | 150 |
| 744 | 3300031852 | Ga0307410_10056473 | Ga0307410_100564735 | 150 |
| 745 | 3300031901 | Ga0307406_10077352 | Ga0307406_100773525 | 150 |
| 746 | 3300031903 | Ga0307407_10012077 | Ga0307407_100120773 | 150 |
| 747 | 3300031911 | Ga0307412_12039389 | Ga0307412_120393891 | 150 |
| 748 | 3300031995 | Ga0307409_100254570 | Ga0307409_1002545702 | 150 |
| 749 | 3300031995 | Ga0307409_100515560 | Ga0307409_1005155602 | 150 |
| 750 | 3300032002 | Ga0307416_100014401 | Ga0307416_1000144015 | 150 |
| 751 | 3300032005 | Ga0307411_10010727 | Ga0307411_100107272 | 150 |
| 752 | 3300032126 | Ga0307415_100029860 | Ga0307415_1000298604 | 150 |
| 753 | 3300035112 | Ga0373932_0093343 | Ga0373932_0093343_302_760 | 150 |
| 754 | 3300035114 | Ga0373939_0012513 | Ga0373939_0012513_778_1236 | 150 |
| 755 | 3300035171 | Ga0373946_0091313 | Ga0373946_0091313_556_1008 | 150 |
| 756 | 3300035691 | Ga0373931_0173642 | Ga0373931_0173642_668_1120 | 150 |
| 757 | 3300035691 | Ga0373931_0267744 | Ga0373931_0267744_531_983 | 150 |
| 758 | 3300035725 | Ga0373947_0038852 | Ga0373947_0038852_247_699 | 150 |
| 759 | 3300036647 | Ga0316582_0471911 | Ga0316582_0471911_204_659 | 150 |
| 760 | 3300036712 | Ga0316584_0110326 | Ga0316584_0110326_223_684 | 150 |
| 761 | 3300042125 | Ga0450923_003245 | Ga0450923_003245_1583_2035 | 150 |
| 762 | 3300042133 | Ga0450896_077762 | Ga0450896_077762_52_504 | 150 |
| 763 | 3300042435 | Ga0439434_0097721 | Ga0439434_0097721_214_669 | 150 |
| 764 | 3300042532 | Ga0450893_0044148 | Ga0450893_0044148_271_723 | 150 |
| 765 | 3300042876 | Ga0451577_0846090 | Ga0451577_0846090_188_640 | 150 |
| 766 | 3300044673 | Ga0453683_0060110 | Ga0453683_0060110_571_1023 | 150 |
| 767 | 3300045051 | Ga0451576_0076699 | Ga0451576_0076699_963_1415 | 150 |
| 768 | 3300045051 | Ga0451576_0804217 | Ga0451576_0804217_428_880 | 150 |
| 769 | 3300046683 | Ga0495658_0436905 | Ga0495658_0436905_223_675 | 150 |
| 770 | 3300046691 | Ga0495670_0478960 | Ga0495670_0478960_164_616 | 150 |
| 771 | 3300049521 | Ga0501298_001964 | Ga0501298_001964_850_1305 | 150 |
| 772 | 3300049522 | Ga0501299_004376 | Ga0501299_004376_12_467 | 150 |
| 773 | 3300049572 | Ga0501036_0835674 | Ga0501036_0835674_280_732 | 150 |
| 774 | 3300049575 | Ga0501039_0332457 | Ga0501039_0332457_617_1069 | 150 |
| 775 | 3300049577 | Ga0501041_0004538 | Ga0501041_0004538_1463_1915 | 150 |
| 776 | 3300049578 | Ga0501042_0235411 | Ga0501042_0235411_280_732 | 150 |
| 777 | 3300049580 | Ga0501046_0117006 | Ga0501046_0117006_731_1183 | 150 |
| 778 | 3300049580 | Ga0501046_0219098 | Ga0501046_0219098_232_684 | 150 |
| 779 | 3300049584 | Ga0501068_0468996 | Ga0501068_0468996_72_524 | 150 |
| 780 | 3300049587 | Ga0501071_0101413 | Ga0501071_0101413_988_1440 | 150 |
| 781 | 3300049587 | Ga0501071_0383700 | Ga0501071_0383700_528_980 | 150 |
| 782 | 3300049588 | Ga0501072_0078507 | Ga0501072_0078507_228_680 | 150 |
| 783 | 3300049589 | Ga0501073_0963113 | Ga0501073_0963113_91_543 | 150 |
| 784 | 3300049590 | Ga0501074_0089317 | Ga0501074_0089317_1265_1717 | 150 |
| 785 | 3300049591 | Ga0501075_0000770 | Ga0501075_0000770_14500_14952 | 150 |
| 786 | 3300049591 | Ga0501075_0079990 | Ga0501075_0079990_1263_1715 | 150 |
| 787 | 3300049592 | Ga0501076_0003602 | Ga0501076_0003602_4547_4999 | 150 |
| 788 | 3300049592 | Ga0501076_0679693 | Ga0501076_0679693_328_780 | 150 |
| 789 | 3300049593 | Ga0501077_0013963 | Ga0501077_0013963_2970_3422 | 150 |
| 790 | 3300049593 | Ga0501077_0103817 | Ga0501077_0103817_659_1111 | 150 |
| 791 | 3300049593 | Ga0501077_0150159 | Ga0501077_0150159_787_1245 | 150 |
| 792 | 3300049661 | Ga0501217_134230 | Ga0501217_134230_62_517 | 150 |
| 793 | 3300049669 | Ga0501235_012869 | Ga0501235_012869_1316_1771 | 150 |
| 794 | 3300049675 | Ga0501243_038621 | Ga0501243_038621_52_507 | 150 |
| 795 | 3300049690 | Ga0501261_042851 | Ga0501261_042851_34_489 | 150 |
| 796 | 3300049705 | Ga0501225_0020204 | Ga0501225_0020204_955_1410 | 150 |
| 797 | 3300049741 | Ga0501079_0085949 | Ga0501079_0085949_1610_2062 | 150 |
| 798 | 3300049741 | Ga0501079_0161057 | Ga0501079_0161057_233_685 | 150 |
| 799 | 3300049741 | Ga0501079_0885231 | Ga0501079_0885231_227_679 | 150 |
| 800 | 3300049743 | Ga0501081_0004872 | Ga0501081_0004872_1869_2321 | 150 |
| 801 | 3300049743 | Ga0501081_0128408 | Ga0501081_0128408_391_843 | 150 |
| 802 | 3300049743 | Ga0501081_0472498 | Ga0501081_0472498_305_766 | 150 |
| 803 | 3300049743 | Ga0501081_0976298 | Ga0501081_0976298_83_535 | 150 |
| 804 | 3300049767 | Ga0501270_027755 | Ga0501270_027755_166_621 | 150 |
| 805 | 3300049824 | Ga0501045_0082381 | Ga0501045_0082381_1783_2235 | 150 |
| 806 | 3300049824 | Ga0501045_0805274 | Ga0501045_0805274_185_637 | 150 |
| 807 | 3300049850 | Ga0501204_005837 | Ga0501204_005837_32_487 | 150 |
| 808 | 3300050507 | nmdc:mga05p37_134390_c1 | nmdc:mga05p37_134390_c1_989_1447 | 150 |
| 809 | 3300050507 | nmdc:mga05p37_16050_c1 | nmdc:mga05p37_16050_c1_5880_6332 | 150 |
| 810 | 3300050507 | nmdc:mga05p37_26567_c1 | nmdc:mga05p37_26567_c1_5511_5966 | 150 |
| 811 | 3300050507 | nmdc:mga05p37_983103_c1 | nmdc:mga05p37_983103_c1_246_698 | 150 |
| 812 | 3300050508 | nmdc:mga09592_1026488_c1 | nmdc:mga09592_1026488_c1_222_674 | 150 |
| 813 | 3300050508 | nmdc:mga09592_11119_c1 | nmdc:mga09592_11119_c1_989_1447 | 150 |
| 814 | 3300050508 | nmdc:mga09592_1120906_c1 | nmdc:mga09592_1120906_c1_125_583 | 150 |
| 815 | 3300050508 | nmdc:mga09592_254973_c1 | nmdc:mga09592_254973_c1_984_1442 | 150 |
| 816 | 3300050508 | nmdc:mga09592_67249_c1 | nmdc:mga09592_67249_c1_1316_1768 | 150 |
| 817 | 3300050508 | nmdc:mga09592_705441_c1 | nmdc:mga09592_705441_c1_112_567 | 150 |
| 818 | 3300050509 | nmdc:mga0qj67_10983_c1 | nmdc:mga0qj67_10983_c1_3130_3582 | 150 |
| 819 | 3300050509 | nmdc:mga0qj67_1545785_c1 | nmdc:mga0qj67_1545785_c1_25_480 | 150 |
| 820 | 3300050509 | nmdc:mga0qj67_211737_c1 | nmdc:mga0qj67_211737_c1_710_1168 | 150 |
| 821 | 3300050509 | nmdc:mga0qj67_26559_c1 | nmdc:mga0qj67_26559_c1_3732_4187 | 150 |
| 822 | 3300050509 | nmdc:mga0qj67_596887_c1 | nmdc:mga0qj67_596887_c1_309_761 | 150 |
| 823 | 3300050509 | nmdc:mga0qj67_829456_c1 | nmdc:mga0qj67_829456_c1_211_666 | 150 |
| 824 | 3300050510 | nmdc:mga06r32_18791_c1 | nmdc:mga06r32_18791_c1_5863_6315 | 150 |
| 825 | 3300050510 | nmdc:mga06r32_21962_c1 | nmdc:mga06r32_21962_c1_2619_3071 | 150 |
| 826 | 3300050511 | nmdc:mga08y16_20164_c1 | nmdc:mga08y16_20164_c1_4617_5069 | 150 |
| 827 | 3300050512 | nmdc:mga0n895_91896_c1 | nmdc:mga0n895_91896_c1_1597_2055 | 150 |
| 828 | 3300050512 | nmdc:mga0n895_93500_c1 | nmdc:mga0n895_93500_c1_1076_1528 | 150 |
| 829 | 3300050514 | nmdc:mga08x19_24722_c1 | nmdc:mga08x19_24722_c1_930_1382 | 150 |
| 830 | 3300050514 | nmdc:mga08x19_478126_c1 | nmdc:mga08x19_478126_c1_184_636 | 150 |
| 831 | 3300050514 | nmdc:mga08x19_72739_c1 | nmdc:mga08x19_72739_c1_341_799 | 150 |
| 832 | 3300050515 | nmdc:mga0a205_1486_c1 | nmdc:mga0a205_1486_c1_18711_19163 | 150 |
| 833 | 3300050515 | nmdc:mga0a205_259485_c1 | nmdc:mga0a205_259485_c1_264_722 | 150 |
| 834 | 3300050515 | nmdc:mga0a205_627500_c1 | nmdc:mga0a205_627500_c1_155_607 | 150 |
| 835 | 3300054114 | Ga0501084_0077570 | Ga0501084_0077570_2264_2716 | 150 |
| 836 | 3300054114 | Ga0501084_0495337 | Ga0501084_0495337_271_723 | 150 |
| 837 | 3300059426 | Ga0590077_063834 | Ga0590077_063834_338_793 | 150 |
| 838 | 3300060353 | Ga0501082_0076961 | Ga0501082_0076961_353_805 | 150 |
| 839 | 3300061734 | Ga0530510_0333066 | Ga0530510_0333066_425_886 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6a6f-assembly1.cif.gz_B | crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 | 0.9426 | 6 | 140 |
| 6a6g-assembly1.cif.gz_C | crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1 | 0.9342 | 8 | 140 |
| 6jzv-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis | 0.9331 | 2 | 141 |
| 6a6g-assembly1.cif.gz_D | crystal structure of thermostable fisufs-sufu complex from thermophilic fervidobacterium islandicum aw-1 | 0.9328 | 10 | 140 |
| 6jzw-assembly3.cif.gz_C | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9255 | 2 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9316 | 2 | 140 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9187 | 2 | 140 | 3.90.1010.10 |
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9123 | 1 | 142 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9078 | 3 | 139 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8952 | 3 | 139 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5RV02-F1-model_v4 | Fe-S assembly protein NifU | 0.9701 | 12 | 141 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A2V9S5W4-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.968 | 34 | 150 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A2V8PTC4-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9679 | 25 | 150 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A5N9B351-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9636 | 1 | 150 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7C5VKY7-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9611 | 10 | 140 |
GO:0005506
GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar