F482985
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 838 | 445 | 789 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300025938|Ga0207704_11670850|Ga0207704_116708502 |
| Length | 93 |
| Sequence | MRANGGYRICDRWNKTQQLQALIQSHLPCEHITLEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGAKMHTDEVHALSMKTYTPAEWAAVEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 9 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 12 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 13 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 14 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 17 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 18 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 19 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 20 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 21 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 22 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 23 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 24 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 25 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 26 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 27 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 28 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 29 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 30 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 31 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 32 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 33 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 34 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 35 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 36 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 37 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 38 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 39 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 40 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 41 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 42 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 43 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 44 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 45 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 46 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 47 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 48 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 49 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 50 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 53 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 54 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 55 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 56 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 57 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 59 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 63 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 69 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 83 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 90 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 124 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 140 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 142 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 143 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 233 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 234 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 235 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 236 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 237 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 238 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 239 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 240 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 241 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 243 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 248 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 260 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 263 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 266 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 267 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 268 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 269 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 270 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 271 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 272 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 283 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 284 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 285 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 290 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 291 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 292 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 293 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 294 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 295 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 296 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 297 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 298 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 299 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 300 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 301 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 302 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 303 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 304 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 305 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 306 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 307 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 308 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 309 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 310 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 311 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 312 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 313 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 314 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 315 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 316 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 317 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 320 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 385 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 386 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 389 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 390 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 391 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 392 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 393 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 399 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 400 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 401 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 402 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 403 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 404 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 409 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 413 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 418 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 421 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 423 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 424 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 426 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 427 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 428 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 429 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 432 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 433 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 434 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 436 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 439 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 441 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 442 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 443 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 444 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 445 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.44 |
| Metatranscriptomes | 0.72 |
| Isolates | 5.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 25.66 |
| Nodule | 0.6 |
| Rhizoplane | 4.42 |
| Rhizosphere | 61.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004290 | 3300001979 | Bacteria | 6145 |
| 2 | JGI24739J22299_10008905 | 3300001989 | Bacteria | 3742 |
| 3 | JGI24739J22299_10009598 | 3300001989 | Bacteria | 3603 |
| 4 | JGI25158J39367_1004285 | 3300002739 | Bacteria | 2147 |
| 5 | JGI25159J45721_1029844 | 3300002987 | Bacteria | 893 |
| 6 | JGI25151J46595_10003000 | 3300003187 | Bacteria | 9602 |
| 7 | JGI25151J46595_10028625 | 3300003187 | Bacteria | 2216 |
| 8 | JGI25151J46595_10071196 | 3300003187 | Bacteria | 1052 |
| 9 | JGI25153J46596_10009310 | 3300003215 | Bacteria | 4586 |
| 10 | rootH1_10079751 | 3300003323 | Bacteria | 1474 |
| 11 | JGI25160J50197_1010452 | 3300003354 | Bacteria | 3357 |
| 12 | Ga0006562J51391_1089139 | 3300003578 | Bacteria | 2360 |
| 13 | Ga0006562J51391_1089141 | 3300003578 | Bacteria | 1140 |
| 14 | Ga0055527_1014119 | 3300003760 | Bacteria | 884 |
| 15 | Ga0055535_1000966 | 3300003761 | Bacteria | 18756 |
| 16 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 17 | Ga0055537_1000150 | 3300003773 | Bacteria | 52097 |
| 18 | Ga0055537_1003599 | 3300003773 | Bacteria | 4720 |
| 19 | Ga0055524_1064407 | 3300003775 | Bacteria | 740 |
| 20 | Ga0055536_1006807 | 3300003781 | Bacteria | 5232 |
| 21 | Ga0055536_1027523 | 3300003781 | Bacteria | 1569 |
| 22 | Ga0055536_1035061 | 3300003781 | Bacteria | 1260 |
| 23 | Ga0055534_1000016 | 3300003784 | Bacteria | 144444 |
| 24 | Ga0055534_1017802 | 3300003784 | Bacteria | 1248 |
| 25 | Ga0055528_1000894 | 3300003790 | Bacteria | 20125 |
| 26 | Ga0055528_1021050 | 3300003790 | Bacteria | 2086 |
| 27 | Ga0055528_1043582 | 3300003790 | Bacteria | 975 |
| 28 | Ga0055528_1094440 | 3300003790 | Bacteria | 510 |
| 29 | Ga0055530_10003550 | 3300003791 | Bacteria | 8789 |
| 30 | Ga0055530_10005191 | 3300003791 | Bacteria | 6327 |
| 31 | Ga0055530_10061295 | 3300003791 | Bacteria | 838 |
| 32 | Ga0055540_1019292 | 3300003792 | Bacteria | 1839 |
| 33 | Ga0055540_1021120 | 3300003792 | Bacteria | 1700 |
| 34 | Ga0055540_1023163 | 3300003792 | Bacteria | 1569 |
| 35 | Ga0055540_1043939 | 3300003792 | Bacteria | 951 |
| 36 | Ga0055531_10001826 | 3300003794 | Bacteria | 15080 |
| 37 | Ga0055531_10004420 | 3300003794 | Bacteria | 8574 |
| 38 | Ga0065714_10004675 | 3300005288 | Bacteria | 8108 |
| 39 | Ga0065714_10080808 | 3300005288 | Bacteria | 2412 |
| 40 | Ga0065714_10479621 | 3300005288 | Bacteria | 535 |
| 41 | Ga0065704_10185663 | 3300005289 | Bacteria | 1214 |
| 42 | Ga0065704_10296250 | 3300005289 | Bacteria | 894 |
| 43 | Ga0065704_10364268 | 3300005289 | Bacteria | 793 |
| 44 | Ga0065704_10444071 | 3300005289 | Bacteria | 710 |
| 45 | Ga0070658_10139715 | 3300005327 | Bacteria | 2023 |
| 46 | Ga0070658_10269609 | 3300005327 | Bacteria | 1447 |
| 47 | Ga0070658_10817630 | 3300005327 | Bacteria | 810 |
| 48 | Ga0068869_100022576 | 3300005334 | Bacteria | 4337 |
| 49 | Ga0068869_100593224 | 3300005334 | Bacteria | 935 |
| 50 | Ga0070666_10270584 | 3300005335 | Bacteria | 1206 |
| 51 | Ga0068868_100159375 | 3300005338 | Bacteria | 1863 |
| 52 | Ga0070660_100010089 | 3300005339 | Bacteria | 6665 |
| 53 | Ga0070660_100782922 | 3300005339 | Bacteria | 802 |
| 54 | Ga0070661_100647509 | 3300005344 | Bacteria | 857 |
| 55 | Ga0070661_101085177 | 3300005344 | Bacteria | 666 |
| 56 | Ga0070668_100766997 | 3300005347 | Bacteria | 855 |
| 57 | Ga0070669_100287905 | 3300005353 | Bacteria | 1318 |
| 58 | Ga0070674_100181127 | 3300005356 | Bacteria | 1614 |
| 59 | Ga0070674_100524611 | 3300005356 | Bacteria | 990 |
| 60 | Ga0070674_100629391 | 3300005356 | Bacteria | 910 |
| 61 | Ga0070674_101776554 | 3300005356 | Bacteria | 559 |
| 62 | Ga0070673_100945336 | 3300005364 | Bacteria | 801 |
| 63 | Ga0070673_101209985 | 3300005364 | Bacteria | 708 |
| 64 | Ga0070688_101789278 | 3300005365 | Bacteria | 504 |
| 65 | Ga0070659_100183936 | 3300005366 | Bacteria | 1715 |
| 66 | Ga0070667_100179365 | 3300005367 | Bacteria | 1873 |
| 67 | Ga0070714_100904660 | 3300005435 | Bacteria | 857 |
| 68 | Ga0070663_102137943 | 3300005455 | Bacteria | 505 |
| 69 | Ga0070678_100243295 | 3300005456 | Bacteria | 1505 |
| 70 | Ga0070678_100630753 | 3300005456 | Bacteria | 959 |
| 71 | Ga0070678_101979127 | 3300005456 | Bacteria | 551 |
| 72 | Ga0070662_100039907 | 3300005457 | Bacteria | 3341 |
| 73 | Ga0068867_101691058 | 3300005459 | Bacteria | 593 |
| 74 | Ga0070685_10929949 | 3300005466 | Bacteria | 649 |
| 75 | Ga0070679_100054548 | 3300005530 | Bacteria | 3979 |
| 76 | Ga0068853_100147073 | 3300005539 | Bacteria | 2118 |
| 77 | Ga0068853_101617070 | 3300005539 | Bacteria | 628 |
| 78 | Ga0070665_100010145 | 3300005548 | Bacteria | 9525 |
| 79 | Ga0070665_101595040 | 3300005548 | Bacteria | 660 |
| 80 | Ga0070665_101802463 | 3300005548 | Bacteria | 618 |
| 81 | Ga0068855_100119841 | 3300005563 | Bacteria | 3012 |
| 82 | Ga0068855_100241413 | 3300005563 | Bacteria | 2019 |
| 83 | Ga0068855_101141513 | 3300005563 | Bacteria | 813 |
| 84 | Ga0070664_100040580 | 3300005564 | Bacteria | 3925 |
| 85 | Ga0068857_100073208 | 3300005577 | Bacteria | 3052 |
| 86 | Ga0068857_100157874 | 3300005577 | Bacteria | 2057 |
| 87 | Ga0068857_100927464 | 3300005577 | Bacteria | 836 |
| 88 | Ga0068857_101816737 | 3300005577 | Bacteria | 597 |
| 89 | Ga0068856_100206139 | 3300005614 | Bacteria | 1981 |
| 90 | Ga0068856_100391387 | 3300005614 | Bacteria | 1410 |
| 91 | Ga0068856_101525123 | 3300005614 | Bacteria | 682 |
| 92 | Ga0068852_100107707 | 3300005616 | Bacteria | 2528 |
| 93 | Ga0068852_101034290 | 3300005616 | Bacteria | 840 |
| 94 | Ga0068859_101314464 | 3300005617 | Bacteria | 797 |
| 95 | Ga0068864_101278132 | 3300005618 | Bacteria | 734 |
| 96 | Ga0068866_11377083 | 3300005718 | Bacteria | 515 |
| 97 | Ga0068861_102635540 | 3300005719 | Bacteria | 507 |
| 98 | Ga0068851_10002741 | 3300005834 | Bacteria | 7758 |
| 99 | Ga0068870_11118470 | 3300005840 | Bacteria | 567 |
| 100 | Ga0068863_100134033 | 3300005841 | Bacteria | 2366 |
| 101 | Ga0068858_101685273 | 3300005842 | Bacteria | 626 |
| 102 | Ga0068862_100298255 | 3300005844 | Bacteria | 1482 |
| 103 | Ga0075365_10022096 | 3300006038 | Bacteria | 3980 |
| 104 | Ga0075365_10071228 | 3300006038 | Bacteria | 2340 |
| 105 | Ga0075365_10930983 | 3300006038 | Bacteria | 613 |
| 106 | Ga0075368_10251250 | 3300006042 | Bacteria | 756 |
| 107 | Ga0075363_100007907 | 3300006048 | Bacteria | 4923 |
| 108 | Ga0075363_100258058 | 3300006048 | Bacteria | 1005 |
| 109 | Ga0075363_100816840 | 3300006048 | Bacteria | 568 |
| 110 | Ga0075363_100876610 | 3300006048 | Bacteria | 549 |
| 111 | Ga0075363_100897483 | 3300006048 | Bacteria | 543 |
| 112 | Ga0075364_10020170 | 3300006051 | Bacteria | 4191 |
| 113 | Ga0075364_10081814 | 3300006051 | Bacteria | 2135 |
| 114 | Ga0075364_10210045 | 3300006051 | Bacteria | 1320 |
| 115 | Ga0075364_10227248 | 3300006051 | Bacteria | 1267 |
| 116 | Ga0075364_10970552 | 3300006051 | Bacteria | 578 |
| 117 | Ga0075432_10002614 | 3300006058 | Bacteria | 6016 |
| 118 | Ga0075432_10072540 | 3300006058 | Bacteria | 1239 |
| 119 | Ga0075362_10037995 | 3300006177 | Bacteria | 2113 |
| 120 | Ga0075362_10038214 | 3300006177 | Bacteria | 2108 |
| 121 | Ga0075362_10056377 | 3300006177 | Bacteria | 1768 |
| 122 | Ga0075362_10135941 | 3300006177 | Bacteria | 1172 |
| 123 | Ga0075362_10179908 | 3300006177 | Bacteria | 1024 |
| 124 | Ga0075362_10183140 | 3300006177 | Bacteria | 1015 |
| 125 | Ga0075367_10136738 | 3300006178 | Bacteria | 1516 |
| 126 | Ga0075367_10255335 | 3300006178 | Bacteria | 1100 |
| 127 | Ga0075367_10440384 | 3300006178 | Bacteria | 825 |
| 128 | Ga0075369_10082983 | 3300006186 | Bacteria | 1423 |
| 129 | Ga0075369_10225578 | 3300006186 | Bacteria | 867 |
| 130 | Ga0075366_10016366 | 3300006195 | Bacteria | 4262 |
| 131 | Ga0075366_10025817 | 3300006195 | Bacteria | 3435 |
| 132 | Ga0075366_10045854 | 3300006195 | Bacteria | 2590 |
| 133 | Ga0075366_10077444 | 3300006195 | Bacteria | 1984 |
| 134 | Ga0075366_10084748 | 3300006195 | Bacteria | 1895 |
| 135 | Ga0075366_10116986 | 3300006195 | Bacteria | 1605 |
| 136 | Ga0075366_10462917 | 3300006195 | Bacteria | 783 |
| 137 | Ga0075366_10877728 | 3300006195 | Bacteria | 558 |
| 138 | Ga0097621_100169928 | 3300006237 | Bacteria | 1879 |
| 139 | Ga0097621_101014025 | 3300006237 | Bacteria | 777 |
| 140 | Ga0075370_10001499 | 3300006353 | Bacteria | 10187 |
| 141 | Ga0075370_10002475 | 3300006353 | Bacteria | 8564 |
| 142 | Ga0075370_10004243 | 3300006353 | Bacteria | 6935 |
| 143 | Ga0075370_10088484 | 3300006353 | Bacteria | 1785 |
| 144 | Ga0075370_10094291 | 3300006353 | Bacteria | 1728 |
| 145 | Ga0075370_10226115 | 3300006353 | Bacteria | 1106 |
| 146 | Ga0075370_10247279 | 3300006353 | Bacteria | 1057 |
| 147 | Ga0075370_10258840 | 3300006353 | Bacteria | 1032 |
| 148 | Ga0075370_10311167 | 3300006353 | Bacteria | 937 |
| 149 | Ga0075370_10590513 | 3300006353 | Bacteria | 673 |
| 150 | Ga0075370_10866468 | 3300006353 | Bacteria | 551 |
| 151 | Ga0068871_100023433 | 3300006358 | Bacteria | 4776 |
| 152 | Ga0068871_100737242 | 3300006358 | Bacteria | 905 |
| 153 | Ga0068871_101324974 | 3300006358 | Bacteria | 677 |
| 154 | Ga0068865_100498852 | 3300006881 | Bacteria | 1014 |
| 155 | Ga0068865_100848700 | 3300006881 | Bacteria | 791 |
| 156 | Ga0068865_101090828 | 3300006881 | Bacteria | 703 |
| 157 | Ga0075436_101513180 | 3300006914 | Bacteria | 510 |
| 158 | Ga0097620_101314383 | 3300006931 | Bacteria | 797 |
| 159 | Ga0079104_1021469 | 3300006946 | Bacteria | 1757 |
| 160 | Ga0099826_10000101 | 3300006948 | Bacteria | 40408 |
| 161 | Ga0105251_10646693 | 3300009011 | Bacteria | 505 |
| 162 | Ga0105244_10010520 | 3300009036 | Bacteria | 5606 |
| 163 | Ga0105244_10117797 | 3300009036 | Bacteria | 1288 |
| 164 | Ga0105244_10126774 | 3300009036 | Bacteria | 1233 |
| 165 | Ga0105250_10009366 | 3300009092 | Bacteria | 4128 |
| 166 | Ga0105240_10006365 | 3300009093 | Bacteria | 17386 |
| 167 | Ga0105240_10254488 | 3300009093 | Bacteria | 2029 |
| 168 | Ga0105240_11010638 | 3300009093 | Bacteria | 889 |
| 169 | Ga0105245_10872035 | 3300009098 | Bacteria | 941 |
| 170 | Ga0105243_10003361 | 3300009148 | Bacteria | 12978 |
| 171 | Ga0105243_10260122 | 3300009148 | Bacteria | 1553 |
| 172 | Ga0105243_11061208 | 3300009148 | Bacteria | 816 |
| 173 | Ga0105241_10419025 | 3300009174 | Bacteria | 1178 |
| 174 | Ga0105242_10000553 | 3300009176 | Bacteria | 29613 |
| 175 | Ga0105242_10201925 | 3300009176 | Bacteria | 1766 |
| 176 | Ga0105242_10689738 | 3300009176 | Bacteria | 998 |
| 177 | Ga0105242_10707822 | 3300009176 | Bacteria | 986 |
| 178 | Ga0105248_10166463 | 3300009177 | Bacteria | 2485 |
| 179 | Ga0105248_11054050 | 3300009177 | Bacteria | 919 |
| 180 | Ga0105248_11159186 | 3300009177 | Bacteria | 874 |
| 181 | Ga0105237_11331089 | 3300009545 | Bacteria | 724 |
| 182 | Ga0105237_11629785 | 3300009545 | Bacteria | 652 |
| 183 | Ga0105238_10017091 | 3300009551 | Bacteria | 7363 |
| 184 | Ga0105238_10543900 | 3300009551 | Bacteria | 1165 |
| 185 | Ga0105238_11705029 | 3300009551 | Bacteria | 661 |
| 186 | Ga0105238_11867165 | 3300009551 | Bacteria | 633 |
| 187 | Ga0105249_12090763 | 3300009553 | Bacteria | 639 |
| 188 | Ga0105239_10200838 | 3300010375 | Bacteria | 2233 |
| 189 | Ga0105239_11114608 | 3300010375 | Bacteria | 909 |
| 190 | Ga0105246_10130197 | 3300011119 | Bacteria | 1878 |
| 191 | Ga0105246_10352106 | 3300011119 | Bacteria | 1207 |
| 192 | Ga0105246_11000133 | 3300011119 | Bacteria | 757 |
| 193 | Ga0105246_11534058 | 3300011119 | Bacteria | 627 |
| 194 | Ga0105246_11799169 | 3300011119 | Bacteria | 585 |
| 195 | Ga0157319_1014482 | 3300012497 | Bacteria | 693 |
| 196 | Ga0157347_1002744 | 3300012502 | Bacteria | 1532 |
| 197 | Ga0157347_1026183 | 3300012502 | Bacteria | 709 |
| 198 | Ga0157339_1032486 | 3300012505 | Bacteria | 618 |
| 199 | Ga0157326_1012389 | 3300012513 | Bacteria | 973 |
| 200 | Ga0157373_10094943 | 3300013100 | Bacteria | 2099 |
| 201 | Ga0157373_10626851 | 3300013100 | Bacteria | 784 |
| 202 | Ga0157373_10850502 | 3300013100 | Bacteria | 675 |
| 203 | Ga0157371_10059656 | 3300013102 | Bacteria | 2704 |
| 204 | Ga0157371_10960774 | 3300013102 | Bacteria | 650 |
| 205 | Ga0157370_10011514 | 3300013104 | Bacteria | 9242 |
| 206 | Ga0157370_10072910 | 3300013104 | Bacteria | 3240 |
| 207 | Ga0157370_10485367 | 3300013104 | Bacteria | 1135 |
| 208 | Ga0157370_11952806 | 3300013104 | Bacteria | 526 |
| 209 | Ga0157369_10013149 | 3300013105 | Bacteria | 9367 |
| 210 | Ga0157369_12189830 | 3300013105 | Bacteria | 560 |
| 211 | Ga0157374_10585406 | 3300013296 | Bacteria | 1125 |
| 212 | Ga0157378_11576671 | 3300013297 | Bacteria | 702 |
| 213 | Ga0163162_10362486 | 3300013306 | Bacteria | 1582 |
| 214 | Ga0163162_10698347 | 3300013306 | Bacteria | 1136 |
| 215 | Ga0163162_10817893 | 3300013306 | Bacteria | 1048 |
| 216 | Ga0163162_12441603 | 3300013306 | Bacteria | 601 |
| 217 | Ga0157372_10576067 | 3300013307 | Bacteria | 1312 |
| 218 | Ga0157375_11511848 | 3300013308 | Bacteria | 793 |
| 219 | Ga0157375_11772195 | 3300013308 | Bacteria | 732 |
| 220 | Ga0163163_11594957 | 3300014325 | Bacteria | 714 |
| 221 | Ga0157380_10114627 | 3300014326 | Bacteria | 2272 |
| 222 | Ga0157380_10967518 | 3300014326 | Bacteria | 882 |
| 223 | Ga0157380_12835996 | 3300014326 | Bacteria | 551 |
| 224 | Ga0182008_10001633 | 3300014497 | Bacteria | 14849 |
| 225 | Ga0182008_10058827 | 3300014497 | Bacteria | 1896 |
| 226 | Ga0182008_10075865 | 3300014497 | Bacteria | 1654 |
| 227 | Ga0182008_10141243 | 3300014497 | Bacteria | 1205 |
| 228 | Ga0182008_10565055 | 3300014497 | Bacteria | 634 |
| 229 | Ga0182008_10688862 | 3300014497 | Bacteria | 583 |
| 230 | Ga0157377_11375600 | 3300014745 | Bacteria | 555 |
| 231 | Ga0157379_10208061 | 3300014968 | Bacteria | 1770 |
| 232 | Ga0157376_10344535 | 3300014969 | Bacteria | 1424 |
| 233 | Ga0157376_10709139 | 3300014969 | Bacteria | 1012 |
| 234 | Ga0157376_10825833 | 3300014969 | Bacteria | 941 |
| 235 | Ga0182006_1010501 | 3300015261 | Bacteria | 4114 |
| 236 | Ga0182006_1025900 | 3300015261 | Bacteria | 2406 |
| 237 | Ga0182006_1150238 | 3300015261 | Bacteria | 790 |
| 238 | Ga0182006_1176170 | 3300015261 | Bacteria | 714 |
| 239 | Ga0182006_1233599 | 3300015261 | Bacteria | 605 |
| 240 | Ga0182007_10000853 | 3300015262 | Bacteria | 16919 |
| 241 | Ga0182007_10003809 | 3300015262 | Bacteria | 7024 |
| 242 | Ga0182007_10343066 | 3300015262 | Bacteria | 559 |
| 243 | Ga0182005_1052265 | 3300015265 | Bacteria | 1112 |
| 244 | Ga0182005_1072204 | 3300015265 | Bacteria | 948 |
| 245 | Ga0182005_1078107 | 3300015265 | Bacteria | 912 |
| 246 | Ga0163161_10001891 | 3300017792 | Bacteria | 15283 |
| 247 | Ga0163161_10007216 | 3300017792 | Bacteria | 7680 |
| 248 | Ga0163161_10008493 | 3300017792 | Bacteria | 7114 |
| 249 | Ga0163161_10042751 | 3300017792 | Bacteria | 3261 |
| 250 | Ga0163161_10122988 | 3300017792 | Bacteria | 1951 |
| 251 | Ga0209436_123904 | 3300025208 | Bacteria | 757 |
| 252 | Ga0209672_100642 | 3300025228 | Bacteria | 17975 |
| 253 | Ga0209147_100995 | 3300025229 | Bacteria | 12281 |
| 254 | Ga0209258_100093 | 3300025242 | Bacteria | 223559 |
| 255 | Ga0207425_1000989 | 3300025245 | Bacteria | 13329 |
| 256 | Ga0207425_1009140 | 3300025245 | Bacteria | 2484 |
| 257 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 258 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 259 | Ga0209129_1006303 | 3300025258 | Bacteria | 3884 |
| 260 | Ga0209129_1010886 | 3300025258 | Bacteria | 2222 |
| 261 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 262 | Ga0209565_1000633 | 3300025263 | Bacteria | 22947 |
| 263 | Ga0209565_1042110 | 3300025263 | Bacteria | 847 |
| 264 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 265 | Ga0209673_1001034 | 3300025273 | Bacteria | 32757 |
| 266 | Ga0209673_1039935 | 3300025273 | Bacteria | 1348 |
| 267 | Ga0209673_1041386 | 3300025273 | Bacteria | 1308 |
| 268 | Ga0209673_1052393 | 3300025273 | Bacteria | 1071 |
| 269 | Ga0209130_1000654 | 3300025284 | Bacteria | 31825 |
| 270 | Ga0209130_1001114 | 3300025284 | Bacteria | 19756 |
| 271 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 272 | Ga0209675_1000151 | 3300025291 | Bacteria | 91172 |
| 273 | Ga0209675_1003092 | 3300025291 | Bacteria | 8132 |
| 274 | Ga0209675_1007033 | 3300025291 | Bacteria | 4388 |
| 275 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 276 | Ga0209676_1001046 | 3300025292 | Bacteria | 31878 |
| 277 | Ga0209676_1003308 | 3300025292 | Bacteria | 10090 |
| 278 | Ga0209676_1025199 | 3300025292 | Bacteria | 1912 |
| 279 | Ga0209676_1027854 | 3300025292 | Bacteria | 1771 |
| 280 | Ga0209676_1064029 | 3300025292 | Bacteria | 901 |
| 281 | Ga0209025_1000685 | 3300025294 | Bacteria | 58093 |
| 282 | Ga0209025_1001904 | 3300025294 | Bacteria | 24327 |
| 283 | Ga0209025_1005469 | 3300025294 | Bacteria | 10341 |
| 284 | Ga0209025_1078148 | 3300025294 | Bacteria | 1137 |
| 285 | Ga0209564_1000209 | 3300025295 | Bacteria | 133651 |
| 286 | Ga0209564_1002281 | 3300025295 | Bacteria | 15652 |
| 287 | Ga0209758_1001224 | 3300025297 | Bacteria | 32124 |
| 288 | Ga0209758_1037536 | 3300025297 | Bacteria | 1871 |
| 289 | Ga0209050_1000072 | 3300025298 | Bacteria | 293619 |
| 290 | Ga0209050_1000927 | 3300025298 | Bacteria | 38487 |
| 291 | Ga0209050_1004050 | 3300025298 | Bacteria | 10280 |
| 292 | Ga0209050_1008317 | 3300025298 | Bacteria | 5579 |
| 293 | Ga0209256_1000088 | 3300025299 | Bacteria | 217236 |
| 294 | Ga0209256_1023010 | 3300025299 | Bacteria | 1870 |
| 295 | Ga0209256_1025808 | 3300025299 | Bacteria | 1705 |
| 296 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 297 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 298 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 299 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 300 | Ga0209051_1000196 | 3300025303 | Bacteria | 107028 |
| 301 | Ga0209051_1000392 | 3300025303 | Bacteria | 61223 |
| 302 | Ga0209051_1000424 | 3300025303 | Bacteria | 57966 |
| 303 | Ga0209051_1000545 | 3300025303 | Bacteria | 46076 |
| 304 | Ga0209257_1000305 | 3300025304 | Bacteria | 107001 |
| 305 | Ga0209257_1002205 | 3300025304 | Bacteria | 20116 |
| 306 | Ga0209257_1004602 | 3300025304 | Bacteria | 10500 |
| 307 | Ga0209257_1009796 | 3300025304 | Bacteria | 5020 |
| 308 | Ga0209257_1059782 | 3300025304 | Bacteria | 1039 |
| 309 | Ga0207656_10012795 | 3300025321 | Bacteria | 3194 |
| 310 | Ga0207655_1006555 | 3300025728 | Bacteria | 7689 |
| 311 | Ga0207655_1222623 | 3300025728 | Bacteria | 549 |
| 312 | Ga0207682_10318236 | 3300025893 | Bacteria | 731 |
| 313 | Ga0207688_10900022 | 3300025901 | Bacteria | 560 |
| 314 | Ga0207680_10255063 | 3300025903 | Bacteria | 1212 |
| 315 | Ga0207705_10022490 | 3300025909 | Bacteria | 4496 |
| 316 | Ga0207705_10074648 | 3300025909 | Bacteria | 2462 |
| 317 | Ga0207705_10472555 | 3300025909 | Bacteria | 973 |
| 318 | Ga0207654_10240763 | 3300025911 | Bacteria | 1209 |
| 319 | Ga0207695_10060685 | 3300025913 | Bacteria | 3913 |
| 320 | Ga0207671_10088086 | 3300025914 | Bacteria | 2335 |
| 321 | Ga0207671_10806075 | 3300025914 | Bacteria | 745 |
| 322 | Ga0207660_10181378 | 3300025917 | Bacteria | 1635 |
| 323 | Ga0207657_10014060 | 3300025919 | Bacteria | 7832 |
| 324 | Ga0207657_10282786 | 3300025919 | Bacteria | 1317 |
| 325 | Ga0207649_10704367 | 3300025920 | Bacteria | 783 |
| 326 | Ga0207649_10810040 | 3300025920 | Bacteria | 731 |
| 327 | Ga0207652_10088927 | 3300025921 | Bacteria | 2711 |
| 328 | Ga0207652_10161675 | 3300025921 | Bacteria | 2008 |
| 329 | Ga0207694_10022934 | 3300025924 | Bacteria | 4736 |
| 330 | Ga0207694_10250337 | 3300025924 | Bacteria | 1449 |
| 331 | Ga0207694_10767923 | 3300025924 | Bacteria | 814 |
| 332 | Ga0207650_10312000 | 3300025925 | Bacteria | 1287 |
| 333 | Ga0207659_10732672 | 3300025926 | Bacteria | 847 |
| 334 | Ga0207659_11340761 | 3300025926 | Bacteria | 614 |
| 335 | Ga0207687_10015912 | 3300025927 | Bacteria | 4935 |
| 336 | Ga0207664_10600294 | 3300025929 | Bacteria | 988 |
| 337 | Ga0207690_10127659 | 3300025932 | Bacteria | 1856 |
| 338 | Ga0207690_11043904 | 3300025932 | Bacteria | 680 |
| 339 | Ga0207706_10075902 | 3300025933 | Bacteria | 2956 |
| 340 | Ga0207706_10275666 | 3300025933 | Bacteria | 1467 |
| 341 | Ga0207686_10001796 | 3300025934 | Bacteria | 11922 |
| 342 | Ga0207686_10224147 | 3300025934 | Bacteria | 1359 |
| 343 | Ga0207686_10579039 | 3300025934 | Bacteria | 881 |
| 344 | Ga0207709_10000958 | 3300025935 | Bacteria | 21596 |
| 345 | Ga0207709_10001025 | 3300025935 | Bacteria | 20674 |
| 346 | Ga0207709_10001291 | 3300025935 | Bacteria | 17879 |
| 347 | Ga0207709_10002267 | 3300025935 | Bacteria | 12201 |
| 348 | Ga0207709_10002735 | 3300025935 | Bacteria | 10877 |
| 349 | Ga0207709_10203263 | 3300025935 | Bacteria | 1416 |
| 350 | Ga0207669_10822658 | 3300025937 | Bacteria | 771 |
| 351 | Ga0207704_10521793 | 3300025938 | Bacteria | 961 |
| 352 | Ga0207704_10843252 | 3300025938 | Bacteria | 768 |
| 353 | Ga0207704_11670850 | 3300025938 | Bacteria | 547 |
| 354 | Ga0207691_10759872 | 3300025940 | Bacteria | 816 |
| 355 | Ga0207691_11492302 | 3300025940 | Bacteria | 553 |
| 356 | Ga0207711_10494626 | 3300025941 | Bacteria | 1140 |
| 357 | Ga0207711_12098101 | 3300025941 | Bacteria | 508 |
| 358 | Ga0207689_10065726 | 3300025942 | Bacteria | 2983 |
| 359 | Ga0207689_10081640 | 3300025942 | Bacteria | 2657 |
| 360 | Ga0207689_10482507 | 3300025942 | Bacteria | 1038 |
| 361 | Ga0207689_10670999 | 3300025942 | Bacteria | 874 |
| 362 | Ga0207679_10066316 | 3300025945 | Bacteria | 2705 |
| 363 | Ga0207667_10341672 | 3300025949 | Bacteria | 1528 |
| 364 | Ga0207667_10374716 | 3300025949 | Bacteria | 1450 |
| 365 | Ga0207667_10674686 | 3300025949 | Bacteria | 1037 |
| 366 | Ga0207667_11952205 | 3300025949 | Bacteria | 548 |
| 367 | Ga0207651_10255794 | 3300025960 | Bacteria | 1435 |
| 368 | Ga0207651_10421668 | 3300025960 | Bacteria | 1139 |
| 369 | Ga0207668_10248284 | 3300025972 | Bacteria | 1444 |
| 370 | Ga0207668_12032824 | 3300025972 | Bacteria | 518 |
| 371 | Ga0207640_10178836 | 3300025981 | Bacteria | 1588 |
| 372 | Ga0207640_10754190 | 3300025981 | Bacteria | 839 |
| 373 | Ga0207658_10267667 | 3300025986 | Bacteria | 1459 |
| 374 | Ga0207658_10747812 | 3300025986 | Bacteria | 885 |
| 375 | Ga0207658_11007527 | 3300025986 | Bacteria | 760 |
| 376 | Ga0207677_10181460 | 3300026023 | Bacteria | 1656 |
| 377 | Ga0207677_10493446 | 3300026023 | Bacteria | 1057 |
| 378 | Ga0207639_10010944 | 3300026041 | Bacteria | 6291 |
| 379 | Ga0207639_11073821 | 3300026041 | Bacteria | 755 |
| 380 | Ga0207639_11245984 | 3300026041 | Bacteria | 698 |
| 381 | Ga0207678_10395257 | 3300026067 | Bacteria | 1196 |
| 382 | Ga0207702_10246572 | 3300026078 | Bacteria | 1676 |
| 383 | Ga0207702_11035726 | 3300026078 | Bacteria | 814 |
| 384 | Ga0207641_10024357 | 3300026088 | Bacteria | 4989 |
| 385 | Ga0207648_10874461 | 3300026089 | Bacteria | 839 |
| 386 | Ga0207648_11344358 | 3300026089 | Bacteria | 671 |
| 387 | Ga0207674_10202033 | 3300026116 | Bacteria | 1937 |
| 388 | Ga0207674_10486044 | 3300026116 | Bacteria | 1193 |
| 389 | Ga0207674_10713668 | 3300026116 | Bacteria | 968 |
| 390 | Ga0207683_10180083 | 3300026121 | Bacteria | 1916 |
| 391 | Ga0207683_10332354 | 3300026121 | Bacteria | 1393 |
| 392 | Ga0207698_10296757 | 3300026142 | Bacteria | 1502 |
| 393 | Ga0207698_11526489 | 3300026142 | Bacteria | 683 |
| 394 | Ga0209281_1033796 | 3300027111 | Bacteria | 897 |
| 395 | Ga0209282_1001024 | 3300027666 | Bacteria | 14706 |
| 396 | Ga0209813_10141295 | 3300027866 | Bacteria | 855 |
| 397 | Ga0209974_10085254 | 3300027876 | Bacteria | 1091 |
| 398 | Ga0207428_10127051 | 3300027907 | Bacteria | 1952 |
| 399 | Ga0268266_10218330 | 3300028379 | Bacteria | 1751 |
| 400 | Ga0268265_10386394 | 3300028380 | Bacteria | 1289 |
| 401 | Ga0268264_12398864 | 3300028381 | Bacteria | 533 |
| 402 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 403 | Ga0307515_10072156 | 3300028794 | Bacteria | 4666 |
| 404 | Ga0307515_10483798 | 3300028794 | Bacteria | 850 |
| 405 | Ga0307515_10538684 | 3300028794 | Bacteria | 777 |
| 406 | Ga0307512_10121381 | 3300030522 | Bacteria | 1677 |
| 407 | Ga0316177_1148101 | 3300030731 | Bacteria | 3719 |
| 408 | Ga0314311_1237239 | 3300030733 | Bacteria | 1505 |
| 409 | Ga0316178_1016090 | 3300030735 | Bacteria | 1219 |
| 410 | Ga0316180_1033885 | 3300030736 | Bacteria | 1336 |
| 411 | Ga0316183_1122753 | 3300030742 | Bacteria | 1765 |
| 412 | Ga0316181_1085526 | 3300030744 | Bacteria | 1950 |
| 413 | Ga0316182_1238099 | 3300030745 | Bacteria | 1133 |
| 414 | Ga0316182_1399987 | 3300030745 | Bacteria | 2746 |
| 415 | Ga0265327_10148026 | 3300031251 | Bacteria | 1092 |
| 416 | Ga0307513_10026225 | 3300031456 | Bacteria | 6725 |
| 417 | Ga0307513_10519366 | 3300031456 | Bacteria | 906 |
| 418 | Ga0307408_100073371 | 3300031548 | Bacteria | 2536 |
| 419 | Ga0307408_100080304 | 3300031548 | Bacteria | 2435 |
| 420 | Ga0307408_100161448 | 3300031548 | Bacteria | 1780 |
| 421 | Ga0307408_100266625 | 3300031548 | Bacteria | 1420 |
| 422 | Ga0307408_100280671 | 3300031548 | Bacteria | 1387 |
| 423 | Ga0307408_100316751 | 3300031548 | Bacteria | 1312 |
| 424 | Ga0307408_100464861 | 3300031548 | Bacteria | 1100 |
| 425 | Ga0307408_100480893 | 3300031548 | Bacteria | 1083 |
| 426 | Ga0307408_100546985 | 3300031548 | Bacteria | 1021 |
| 427 | Ga0307408_101249100 | 3300031548 | Bacteria | 694 |
| 428 | Ga0307408_101845938 | 3300031548 | Bacteria | 578 |
| 429 | Ga0307408_102262748 | 3300031548 | Bacteria | 526 |
| 430 | Ga0307514_10000954 | 3300031649 | Bacteria | 43472 |
| 431 | Ga0307514_10138226 | 3300031649 | Bacteria | 1662 |
| 432 | Ga0265314_10007074 | 3300031711 | Bacteria | 9791 |
| 433 | Ga0307405_10022681 | 3300031731 | Bacteria | 3553 |
| 434 | Ga0307405_10203872 | 3300031731 | Bacteria | 1438 |
| 435 | Ga0307405_10313310 | 3300031731 | Bacteria | 1195 |
| 436 | Ga0307405_10474225 | 3300031731 | Bacteria | 997 |
| 437 | Ga0307413_10138982 | 3300031824 | Bacteria | 1675 |
| 438 | Ga0307413_10454530 | 3300031824 | Bacteria | 1017 |
| 439 | Ga0307413_10903079 | 3300031824 | Bacteria | 750 |
| 440 | Ga0307410_10510404 | 3300031852 | Bacteria | 990 |
| 441 | Ga0307410_10530941 | 3300031852 | Bacteria | 972 |
| 442 | Ga0307410_11552995 | 3300031852 | Bacteria | 584 |
| 443 | Ga0307406_10001705 | 3300031901 | Bacteria | 12082 |
| 444 | Ga0307406_10029763 | 3300031901 | Bacteria | 3309 |
| 445 | Ga0307406_10444781 | 3300031901 | Bacteria | 1038 |
| 446 | Ga0307406_10880524 | 3300031901 | Bacteria | 761 |
| 447 | Ga0307406_10985024 | 3300031901 | Bacteria | 722 |
| 448 | Ga0307406_11055058 | 3300031901 | Bacteria | 700 |
| 449 | Ga0307407_10127011 | 3300031903 | Bacteria | 1625 |
| 450 | Ga0307407_10219229 | 3300031903 | Bacteria | 1285 |
| 451 | Ga0307412_10009231 | 3300031911 | Bacteria | 5653 |
| 452 | Ga0307412_10018497 | 3300031911 | Bacteria | 4194 |
| 453 | Ga0307412_10040329 | 3300031911 | Bacteria | 3020 |
| 454 | Ga0307412_10069765 | 3300031911 | Bacteria | 2393 |
| 455 | Ga0307412_10164512 | 3300031911 | Bacteria | 1652 |
| 456 | Ga0307412_10239149 | 3300031911 | Bacteria | 1403 |
| 457 | Ga0307412_10434341 | 3300031911 | Bacteria | 1077 |
| 458 | Ga0307412_10818926 | 3300031911 | Bacteria | 810 |
| 459 | Ga0307412_10882358 | 3300031911 | Bacteria | 782 |
| 460 | Ga0307412_11066941 | 3300031911 | Bacteria | 717 |
| 461 | Ga0307412_11218498 | 3300031911 | Bacteria | 674 |
| 462 | Ga0307409_100360040 | 3300031995 | Bacteria | 1376 |
| 463 | Ga0307409_101306064 | 3300031995 | Bacteria | 751 |
| 464 | Ga0307416_100090654 | 3300032002 | Bacteria | 2622 |
| 465 | Ga0307416_100648391 | 3300032002 | Bacteria | 1140 |
| 466 | Ga0307416_100665749 | 3300032002 | Bacteria | 1127 |
| 467 | Ga0307416_100692627 | 3300032002 | Bacteria | 1107 |
| 468 | Ga0307416_101187508 | 3300032002 | Bacteria | 868 |
| 469 | Ga0307416_101387557 | 3300032002 | Bacteria | 808 |
| 470 | Ga0307416_102124172 | 3300032002 | Bacteria | 663 |
| 471 | Ga0307416_103302620 | 3300032002 | Bacteria | 540 |
| 472 | Ga0307414_10068974 | 3300032004 | Bacteria | 2539 |
| 473 | Ga0307414_10091564 | 3300032004 | Bacteria | 2260 |
| 474 | Ga0307414_10593157 | 3300032004 | Bacteria | 993 |
| 475 | Ga0307414_10877261 | 3300032004 | Bacteria | 822 |
| 476 | Ga0307414_12203709 | 3300032004 | Bacteria | 514 |
| 477 | Ga0307411_10024402 | 3300032005 | Bacteria | 3604 |
| 478 | Ga0307411_10178581 | 3300032005 | Bacteria | 1609 |
| 479 | Ga0307411_10311964 | 3300032005 | Bacteria | 1266 |
| 480 | Ga0307411_10454826 | 3300032005 | Bacteria | 1072 |
| 481 | Ga0307411_10974878 | 3300032005 | Bacteria | 757 |
| 482 | Ga0307411_11479876 | 3300032005 | Bacteria | 623 |
| 483 | Ga0307411_12260670 | 3300032005 | Bacteria | 510 |
| 484 | Ga0307415_101084036 | 3300032126 | Bacteria | 749 |
| 485 | Ga0373943_0428727 | 3300035170 | Bacteria | 766 |
| 486 | Ga0373931_0089159 | 3300035691 | Bacteria | 1716 |
| 487 | Ga0395899_0104110 | 3300037312 | Bacteria | 2046 |
| 488 | Ga0395900_0161473 | 3300037418 | Bacteria | 2285 |
| 489 | Ga0395898_0294881 | 3300037466 | Bacteria | 1547 |
| 490 | Ga0395905_0050498 | 3300037471 | Bacteria | 3896 |
| 491 | Ga0395905_0633031 | 3300037471 | Bacteria | 971 |
| 492 | Ga0395901_0074087 | 3300038443 | Bacteria | 3552 |
| 493 | Ga0395901_0435328 | 3300038443 | Bacteria | 1343 |
| 494 | Ga0395901_1223270 | 3300038443 | Bacteria | 716 |
| 495 | Ga0436361_0070738 | 3300039447 | Bacteria | 27213 |
| 496 | Ga0439436_0001048 | 3300041404 | Bacteria | 7765 |
| 497 | Ga0439436_0049230 | 3300041404 | Bacteria | 1194 |
| 498 | Ga0439436_0265955 | 3300041404 | Bacteria | 500 |
| 499 | Ga0439438_081388 | 3300041405 | Bacteria | 794 |
| 500 | Ga0439439_0000268 | 3300041406 | Bacteria | 8200 |
| 501 | Ga0439439_0039004 | 3300041406 | Bacteria | 1227 |
| 502 | Ga0439447_023051 | 3300041407 | Bacteria | 1625 |
| 503 | Ga0439461_0006198 | 3300041410 | Bacteria | 2077 |
| 504 | Ga0439461_0051778 | 3300041410 | Bacteria | 912 |
| 505 | Ga0439461_0077677 | 3300041410 | Bacteria | 779 |
| 506 | Ga0439461_0101819 | 3300041410 | Bacteria | 700 |
| 507 | Ga0439466_0004086 | 3300041411 | Bacteria | 5638 |
| 508 | Ga0439466_0051658 | 3300041411 | Bacteria | 1345 |
| 509 | Ga0439466_0106718 | 3300041411 | Bacteria | 870 |
| 510 | Ga0439466_0238257 | 3300041411 | Bacteria | 551 |
| 511 | Ga0439465_0003993 | 3300041413 | Bacteria | 4808 |
| 512 | Ga0439465_0023149 | 3300041413 | Bacteria | 1954 |
| 513 | Ga0451787_019627 | 3300041441 | Bacteria | 828 |
| 514 | Ga0451789_0111381 | 3300041443 | Bacteria | 523 |
| 515 | Ga0451791_1495823 | 3300041451 | Bacteria | 572 |
| 516 | Ga0451793_0435770 | 3300041452 | Bacteria | 960 |
| 517 | Ga0451793_1075355 | 3300041452 | Bacteria | 1045 |
| 518 | Ga0451793_1159892 | 3300041452 | Bacteria | 628 |
| 519 | Ga0451797_0157609 | 3300041453 | Bacteria | 578 |
| 520 | Ga0451795_1558984 | 3300041456 | Bacteria | 531 |
| 521 | Ga0451798_0238516 | 3300041458 | Bacteria | 585 |
| 522 | Ga0451800_1458506 | 3300041459 | Bacteria | 631 |
| 523 | Ga0451802_0624242 | 3300041460 | Bacteria | 863 |
| 524 | Ga0451807_0286398 | 3300041486 | Bacteria | 846 |
| 525 | Ga0451807_1888789 | 3300041486 | Bacteria | 510 |
| 526 | Ga0451833_0083665 | 3300041491 | Bacteria | 559 |
| 527 | Ga0451837_0663527 | 3300041494 | Bacteria | 596 |
| 528 | Ga0451841_0595886 | 3300041498 | Bacteria | 901 |
| 529 | Ga0451849_1011591 | 3300041505 | Bacteria | 562 |
| 530 | Ga0451853_1220038 | 3300041512 | Bacteria | 535 |
| 531 | Ga0439431_0000483 | 3300041997 | Bacteria | 8459 |
| 532 | Ga0439431_0022187 | 3300041997 | Bacteria | 1529 |
| 533 | Ga0439433_0002772 | 3300041999 | Bacteria | 3733 |
| 534 | Ga0439433_0007775 | 3300041999 | Bacteria | 2317 |
| 535 | Ga0439437_038995 | 3300042000 | Bacteria | 613 |
| 536 | Ga0439437_044912 | 3300042000 | Bacteria | 578 |
| 537 | Ga0439442_026084 | 3300042002 | Bacteria | 1216 |
| 538 | Ga0439442_035387 | 3300042002 | Bacteria | 1044 |
| 539 | Ga0439445_0255926 | 3300042004 | Bacteria | 523 |
| 540 | Ga0439432_001040 | 3300042006 | Bacteria | 10528 |
| 541 | Ga0439432_096329 | 3300042006 | Bacteria | 887 |
| 542 | Ga0439432_213823 | 3300042006 | Bacteria | 557 |
| 543 | Ga0439449_0019219 | 3300042007 | Bacteria | 2561 |
| 544 | Ga0439449_0130775 | 3300042007 | Bacteria | 933 |
| 545 | Ga0439452_003891 | 3300042010 | Bacteria | 5118 |
| 546 | Ga0439452_006902 | 3300042010 | Bacteria | 3517 |
| 547 | Ga0439454_012408 | 3300042011 | Bacteria | 1156 |
| 548 | Ga0439457_012603 | 3300042014 | Bacteria | 1905 |
| 549 | Ga0439457_046768 | 3300042014 | Bacteria | 968 |
| 550 | Ga0439457_065680 | 3300042014 | Bacteria | 824 |
| 551 | Ga0439462_0001318 | 3300042015 | Bacteria | 5467 |
| 552 | Ga0439462_0079804 | 3300042015 | Bacteria | 893 |
| 553 | Ga0450911_030684 | 3300042115 | Bacteria | 697 |
| 554 | Ga0450912_032470 | 3300042116 | Bacteria | 545 |
| 555 | Ga0450919_015142 | 3300042121 | Bacteria | 871 |
| 556 | Ga0450920_033381 | 3300042122 | Bacteria | 1017 |
| 557 | Ga0450921_005413 | 3300042123 | Bacteria | 964 |
| 558 | Ga0450922_022460 | 3300042124 | Bacteria | 657 |
| 559 | Ga0450923_005097 | 3300042125 | Bacteria | 2103 |
| 560 | Ga0450888_039612 | 3300042126 | Bacteria | 652 |
| 561 | Ga0450890_078893 | 3300042127 | Bacteria | 535 |
| 562 | Ga0450894_041805 | 3300042131 | Bacteria | 659 |
| 563 | Ga0450896_015628 | 3300042133 | Bacteria | 1087 |
| 564 | Ga0450896_036011 | 3300042133 | Bacteria | 761 |
| 565 | Ga0450898_006200 | 3300042134 | Bacteria | 1829 |
| 566 | Ga0450898_018085 | 3300042134 | Bacteria | 1218 |
| 567 | Ga0450900_033416 | 3300042136 | Bacteria | 753 |
| 568 | Ga0450906_005730 | 3300042145 | Bacteria | 2536 |
| 569 | Ga0450910_010111 | 3300042147 | Bacteria | 1340 |
| 570 | Ga0450910_054393 | 3300042147 | Bacteria | 666 |
| 571 | Ga0439446_0005262 | 3300042156 | Bacteria | 3322 |
| 572 | Ga0439446_0048173 | 3300042156 | Bacteria | 1269 |
| 573 | Ga0439446_0124007 | 3300042156 | Bacteria | 833 |
| 574 | Ga0439446_0139013 | 3300042156 | Bacteria | 792 |
| 575 | Ga0439446_0182861 | 3300042156 | Bacteria | 701 |
| 576 | Ga0450908_004957 | 3300042184 | Bacteria | 2557 |
| 577 | Ga0450908_005518 | 3300042184 | Bacteria | 2424 |
| 578 | Ga0439434_0004240 | 3300042435 | Bacteria | 4188 |
| 579 | Ga0439434_0006113 | 3300042435 | Bacteria | 3511 |
| 580 | Ga0439434_0024175 | 3300042435 | Bacteria | 1832 |
| 581 | Ga0450918_007011 | 3300042531 | Bacteria | 2002 |
| 582 | Ga0450893_0001626 | 3300042532 | Bacteria | 3452 |
| 583 | Ga0450893_0027591 | 3300042532 | Bacteria | 1001 |
| 584 | Ga0450893_0064141 | 3300042532 | Bacteria | 706 |
| 585 | Ga0450893_0112883 | 3300042532 | Bacteria | 562 |
| 586 | Ga0451577_0007910 | 3300042876 | Bacteria | 10388 |
| 587 | Ga0451577_0129918 | 3300042876 | Bacteria | 2259 |
| 588 | Ga0453683_0009185 | 3300044673 | Bacteria | 6605 |
| 589 | Ga0466965_0050739 | 3300044683 | Bacteria | 2057 |
| 590 | Ga0453684_0026869 | 3300044712 | Bacteria | 8292 |
| 591 | Ga0453684_0763732 | 3300044712 | Bacteria | 1045 |
| 592 | Ga0453684_1589321 | 3300044712 | Bacteria | 671 |
| 593 | Ga0466971_0401815 | 3300044719 | Bacteria | 668 |
| 594 | Ga0466957_0394886 | 3300044842 | Bacteria | 945 |
| 595 | Ga0466960_0024961 | 3300044901 | Bacteria | 2701 |
| 596 | Ga0451576_0018182 | 3300045051 | Bacteria | 7710 |
| 597 | Ga0451576_0788109 | 3300045051 | Bacteria | 998 |
| 598 | Ga0466967_0959779 | 3300045976 | Bacteria | 851 |
| 599 | Ga0495627_001913 | 3300046453 | Bacteria | 10880 |
| 600 | Ga0495627_084868 | 3300046453 | Bacteria | 914 |
| 601 | Ga0495629_0801468 | 3300046459 | Bacteria | 621 |
| 602 | Ga0495638_0119583 | 3300046460 | Bacteria | 1558 |
| 603 | Ga0495651_0382814 | 3300046462 | Bacteria | 922 |
| 604 | Ga0495653_0500140 | 3300046463 | Bacteria | 758 |
| 605 | Ga0495653_0969763 | 3300046463 | Bacteria | 504 |
| 606 | Ga0495650_0113844 | 3300046471 | Bacteria | 1002 |
| 607 | Ga0495639_0023242 | 3300046475 | Bacteria | 2723 |
| 608 | Ga0495610_0024818 | 3300046512 | Bacteria | 3229 |
| 609 | Ga0495610_0212363 | 3300046512 | Bacteria | 786 |
| 610 | Ga0495616_0010183 | 3300046513 | Bacteria | 5456 |
| 611 | Ga0495620_0002466 | 3300046515 | Bacteria | 10724 |
| 612 | Ga0495620_0218188 | 3300046515 | Bacteria | 730 |
| 613 | Ga0495628_0750912 | 3300046516 | Bacteria | 686 |
| 614 | Ga0495630_0489811 | 3300046517 | Bacteria | 943 |
| 615 | Ga0495631_0003037 | 3300046518 | Bacteria | 9274 |
| 616 | Ga0495637_0003474 | 3300046520 | Bacteria | 8367 |
| 617 | Ga0495663_0153113 | 3300046525 | Bacteria | 788 |
| 618 | Ga0495642_0240402 | 3300046528 | Bacteria | 791 |
| 619 | Ga0495652_0731076 | 3300046529 | Bacteria | 664 |
| 620 | Ga0495654_0011433 | 3300046530 | Bacteria | 4802 |
| 621 | Ga0495621_0013869 | 3300046539 | Bacteria | 2541 |
| 622 | Ga0495621_0019672 | 3300046539 | Bacteria | 2207 |
| 623 | Ga0495621_0302859 | 3300046539 | Bacteria | 663 |
| 624 | Ga0495622_0104723 | 3300046557 | Bacteria | 1296 |
| 625 | Ga0495633_0270865 | 3300046558 | Bacteria | 773 |
| 626 | Ga0495656_0000746 | 3300046615 | Bacteria | 10523 |
| 627 | Ga0495634_0699015 | 3300046642 | Bacteria | 583 |
| 628 | Ga0495625_0005468 | 3300046660 | Bacteria | 11573 |
| 629 | Ga0495625_0069851 | 3300046660 | Bacteria | 2467 |
| 630 | Ga0495625_0238885 | 3300046660 | Bacteria | 1183 |
| 631 | Ga0495661_0328406 | 3300046665 | Bacteria | 758 |
| 632 | Ga0495661_0420979 | 3300046665 | Bacteria | 647 |
| 633 | Ga0495588_0102512 | 3300046674 | Bacteria | 1504 |
| 634 | Ga0495588_0373218 | 3300046674 | Bacteria | 749 |
| 635 | Ga0495658_0063297 | 3300046683 | Bacteria | 2128 |
| 636 | Ga0495658_1072531 | 3300046683 | Bacteria | 514 |
| 637 | Ga0495669_0657056 | 3300046684 | Bacteria | 510 |
| 638 | Ga0495624_0128461 | 3300046690 | Bacteria | 1555 |
| 639 | Ga0495624_0344680 | 3300046690 | Bacteria | 896 |
| 640 | Ga0495670_0212498 | 3300046691 | Bacteria | 1026 |
| 641 | Ga0495670_0255194 | 3300046691 | Bacteria | 935 |
| 642 | Ga0495670_0393707 | 3300046691 | Bacteria | 748 |
| 643 | Ga0495670_0529958 | 3300046691 | Bacteria | 640 |
| 644 | Ga0495671_0009329 | 3300046692 | Bacteria | 5482 |
| 645 | Ga0495581_0353461 | 3300047315 | Bacteria | 858 |
| 646 | Ga0495604_1012317 | 3300047317 | Bacteria | 514 |
| 647 | Ga0495676_0102050 | 3300047321 | Bacteria | 2120 |
| 648 | Ga0495677_0467489 | 3300047445 | Bacteria | 500 |
| 649 | Ga0495681_0345125 | 3300047470 | Bacteria | 567 |
| 650 | Ga0495686_0214275 | 3300047472 | Bacteria | 1099 |
| 651 | Ga0495593_0012263 | 3300047673 | Bacteria | 4898 |
| 652 | Ga0495602_0384296 | 3300048088 | Bacteria | 1005 |
| 653 | Ga0495614_0051869 | 3300048089 | Bacteria | 1758 |
| 654 | Ga0495614_0262777 | 3300048089 | Bacteria | 792 |
| 655 | Ga0495615_0096335 | 3300048090 | Bacteria | 831 |
| 656 | Ga0495615_0120639 | 3300048090 | Bacteria | 758 |
| 657 | Ga0496100_0009165 | 3300048903 | Bacteria | 5553 |
| 658 | Ga0496101_0004382 | 3300048904 | Bacteria | 8872 |
| 659 | Ga0496101_0005001 | 3300048904 | Bacteria | 8419 |
| 660 | Ga0496102_0006127 | 3300048905 | Bacteria | 10246 |
| 661 | Ga0496103_0210241 | 3300048906 | Bacteria | 1251 |
| 662 | Ga0496104_0029955 | 3300048907 | Bacteria | 5053 |
| 663 | Ga0496105_0004053 | 3300048908 | Bacteria | 10967 |
| 664 | Ga0496106_0009081 | 3300048909 | Bacteria | 7347 |
| 665 | Ga0496107_0054704 | 3300048910 | Bacteria | 2881 |
| 666 | Ga0496107_0175066 | 3300048910 | Bacteria | 1593 |
| 667 | Ga0496108_0571847 | 3300048911 | Bacteria | 985 |
| 668 | Ga0496109_0227502 | 3300048912 | Bacteria | 1754 |
| 669 | Ga0496109_0594722 | 3300048912 | Bacteria | 1042 |
| 670 | Ga0496110_0446642 | 3300048913 | Bacteria | 1178 |
| 671 | Ga0496111_0071605 | 3300048914 | Bacteria | 2523 |
| 672 | Ga0496111_0812564 | 3300048914 | Bacteria | 676 |
| 673 | Ga0496112_0325183 | 3300048915 | Bacteria | 1482 |
| 674 | Ga0496113_0518479 | 3300048916 | Bacteria | 957 |
| 675 | Ga0496114_1021945 | 3300048917 | Bacteria | 710 |
| 676 | Ga0496114_1132328 | 3300048917 | Bacteria | 668 |
| 677 | Ga0496115_0941435 | 3300048918 | Bacteria | 664 |
| 678 | Ga0496116_0039510 | 3300048919 | Bacteria | 3262 |
| 679 | Ga0496117_0023000 | 3300048920 | Bacteria | 4983 |
| 680 | Ga0496117_0043622 | 3300048920 | Bacteria | 3258 |
| 681 | Ga0496118_0006363 | 3300048921 | Bacteria | 13016 |
| 682 | Ga0496118_0019829 | 3300048921 | Bacteria | 5994 |
| 683 | Ga0496119_0082193 | 3300048922 | Bacteria | 1853 |
| 684 | Ga0496119_0175820 | 3300048922 | Bacteria | 1127 |
| 685 | Ga0496121_0052610 | 3300048924 | Bacteria | 3417 |
| 686 | Ga0496121_0121176 | 3300048924 | Bacteria | 1975 |
| 687 | Ga0496122_0582460 | 3300048925 | Bacteria | 527 |
| 688 | Ga0496123_0377373 | 3300048926 | Bacteria | 651 |
| 689 | Ga0496124_0176704 | 3300048927 | Bacteria | 1647 |
| 690 | Ga0496124_0544698 | 3300048927 | Bacteria | 767 |
| 691 | Ga0496125_0046359 | 3300048928 | Bacteria | 3647 |
| 692 | Ga0496125_0053320 | 3300048928 | Bacteria | 3316 |
| 693 | Ga0496125_0617063 | 3300048928 | Bacteria | 589 |
| 694 | Ga0501315_012151 | 3300049531 | Bacteria | 1061 |
| 695 | Ga0501317_049401 | 3300049533 | Bacteria | 664 |
| 696 | Ga0501323_015594 | 3300049539 | Bacteria | 961 |
| 697 | Ga0501323_067597 | 3300049539 | Bacteria | 567 |
| 698 | Ga0501037_0145399 | 3300049573 | Bacteria | 1696 |
| 699 | Ga0501046_0281209 | 3300049580 | Bacteria | 1219 |
| 700 | Ga0501223_144669 | 3300049663 | Bacteria | 513 |
| 701 | Ga0501233_289805 | 3300049668 | Bacteria | 503 |
| 702 | Ga0501243_142071 | 3300049675 | Bacteria | 508 |
| 703 | Ga0501249_050489 | 3300049679 | Bacteria | 954 |
| 704 | Ga0501225_0046999 | 3300049705 | Bacteria | 1197 |
| 705 | Ga0501280_027411 | 3300049776 | Bacteria | 876 |
| 706 | nmdc:mga03683_105991_c1 | 3300050489 | Bacteria | 1239 |
| 707 | nmdc:mga03683_162337_c1 | 3300050489 | Bacteria | 1013 |
| 708 | nmdc:mga03683_197312_c2 | 3300050489 | Bacteria | 520 |
| 709 | nmdc:mga03683_343496_c1 | 3300050489 | Bacteria | 705 |
| 710 | nmdc:mga03683_345433_c1 | 3300050489 | Bacteria | 704 |
| 711 | nmdc:mga03683_456182_c1 | 3300050489 | Bacteria | 615 |
| 712 | nmdc:mga03683_468576_c1 | 3300050489 | Bacteria | 607 |
| 713 | nmdc:mga03683_73810_c1 | 3300050489 | Bacteria | 1463 |
| 714 | nmdc:mga03n38_116333_c1 | 3300050490 | Bacteria | 1309 |
| 715 | nmdc:mga03n38_258017_c1 | 3300050490 | Bacteria | 923 |
| 716 | nmdc:mga03n38_330806_c1 | 3300050490 | Bacteria | 825 |
| 717 | nmdc:mga03n38_430839_c1 | 3300050490 | Bacteria | 731 |
| 718 | nmdc:mga03n38_500810_c1 | 3300050490 | Bacteria | 682 |
| 719 | nmdc:mga00v17_315474_c1 | 3300050491 | Bacteria | 1016 |
| 720 | nmdc:mga00v17_42986_c1 | 3300050491 | Bacteria | 2720 |
| 721 | nmdc:mga00v17_565297_c1 | 3300050491 | Bacteria | 735 |
| 722 | nmdc:mga00v17_585738_c1 | 3300050491 | Bacteria | 720 |
| 723 | nmdc:mga00v17_636184_c1 | 3300050491 | Bacteria | 686 |
| 724 | nmdc:mga00v17_767875_c1 | 3300050491 | Bacteria | 615 |
| 725 | nmdc:mga0yw44_138048_c1 | 3300050492 | Bacteria | 1583 |
| 726 | nmdc:mga0yw44_658365_c1 | 3300050492 | Bacteria | 712 |
| 727 | nmdc:mga0k408_111441_c1 | 3300050493 | Bacteria | 1617 |
| 728 | nmdc:mga0k408_231329_c1 | 3300050493 | Bacteria | 1103 |
| 729 | nmdc:mga0k408_26362_c1 | 3300050493 | Bacteria | 3295 |
| 730 | nmdc:mga0k408_305574_c1 | 3300050493 | Bacteria | 949 |
| 731 | nmdc:mga0k408_6011_c1 | 3300050493 | Bacteria | 6476 |
| 732 | nmdc:mga0k408_81457_c1 | 3300050493 | Bacteria | 1895 |
| 733 | nmdc:mga0k408_89457_c1 | 3300050493 | Bacteria | 1808 |
| 734 | nmdc:mga06z11_154388_c1 | 3300050494 | Bacteria | 834 |
| 735 | nmdc:mga06z11_72127_c1 | 3300050494 | Bacteria | 1830 |
| 736 | nmdc:mga04h51_283906_c1 | 3300050495 | Bacteria | 671 |
| 737 | nmdc:mga07m45_206558_c1 | 3300050496 | Bacteria | 1142 |
| 738 | nmdc:mga07m45_25369_c1 | 3300050496 | Bacteria | 3251 |
| 739 | nmdc:mga07m45_277484_c1 | 3300050496 | Bacteria | 975 |
| 740 | nmdc:mga07m45_289043_c1 | 3300050496 | Bacteria | 954 |
| 741 | nmdc:mga07m45_36823_c1 | 3300050496 | Bacteria | 2727 |
| 742 | nmdc:mga07m45_383745_c1 | 3300050496 | Bacteria | 816 |
| 743 | nmdc:mga07m45_5257_c1 | 3300050496 | Bacteria | 6430 |
| 744 | nmdc:mga07m45_532405_c1 | 3300050496 | Bacteria | 680 |
| 745 | nmdc:mga07m45_5339_c1 | 3300050496 | Bacteria | 6394 |
| 746 | nmdc:mga07m45_56345_c1 | 3300050496 | Bacteria | 2222 |
| 747 | nmdc:mga07m45_758688_c1 | 3300050496 | Bacteria | 557 |
| 748 | nmdc:mga07m45_768095_c1 | 3300050496 | Bacteria | 553 |
| 749 | nmdc:mga0sz30_271917_c1 | 3300050516 | Bacteria | 755 |
| 750 | nmdc:mga0sz30_388442_c1 | 3300050516 | Bacteria | 625 |
| 751 | Ga0495612_0168246 | 3300053078 | Bacteria | 959 |
| 752 | Ga0500610_0056696 | 3300053079 | Bacteria | 2044 |
| 753 | Ga0495655_0148787 | 3300053083 | Bacteria | 735 |
| 754 | Ga0500643_019521 | 3300053087 | Bacteria | 2229 |
| 755 | Ga0500651_0000347 | 3300053093 | Bacteria | 26028 |
| 756 | Ga0500566_0114122 | 3300053094 | Bacteria | 1465 |
| 757 | Ga0500555_159784 | 3300053103 | Bacteria | 550 |
| 758 | Ga0500562_006293 | 3300053108 | Bacteria | 2995 |
| 759 | Ga0500562_144760 | 3300053108 | Bacteria | 647 |
| 760 | Ga0500571_001746 | 3300053110 | Bacteria | 10443 |
| 761 | Ga0500572_175521 | 3300053111 | Bacteria | 702 |
| 762 | Ga0500593_018569 | 3300053117 | Bacteria | 3034 |
| 763 | Ga0500593_118317 | 3300053117 | Bacteria | 1078 |
| 764 | Ga0500594_0033579 | 3300053118 | Bacteria | 1365 |
| 765 | Ga0500607_006984 | 3300053121 | Bacteria | 7040 |
| 766 | Ga0500607_197701 | 3300053121 | Bacteria | 868 |
| 767 | Ga0500608_017372 | 3300053122 | Bacteria | 3267 |
| 768 | Ga0500608_358475 | 3300053122 | Bacteria | 513 |
| 769 | Ga0500628_111204 | 3300053129 | Bacteria | 735 |
| 770 | Ga0500655_055511 | 3300053133 | Bacteria | 793 |
| 771 | Ga0500658_0000560 | 3300053134 | Bacteria | 15661 |
| 772 | Ga0500658_0000589 | 3300053134 | Bacteria | 15190 |
| 773 | Ga0500564_131856 | 3300053138 | Bacteria | 1080 |
| 774 | Ga0500568_0006650 | 3300053139 | Bacteria | 5780 |
| 775 | Ga0500577_0220196 | 3300053142 | Bacteria | 821 |
| 776 | Ga0500586_158012 | 3300053145 | Bacteria | 770 |
| 777 | Ga0500616_0021860 | 3300053153 | Bacteria | 3578 |
| 778 | Ga0500624_015969 | 3300053157 | Bacteria | 1154 |
| 779 | Ga0500627_0044221 | 3300053158 | Bacteria | 1922 |
| 780 | Ga0500634_0257925 | 3300053161 | Bacteria | 719 |
| 781 | Ga0500634_0325631 | 3300053161 | Bacteria | 597 |
| 782 | Ga0500638_051737 | 3300053162 | Bacteria | 1985 |
| 783 | Ga0500636_0352800 | 3300053177 | Bacteria | 701 |
| 784 | Ga0500625_202069 | 3300053729 | Bacteria | 663 |
| 785 | Ga0500645_198453 | 3300053730 | Bacteria | 542 |
| 786 | Ga0500565_017652 | 3300053734 | Bacteria | 824 |
| 787 | Ga0500596_018659 | 3300053735 | Bacteria | 1041 |
| 788 | Ga0590075_049907 | 3300059424 | Bacteria | 1073 |
| 789 | Ga0590077_137847 | 3300059426 | Bacteria | 581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2513020051 | 2513230074 | 76 |
| 2 | iso_pu_bacteria | 2547132374 | 2548499081 | 76 |
| 3 | iso_pu_bacteria | 2599185214 | 2599620577 | 76 |
| 4 | iso_pu_bacteria | 2599185226 | 2599673876 | 76 |
| 5 | iso_pu_bacteria | 2599185227 | 2599678807 | 76 |
| 6 | iso_pu_bacteria | 2599185229 | 2599690088 | 76 |
| 7 | iso_pu_bacteria | 2643221570 | 2643867715 | 76 |
| 8 | iso_pu_bacteria | 2643221596 | 2643991578 | 76 |
| 9 | iso_pu_bacteria | 2643221609 | 2644062256 | 76 |
| 10 | iso_pu_bacteria | 2643221611 | 2644071443 | 76 |
| 11 | iso_pu_bacteria | 2643221628 | 2644162160 | 76 |
| 12 | iso_pu_bacteria | 2643221652 | 2644293324 | 76 |
| 13 | iso_pu_bacteria | 2643221658 | 2644324283 | 76 |
| 14 | iso_pu_bacteria | 2643221672 | 2644396124 | 76 |
| 15 | iso_pu_bacteria | 2643221683 | 2644464964 | 76 |
| 16 | iso_pu_bacteria | 2643221717 | 2644648538 | 76 |
| 17 | iso_pu_bacteria | 2738541277 | 2738720472 | 76 |
| 18 | iso_pu_bacteria | 2738541307 | 2738884043 | 76 |
| 19 | iso_pu_bacteria | 2738543012 | 2739245866 | 76 |
| 20 | iso_pu_bacteria | 2738543019 | 2739279671 | 76 |
| 21 | iso_pu_bacteria | 2816332133 | 2816470560 | 76 |
| 22 | iso_pu_bacteria | 2818991446 | 2819601154 | 76 |
| 23 | iso_pu_bacteria | 2831265667 | 2831271532 | 76 |
| 24 | iso_pu_bacteria | 2838054893 | 2838055433 | 76 |
| 25 | iso_pu_bacteria | 2842677519 | 2842680582 | 76 |
| 26 | iso_pu_bacteria | 2842718218 | 2842718659 | 76 |
| 27 | iso_pu_bacteria | 2881101125 | 2881103401 | 76 |
| 28 | iso_pu_bacteria | 2885198086 | 2885201034 | 76 |
| 29 | iso_pu_bacteria | 2885211737 | 2885214183 | 76 |
| 30 | iso_pu_bacteria | 2899924645 | 2899927499 | 76 |
| 31 | iso_pu_bacteria | 2904449895 | 2904450772 | 76 |
| 32 | iso_pu_bacteria | 2904456579 | 2904459728 | 76 |
| 33 | iso_pu_bacteria | 2904541872 | 2904547995 | 76 |
| 34 | iso_pu_bacteria | 2919462493 | 2919462697 | 76 |
| 35 | iso_pu_bacteria | 2919704043 | 2919707086 | 76 |
| 36 | iso_pu_bacteria | 2928037797 | 2928042588 | 76 |
| 37 | iso_pu_bacteria | 2928044640 | 2928048985 | 76 |
| 38 | iso_pu_bacteria | 2928051484 | 2928051535 | 76 |
| 39 | iso_pu_bacteria | 2928064002 | 2928068746 | 76 |
| 40 | iso_pu_bacteria | 2928070936 | 2928073256 | 76 |
| 41 | iso_pu_bacteria | 2928084124 | 2928087017 | 76 |
| 42 | iso_pu_bacteria | 2929160207 | 2929161610 | 76 |
| 43 | iso_pu_bacteria | 2929520902 | 2929521490 | 76 |
| 44 | iso_pu_bacteria | 2945909444 | 2945913949 | 76 |
| 45 | iso_pu_bacteria | 2945945610 | 2945949504 | 76 |
| 46 | iso_pu_bacteria | 2945972063 | 2945973548 | 76 |
| 47 | iso_pu_bacteria | 2945984333 | 2945990653 | 76 |
| 48 | iso_pu_bacteria | 2954767861 | 2954770838 | 76 |
| 49 | iso_pu_bacteria | 2990710928 | 2990713976 | 76 |
| 50 | 3300006237 | Ga0097621_101014025 | Ga0097621_1010140252 | 79 |
| 51 | 3300006358 | Ga0068871_100737242 | Ga0068871_1007372422 | 79 |
| 52 | 3300013306 | Ga0163162_10698347 | Ga0163162_106983472 | 79 |
| 53 | 3300041456 | Ga0451795_1558984 | Ga0451795_1558984_164_406 | 79 |
| 54 | 3300046463 | Ga0495653_0969763 | Ga0495653_0969763_159_398 | 79 |
| 55 | 3300001979 | JGI24740J21852_10004290 | JGI24740J21852_100042902 | 80 |
| 56 | 3300001989 | JGI24739J22299_10008905 | JGI24739J22299_100089052 | 80 |
| 57 | 3300001989 | JGI24739J22299_10009598 | JGI24739J22299_100095985 | 80 |
| 58 | 3300002739 | JGI25158J39367_1004285 | JGI25158J39367_10042852 | 80 |
| 59 | 3300002987 | JGI25159J45721_1029844 | JGI25159J45721_10298442 | 80 |
| 60 | 3300003187 | JGI25151J46595_10003000 | JGI25151J46595_1000300011 | 80 |
| 61 | 3300003187 | JGI25151J46595_10028625 | JGI25151J46595_100286253 | 80 |
| 62 | 3300003187 | JGI25151J46595_10071196 | JGI25151J46595_100711962 | 80 |
| 63 | 3300003215 | JGI25153J46596_10009310 | JGI25153J46596_100093102 | 80 |
| 64 | 3300003323 | rootH1_10079751 | rootH1_100797512 | 80 |
| 65 | 3300003354 | JGI25160J50197_1010452 | JGI25160J50197_10104522 | 80 |
| 66 | 3300003578 | Ga0006562J51391_1089139 | Ga0006562J51391_10891392 | 80 |
| 67 | 3300003578 | Ga0006562J51391_1089141 | Ga0006562J51391_10891412 | 80 |
| 68 | 3300003760 | Ga0055527_1014119 | Ga0055527_10141192 | 80 |
| 69 | 3300003761 | Ga0055535_1000966 | Ga0055535_100096611 | 80 |
| 70 | 3300003762 | Ga0055542_1000080 | Ga0055542_100008081 | 80 |
| 71 | 3300003773 | Ga0055537_1000150 | Ga0055537_10001502 | 80 |
| 72 | 3300003773 | Ga0055537_1003599 | Ga0055537_10035993 | 80 |
| 73 | 3300003775 | Ga0055524_1064407 | Ga0055524_10644071 | 80 |
| 74 | 3300003781 | Ga0055536_1006807 | Ga0055536_10068077 | 80 |
| 75 | 3300003781 | Ga0055536_1027523 | Ga0055536_10275232 | 80 |
| 76 | 3300003781 | Ga0055536_1035061 | Ga0055536_10350612 | 80 |
| 77 | 3300003784 | Ga0055534_1000016 | Ga0055534_1000016108 | 80 |
| 78 | 3300003784 | Ga0055534_1017802 | Ga0055534_10178021 | 80 |
| 79 | 3300003790 | Ga0055528_1000894 | Ga0055528_100089418 | 80 |
| 80 | 3300003790 | Ga0055528_1021050 | Ga0055528_10210503 | 80 |
| 81 | 3300003790 | Ga0055528_1043582 | Ga0055528_10435822 | 80 |
| 82 | 3300003790 | Ga0055528_1094440 | Ga0055528_10944401 | 80 |
| 83 | 3300003791 | Ga0055530_10003550 | Ga0055530_1000355010 | 80 |
| 84 | 3300003791 | Ga0055530_10005191 | Ga0055530_100051919 | 80 |
| 85 | 3300003791 | Ga0055530_10061295 | Ga0055530_100612952 | 80 |
| 86 | 3300003792 | Ga0055540_1019292 | Ga0055540_10192923 | 80 |
| 87 | 3300003792 | Ga0055540_1021120 | Ga0055540_10211203 | 80 |
| 88 | 3300003792 | Ga0055540_1023163 | Ga0055540_10231632 | 80 |
| 89 | 3300003792 | Ga0055540_1043939 | Ga0055540_10439392 | 80 |
| 90 | 3300003794 | Ga0055531_10001826 | Ga0055531_1000182611 | 80 |
| 91 | 3300003794 | Ga0055531_10004420 | Ga0055531_100044202 | 80 |
| 92 | 3300005288 | Ga0065714_10004675 | Ga0065714_100046759 | 80 |
| 93 | 3300005288 | Ga0065714_10080808 | Ga0065714_100808082 | 80 |
| 94 | 3300005288 | Ga0065714_10479621 | Ga0065714_104796211 | 80 |
| 95 | 3300005289 | Ga0065704_10185663 | Ga0065704_101856632 | 80 |
| 96 | 3300005289 | Ga0065704_10296250 | Ga0065704_102962502 | 80 |
| 97 | 3300005289 | Ga0065704_10364268 | Ga0065704_103642681 | 80 |
| 98 | 3300005289 | Ga0065704_10444071 | Ga0065704_104440712 | 80 |
| 99 | 3300005327 | Ga0070658_10139715 | Ga0070658_101397153 | 80 |
| 100 | 3300005327 | Ga0070658_10269609 | Ga0070658_102696092 | 80 |
| 101 | 3300005327 | Ga0070658_10817630 | Ga0070658_108176302 | 80 |
| 102 | 3300005334 | Ga0068869_100022576 | Ga0068869_1000225762 | 80 |
| 103 | 3300005334 | Ga0068869_100593224 | Ga0068869_1005932242 | 80 |
| 104 | 3300005335 | Ga0070666_10270584 | Ga0070666_102705841 | 80 |
| 105 | 3300005338 | Ga0068868_100159375 | Ga0068868_1001593752 | 80 |
| 106 | 3300005339 | Ga0070660_100010089 | Ga0070660_1000100893 | 80 |
| 107 | 3300005339 | Ga0070660_100782922 | Ga0070660_1007829222 | 80 |
| 108 | 3300005344 | Ga0070661_100647509 | Ga0070661_1006475091 | 80 |
| 109 | 3300005344 | Ga0070661_101085177 | Ga0070661_1010851772 | 80 |
| 110 | 3300005347 | Ga0070668_100766997 | Ga0070668_1007669972 | 80 |
| 111 | 3300005353 | Ga0070669_100287905 | Ga0070669_1002879052 | 80 |
| 112 | 3300005356 | Ga0070674_100181127 | Ga0070674_1001811273 | 80 |
| 113 | 3300005356 | Ga0070674_100524611 | Ga0070674_1005246112 | 80 |
| 114 | 3300005356 | Ga0070674_100629391 | Ga0070674_1006293911 | 80 |
| 115 | 3300005356 | Ga0070674_101776554 | Ga0070674_1017765542 | 80 |
| 116 | 3300005364 | Ga0070673_100945336 | Ga0070673_1009453362 | 80 |
| 117 | 3300005364 | Ga0070673_101209985 | Ga0070673_1012099852 | 80 |
| 118 | 3300005365 | Ga0070688_101789278 | Ga0070688_1017892782 | 80 |
| 119 | 3300005366 | Ga0070659_100183936 | Ga0070659_1001839362 | 80 |
| 120 | 3300005367 | Ga0070667_100179365 | Ga0070667_1001793653 | 80 |
| 121 | 3300005435 | Ga0070714_100904660 | Ga0070714_1009046602 | 80 |
| 122 | 3300005455 | Ga0070663_102137943 | Ga0070663_1021379432 | 80 |
| 123 | 3300005456 | Ga0070678_100243295 | Ga0070678_1002432953 | 80 |
| 124 | 3300005456 | Ga0070678_100630753 | Ga0070678_1006307532 | 80 |
| 125 | 3300005456 | Ga0070678_101979127 | Ga0070678_1019791271 | 80 |
| 126 | 3300005457 | Ga0070662_100039907 | Ga0070662_1000399073 | 80 |
| 127 | 3300005459 | Ga0068867_101691058 | Ga0068867_1016910581 | 80 |
| 128 | 3300005466 | Ga0070685_10929949 | Ga0070685_109299492 | 80 |
| 129 | 3300005530 | Ga0070679_100054548 | Ga0070679_1000545483 | 80 |
| 130 | 3300005539 | Ga0068853_100147073 | Ga0068853_1001470732 | 80 |
| 131 | 3300005539 | Ga0068853_101617070 | Ga0068853_1016170702 | 80 |
| 132 | 3300005548 | Ga0070665_100010145 | Ga0070665_10001014510 | 80 |
| 133 | 3300005548 | Ga0070665_101595040 | Ga0070665_1015950401 | 80 |
| 134 | 3300005548 | Ga0070665_101802463 | Ga0070665_1018024631 | 80 |
| 135 | 3300005563 | Ga0068855_100119841 | Ga0068855_1001198413 | 80 |
| 136 | 3300005563 | Ga0068855_100241413 | Ga0068855_1002414133 | 80 |
| 137 | 3300005563 | Ga0068855_101141513 | Ga0068855_1011415132 | 80 |
| 138 | 3300005564 | Ga0070664_100040580 | Ga0070664_1000405803 | 80 |
| 139 | 3300005577 | Ga0068857_100073208 | Ga0068857_1000732082 | 80 |
| 140 | 3300005577 | Ga0068857_100157874 | Ga0068857_1001578742 | 80 |
| 141 | 3300005577 | Ga0068857_100927464 | Ga0068857_1009274642 | 80 |
| 142 | 3300005577 | Ga0068857_101816737 | Ga0068857_1018167372 | 80 |
| 143 | 3300005614 | Ga0068856_100206139 | Ga0068856_1002061392 | 80 |
| 144 | 3300005614 | Ga0068856_100391387 | Ga0068856_1003913872 | 80 |
| 145 | 3300005614 | Ga0068856_101525123 | Ga0068856_1015251232 | 80 |
| 146 | 3300005616 | Ga0068852_100107707 | Ga0068852_1001077073 | 80 |
| 147 | 3300005616 | Ga0068852_101034290 | Ga0068852_1010342902 | 80 |
| 148 | 3300005617 | Ga0068859_101314464 | Ga0068859_1013144642 | 80 |
| 149 | 3300005618 | Ga0068864_101278132 | Ga0068864_1012781322 | 80 |
| 150 | 3300005718 | Ga0068866_11377083 | Ga0068866_113770831 | 80 |
| 151 | 3300005719 | Ga0068861_102635540 | Ga0068861_1026355402 | 80 |
| 152 | 3300005834 | Ga0068851_10002741 | Ga0068851_100027414 | 80 |
| 153 | 3300005840 | Ga0068870_11118470 | Ga0068870_111184702 | 80 |
| 154 | 3300005841 | Ga0068863_100134033 | Ga0068863_1001340333 | 80 |
| 155 | 3300005842 | Ga0068858_101685273 | Ga0068858_1016852731 | 80 |
| 156 | 3300005844 | Ga0068862_100298255 | Ga0068862_1002982551 | 80 |
| 157 | 3300006038 | Ga0075365_10022096 | Ga0075365_100220964 | 80 |
| 158 | 3300006038 | Ga0075365_10071228 | Ga0075365_100712283 | 80 |
| 159 | 3300006038 | Ga0075365_10930983 | Ga0075365_109309832 | 80 |
| 160 | 3300006042 | Ga0075368_10251250 | Ga0075368_102512502 | 80 |
| 161 | 3300006048 | Ga0075363_100007907 | Ga0075363_1000079078 | 80 |
| 162 | 3300006048 | Ga0075363_100258058 | Ga0075363_1002580582 | 80 |
| 163 | 3300006048 | Ga0075363_100816840 | Ga0075363_1008168402 | 80 |
| 164 | 3300006048 | Ga0075363_100876610 | Ga0075363_1008766102 | 80 |
| 165 | 3300006048 | Ga0075363_100897483 | Ga0075363_1008974831 | 80 |
| 166 | 3300006051 | Ga0075364_10020170 | Ga0075364_100201704 | 80 |
| 167 | 3300006051 | Ga0075364_10081814 | Ga0075364_100818142 | 80 |
| 168 | 3300006051 | Ga0075364_10210045 | Ga0075364_102100452 | 80 |
| 169 | 3300006051 | Ga0075364_10227248 | Ga0075364_102272482 | 80 |
| 170 | 3300006051 | Ga0075364_10970552 | Ga0075364_109705522 | 80 |
| 171 | 3300006058 | Ga0075432_10002614 | Ga0075432_100026146 | 80 |
| 172 | 3300006058 | Ga0075432_10072540 | Ga0075432_100725403 | 80 |
| 173 | 3300006177 | Ga0075362_10037995 | Ga0075362_100379953 | 80 |
| 174 | 3300006177 | Ga0075362_10038214 | Ga0075362_100382142 | 80 |
| 175 | 3300006177 | Ga0075362_10056377 | Ga0075362_100563772 | 80 |
| 176 | 3300006177 | Ga0075362_10135941 | Ga0075362_101359412 | 80 |
| 177 | 3300006177 | Ga0075362_10179908 | Ga0075362_101799082 | 80 |
| 178 | 3300006177 | Ga0075362_10183140 | Ga0075362_101831402 | 80 |
| 179 | 3300006178 | Ga0075367_10136738 | Ga0075367_101367383 | 80 |
| 180 | 3300006178 | Ga0075367_10255335 | Ga0075367_102553352 | 80 |
| 181 | 3300006178 | Ga0075367_10440384 | Ga0075367_104403842 | 80 |
| 182 | 3300006186 | Ga0075369_10082983 | Ga0075369_100829832 | 80 |
| 183 | 3300006186 | Ga0075369_10225578 | Ga0075369_102255782 | 80 |
| 184 | 3300006195 | Ga0075366_10016366 | Ga0075366_100163665 | 80 |
| 185 | 3300006195 | Ga0075366_10025817 | Ga0075366_100258172 | 80 |
| 186 | 3300006195 | Ga0075366_10045854 | Ga0075366_100458543 | 80 |
| 187 | 3300006195 | Ga0075366_10077444 | Ga0075366_100774443 | 80 |
| 188 | 3300006195 | Ga0075366_10084748 | Ga0075366_100847483 | 80 |
| 189 | 3300006195 | Ga0075366_10116986 | Ga0075366_101169862 | 80 |
| 190 | 3300006195 | Ga0075366_10462917 | Ga0075366_104629172 | 80 |
| 191 | 3300006195 | Ga0075366_10877728 | Ga0075366_108777282 | 80 |
| 192 | 3300006237 | Ga0097621_100169928 | Ga0097621_1001699282 | 80 |
| 193 | 3300006353 | Ga0075370_10001499 | Ga0075370_1000149912 | 80 |
| 194 | 3300006353 | Ga0075370_10002475 | Ga0075370_100024759 | 80 |
| 195 | 3300006353 | Ga0075370_10004243 | Ga0075370_100042432 | 80 |
| 196 | 3300006353 | Ga0075370_10088484 | Ga0075370_100884842 | 80 |
| 197 | 3300006353 | Ga0075370_10094291 | Ga0075370_100942913 | 80 |
| 198 | 3300006353 | Ga0075370_10226115 | Ga0075370_102261152 | 80 |
| 199 | 3300006353 | Ga0075370_10247279 | Ga0075370_102472792 | 80 |
| 200 | 3300006353 | Ga0075370_10258840 | Ga0075370_102588402 | 80 |
| 201 | 3300006353 | Ga0075370_10311167 | Ga0075370_103111672 | 80 |
| 202 | 3300006353 | Ga0075370_10590513 | Ga0075370_105905132 | 80 |
| 203 | 3300006353 | Ga0075370_10866468 | Ga0075370_108664682 | 80 |
| 204 | 3300006358 | Ga0068871_100023433 | Ga0068871_1000234335 | 80 |
| 205 | 3300006358 | Ga0068871_101324974 | Ga0068871_1013249742 | 80 |
| 206 | 3300006881 | Ga0068865_100498852 | Ga0068865_1004988522 | 80 |
| 207 | 3300006881 | Ga0068865_100848700 | Ga0068865_1008487002 | 80 |
| 208 | 3300006881 | Ga0068865_101090828 | Ga0068865_1010908282 | 80 |
| 209 | 3300006914 | Ga0075436_101513180 | Ga0075436_1015131802 | 80 |
| 210 | 3300006931 | Ga0097620_101314383 | Ga0097620_1013143832 | 80 |
| 211 | 3300006946 | Ga0079104_1021469 | Ga0079104_10214692 | 80 |
| 212 | 3300006948 | Ga0099826_10000101 | Ga0099826_1000010136 | 80 |
| 213 | 3300009011 | Ga0105251_10646693 | Ga0105251_106466932 | 80 |
| 214 | 3300009036 | Ga0105244_10010520 | Ga0105244_100105207 | 80 |
| 215 | 3300009036 | Ga0105244_10117797 | Ga0105244_101177972 | 80 |
| 216 | 3300009036 | Ga0105244_10126774 | Ga0105244_101267742 | 80 |
| 217 | 3300009092 | Ga0105250_10009366 | Ga0105250_100093665 | 80 |
| 218 | 3300009093 | Ga0105240_10006365 | Ga0105240_1000636511 | 80 |
| 219 | 3300009093 | Ga0105240_10254488 | Ga0105240_102544882 | 80 |
| 220 | 3300009093 | Ga0105240_11010638 | Ga0105240_110106382 | 80 |
| 221 | 3300009098 | Ga0105245_10872035 | Ga0105245_108720352 | 80 |
| 222 | 3300009148 | Ga0105243_10003361 | Ga0105243_100033614 | 80 |
| 223 | 3300009148 | Ga0105243_10260122 | Ga0105243_102601222 | 80 |
| 224 | 3300009148 | Ga0105243_11061208 | Ga0105243_110612082 | 80 |
| 225 | 3300009174 | Ga0105241_10419025 | Ga0105241_104190252 | 80 |
| 226 | 3300009176 | Ga0105242_10000553 | Ga0105242_1000055319 | 80 |
| 227 | 3300009176 | Ga0105242_10201925 | Ga0105242_102019252 | 80 |
| 228 | 3300009176 | Ga0105242_10689738 | Ga0105242_106897382 | 80 |
| 229 | 3300009176 | Ga0105242_10707822 | Ga0105242_107078222 | 80 |
| 230 | 3300009177 | Ga0105248_10166463 | Ga0105248_101664632 | 80 |
| 231 | 3300009177 | Ga0105248_11054050 | Ga0105248_110540502 | 80 |
| 232 | 3300009177 | Ga0105248_11159186 | Ga0105248_111591862 | 80 |
| 233 | 3300009545 | Ga0105237_11331089 | Ga0105237_113310892 | 80 |
| 234 | 3300009545 | Ga0105237_11629785 | Ga0105237_116297852 | 80 |
| 235 | 3300009551 | Ga0105238_10017091 | Ga0105238_100170912 | 80 |
| 236 | 3300009551 | Ga0105238_10543900 | Ga0105238_105439002 | 80 |
| 237 | 3300009551 | Ga0105238_11705029 | Ga0105238_117050292 | 80 |
| 238 | 3300009551 | Ga0105238_11867165 | Ga0105238_118671652 | 80 |
| 239 | 3300009553 | Ga0105249_12090763 | Ga0105249_120907631 | 80 |
| 240 | 3300010375 | Ga0105239_10200838 | Ga0105239_102008382 | 80 |
| 241 | 3300010375 | Ga0105239_11114608 | Ga0105239_111146082 | 80 |
| 242 | 3300011119 | Ga0105246_10130197 | Ga0105246_101301973 | 80 |
| 243 | 3300011119 | Ga0105246_10352106 | Ga0105246_103521062 | 80 |
| 244 | 3300011119 | Ga0105246_11000133 | Ga0105246_110001332 | 80 |
| 245 | 3300011119 | Ga0105246_11534058 | Ga0105246_115340582 | 80 |
| 246 | 3300011119 | Ga0105246_11799169 | Ga0105246_117991691 | 80 |
| 247 | 3300012497 | Ga0157319_1014482 | Ga0157319_10144822 | 80 |
| 248 | 3300012502 | Ga0157347_1002744 | Ga0157347_10027441 | 80 |
| 249 | 3300012502 | Ga0157347_1026183 | Ga0157347_10261832 | 80 |
| 250 | 3300012505 | Ga0157339_1032486 | Ga0157339_10324862 | 80 |
| 251 | 3300012513 | Ga0157326_1012389 | Ga0157326_10123892 | 80 |
| 252 | 3300013100 | Ga0157373_10094943 | Ga0157373_100949432 | 80 |
| 253 | 3300013100 | Ga0157373_10626851 | Ga0157373_106268512 | 80 |
| 254 | 3300013100 | Ga0157373_10850502 | Ga0157373_108505022 | 80 |
| 255 | 3300013102 | Ga0157371_10059656 | Ga0157371_100596562 | 80 |
| 256 | 3300013102 | Ga0157371_10960774 | Ga0157371_109607742 | 80 |
| 257 | 3300013104 | Ga0157370_10011514 | Ga0157370_1001151410 | 80 |
| 258 | 3300013104 | Ga0157370_10072910 | Ga0157370_100729103 | 80 |
| 259 | 3300013104 | Ga0157370_10485367 | Ga0157370_104853672 | 80 |
| 260 | 3300013104 | Ga0157370_11952806 | Ga0157370_119528061 | 80 |
| 261 | 3300013105 | Ga0157369_10013149 | Ga0157369_1001314910 | 80 |
| 262 | 3300013105 | Ga0157369_12189830 | Ga0157369_121898301 | 80 |
| 263 | 3300013296 | Ga0157374_10585406 | Ga0157374_105854062 | 80 |
| 264 | 3300013297 | Ga0157378_11576671 | Ga0157378_115766712 | 80 |
| 265 | 3300013306 | Ga0163162_10362486 | Ga0163162_103624862 | 80 |
| 266 | 3300013306 | Ga0163162_10817893 | Ga0163162_108178932 | 80 |
| 267 | 3300013306 | Ga0163162_12441603 | Ga0163162_124416032 | 80 |
| 268 | 3300013307 | Ga0157372_10576067 | Ga0157372_105760672 | 80 |
| 269 | 3300013308 | Ga0157375_11511848 | Ga0157375_115118482 | 80 |
| 270 | 3300013308 | Ga0157375_11772195 | Ga0157375_117721952 | 80 |
| 271 | 3300014325 | Ga0163163_11594957 | Ga0163163_115949572 | 80 |
| 272 | 3300014326 | Ga0157380_10114627 | Ga0157380_101146273 | 80 |
| 273 | 3300014326 | Ga0157380_10967518 | Ga0157380_109675182 | 80 |
| 274 | 3300014326 | Ga0157380_12835996 | Ga0157380_128359962 | 80 |
| 275 | 3300014497 | Ga0182008_10001633 | Ga0182008_100016339 | 80 |
| 276 | 3300014497 | Ga0182008_10058827 | Ga0182008_100588272 | 80 |
| 277 | 3300014497 | Ga0182008_10075865 | Ga0182008_100758652 | 80 |
| 278 | 3300014497 | Ga0182008_10141243 | Ga0182008_101412432 | 80 |
| 279 | 3300014497 | Ga0182008_10565055 | Ga0182008_105650552 | 80 |
| 280 | 3300014497 | Ga0182008_10688862 | Ga0182008_106888622 | 80 |
| 281 | 3300014745 | Ga0157377_11375600 | Ga0157377_113756002 | 80 |
| 282 | 3300014968 | Ga0157379_10208061 | Ga0157379_102080612 | 80 |
| 283 | 3300014969 | Ga0157376_10344535 | Ga0157376_103445352 | 80 |
| 284 | 3300014969 | Ga0157376_10709139 | Ga0157376_107091392 | 80 |
| 285 | 3300014969 | Ga0157376_10825833 | Ga0157376_108258332 | 80 |
| 286 | 3300015261 | Ga0182006_1010501 | Ga0182006_10105014 | 80 |
| 287 | 3300015261 | Ga0182006_1025900 | Ga0182006_10259002 | 80 |
| 288 | 3300015261 | Ga0182006_1150238 | Ga0182006_11502382 | 80 |
| 289 | 3300015261 | Ga0182006_1176170 | Ga0182006_11761701 | 80 |
| 290 | 3300015261 | Ga0182006_1233599 | Ga0182006_12335992 | 80 |
| 291 | 3300015262 | Ga0182007_10000853 | Ga0182007_1000085315 | 80 |
| 292 | 3300015262 | Ga0182007_10003809 | Ga0182007_100038093 | 80 |
| 293 | 3300015262 | Ga0182007_10343066 | Ga0182007_103430662 | 80 |
| 294 | 3300015265 | Ga0182005_1052265 | Ga0182005_10522652 | 80 |
| 295 | 3300015265 | Ga0182005_1072204 | Ga0182005_10722042 | 80 |
| 296 | 3300015265 | Ga0182005_1078107 | Ga0182005_10781072 | 80 |
| 297 | 3300017792 | Ga0163161_10001891 | Ga0163161_1000189110 | 80 |
| 298 | 3300017792 | Ga0163161_10007216 | Ga0163161_100072169 | 80 |
| 299 | 3300017792 | Ga0163161_10008493 | Ga0163161_100084932 | 80 |
| 300 | 3300017792 | Ga0163161_10042751 | Ga0163161_100427512 | 80 |
| 301 | 3300017792 | Ga0163161_10122988 | Ga0163161_101229882 | 80 |
| 302 | 3300025208 | Ga0209436_123904 | Ga0209436_1239042 | 80 |
| 303 | 3300025228 | Ga0209672_100642 | Ga0209672_1006423 | 80 |
| 304 | 3300025229 | Ga0209147_100995 | Ga0209147_1009951 | 80 |
| 305 | 3300025242 | Ga0209258_100093 | Ga0209258_10009329 | 80 |
| 306 | 3300025245 | Ga0207425_1000989 | Ga0207425_100098911 | 80 |
| 307 | 3300025245 | Ga0207425_1009140 | Ga0207425_10091404 | 80 |
| 308 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007996 | 80 |
| 309 | 3300025258 | Ga0209129_1000024 | Ga0209129_100002481 | 80 |
| 310 | 3300025258 | Ga0209129_1006303 | Ga0209129_10063033 | 80 |
| 311 | 3300025258 | Ga0209129_1010886 | Ga0209129_10108862 | 80 |
| 312 | 3300025263 | Ga0209565_1000098 | Ga0209565_100009870 | 80 |
| 313 | 3300025263 | Ga0209565_1000633 | Ga0209565_100063328 | 80 |
| 314 | 3300025263 | Ga0209565_1042110 | Ga0209565_10421102 | 80 |
| 315 | 3300025273 | Ga0209673_1000058 | Ga0209673_1000058181 | 80 |
| 316 | 3300025273 | Ga0209673_1001034 | Ga0209673_10010342 | 80 |
| 317 | 3300025273 | Ga0209673_1039935 | Ga0209673_10399352 | 80 |
| 318 | 3300025273 | Ga0209673_1041386 | Ga0209673_10413862 | 80 |
| 319 | 3300025273 | Ga0209673_1052393 | Ga0209673_10523932 | 80 |
| 320 | 3300025284 | Ga0209130_1000654 | Ga0209130_100065417 | 80 |
| 321 | 3300025284 | Ga0209130_1001114 | Ga0209130_100111412 | 80 |
| 322 | 3300025291 | Ga0209675_1000010 | Ga0209675_100001084 | 80 |
| 323 | 3300025291 | Ga0209675_1000151 | Ga0209675_10001512 | 80 |
| 324 | 3300025291 | Ga0209675_1003092 | Ga0209675_10030922 | 80 |
| 325 | 3300025291 | Ga0209675_1007033 | Ga0209675_10070337 | 80 |
| 326 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028275 | 80 |
| 327 | 3300025292 | Ga0209676_1001046 | Ga0209676_100104630 | 80 |
| 328 | 3300025292 | Ga0209676_1003308 | Ga0209676_10033082 | 80 |
| 329 | 3300025292 | Ga0209676_1025199 | Ga0209676_10251992 | 80 |
| 330 | 3300025292 | Ga0209676_1027854 | Ga0209676_10278543 | 80 |
| 331 | 3300025292 | Ga0209676_1064029 | Ga0209676_10640292 | 80 |
| 332 | 3300025294 | Ga0209025_1000685 | Ga0209025_100068512 | 80 |
| 333 | 3300025294 | Ga0209025_1001904 | Ga0209025_100190413 | 80 |
| 334 | 3300025294 | Ga0209025_1005469 | Ga0209025_10054695 | 80 |
| 335 | 3300025294 | Ga0209025_1078148 | Ga0209025_10781482 | 80 |
| 336 | 3300025295 | Ga0209564_1000209 | Ga0209564_100020992 | 80 |
| 337 | 3300025295 | Ga0209564_1002281 | Ga0209564_100228120 | 80 |
| 338 | 3300025297 | Ga0209758_1001224 | Ga0209758_10012242 | 80 |
| 339 | 3300025297 | Ga0209758_1037536 | Ga0209758_10375362 | 80 |
| 340 | 3300025298 | Ga0209050_1000072 | Ga0209050_100007231 | 80 |
| 341 | 3300025298 | Ga0209050_1000927 | Ga0209050_100092713 | 80 |
| 342 | 3300025298 | Ga0209050_1004050 | Ga0209050_10040502 | 80 |
| 343 | 3300025298 | Ga0209050_1008317 | Ga0209050_10083174 | 80 |
| 344 | 3300025299 | Ga0209256_1000088 | Ga0209256_1000088184 | 80 |
| 345 | 3300025299 | Ga0209256_1023010 | Ga0209256_10230102 | 80 |
| 346 | 3300025299 | Ga0209256_1025808 | Ga0209256_10258082 | 80 |
| 347 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038378 | 80 |
| 348 | 3300025302 | Ga0207426_1000053 | Ga0207426_100005336 | 80 |
| 349 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015204 | 80 |
| 350 | 3300025303 | Ga0209051_1000056 | Ga0209051_1000056196 | 80 |
| 351 | 3300025303 | Ga0209051_1000196 | Ga0209051_1000196110 | 80 |
| 352 | 3300025303 | Ga0209051_1000392 | Ga0209051_10003922 | 80 |
| 353 | 3300025303 | Ga0209051_1000424 | Ga0209051_100042411 | 80 |
| 354 | 3300025303 | Ga0209051_1000545 | Ga0209051_100054541 | 80 |
| 355 | 3300025304 | Ga0209257_1000305 | Ga0209257_10003059 | 80 |
| 356 | 3300025304 | Ga0209257_1002205 | Ga0209257_10022052 | 80 |
| 357 | 3300025304 | Ga0209257_1004602 | Ga0209257_100460213 | 80 |
| 358 | 3300025304 | Ga0209257_1009796 | Ga0209257_10097962 | 80 |
| 359 | 3300025304 | Ga0209257_1059782 | Ga0209257_10597822 | 80 |
| 360 | 3300025321 | Ga0207656_10012795 | Ga0207656_100127954 | 80 |
| 361 | 3300025728 | Ga0207655_1006555 | Ga0207655_10065556 | 80 |
| 362 | 3300025728 | Ga0207655_1222623 | Ga0207655_12226232 | 80 |
| 363 | 3300025893 | Ga0207682_10318236 | Ga0207682_103182361 | 80 |
| 364 | 3300025901 | Ga0207688_10900022 | Ga0207688_109000222 | 80 |
| 365 | 3300025903 | Ga0207680_10255063 | Ga0207680_102550632 | 80 |
| 366 | 3300025909 | Ga0207705_10022490 | Ga0207705_100224903 | 80 |
| 367 | 3300025909 | Ga0207705_10074648 | Ga0207705_100746483 | 80 |
| 368 | 3300025909 | Ga0207705_10472555 | Ga0207705_104725552 | 80 |
| 369 | 3300025911 | Ga0207654_10240763 | Ga0207654_102407632 | 80 |
| 370 | 3300025913 | Ga0207695_10060685 | Ga0207695_100606853 | 80 |
| 371 | 3300025914 | Ga0207671_10088086 | Ga0207671_100880862 | 80 |
| 372 | 3300025914 | Ga0207671_10806075 | Ga0207671_108060752 | 80 |
| 373 | 3300025917 | Ga0207660_10181378 | Ga0207660_101813782 | 80 |
| 374 | 3300025919 | Ga0207657_10014060 | Ga0207657_100140605 | 80 |
| 375 | 3300025919 | Ga0207657_10282786 | Ga0207657_102827862 | 80 |
| 376 | 3300025920 | Ga0207649_10704367 | Ga0207649_107043672 | 80 |
| 377 | 3300025920 | Ga0207649_10810040 | Ga0207649_108100402 | 80 |
| 378 | 3300025921 | Ga0207652_10088927 | Ga0207652_100889273 | 80 |
| 379 | 3300025921 | Ga0207652_10161675 | Ga0207652_101616752 | 80 |
| 380 | 3300025924 | Ga0207694_10022934 | Ga0207694_100229344 | 80 |
| 381 | 3300025924 | Ga0207694_10250337 | Ga0207694_102503372 | 80 |
| 382 | 3300025924 | Ga0207694_10767923 | Ga0207694_107679232 | 80 |
| 383 | 3300025925 | Ga0207650_10312000 | Ga0207650_103120002 | 80 |
| 384 | 3300025926 | Ga0207659_10732672 | Ga0207659_107326722 | 80 |
| 385 | 3300025926 | Ga0207659_11340761 | Ga0207659_113407611 | 80 |
| 386 | 3300025927 | Ga0207687_10015912 | Ga0207687_100159124 | 80 |
| 387 | 3300025929 | Ga0207664_10600294 | Ga0207664_106002942 | 80 |
| 388 | 3300025932 | Ga0207690_10127659 | Ga0207690_101276593 | 80 |
| 389 | 3300025932 | Ga0207690_11043904 | Ga0207690_110439042 | 80 |
| 390 | 3300025933 | Ga0207706_10075902 | Ga0207706_100759023 | 80 |
| 391 | 3300025933 | Ga0207706_10275666 | Ga0207706_102756662 | 80 |
| 392 | 3300025934 | Ga0207686_10001796 | Ga0207686_100017962 | 80 |
| 393 | 3300025934 | Ga0207686_10224147 | Ga0207686_102241472 | 80 |
| 394 | 3300025934 | Ga0207686_10579039 | Ga0207686_105790392 | 80 |
| 395 | 3300025935 | Ga0207709_10000958 | Ga0207709_100009589 | 80 |
| 396 | 3300025935 | Ga0207709_10001025 | Ga0207709_100010259 | 80 |
| 397 | 3300025935 | Ga0207709_10001291 | Ga0207709_1000129112 | 80 |
| 398 | 3300025935 | Ga0207709_10002267 | Ga0207709_100022677 | 80 |
| 399 | 3300025935 | Ga0207709_10002735 | Ga0207709_100027356 | 80 |
| 400 | 3300025935 | Ga0207709_10203263 | Ga0207709_102032632 | 80 |
| 401 | 3300025937 | Ga0207669_10822658 | Ga0207669_108226582 | 80 |
| 402 | 3300025938 | Ga0207704_10521793 | Ga0207704_105217932 | 80 |
| 403 | 3300025938 | Ga0207704_10843252 | Ga0207704_108432522 | 80 |
| 404 | 3300025938 | Ga0207704_11670850 | Ga0207704_116708502 | 80 |
| 405 | 3300025940 | Ga0207691_10759872 | Ga0207691_107598722 | 80 |
| 406 | 3300025940 | Ga0207691_11492302 | Ga0207691_114923021 | 80 |
| 407 | 3300025941 | Ga0207711_10494626 | Ga0207711_104946262 | 80 |
| 408 | 3300025941 | Ga0207711_12098101 | Ga0207711_120981011 | 80 |
| 409 | 3300025942 | Ga0207689_10065726 | Ga0207689_100657264 | 80 |
| 410 | 3300025942 | Ga0207689_10081640 | Ga0207689_100816402 | 80 |
| 411 | 3300025942 | Ga0207689_10482507 | Ga0207689_104825071 | 80 |
| 412 | 3300025942 | Ga0207689_10670999 | Ga0207689_106709992 | 80 |
| 413 | 3300025945 | Ga0207679_10066316 | Ga0207679_100663164 | 80 |
| 414 | 3300025949 | Ga0207667_10341672 | Ga0207667_103416722 | 80 |
| 415 | 3300025949 | Ga0207667_10374716 | Ga0207667_103747163 | 80 |
| 416 | 3300025949 | Ga0207667_10674686 | Ga0207667_106746862 | 80 |
| 417 | 3300025949 | Ga0207667_11952205 | Ga0207667_119522052 | 80 |
| 418 | 3300025960 | Ga0207651_10255794 | Ga0207651_102557942 | 80 |
| 419 | 3300025960 | Ga0207651_10421668 | Ga0207651_104216682 | 80 |
| 420 | 3300025972 | Ga0207668_10248284 | Ga0207668_102482842 | 80 |
| 421 | 3300025972 | Ga0207668_12032824 | Ga0207668_120328242 | 80 |
| 422 | 3300025981 | Ga0207640_10178836 | Ga0207640_101788362 | 80 |
| 423 | 3300025981 | Ga0207640_10754190 | Ga0207640_107541902 | 80 |
| 424 | 3300025986 | Ga0207658_10267667 | Ga0207658_102676672 | 80 |
| 425 | 3300025986 | Ga0207658_10747812 | Ga0207658_107478122 | 80 |
| 426 | 3300025986 | Ga0207658_11007527 | Ga0207658_110075272 | 80 |
| 427 | 3300026023 | Ga0207677_10181460 | Ga0207677_101814602 | 80 |
| 428 | 3300026023 | Ga0207677_10493446 | Ga0207677_104934463 | 80 |
| 429 | 3300026041 | Ga0207639_10010944 | Ga0207639_100109449 | 80 |
| 430 | 3300026041 | Ga0207639_11073821 | Ga0207639_110738212 | 80 |
| 431 | 3300026041 | Ga0207639_11245984 | Ga0207639_112459842 | 80 |
| 432 | 3300026067 | Ga0207678_10395257 | Ga0207678_103952572 | 80 |
| 433 | 3300026078 | Ga0207702_10246572 | Ga0207702_102465722 | 80 |
| 434 | 3300026078 | Ga0207702_11035726 | Ga0207702_110357262 | 80 |
| 435 | 3300026088 | Ga0207641_10024357 | Ga0207641_100243573 | 80 |
| 436 | 3300026089 | Ga0207648_10874461 | Ga0207648_108744612 | 80 |
| 437 | 3300026089 | Ga0207648_11344358 | Ga0207648_113443582 | 80 |
| 438 | 3300026116 | Ga0207674_10202033 | Ga0207674_102020333 | 80 |
| 439 | 3300026116 | Ga0207674_10486044 | Ga0207674_104860442 | 80 |
| 440 | 3300026116 | Ga0207674_10713668 | Ga0207674_107136682 | 80 |
| 441 | 3300026121 | Ga0207683_10180083 | Ga0207683_101800832 | 80 |
| 442 | 3300026121 | Ga0207683_10332354 | Ga0207683_103323542 | 80 |
| 443 | 3300026142 | Ga0207698_10296757 | Ga0207698_102967572 | 80 |
| 444 | 3300026142 | Ga0207698_11526489 | Ga0207698_115264892 | 80 |
| 445 | 3300027111 | Ga0209281_1033796 | Ga0209281_10337962 | 80 |
| 446 | 3300027666 | Ga0209282_1001024 | Ga0209282_100102412 | 80 |
| 447 | 3300027866 | Ga0209813_10141295 | Ga0209813_101412952 | 80 |
| 448 | 3300027876 | Ga0209974_10085254 | Ga0209974_100852542 | 80 |
| 449 | 3300027907 | Ga0207428_10127051 | Ga0207428_101270512 | 80 |
| 450 | 3300028379 | Ga0268266_10218330 | Ga0268266_102183302 | 80 |
| 451 | 3300028380 | Ga0268265_10386394 | Ga0268265_103863941 | 80 |
| 452 | 3300028381 | Ga0268264_12398864 | Ga0268264_123988642 | 80 |
| 453 | 3300028794 | Ga0307515_10000084 | Ga0307515_10000084178 | 80 |
| 454 | 3300028794 | Ga0307515_10072156 | Ga0307515_100721562 | 80 |
| 455 | 3300028794 | Ga0307515_10483798 | Ga0307515_104837981 | 80 |
| 456 | 3300028794 | Ga0307515_10538684 | Ga0307515_105386842 | 80 |
| 457 | 3300030522 | Ga0307512_10121381 | Ga0307512_101213812 | 80 |
| 458 | 3300030731 | Ga0316177_1148101 | Ga0316177_11481013 | 80 |
| 459 | 3300030733 | Ga0314311_1237239 | Ga0314311_12372392 | 80 |
| 460 | 3300030735 | Ga0316178_1016090 | Ga0316178_10160902 | 80 |
| 461 | 3300030736 | Ga0316180_1033885 | Ga0316180_10338852 | 80 |
| 462 | 3300030742 | Ga0316183_1122753 | Ga0316183_11227532 | 80 |
| 463 | 3300030744 | Ga0316181_1085526 | Ga0316181_10855262 | 80 |
| 464 | 3300030745 | Ga0316182_1238099 | Ga0316182_12380992 | 80 |
| 465 | 3300030745 | Ga0316182_1399987 | Ga0316182_13999873 | 80 |
| 466 | 3300031251 | Ga0265327_10148026 | Ga0265327_101480262 | 80 |
| 467 | 3300031456 | Ga0307513_10026225 | Ga0307513_100262258 | 80 |
| 468 | 3300031456 | Ga0307513_10519366 | Ga0307513_105193662 | 80 |
| 469 | 3300031548 | Ga0307408_100073371 | Ga0307408_1000733712 | 80 |
| 470 | 3300031548 | Ga0307408_100080304 | Ga0307408_1000803042 | 80 |
| 471 | 3300031548 | Ga0307408_100161448 | Ga0307408_1001614482 | 80 |
| 472 | 3300031548 | Ga0307408_100266625 | Ga0307408_1002666252 | 80 |
| 473 | 3300031548 | Ga0307408_100280671 | Ga0307408_1002806712 | 80 |
| 474 | 3300031548 | Ga0307408_100316751 | Ga0307408_1003167512 | 80 |
| 475 | 3300031548 | Ga0307408_100464861 | Ga0307408_1004648611 | 80 |
| 476 | 3300031548 | Ga0307408_100480893 | Ga0307408_1004808932 | 80 |
| 477 | 3300031548 | Ga0307408_100546985 | Ga0307408_1005469852 | 80 |
| 478 | 3300031548 | Ga0307408_101249100 | Ga0307408_1012491002 | 80 |
| 479 | 3300031548 | Ga0307408_101845938 | Ga0307408_1018459382 | 80 |
| 480 | 3300031548 | Ga0307408_102262748 | Ga0307408_1022627482 | 80 |
| 481 | 3300031649 | Ga0307514_10000954 | Ga0307514_1000095428 | 80 |
| 482 | 3300031649 | Ga0307514_10138226 | Ga0307514_101382262 | 80 |
| 483 | 3300031711 | Ga0265314_10007074 | Ga0265314_100070746 | 80 |
| 484 | 3300031731 | Ga0307405_10022681 | Ga0307405_100226813 | 80 |
| 485 | 3300031731 | Ga0307405_10203872 | Ga0307405_102038721 | 80 |
| 486 | 3300031731 | Ga0307405_10313310 | Ga0307405_103133102 | 80 |
| 487 | 3300031731 | Ga0307405_10474225 | Ga0307405_104742252 | 80 |
| 488 | 3300031824 | Ga0307413_10138982 | Ga0307413_101389822 | 80 |
| 489 | 3300031824 | Ga0307413_10454530 | Ga0307413_104545302 | 80 |
| 490 | 3300031824 | Ga0307413_10903079 | Ga0307413_109030792 | 80 |
| 491 | 3300031852 | Ga0307410_10510404 | Ga0307410_105104042 | 80 |
| 492 | 3300031852 | Ga0307410_10530941 | Ga0307410_105309412 | 80 |
| 493 | 3300031852 | Ga0307410_11552995 | Ga0307410_115529952 | 80 |
| 494 | 3300031901 | Ga0307406_10001705 | Ga0307406_100017052 | 80 |
| 495 | 3300031901 | Ga0307406_10029763 | Ga0307406_100297633 | 80 |
| 496 | 3300031901 | Ga0307406_10444781 | Ga0307406_104447812 | 80 |
| 497 | 3300031901 | Ga0307406_10880524 | Ga0307406_108805242 | 80 |
| 498 | 3300031901 | Ga0307406_10985024 | Ga0307406_109850242 | 80 |
| 499 | 3300031901 | Ga0307406_11055058 | Ga0307406_110550582 | 80 |
| 500 | 3300031903 | Ga0307407_10127011 | Ga0307407_101270112 | 80 |
| 501 | 3300031903 | Ga0307407_10219229 | Ga0307407_102192292 | 80 |
| 502 | 3300031911 | Ga0307412_10009231 | Ga0307412_100092317 | 80 |
| 503 | 3300031911 | Ga0307412_10018497 | Ga0307412_100184975 | 80 |
| 504 | 3300031911 | Ga0307412_10040329 | Ga0307412_100403295 | 80 |
| 505 | 3300031911 | Ga0307412_10069765 | Ga0307412_100697652 | 80 |
| 506 | 3300031911 | Ga0307412_10164512 | Ga0307412_101645122 | 80 |
| 507 | 3300031911 | Ga0307412_10239149 | Ga0307412_102391492 | 80 |
| 508 | 3300031911 | Ga0307412_10434341 | Ga0307412_104343412 | 80 |
| 509 | 3300031911 | Ga0307412_10818926 | Ga0307412_108189262 | 80 |
| 510 | 3300031911 | Ga0307412_10882358 | Ga0307412_108823582 | 80 |
| 511 | 3300031911 | Ga0307412_11066941 | Ga0307412_110669412 | 80 |
| 512 | 3300031911 | Ga0307412_11218498 | Ga0307412_112184982 | 80 |
| 513 | 3300031995 | Ga0307409_100360040 | Ga0307409_1003600402 | 80 |
| 514 | 3300031995 | Ga0307409_101306064 | Ga0307409_1013060642 | 80 |
| 515 | 3300032002 | Ga0307416_100090654 | Ga0307416_1000906542 | 80 |
| 516 | 3300032002 | Ga0307416_100648391 | Ga0307416_1006483912 | 80 |
| 517 | 3300032002 | Ga0307416_100665749 | Ga0307416_1006657492 | 80 |
| 518 | 3300032002 | Ga0307416_100692627 | Ga0307416_1006926272 | 80 |
| 519 | 3300032002 | Ga0307416_101187508 | Ga0307416_1011875082 | 80 |
| 520 | 3300032002 | Ga0307416_101387557 | Ga0307416_1013875572 | 80 |
| 521 | 3300032002 | Ga0307416_102124172 | Ga0307416_1021241721 | 80 |
| 522 | 3300032002 | Ga0307416_103302620 | Ga0307416_1033026202 | 80 |
| 523 | 3300032004 | Ga0307414_10068974 | Ga0307414_100689742 | 80 |
| 524 | 3300032004 | Ga0307414_10091564 | Ga0307414_100915642 | 80 |
| 525 | 3300032004 | Ga0307414_10593157 | Ga0307414_105931571 | 80 |
| 526 | 3300032004 | Ga0307414_10877261 | Ga0307414_108772611 | 80 |
| 527 | 3300032004 | Ga0307414_12203709 | Ga0307414_122037092 | 80 |
| 528 | 3300032005 | Ga0307411_10024402 | Ga0307411_100244022 | 80 |
| 529 | 3300032005 | Ga0307411_10178581 | Ga0307411_101785812 | 80 |
| 530 | 3300032005 | Ga0307411_10311964 | Ga0307411_103119642 | 80 |
| 531 | 3300032005 | Ga0307411_10454826 | Ga0307411_104548262 | 80 |
| 532 | 3300032005 | Ga0307411_10974878 | Ga0307411_109748782 | 80 |
| 533 | 3300032005 | Ga0307411_11479876 | Ga0307411_114798762 | 80 |
| 534 | 3300032005 | Ga0307411_12260670 | Ga0307411_122606702 | 80 |
| 535 | 3300032126 | Ga0307415_101084036 | Ga0307415_1010840361 | 80 |
| 536 | 3300035170 | Ga0373943_0428727 | Ga0373943_0428727_73_315 | 80 |
| 537 | 3300035691 | Ga0373931_0089159 | Ga0373931_0089159_172_414 | 80 |
| 538 | 3300037312 | Ga0395899_0104110 | Ga0395899_0104110_180_428 | 80 |
| 539 | 3300037418 | Ga0395900_0161473 | Ga0395900_0161473_443_688 | 80 |
| 540 | 3300037466 | Ga0395898_0294881 | Ga0395898_0294881_213_461 | 80 |
| 541 | 3300037471 | Ga0395905_0050498 | Ga0395905_0050498_3414_3662 | 80 |
| 542 | 3300037471 | Ga0395905_0633031 | Ga0395905_0633031_353_598 | 80 |
| 543 | 3300038443 | Ga0395901_0074087 | Ga0395901_0074087_1998_2240 | 80 |
| 544 | 3300038443 | Ga0395901_0435328 | Ga0395901_0435328_105_350 | 80 |
| 545 | 3300038443 | Ga0395901_1223270 | Ga0395901_1223270_14_262 | 80 |
| 546 | 3300039447 | Ga0436361_0070738 | Ga0436361_0070738_18275_18517 | 80 |
| 547 | 3300041404 | Ga0439436_0001048 | Ga0439436_0001048_5892_6134 | 80 |
| 548 | 3300041404 | Ga0439436_0049230 | Ga0439436_0049230_459_701 | 80 |
| 549 | 3300041404 | Ga0439436_0265955 | Ga0439436_0265955_105_347 | 80 |
| 550 | 3300041405 | Ga0439438_081388 | Ga0439438_081388_335_577 | 80 |
| 551 | 3300041406 | Ga0439439_0000268 | Ga0439439_0000268_5305_5547 | 80 |
| 552 | 3300041406 | Ga0439439_0039004 | Ga0439439_0039004_883_1125 | 80 |
| 553 | 3300041407 | Ga0439447_023051 | Ga0439447_023051_1090_1332 | 80 |
| 554 | 3300041410 | Ga0439461_0006198 | Ga0439461_0006198_1242_1484 | 80 |
| 555 | 3300041410 | Ga0439461_0051778 | Ga0439461_0051778_163_405 | 80 |
| 556 | 3300041410 | Ga0439461_0077677 | Ga0439461_0077677_16_258 | 80 |
| 557 | 3300041410 | Ga0439461_0101819 | Ga0439461_0101819_61_303 | 80 |
| 558 | 3300041411 | Ga0439466_0004086 | Ga0439466_0004086_3020_3262 | 80 |
| 559 | 3300041411 | Ga0439466_0051658 | Ga0439466_0051658_923_1165 | 80 |
| 560 | 3300041411 | Ga0439466_0106718 | Ga0439466_0106718_98_340 | 80 |
| 561 | 3300041411 | Ga0439466_0238257 | Ga0439466_0238257_215_457 | 80 |
| 562 | 3300041413 | Ga0439465_0003993 | Ga0439465_0003993_4069_4311 | 80 |
| 563 | 3300041413 | Ga0439465_0023149 | Ga0439465_0023149_263_505 | 80 |
| 564 | 3300041441 | Ga0451787_019627 | Ga0451787_019627_545_787 | 80 |
| 565 | 3300041443 | Ga0451789_0111381 | Ga0451789_0111381_222_464 | 80 |
| 566 | 3300041451 | Ga0451791_1495823 | Ga0451791_1495823_18_260 | 80 |
| 567 | 3300041452 | Ga0451793_0435770 | Ga0451793_0435770_687_929 | 80 |
| 568 | 3300041452 | Ga0451793_1075355 | Ga0451793_1075355_421_663 | 80 |
| 569 | 3300041452 | Ga0451793_1159892 | Ga0451793_1159892_115_357 | 80 |
| 570 | 3300041453 | Ga0451797_0157609 | Ga0451797_0157609_224_466 | 80 |
| 571 | 3300041458 | Ga0451798_0238516 | Ga0451798_0238516_85_336 | 80 |
| 572 | 3300041459 | Ga0451800_1458506 | Ga0451800_1458506_273_515 | 80 |
| 573 | 3300041460 | Ga0451802_0624242 | Ga0451802_0624242_149_391 | 80 |
| 574 | 3300041486 | Ga0451807_0286398 | Ga0451807_0286398_152_394 | 80 |
| 575 | 3300041486 | Ga0451807_1888789 | Ga0451807_1888789_78_320 | 80 |
| 576 | 3300041491 | Ga0451833_0083665 | Ga0451833_0083665_207_449 | 80 |
| 577 | 3300041494 | Ga0451837_0663527 | Ga0451837_0663527_267_509 | 80 |
| 578 | 3300041498 | Ga0451841_0595886 | Ga0451841_0595886_400_642 | 80 |
| 579 | 3300041505 | Ga0451849_1011591 | Ga0451849_1011591_168_410 | 80 |
| 580 | 3300041512 | Ga0451853_1220038 | Ga0451853_1220038_231_479 | 80 |
| 581 | 3300041997 | Ga0439431_0000483 | Ga0439431_0000483_2805_3047 | 80 |
| 582 | 3300041997 | Ga0439431_0022187 | Ga0439431_0022187_17_259 | 80 |
| 583 | 3300041999 | Ga0439433_0002772 | Ga0439433_0002772_2122_2364 | 80 |
| 584 | 3300041999 | Ga0439433_0007775 | Ga0439433_0007775_602_844 | 80 |
| 585 | 3300042000 | Ga0439437_038995 | Ga0439437_038995_191_436 | 80 |
| 586 | 3300042000 | Ga0439437_044912 | Ga0439437_044912_259_501 | 80 |
| 587 | 3300042002 | Ga0439442_026084 | Ga0439442_026084_421_663 | 80 |
| 588 | 3300042002 | Ga0439442_035387 | Ga0439442_035387_26_268 | 80 |
| 589 | 3300042004 | Ga0439445_0255926 | Ga0439445_0255926_126_368 | 80 |
| 590 | 3300042006 | Ga0439432_001040 | Ga0439432_001040_6822_7064 | 80 |
| 591 | 3300042006 | Ga0439432_096329 | Ga0439432_096329_474_716 | 80 |
| 592 | 3300042006 | Ga0439432_213823 | Ga0439432_213823_287_529 | 80 |
| 593 | 3300042007 | Ga0439449_0019219 | Ga0439449_0019219_1457_1699 | 80 |
| 594 | 3300042007 | Ga0439449_0130775 | Ga0439449_0130775_379_621 | 80 |
| 595 | 3300042010 | Ga0439452_003891 | Ga0439452_003891_491_733 | 80 |
| 596 | 3300042010 | Ga0439452_006902 | Ga0439452_006902_1321_1563 | 80 |
| 597 | 3300042011 | Ga0439454_012408 | Ga0439454_012408_493_735 | 80 |
| 598 | 3300042014 | Ga0439457_012603 | Ga0439457_012603_228_470 | 80 |
| 599 | 3300042014 | Ga0439457_046768 | Ga0439457_046768_131_373 | 80 |
| 600 | 3300042014 | Ga0439457_065680 | Ga0439457_065680_150_392 | 80 |
| 601 | 3300042015 | Ga0439462_0001318 | Ga0439462_0001318_4575_4817 | 80 |
| 602 | 3300042015 | Ga0439462_0079804 | Ga0439462_0079804_491_733 | 80 |
| 603 | 3300042115 | Ga0450911_030684 | Ga0450911_030684_163_405 | 80 |
| 604 | 3300042116 | Ga0450912_032470 | Ga0450912_032470_141_383 | 80 |
| 605 | 3300042121 | Ga0450919_015142 | Ga0450919_015142_422_664 | 80 |
| 606 | 3300042122 | Ga0450920_033381 | Ga0450920_033381_268_510 | 80 |
| 607 | 3300042123 | Ga0450921_005413 | Ga0450921_005413_278_520 | 80 |
| 608 | 3300042124 | Ga0450922_022460 | Ga0450922_022460_384_626 | 80 |
| 609 | 3300042125 | Ga0450923_005097 | Ga0450923_005097_140_382 | 80 |
| 610 | 3300042126 | Ga0450888_039612 | Ga0450888_039612_294_539 | 80 |
| 611 | 3300042127 | Ga0450890_078893 | Ga0450890_078893_129_374 | 80 |
| 612 | 3300042131 | Ga0450894_041805 | Ga0450894_041805_57_299 | 80 |
| 613 | 3300042133 | Ga0450896_015628 | Ga0450896_015628_341_583 | 80 |
| 614 | 3300042133 | Ga0450896_036011 | Ga0450896_036011_227_469 | 80 |
| 615 | 3300042134 | Ga0450898_006200 | Ga0450898_006200_471_713 | 80 |
| 616 | 3300042134 | Ga0450898_018085 | Ga0450898_018085_413_655 | 80 |
| 617 | 3300042136 | Ga0450900_033416 | Ga0450900_033416_23_265 | 80 |
| 618 | 3300042145 | Ga0450906_005730 | Ga0450906_005730_1816_2058 | 80 |
| 619 | 3300042147 | Ga0450910_010111 | Ga0450910_010111_839_1081 | 80 |
| 620 | 3300042147 | Ga0450910_054393 | Ga0450910_054393_187_429 | 80 |
| 621 | 3300042156 | Ga0439446_0005262 | Ga0439446_0005262_1265_1507 | 80 |
| 622 | 3300042156 | Ga0439446_0048173 | Ga0439446_0048173_252_494 | 80 |
| 623 | 3300042156 | Ga0439446_0124007 | Ga0439446_0124007_75_317 | 80 |
| 624 | 3300042156 | Ga0439446_0139013 | Ga0439446_0139013_445_687 | 80 |
| 625 | 3300042156 | Ga0439446_0182861 | Ga0439446_0182861_77_319 | 80 |
| 626 | 3300042184 | Ga0450908_004957 | Ga0450908_004957_1823_2065 | 80 |
| 627 | 3300042184 | Ga0450908_005518 | Ga0450908_005518_2025_2267 | 80 |
| 628 | 3300042435 | Ga0439434_0004240 | Ga0439434_0004240_487_729 | 80 |
| 629 | 3300042435 | Ga0439434_0006113 | Ga0439434_0006113_1457_1699 | 80 |
| 630 | 3300042435 | Ga0439434_0024175 | Ga0439434_0024175_587_829 | 80 |
| 631 | 3300042531 | Ga0450918_007011 | Ga0450918_007011_786_1028 | 80 |
| 632 | 3300042532 | Ga0450893_0001626 | Ga0450893_0001626_1272_1517 | 80 |
| 633 | 3300042532 | Ga0450893_0027591 | Ga0450893_0027591_457_699 | 80 |
| 634 | 3300042532 | Ga0450893_0064141 | Ga0450893_0064141_89_331 | 80 |
| 635 | 3300042532 | Ga0450893_0112883 | Ga0450893_0112883_271_513 | 80 |
| 636 | 3300042876 | Ga0451577_0007910 | Ga0451577_0007910_9248_9490 | 80 |
| 637 | 3300042876 | Ga0451577_0129918 | Ga0451577_0129918_1770_2015 | 80 |
| 638 | 3300044673 | Ga0453683_0009185 | Ga0453683_0009185_956_1198 | 80 |
| 639 | 3300044683 | Ga0466965_0050739 | Ga0466965_0050739_1384_1626 | 80 |
| 640 | 3300044712 | Ga0453684_0026869 | Ga0453684_0026869_8015_8257 | 80 |
| 641 | 3300044712 | Ga0453684_0763732 | Ga0453684_0763732_502_747 | 80 |
| 642 | 3300044712 | Ga0453684_1589321 | Ga0453684_1589321_36_278 | 80 |
| 643 | 3300044719 | Ga0466971_0401815 | Ga0466971_0401815_68_313 | 80 |
| 644 | 3300044842 | Ga0466957_0394886 | Ga0466957_0394886_305_550 | 80 |
| 645 | 3300044901 | Ga0466960_0024961 | Ga0466960_0024961_1922_2164 | 80 |
| 646 | 3300045051 | Ga0451576_0018182 | Ga0451576_0018182_366_608 | 80 |
| 647 | 3300045051 | Ga0451576_0788109 | Ga0451576_0788109_457_702 | 80 |
| 648 | 3300045976 | Ga0466967_0959779 | Ga0466967_0959779_324_569 | 80 |
| 649 | 3300046453 | Ga0495627_001913 | Ga0495627_001913_5513_5755 | 80 |
| 650 | 3300046453 | Ga0495627_084868 | Ga0495627_084868_494_736 | 80 |
| 651 | 3300046459 | Ga0495629_0801468 | Ga0495629_0801468_221_463 | 80 |
| 652 | 3300046460 | Ga0495638_0119583 | Ga0495638_0119583_609_851 | 80 |
| 653 | 3300046462 | Ga0495651_0382814 | Ga0495651_0382814_479_721 | 80 |
| 654 | 3300046463 | Ga0495653_0500140 | Ga0495653_0500140_213_455 | 80 |
| 655 | 3300046471 | Ga0495650_0113844 | Ga0495650_0113844_547_789 | 80 |
| 656 | 3300046475 | Ga0495639_0023242 | Ga0495639_0023242_772_1014 | 80 |
| 657 | 3300046512 | Ga0495610_0024818 | Ga0495610_0024818_2400_2642 | 80 |
| 658 | 3300046512 | Ga0495610_0212363 | Ga0495610_0212363_206_448 | 80 |
| 659 | 3300046513 | Ga0495616_0010183 | Ga0495616_0010183_2382_2624 | 80 |
| 660 | 3300046515 | Ga0495620_0002466 | Ga0495620_0002466_6589_6831 | 80 |
| 661 | 3300046515 | Ga0495620_0218188 | Ga0495620_0218188_402_644 | 80 |
| 662 | 3300046516 | Ga0495628_0750912 | Ga0495628_0750912_25_267 | 80 |
| 663 | 3300046517 | Ga0495630_0489811 | Ga0495630_0489811_564_806 | 80 |
| 664 | 3300046518 | Ga0495631_0003037 | Ga0495631_0003037_6284_6526 | 80 |
| 665 | 3300046520 | Ga0495637_0003474 | Ga0495637_0003474_1071_1313 | 80 |
| 666 | 3300046525 | Ga0495663_0153113 | Ga0495663_0153113_485_739 | 80 |
| 667 | 3300046528 | Ga0495642_0240402 | Ga0495642_0240402_370_612 | 80 |
| 668 | 3300046529 | Ga0495652_0731076 | Ga0495652_0731076_136_378 | 80 |
| 669 | 3300046530 | Ga0495654_0011433 | Ga0495654_0011433_4386_4628 | 80 |
| 670 | 3300046539 | Ga0495621_0013869 | Ga0495621_0013869_496_750 | 80 |
| 671 | 3300046539 | Ga0495621_0019672 | Ga0495621_0019672_121_363 | 80 |
| 672 | 3300046539 | Ga0495621_0302859 | Ga0495621_0302859_233_475 | 80 |
| 673 | 3300046557 | Ga0495622_0104723 | Ga0495622_0104723_684_926 | 80 |
| 674 | 3300046558 | Ga0495633_0270865 | Ga0495633_0270865_399_641 | 80 |
| 675 | 3300046615 | Ga0495656_0000746 | Ga0495656_0000746_8853_9107 | 80 |
| 676 | 3300046642 | Ga0495634_0699015 | Ga0495634_0699015_146_388 | 80 |
| 677 | 3300046660 | Ga0495625_0005468 | Ga0495625_0005468_503_745 | 80 |
| 678 | 3300046660 | Ga0495625_0069851 | Ga0495625_0069851_2055_2297 | 80 |
| 679 | 3300046660 | Ga0495625_0238885 | Ga0495625_0238885_402_644 | 80 |
| 680 | 3300046665 | Ga0495661_0328406 | Ga0495661_0328406_212_454 | 80 |
| 681 | 3300046665 | Ga0495661_0420979 | Ga0495661_0420979_209_451 | 80 |
| 682 | 3300046674 | Ga0495588_0102512 | Ga0495588_0102512_1112_1354 | 80 |
| 683 | 3300046674 | Ga0495588_0373218 | Ga0495588_0373218_103_345 | 80 |
| 684 | 3300046683 | Ga0495658_0063297 | Ga0495658_0063297_1390_1632 | 80 |
| 685 | 3300046683 | Ga0495658_1072531 | Ga0495658_1072531_50_292 | 80 |
| 686 | 3300046684 | Ga0495669_0657056 | Ga0495669_0657056_133_375 | 80 |
| 687 | 3300046690 | Ga0495624_0128461 | Ga0495624_0128461_655_897 | 80 |
| 688 | 3300046690 | Ga0495624_0344680 | Ga0495624_0344680_267_509 | 80 |
| 689 | 3300046691 | Ga0495670_0212498 | Ga0495670_0212498_263_505 | 80 |
| 690 | 3300046691 | Ga0495670_0255194 | Ga0495670_0255194_422_664 | 80 |
| 691 | 3300046691 | Ga0495670_0393707 | Ga0495670_0393707_240_482 | 80 |
| 692 | 3300046691 | Ga0495670_0529958 | Ga0495670_0529958_95_349 | 80 |
| 693 | 3300046692 | Ga0495671_0009329 | Ga0495671_0009329_2529_2771 | 80 |
| 694 | 3300047315 | Ga0495581_0353461 | Ga0495581_0353461_427_669 | 80 |
| 695 | 3300047317 | Ga0495604_1012317 | Ga0495604_1012317_120_362 | 80 |
| 696 | 3300047321 | Ga0495676_0102050 | Ga0495676_0102050_1038_1280 | 80 |
| 697 | 3300047445 | Ga0495677_0467489 | Ga0495677_0467489_182_424 | 80 |
| 698 | 3300047470 | Ga0495681_0345125 | Ga0495681_0345125_143_385 | 80 |
| 699 | 3300047472 | Ga0495686_0214275 | Ga0495686_0214275_429_671 | 80 |
| 700 | 3300047673 | Ga0495593_0012263 | Ga0495593_0012263_189_431 | 80 |
| 701 | 3300048088 | Ga0495602_0384296 | Ga0495602_0384296_56_298 | 80 |
| 702 | 3300048089 | Ga0495614_0051869 | Ga0495614_0051869_1022_1264 | 80 |
| 703 | 3300048089 | Ga0495614_0262777 | Ga0495614_0262777_496_738 | 80 |
| 704 | 3300048090 | Ga0495615_0096335 | Ga0495615_0096335_553_795 | 80 |
| 705 | 3300048090 | Ga0495615_0120639 | Ga0495615_0120639_296_550 | 80 |
| 706 | 3300048903 | Ga0496100_0009165 | Ga0496100_0009165_2451_2693 | 80 |
| 707 | 3300048904 | Ga0496101_0004382 | Ga0496101_0004382_8357_8599 | 80 |
| 708 | 3300048904 | Ga0496101_0005001 | Ga0496101_0005001_1845_2087 | 80 |
| 709 | 3300048905 | Ga0496102_0006127 | Ga0496102_0006127_1035_1277 | 80 |
| 710 | 3300048906 | Ga0496103_0210241 | Ga0496103_0210241_296_538 | 80 |
| 711 | 3300048907 | Ga0496104_0029955 | Ga0496104_0029955_4237_4479 | 80 |
| 712 | 3300048908 | Ga0496105_0004053 | Ga0496105_0004053_10398_10640 | 80 |
| 713 | 3300048909 | Ga0496106_0009081 | Ga0496106_0009081_175_417 | 80 |
| 714 | 3300048910 | Ga0496107_0054704 | Ga0496107_0054704_1418_1660 | 80 |
| 715 | 3300048910 | Ga0496107_0175066 | Ga0496107_0175066_71_313 | 80 |
| 716 | 3300048911 | Ga0496108_0571847 | Ga0496108_0571847_231_473 | 80 |
| 717 | 3300048912 | Ga0496109_0227502 | Ga0496109_0227502_79_321 | 80 |
| 718 | 3300048912 | Ga0496109_0594722 | Ga0496109_0594722_458_700 | 80 |
| 719 | 3300048913 | Ga0496110_0446642 | Ga0496110_0446642_435_677 | 80 |
| 720 | 3300048914 | Ga0496111_0071605 | Ga0496111_0071605_1896_2138 | 80 |
| 721 | 3300048914 | Ga0496111_0812564 | Ga0496111_0812564_160_402 | 80 |
| 722 | 3300048915 | Ga0496112_0325183 | Ga0496112_0325183_1019_1261 | 80 |
| 723 | 3300048916 | Ga0496113_0518479 | Ga0496113_0518479_345_587 | 80 |
| 724 | 3300048917 | Ga0496114_1021945 | Ga0496114_1021945_88_330 | 80 |
| 725 | 3300048917 | Ga0496114_1132328 | Ga0496114_1132328_400_654 | 80 |
| 726 | 3300048918 | Ga0496115_0941435 | Ga0496115_0941435_37_279 | 80 |
| 727 | 3300048919 | Ga0496116_0039510 | Ga0496116_0039510_792_1034 | 80 |
| 728 | 3300048920 | Ga0496117_0023000 | Ga0496117_0023000_2779_3021 | 80 |
| 729 | 3300048920 | Ga0496117_0043622 | Ga0496117_0043622_2597_2839 | 80 |
| 730 | 3300048921 | Ga0496118_0006363 | Ga0496118_0006363_6409_6651 | 80 |
| 731 | 3300048921 | Ga0496118_0019829 | Ga0496118_0019829_2419_2661 | 80 |
| 732 | 3300048922 | Ga0496119_0082193 | Ga0496119_0082193_591_833 | 80 |
| 733 | 3300048922 | Ga0496119_0175820 | Ga0496119_0175820_155_403 | 80 |
| 734 | 3300048924 | Ga0496121_0052610 | Ga0496121_0052610_1510_1752 | 80 |
| 735 | 3300048924 | Ga0496121_0121176 | Ga0496121_0121176_113_355 | 80 |
| 736 | 3300048925 | Ga0496122_0582460 | Ga0496122_0582460_267_509 | 80 |
| 737 | 3300048926 | Ga0496123_0377373 | Ga0496123_0377373_84_326 | 80 |
| 738 | 3300048927 | Ga0496124_0176704 | Ga0496124_0176704_610_852 | 80 |
| 739 | 3300048927 | Ga0496124_0544698 | Ga0496124_0544698_233_475 | 80 |
| 740 | 3300048928 | Ga0496125_0046359 | Ga0496125_0046359_253_495 | 80 |
| 741 | 3300048928 | Ga0496125_0053320 | Ga0496125_0053320_399_641 | 80 |
| 742 | 3300048928 | Ga0496125_0617063 | Ga0496125_0617063_142_384 | 80 |
| 743 | 3300049531 | Ga0501315_012151 | Ga0501315_012151_480_722 | 80 |
| 744 | 3300049533 | Ga0501317_049401 | Ga0501317_049401_263_505 | 80 |
| 745 | 3300049539 | Ga0501323_015594 | Ga0501323_015594_439_681 | 80 |
| 746 | 3300049539 | Ga0501323_067597 | Ga0501323_067597_69_314 | 80 |
| 747 | 3300049573 | Ga0501037_0145399 | Ga0501037_0145399_1070_1315 | 80 |
| 748 | 3300049580 | Ga0501046_0281209 | Ga0501046_0281209_605_847 | 80 |
| 749 | 3300049663 | Ga0501223_144669 | Ga0501223_144669_82_324 | 80 |
| 750 | 3300049668 | Ga0501233_289805 | Ga0501233_289805_144_386 | 80 |
| 751 | 3300049675 | Ga0501243_142071 | Ga0501243_142071_99_344 | 80 |
| 752 | 3300049679 | Ga0501249_050489 | Ga0501249_050489_61_303 | 80 |
| 753 | 3300049705 | Ga0501225_0046999 | Ga0501225_0046999_303_545 | 80 |
| 754 | 3300049776 | Ga0501280_027411 | Ga0501280_027411_302_547 | 80 |
| 755 | 3300050489 | nmdc:mga03683_105991_c1 | nmdc:mga03683_105991_c1_409_651 | 80 |
| 756 | 3300050489 | nmdc:mga03683_162337_c1 | nmdc:mga03683_162337_c1_451_693 | 80 |
| 757 | 3300050489 | nmdc:mga03683_197312_c2 | nmdc:mga03683_197312_c2_97_339 | 80 |
| 758 | 3300050489 | nmdc:mga03683_343496_c1 | nmdc:mga03683_343496_c1_447_689 | 80 |
| 759 | 3300050489 | nmdc:mga03683_345433_c1 | nmdc:mga03683_345433_c1_182_424 | 80 |
| 760 | 3300050489 | nmdc:mga03683_456182_c1 | nmdc:mga03683_456182_c1_149_391 | 80 |
| 761 | 3300050489 | nmdc:mga03683_468576_c1 | nmdc:mga03683_468576_c1_264_506 | 80 |
| 762 | 3300050489 | nmdc:mga03683_73810_c1 | nmdc:mga03683_73810_c1_1144_1386 | 80 |
| 763 | 3300050490 | nmdc:mga03n38_116333_c1 | nmdc:mga03n38_116333_c1_938_1180 | 80 |
| 764 | 3300050490 | nmdc:mga03n38_258017_c1 | nmdc:mga03n38_258017_c1_540_782 | 80 |
| 765 | 3300050490 | nmdc:mga03n38_330806_c1 | nmdc:mga03n38_330806_c1_509_751 | 80 |
| 766 | 3300050490 | nmdc:mga03n38_430839_c1 | nmdc:mga03n38_430839_c1_174_416 | 80 |
| 767 | 3300050490 | nmdc:mga03n38_500810_c1 | nmdc:mga03n38_500810_c1_271_513 | 80 |
| 768 | 3300050491 | nmdc:mga00v17_315474_c1 | nmdc:mga00v17_315474_c1_576_818 | 80 |
| 769 | 3300050491 | nmdc:mga00v17_42986_c1 | nmdc:mga00v17_42986_c1_612_854 | 80 |
| 770 | 3300050491 | nmdc:mga00v17_565297_c1 | nmdc:mga00v17_565297_c1_71_319 | 80 |
| 771 | 3300050491 | nmdc:mga00v17_585738_c1 | nmdc:mga00v17_585738_c1_143_385 | 80 |
| 772 | 3300050491 | nmdc:mga00v17_636184_c1 | nmdc:mga00v17_636184_c1_278_520 | 80 |
| 773 | 3300050491 | nmdc:mga00v17_767875_c1 | nmdc:mga00v17_767875_c1_237_479 | 80 |
| 774 | 3300050492 | nmdc:mga0yw44_138048_c1 | nmdc:mga0yw44_138048_c1_224_472 | 80 |
| 775 | 3300050492 | nmdc:mga0yw44_658365_c1 | nmdc:mga0yw44_658365_c1_232_474 | 80 |
| 776 | 3300050493 | nmdc:mga0k408_111441_c1 | nmdc:mga0k408_111441_c1_231_473 | 80 |
| 777 | 3300050493 | nmdc:mga0k408_231329_c1 | nmdc:mga0k408_231329_c1_670_912 | 80 |
| 778 | 3300050493 | nmdc:mga0k408_26362_c1 | nmdc:mga0k408_26362_c1_2373_2615 | 80 |
| 779 | 3300050493 | nmdc:mga0k408_305574_c1 | nmdc:mga0k408_305574_c1_468_710 | 80 |
| 780 | 3300050493 | nmdc:mga0k408_6011_c1 | nmdc:mga0k408_6011_c1_5924_6166 | 80 |
| 781 | 3300050493 | nmdc:mga0k408_81457_c1 | nmdc:mga0k408_81457_c1_1176_1418 | 80 |
| 782 | 3300050493 | nmdc:mga0k408_89457_c1 | nmdc:mga0k408_89457_c1_1389_1631 | 80 |
| 783 | 3300050494 | nmdc:mga06z11_154388_c1 | nmdc:mga06z11_154388_c1_145_387 | 80 |
| 784 | 3300050494 | nmdc:mga06z11_72127_c1 | nmdc:mga06z11_72127_c1_434_676 | 80 |
| 785 | 3300050495 | nmdc:mga04h51_283906_c1 | nmdc:mga04h51_283906_c1_60_302 | 80 |
| 786 | 3300050496 | nmdc:mga07m45_206558_c1 | nmdc:mga07m45_206558_c1_290_532 | 80 |
| 787 | 3300050496 | nmdc:mga07m45_25369_c1 | nmdc:mga07m45_25369_c1_91_336 | 80 |
| 788 | 3300050496 | nmdc:mga07m45_277484_c1 | nmdc:mga07m45_277484_c1_566_808 | 80 |
| 789 | 3300050496 | nmdc:mga07m45_289043_c1 | nmdc:mga07m45_289043_c1_487_729 | 80 |
| 790 | 3300050496 | nmdc:mga07m45_36823_c1 | nmdc:mga07m45_36823_c1_558_800 | 80 |
| 791 | 3300050496 | nmdc:mga07m45_383745_c1 | nmdc:mga07m45_383745_c1_226_468 | 80 |
| 792 | 3300050496 | nmdc:mga07m45_5257_c1 | nmdc:mga07m45_5257_c1_811_1053 | 80 |
| 793 | 3300050496 | nmdc:mga07m45_532405_c1 | nmdc:mga07m45_532405_c1_422_664 | 80 |
| 794 | 3300050496 | nmdc:mga07m45_5339_c1 | nmdc:mga07m45_5339_c1_1163_1405 | 80 |
| 795 | 3300050496 | nmdc:mga07m45_56345_c1 | nmdc:mga07m45_56345_c1_1210_1452 | 80 |
| 796 | 3300050496 | nmdc:mga07m45_758688_c1 | nmdc:mga07m45_758688_c1_187_429 | 80 |
| 797 | 3300050496 | nmdc:mga07m45_768095_c1 | nmdc:mga07m45_768095_c1_78_323 | 80 |
| 798 | 3300050516 | nmdc:mga0sz30_271917_c1 | nmdc:mga0sz30_271917_c1_186_428 | 80 |
| 799 | 3300050516 | nmdc:mga0sz30_388442_c1 | nmdc:mga0sz30_388442_c1_287_529 | 80 |
| 800 | 3300053078 | Ga0495612_0168246 | Ga0495612_0168246_576_818 | 80 |
| 801 | 3300053079 | Ga0500610_0056696 | Ga0500610_0056696_1079_1321 | 80 |
| 802 | 3300053083 | Ga0495655_0148787 | Ga0495655_0148787_59_301 | 80 |
| 803 | 3300053087 | Ga0500643_019521 | Ga0500643_019521_1227_1469 | 80 |
| 804 | 3300053093 | Ga0500651_0000347 | Ga0500651_0000347_14075_14317 | 80 |
| 805 | 3300053094 | Ga0500566_0114122 | Ga0500566_0114122_738_980 | 80 |
| 806 | 3300053103 | Ga0500555_159784 | Ga0500555_159784_198_440 | 80 |
| 807 | 3300053108 | Ga0500562_006293 | Ga0500562_006293_1301_1552 | 80 |
| 808 | 3300053108 | Ga0500562_144760 | Ga0500562_144760_224_466 | 80 |
| 809 | 3300053110 | Ga0500571_001746 | Ga0500571_001746_7037_7279 | 80 |
| 810 | 3300053111 | Ga0500572_175521 | Ga0500572_175521_413_655 | 80 |
| 811 | 3300053117 | Ga0500593_018569 | Ga0500593_018569_287_529 | 80 |
| 812 | 3300053117 | Ga0500593_118317 | Ga0500593_118317_366_617 | 80 |
| 813 | 3300053118 | Ga0500594_0033579 | Ga0500594_0033579_659_901 | 80 |
| 814 | 3300053121 | Ga0500607_006984 | Ga0500607_006984_2568_2810 | 80 |
| 815 | 3300053121 | Ga0500607_197701 | Ga0500607_197701_213_455 | 80 |
| 816 | 3300053122 | Ga0500608_017372 | Ga0500608_017372_1836_2078 | 80 |
| 817 | 3300053122 | Ga0500608_358475 | Ga0500608_358475_153_395 | 80 |
| 818 | 3300053129 | Ga0500628_111204 | Ga0500628_111204_16_258 | 80 |
| 819 | 3300053133 | Ga0500655_055511 | Ga0500655_055511_431_673 | 80 |
| 820 | 3300053134 | Ga0500658_0000560 | Ga0500658_0000560_6483_6725 | 80 |
| 821 | 3300053134 | Ga0500658_0000589 | Ga0500658_0000589_5946_6188 | 80 |
| 822 | 3300053138 | Ga0500564_131856 | Ga0500564_131856_469_711 | 80 |
| 823 | 3300053139 | Ga0500568_0006650 | Ga0500568_0006650_615_857 | 80 |
| 824 | 3300053142 | Ga0500577_0220196 | Ga0500577_0220196_460_711 | 80 |
| 825 | 3300053145 | Ga0500586_158012 | Ga0500586_158012_115_366 | 80 |
| 826 | 3300053153 | Ga0500616_0021860 | Ga0500616_0021860_1394_1636 | 80 |
| 827 | 3300053157 | Ga0500624_015969 | Ga0500624_015969_343_585 | 80 |
| 828 | 3300053158 | Ga0500627_0044221 | Ga0500627_0044221_633_875 | 80 |
| 829 | 3300053161 | Ga0500634_0257925 | Ga0500634_0257925_286_528 | 80 |
| 830 | 3300053161 | Ga0500634_0325631 | Ga0500634_0325631_15_257 | 80 |
| 831 | 3300053162 | Ga0500638_051737 | Ga0500638_051737_1312_1554 | 80 |
| 832 | 3300053177 | Ga0500636_0352800 | Ga0500636_0352800_287_529 | 80 |
| 833 | 3300053729 | Ga0500625_202069 | Ga0500625_202069_409_651 | 80 |
| 834 | 3300053730 | Ga0500645_198453 | Ga0500645_198453_264_515 | 80 |
| 835 | 3300053734 | Ga0500565_017652 | Ga0500565_017652_507_749 | 80 |
| 836 | 3300053735 | Ga0500596_018659 | Ga0500596_018659_634_876 | 80 |
| 837 | 3300059424 | Ga0590075_049907 | Ga0590075_049907_733_975 | 80 |
| 838 | 3300059426 | Ga0590077_137847 | Ga0590077_137847_297_539 | 80 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tr3-assembly2.cif.gz_A | structure of a bola protein homologue from coxiella burnetii | 0.9082 | 1 | 76 |
| 4pui-assembly1.cif.gz_A | bola domain of sufe1 from arabidopsis thaliana | 0.9015 | 3 | 74 |
| 4pui-assembly2.cif.gz_B | bola domain of sufe1 from arabidopsis thaliana | 0.8978 | 3 | 74 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.8854 | 1 | 80 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8819 | 1 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9W6_1_84_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9497 | 1 | 77 | 3.30.300.90 |
| af_Q67VQ4_70_166_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.9228 | 3 | 77 | 3.10.20.90 |
| af_Q4DAW3_3_74_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9134 | 2 | 69 | 3.30.300.90 |
| af_Q12238_9_101_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9116 | 4 | 74 | 3.30.300.90 |
| af_Q5AKW1_24_116_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9083 | 4 | 74 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L8XX10-F1-model_v4 | BolA family transcriptional regulator | 0.9845 | 1 | 78 |
|
| AF-A0A6A5L5I3-F1-model_v4 | deleted | 0.9832 | 1 | 76 |
|
| AF-A0A7V5V488-F1-model_v4 | BolA/IbaG family iron-sulfur metabolism protein | 0.9743 | 1 | 78 |
GO:0005829
GO:0006351 |
| AF-A0A1F3ZBD0-F1-model_v4 | BolA family transcriptional regulator | 0.9679 | 1 | 77 |
|
| AF-A0A4P7BH98-F1-model_v4 | deleted | 0.9646 | 1 | 79 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar