F482985

General Info

Members Datasets Scaffolds Average Seq Length
838 445 789 80

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_11670850|Ga0207704_116708502
Length 93
Sequence MRANGGYRICDRWNKTQQLQALIQSHLPCEHITLEGDGRHWYATIVSAEFEGKRAIQRHQRVYATLGAKMHTDEVHALSMKTYTPAEWAAVEK

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2738541277 Variovorax sp. GV051 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2738543012 Acidovorax sp. CF301 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2816332133 Acidovorax radicis 2721A Isolate Unclassified
22 2818991446 Variovorax sp. 1180 Isolate Unclassified
23 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
24 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
25 2842677519 Variovorax sp. R-72495 Isolate Unclassified
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
28 2885198086 Variovorax sp. 679 Isolate Unclassified
29 2885211737 Variovorax sp. 553 Isolate Unclassified
30 2899924645 Variovorax sp. 369 Isolate Unclassified
31 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
32 2904456579 Variovorax sp. 2002 Isolate Unclassified
33 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
34 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
35 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
36 2928037797 Variovorax sp. 1126 Isolate Unclassified
37 2928044640 Variovorax sp. 1128 Isolate Unclassified
38 2928051484 Variovorax sp. 1133 Isolate Unclassified
39 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
40 2928070936 Variovorax gossypii 1167 Isolate Unclassified
41 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
42 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
43 2929520902 Variovorax beijingensis 502 Isolate Unclassified
44 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
45 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
46 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
47 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
48 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
49 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
53 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
63 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
82 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
140 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
141 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
142 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
143 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
159 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
172 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
177 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
225 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
226 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
233 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
234 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
235 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
238 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
239 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
240 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
243 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
260 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
266 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
267 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
268 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
269 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
270 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
273 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
274 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
275 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
276 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
277 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
278 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
279 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
280 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
281 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
282 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
283 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
284 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
285 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
290 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
291 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
292 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
293 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
294 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
295 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
296 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
297 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
298 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
299 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
300 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
301 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
302 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
303 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
304 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
305 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
306 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
307 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
308 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
309 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
310 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
311 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
312 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
313 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
314 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
315 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
316 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
317 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
320 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
327 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
334 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
335 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
336 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
340 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
341 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
351 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
352 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
353 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
354 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
362 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
363 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
364 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
365 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
366 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
367 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
389 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
390 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
391 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
392 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
393 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
399 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
400 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
401 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
402 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
403 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
415 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
418 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
419 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
420 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
421 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
422 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
423 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
424 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
425 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
426 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
427 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
428 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
429 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
430 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
431 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
432 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
433 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
434 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
435 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
436 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
437 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
438 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
441 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
442 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
443 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
444 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
445 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.44
Metatranscriptomes 0.72
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.66
Nodule 0.6
Rhizoplane 4.42
Rhizosphere 61.69
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004290 3300001979 Bacteria 6145
2 JGI24739J22299_10008905 3300001989 Bacteria 3742
3 JGI24739J22299_10009598 3300001989 Bacteria 3603
4 JGI25158J39367_1004285 3300002739 Bacteria 2147
5 JGI25159J45721_1029844 3300002987 Bacteria 893
6 JGI25151J46595_10003000 3300003187 Bacteria 9602
7 JGI25151J46595_10028625 3300003187 Bacteria 2216
8 JGI25151J46595_10071196 3300003187 Bacteria 1052
9 JGI25153J46596_10009310 3300003215 Bacteria 4586
10 rootH1_10079751 3300003323 Bacteria 1474
11 JGI25160J50197_1010452 3300003354 Bacteria 3357
12 Ga0006562J51391_1089139 3300003578 Bacteria 2360
13 Ga0006562J51391_1089141 3300003578 Bacteria 1140
14 Ga0055527_1014119 3300003760 Bacteria 884
15 Ga0055535_1000966 3300003761 Bacteria 18756
16 Ga0055542_1000080 3300003762 Bacteria 129634
17 Ga0055537_1000150 3300003773 Bacteria 52097
18 Ga0055537_1003599 3300003773 Bacteria 4720
19 Ga0055524_1064407 3300003775 Bacteria 740
20 Ga0055536_1006807 3300003781 Bacteria 5232
21 Ga0055536_1027523 3300003781 Bacteria 1569
22 Ga0055536_1035061 3300003781 Bacteria 1260
23 Ga0055534_1000016 3300003784 Bacteria 144444
24 Ga0055534_1017802 3300003784 Bacteria 1248
25 Ga0055528_1000894 3300003790 Bacteria 20125
26 Ga0055528_1021050 3300003790 Bacteria 2086
27 Ga0055528_1043582 3300003790 Bacteria 975
28 Ga0055528_1094440 3300003790 Bacteria 510
29 Ga0055530_10003550 3300003791 Bacteria 8789
30 Ga0055530_10005191 3300003791 Bacteria 6327
31 Ga0055530_10061295 3300003791 Bacteria 838
32 Ga0055540_1019292 3300003792 Bacteria 1839
33 Ga0055540_1021120 3300003792 Bacteria 1700
34 Ga0055540_1023163 3300003792 Bacteria 1569
35 Ga0055540_1043939 3300003792 Bacteria 951
36 Ga0055531_10001826 3300003794 Bacteria 15080
37 Ga0055531_10004420 3300003794 Bacteria 8574
38 Ga0065714_10004675 3300005288 Bacteria 8108
39 Ga0065714_10080808 3300005288 Bacteria 2412
40 Ga0065714_10479621 3300005288 Bacteria 535
41 Ga0065704_10185663 3300005289 Bacteria 1214
42 Ga0065704_10296250 3300005289 Bacteria 894
43 Ga0065704_10364268 3300005289 Bacteria 793
44 Ga0065704_10444071 3300005289 Bacteria 710
45 Ga0070658_10139715 3300005327 Bacteria 2023
46 Ga0070658_10269609 3300005327 Bacteria 1447
47 Ga0070658_10817630 3300005327 Bacteria 810
48 Ga0068869_100022576 3300005334 Bacteria 4337
49 Ga0068869_100593224 3300005334 Bacteria 935
50 Ga0070666_10270584 3300005335 Bacteria 1206
51 Ga0068868_100159375 3300005338 Bacteria 1863
52 Ga0070660_100010089 3300005339 Bacteria 6665
53 Ga0070660_100782922 3300005339 Bacteria 802
54 Ga0070661_100647509 3300005344 Bacteria 857
55 Ga0070661_101085177 3300005344 Bacteria 666
56 Ga0070668_100766997 3300005347 Bacteria 855
57 Ga0070669_100287905 3300005353 Bacteria 1318
58 Ga0070674_100181127 3300005356 Bacteria 1614
59 Ga0070674_100524611 3300005356 Bacteria 990
60 Ga0070674_100629391 3300005356 Bacteria 910
61 Ga0070674_101776554 3300005356 Bacteria 559
62 Ga0070673_100945336 3300005364 Bacteria 801
63 Ga0070673_101209985 3300005364 Bacteria 708
64 Ga0070688_101789278 3300005365 Bacteria 504
65 Ga0070659_100183936 3300005366 Bacteria 1715
66 Ga0070667_100179365 3300005367 Bacteria 1873
67 Ga0070714_100904660 3300005435 Bacteria 857
68 Ga0070663_102137943 3300005455 Bacteria 505
69 Ga0070678_100243295 3300005456 Bacteria 1505
70 Ga0070678_100630753 3300005456 Bacteria 959
71 Ga0070678_101979127 3300005456 Bacteria 551
72 Ga0070662_100039907 3300005457 Bacteria 3341
73 Ga0068867_101691058 3300005459 Bacteria 593
74 Ga0070685_10929949 3300005466 Bacteria 649
75 Ga0070679_100054548 3300005530 Bacteria 3979
76 Ga0068853_100147073 3300005539 Bacteria 2118
77 Ga0068853_101617070 3300005539 Bacteria 628
78 Ga0070665_100010145 3300005548 Bacteria 9525
79 Ga0070665_101595040 3300005548 Bacteria 660
80 Ga0070665_101802463 3300005548 Bacteria 618
81 Ga0068855_100119841 3300005563 Bacteria 3012
82 Ga0068855_100241413 3300005563 Bacteria 2019
83 Ga0068855_101141513 3300005563 Bacteria 813
84 Ga0070664_100040580 3300005564 Bacteria 3925
85 Ga0068857_100073208 3300005577 Bacteria 3052
86 Ga0068857_100157874 3300005577 Bacteria 2057
87 Ga0068857_100927464 3300005577 Bacteria 836
88 Ga0068857_101816737 3300005577 Bacteria 597
89 Ga0068856_100206139 3300005614 Bacteria 1981
90 Ga0068856_100391387 3300005614 Bacteria 1410
91 Ga0068856_101525123 3300005614 Bacteria 682
92 Ga0068852_100107707 3300005616 Bacteria 2528
93 Ga0068852_101034290 3300005616 Bacteria 840
94 Ga0068859_101314464 3300005617 Bacteria 797
95 Ga0068864_101278132 3300005618 Bacteria 734
96 Ga0068866_11377083 3300005718 Bacteria 515
97 Ga0068861_102635540 3300005719 Bacteria 507
98 Ga0068851_10002741 3300005834 Bacteria 7758
99 Ga0068870_11118470 3300005840 Bacteria 567
100 Ga0068863_100134033 3300005841 Bacteria 2366
101 Ga0068858_101685273 3300005842 Bacteria 626
102 Ga0068862_100298255 3300005844 Bacteria 1482
103 Ga0075365_10022096 3300006038 Bacteria 3980
104 Ga0075365_10071228 3300006038 Bacteria 2340
105 Ga0075365_10930983 3300006038 Bacteria 613
106 Ga0075368_10251250 3300006042 Bacteria 756
107 Ga0075363_100007907 3300006048 Bacteria 4923
108 Ga0075363_100258058 3300006048 Bacteria 1005
109 Ga0075363_100816840 3300006048 Bacteria 568
110 Ga0075363_100876610 3300006048 Bacteria 549
111 Ga0075363_100897483 3300006048 Bacteria 543
112 Ga0075364_10020170 3300006051 Bacteria 4191
113 Ga0075364_10081814 3300006051 Bacteria 2135
114 Ga0075364_10210045 3300006051 Bacteria 1320
115 Ga0075364_10227248 3300006051 Bacteria 1267
116 Ga0075364_10970552 3300006051 Bacteria 578
117 Ga0075432_10002614 3300006058 Bacteria 6016
118 Ga0075432_10072540 3300006058 Bacteria 1239
119 Ga0075362_10037995 3300006177 Bacteria 2113
120 Ga0075362_10038214 3300006177 Bacteria 2108
121 Ga0075362_10056377 3300006177 Bacteria 1768
122 Ga0075362_10135941 3300006177 Bacteria 1172
123 Ga0075362_10179908 3300006177 Bacteria 1024
124 Ga0075362_10183140 3300006177 Bacteria 1015
125 Ga0075367_10136738 3300006178 Bacteria 1516
126 Ga0075367_10255335 3300006178 Bacteria 1100
127 Ga0075367_10440384 3300006178 Bacteria 825
128 Ga0075369_10082983 3300006186 Bacteria 1423
129 Ga0075369_10225578 3300006186 Bacteria 867
130 Ga0075366_10016366 3300006195 Bacteria 4262
131 Ga0075366_10025817 3300006195 Bacteria 3435
132 Ga0075366_10045854 3300006195 Bacteria 2590
133 Ga0075366_10077444 3300006195 Bacteria 1984
134 Ga0075366_10084748 3300006195 Bacteria 1895
135 Ga0075366_10116986 3300006195 Bacteria 1605
136 Ga0075366_10462917 3300006195 Bacteria 783
137 Ga0075366_10877728 3300006195 Bacteria 558
138 Ga0097621_100169928 3300006237 Bacteria 1879
139 Ga0097621_101014025 3300006237 Bacteria 777
140 Ga0075370_10001499 3300006353 Bacteria 10187
141 Ga0075370_10002475 3300006353 Bacteria 8564
142 Ga0075370_10004243 3300006353 Bacteria 6935
143 Ga0075370_10088484 3300006353 Bacteria 1785
144 Ga0075370_10094291 3300006353 Bacteria 1728
145 Ga0075370_10226115 3300006353 Bacteria 1106
146 Ga0075370_10247279 3300006353 Bacteria 1057
147 Ga0075370_10258840 3300006353 Bacteria 1032
148 Ga0075370_10311167 3300006353 Bacteria 937
149 Ga0075370_10590513 3300006353 Bacteria 673
150 Ga0075370_10866468 3300006353 Bacteria 551
151 Ga0068871_100023433 3300006358 Bacteria 4776
152 Ga0068871_100737242 3300006358 Bacteria 905
153 Ga0068871_101324974 3300006358 Bacteria 677
154 Ga0068865_100498852 3300006881 Bacteria 1014
155 Ga0068865_100848700 3300006881 Bacteria 791
156 Ga0068865_101090828 3300006881 Bacteria 703
157 Ga0075436_101513180 3300006914 Bacteria 510
158 Ga0097620_101314383 3300006931 Bacteria 797
159 Ga0079104_1021469 3300006946 Bacteria 1757
160 Ga0099826_10000101 3300006948 Bacteria 40408
161 Ga0105251_10646693 3300009011 Bacteria 505
162 Ga0105244_10010520 3300009036 Bacteria 5606
163 Ga0105244_10117797 3300009036 Bacteria 1288
164 Ga0105244_10126774 3300009036 Bacteria 1233
165 Ga0105250_10009366 3300009092 Bacteria 4128
166 Ga0105240_10006365 3300009093 Bacteria 17386
167 Ga0105240_10254488 3300009093 Bacteria 2029
168 Ga0105240_11010638 3300009093 Bacteria 889
169 Ga0105245_10872035 3300009098 Bacteria 941
170 Ga0105243_10003361 3300009148 Bacteria 12978
171 Ga0105243_10260122 3300009148 Bacteria 1553
172 Ga0105243_11061208 3300009148 Bacteria 816
173 Ga0105241_10419025 3300009174 Bacteria 1178
174 Ga0105242_10000553 3300009176 Bacteria 29613
175 Ga0105242_10201925 3300009176 Bacteria 1766
176 Ga0105242_10689738 3300009176 Bacteria 998
177 Ga0105242_10707822 3300009176 Bacteria 986
178 Ga0105248_10166463 3300009177 Bacteria 2485
179 Ga0105248_11054050 3300009177 Bacteria 919
180 Ga0105248_11159186 3300009177 Bacteria 874
181 Ga0105237_11331089 3300009545 Bacteria 724
182 Ga0105237_11629785 3300009545 Bacteria 652
183 Ga0105238_10017091 3300009551 Bacteria 7363
184 Ga0105238_10543900 3300009551 Bacteria 1165
185 Ga0105238_11705029 3300009551 Bacteria 661
186 Ga0105238_11867165 3300009551 Bacteria 633
187 Ga0105249_12090763 3300009553 Bacteria 639
188 Ga0105239_10200838 3300010375 Bacteria 2233
189 Ga0105239_11114608 3300010375 Bacteria 909
190 Ga0105246_10130197 3300011119 Bacteria 1878
191 Ga0105246_10352106 3300011119 Bacteria 1207
192 Ga0105246_11000133 3300011119 Bacteria 757
193 Ga0105246_11534058 3300011119 Bacteria 627
194 Ga0105246_11799169 3300011119 Bacteria 585
195 Ga0157319_1014482 3300012497 Bacteria 693
196 Ga0157347_1002744 3300012502 Bacteria 1532
197 Ga0157347_1026183 3300012502 Bacteria 709
198 Ga0157339_1032486 3300012505 Bacteria 618
199 Ga0157326_1012389 3300012513 Bacteria 973
200 Ga0157373_10094943 3300013100 Bacteria 2099
201 Ga0157373_10626851 3300013100 Bacteria 784
202 Ga0157373_10850502 3300013100 Bacteria 675
203 Ga0157371_10059656 3300013102 Bacteria 2704
204 Ga0157371_10960774 3300013102 Bacteria 650
205 Ga0157370_10011514 3300013104 Bacteria 9242
206 Ga0157370_10072910 3300013104 Bacteria 3240
207 Ga0157370_10485367 3300013104 Bacteria 1135
208 Ga0157370_11952806 3300013104 Bacteria 526
209 Ga0157369_10013149 3300013105 Bacteria 9367
210 Ga0157369_12189830 3300013105 Bacteria 560
211 Ga0157374_10585406 3300013296 Bacteria 1125
212 Ga0157378_11576671 3300013297 Bacteria 702
213 Ga0163162_10362486 3300013306 Bacteria 1582
214 Ga0163162_10698347 3300013306 Bacteria 1136
215 Ga0163162_10817893 3300013306 Bacteria 1048
216 Ga0163162_12441603 3300013306 Bacteria 601
217 Ga0157372_10576067 3300013307 Bacteria 1312
218 Ga0157375_11511848 3300013308 Bacteria 793
219 Ga0157375_11772195 3300013308 Bacteria 732
220 Ga0163163_11594957 3300014325 Bacteria 714
221 Ga0157380_10114627 3300014326 Bacteria 2272
222 Ga0157380_10967518 3300014326 Bacteria 882
223 Ga0157380_12835996 3300014326 Bacteria 551
224 Ga0182008_10001633 3300014497 Bacteria 14849
225 Ga0182008_10058827 3300014497 Bacteria 1896
226 Ga0182008_10075865 3300014497 Bacteria 1654
227 Ga0182008_10141243 3300014497 Bacteria 1205
228 Ga0182008_10565055 3300014497 Bacteria 634
229 Ga0182008_10688862 3300014497 Bacteria 583
230 Ga0157377_11375600 3300014745 Bacteria 555
231 Ga0157379_10208061 3300014968 Bacteria 1770
232 Ga0157376_10344535 3300014969 Bacteria 1424
233 Ga0157376_10709139 3300014969 Bacteria 1012
234 Ga0157376_10825833 3300014969 Bacteria 941
235 Ga0182006_1010501 3300015261 Bacteria 4114
236 Ga0182006_1025900 3300015261 Bacteria 2406
237 Ga0182006_1150238 3300015261 Bacteria 790
238 Ga0182006_1176170 3300015261 Bacteria 714
239 Ga0182006_1233599 3300015261 Bacteria 605
240 Ga0182007_10000853 3300015262 Bacteria 16919
241 Ga0182007_10003809 3300015262 Bacteria 7024
242 Ga0182007_10343066 3300015262 Bacteria 559
243 Ga0182005_1052265 3300015265 Bacteria 1112
244 Ga0182005_1072204 3300015265 Bacteria 948
245 Ga0182005_1078107 3300015265 Bacteria 912
246 Ga0163161_10001891 3300017792 Bacteria 15283
247 Ga0163161_10007216 3300017792 Bacteria 7680
248 Ga0163161_10008493 3300017792 Bacteria 7114
249 Ga0163161_10042751 3300017792 Bacteria 3261
250 Ga0163161_10122988 3300017792 Bacteria 1951
251 Ga0209436_123904 3300025208 Bacteria 757
252 Ga0209672_100642 3300025228 Bacteria 17975
253 Ga0209147_100995 3300025229 Bacteria 12281
254 Ga0209258_100093 3300025242 Bacteria 223559
255 Ga0207425_1000989 3300025245 Bacteria 13329
256 Ga0207425_1009140 3300025245 Bacteria 2484
257 Ga0209148_1000007 3300025254 Bacteria 1592273
258 Ga0209129_1000024 3300025258 Bacteria 417268
259 Ga0209129_1006303 3300025258 Bacteria 3884
260 Ga0209129_1010886 3300025258 Bacteria 2222
261 Ga0209565_1000098 3300025263 Bacteria 132021
262 Ga0209565_1000633 3300025263 Bacteria 22947
263 Ga0209565_1042110 3300025263 Bacteria 847
264 Ga0209673_1000058 3300025273 Bacteria 269028
265 Ga0209673_1001034 3300025273 Bacteria 32757
266 Ga0209673_1039935 3300025273 Bacteria 1348
267 Ga0209673_1041386 3300025273 Bacteria 1308
268 Ga0209673_1052393 3300025273 Bacteria 1071
269 Ga0209130_1000654 3300025284 Bacteria 31825
270 Ga0209130_1001114 3300025284 Bacteria 19756
271 Ga0209675_1000010 3300025291 Bacteria 541927
272 Ga0209675_1000151 3300025291 Bacteria 91172
273 Ga0209675_1003092 3300025291 Bacteria 8132
274 Ga0209675_1007033 3300025291 Bacteria 4388
275 Ga0209676_1000028 3300025292 Bacteria 559745
276 Ga0209676_1001046 3300025292 Bacteria 31878
277 Ga0209676_1003308 3300025292 Bacteria 10090
278 Ga0209676_1025199 3300025292 Bacteria 1912
279 Ga0209676_1027854 3300025292 Bacteria 1771
280 Ga0209676_1064029 3300025292 Bacteria 901
281 Ga0209025_1000685 3300025294 Bacteria 58093
282 Ga0209025_1001904 3300025294 Bacteria 24327
283 Ga0209025_1005469 3300025294 Bacteria 10341
284 Ga0209025_1078148 3300025294 Bacteria 1137
285 Ga0209564_1000209 3300025295 Bacteria 133651
286 Ga0209564_1002281 3300025295 Bacteria 15652
287 Ga0209758_1001224 3300025297 Bacteria 32124
288 Ga0209758_1037536 3300025297 Bacteria 1871
289 Ga0209050_1000072 3300025298 Bacteria 293619
290 Ga0209050_1000927 3300025298 Bacteria 38487
291 Ga0209050_1004050 3300025298 Bacteria 10280
292 Ga0209050_1008317 3300025298 Bacteria 5579
293 Ga0209256_1000088 3300025299 Bacteria 217236
294 Ga0209256_1023010 3300025299 Bacteria 1870
295 Ga0209256_1025808 3300025299 Bacteria 1705
296 Ga0207426_1000038 3300025302 Bacteria 441522
297 Ga0207426_1000053 3300025302 Bacteria 384818
298 Ga0209051_1000015 3300025303 Bacteria 546798
299 Ga0209051_1000056 3300025303 Bacteria 271616
300 Ga0209051_1000196 3300025303 Bacteria 107028
301 Ga0209051_1000392 3300025303 Bacteria 61223
302 Ga0209051_1000424 3300025303 Bacteria 57966
303 Ga0209051_1000545 3300025303 Bacteria 46076
304 Ga0209257_1000305 3300025304 Bacteria 107001
305 Ga0209257_1002205 3300025304 Bacteria 20116
306 Ga0209257_1004602 3300025304 Bacteria 10500
307 Ga0209257_1009796 3300025304 Bacteria 5020
308 Ga0209257_1059782 3300025304 Bacteria 1039
309 Ga0207656_10012795 3300025321 Bacteria 3194
310 Ga0207655_1006555 3300025728 Bacteria 7689
311 Ga0207655_1222623 3300025728 Bacteria 549
312 Ga0207682_10318236 3300025893 Bacteria 731
313 Ga0207688_10900022 3300025901 Bacteria 560
314 Ga0207680_10255063 3300025903 Bacteria 1212
315 Ga0207705_10022490 3300025909 Bacteria 4496
316 Ga0207705_10074648 3300025909 Bacteria 2462
317 Ga0207705_10472555 3300025909 Bacteria 973
318 Ga0207654_10240763 3300025911 Bacteria 1209
319 Ga0207695_10060685 3300025913 Bacteria 3913
320 Ga0207671_10088086 3300025914 Bacteria 2335
321 Ga0207671_10806075 3300025914 Bacteria 745
322 Ga0207660_10181378 3300025917 Bacteria 1635
323 Ga0207657_10014060 3300025919 Bacteria 7832
324 Ga0207657_10282786 3300025919 Bacteria 1317
325 Ga0207649_10704367 3300025920 Bacteria 783
326 Ga0207649_10810040 3300025920 Bacteria 731
327 Ga0207652_10088927 3300025921 Bacteria 2711
328 Ga0207652_10161675 3300025921 Bacteria 2008
329 Ga0207694_10022934 3300025924 Bacteria 4736
330 Ga0207694_10250337 3300025924 Bacteria 1449
331 Ga0207694_10767923 3300025924 Bacteria 814
332 Ga0207650_10312000 3300025925 Bacteria 1287
333 Ga0207659_10732672 3300025926 Bacteria 847
334 Ga0207659_11340761 3300025926 Bacteria 614
335 Ga0207687_10015912 3300025927 Bacteria 4935
336 Ga0207664_10600294 3300025929 Bacteria 988
337 Ga0207690_10127659 3300025932 Bacteria 1856
338 Ga0207690_11043904 3300025932 Bacteria 680
339 Ga0207706_10075902 3300025933 Bacteria 2956
340 Ga0207706_10275666 3300025933 Bacteria 1467
341 Ga0207686_10001796 3300025934 Bacteria 11922
342 Ga0207686_10224147 3300025934 Bacteria 1359
343 Ga0207686_10579039 3300025934 Bacteria 881
344 Ga0207709_10000958 3300025935 Bacteria 21596
345 Ga0207709_10001025 3300025935 Bacteria 20674
346 Ga0207709_10001291 3300025935 Bacteria 17879
347 Ga0207709_10002267 3300025935 Bacteria 12201
348 Ga0207709_10002735 3300025935 Bacteria 10877
349 Ga0207709_10203263 3300025935 Bacteria 1416
350 Ga0207669_10822658 3300025937 Bacteria 771
351 Ga0207704_10521793 3300025938 Bacteria 961
352 Ga0207704_10843252 3300025938 Bacteria 768
353 Ga0207704_11670850 3300025938 Bacteria 547
354 Ga0207691_10759872 3300025940 Bacteria 816
355 Ga0207691_11492302 3300025940 Bacteria 553
356 Ga0207711_10494626 3300025941 Bacteria 1140
357 Ga0207711_12098101 3300025941 Bacteria 508
358 Ga0207689_10065726 3300025942 Bacteria 2983
359 Ga0207689_10081640 3300025942 Bacteria 2657
360 Ga0207689_10482507 3300025942 Bacteria 1038
361 Ga0207689_10670999 3300025942 Bacteria 874
362 Ga0207679_10066316 3300025945 Bacteria 2705
363 Ga0207667_10341672 3300025949 Bacteria 1528
364 Ga0207667_10374716 3300025949 Bacteria 1450
365 Ga0207667_10674686 3300025949 Bacteria 1037
366 Ga0207667_11952205 3300025949 Bacteria 548
367 Ga0207651_10255794 3300025960 Bacteria 1435
368 Ga0207651_10421668 3300025960 Bacteria 1139
369 Ga0207668_10248284 3300025972 Bacteria 1444
370 Ga0207668_12032824 3300025972 Bacteria 518
371 Ga0207640_10178836 3300025981 Bacteria 1588
372 Ga0207640_10754190 3300025981 Bacteria 839
373 Ga0207658_10267667 3300025986 Bacteria 1459
374 Ga0207658_10747812 3300025986 Bacteria 885
375 Ga0207658_11007527 3300025986 Bacteria 760
376 Ga0207677_10181460 3300026023 Bacteria 1656
377 Ga0207677_10493446 3300026023 Bacteria 1057
378 Ga0207639_10010944 3300026041 Bacteria 6291
379 Ga0207639_11073821 3300026041 Bacteria 755
380 Ga0207639_11245984 3300026041 Bacteria 698
381 Ga0207678_10395257 3300026067 Bacteria 1196
382 Ga0207702_10246572 3300026078 Bacteria 1676
383 Ga0207702_11035726 3300026078 Bacteria 814
384 Ga0207641_10024357 3300026088 Bacteria 4989
385 Ga0207648_10874461 3300026089 Bacteria 839
386 Ga0207648_11344358 3300026089 Bacteria 671
387 Ga0207674_10202033 3300026116 Bacteria 1937
388 Ga0207674_10486044 3300026116 Bacteria 1193
389 Ga0207674_10713668 3300026116 Bacteria 968
390 Ga0207683_10180083 3300026121 Bacteria 1916
391 Ga0207683_10332354 3300026121 Bacteria 1393
392 Ga0207698_10296757 3300026142 Bacteria 1502
393 Ga0207698_11526489 3300026142 Bacteria 683
394 Ga0209281_1033796 3300027111 Bacteria 897
395 Ga0209282_1001024 3300027666 Bacteria 14706
396 Ga0209813_10141295 3300027866 Bacteria 855
397 Ga0209974_10085254 3300027876 Bacteria 1091
398 Ga0207428_10127051 3300027907 Bacteria 1952
399 Ga0268266_10218330 3300028379 Bacteria 1751
400 Ga0268265_10386394 3300028380 Bacteria 1289
401 Ga0268264_12398864 3300028381 Bacteria 533
402 Ga0307515_10000084 3300028794 Bacteria 221434
403 Ga0307515_10072156 3300028794 Bacteria 4666
404 Ga0307515_10483798 3300028794 Bacteria 850
405 Ga0307515_10538684 3300028794 Bacteria 777
406 Ga0307512_10121381 3300030522 Bacteria 1677
407 Ga0316177_1148101 3300030731 Bacteria 3719
408 Ga0314311_1237239 3300030733 Bacteria 1505
409 Ga0316178_1016090 3300030735 Bacteria 1219
410 Ga0316180_1033885 3300030736 Bacteria 1336
411 Ga0316183_1122753 3300030742 Bacteria 1765
412 Ga0316181_1085526 3300030744 Bacteria 1950
413 Ga0316182_1238099 3300030745 Bacteria 1133
414 Ga0316182_1399987 3300030745 Bacteria 2746
415 Ga0265327_10148026 3300031251 Bacteria 1092
416 Ga0307513_10026225 3300031456 Bacteria 6725
417 Ga0307513_10519366 3300031456 Bacteria 906
418 Ga0307408_100073371 3300031548 Bacteria 2536
419 Ga0307408_100080304 3300031548 Bacteria 2435
420 Ga0307408_100161448 3300031548 Bacteria 1780
421 Ga0307408_100266625 3300031548 Bacteria 1420
422 Ga0307408_100280671 3300031548 Bacteria 1387
423 Ga0307408_100316751 3300031548 Bacteria 1312
424 Ga0307408_100464861 3300031548 Bacteria 1100
425 Ga0307408_100480893 3300031548 Bacteria 1083
426 Ga0307408_100546985 3300031548 Bacteria 1021
427 Ga0307408_101249100 3300031548 Bacteria 694
428 Ga0307408_101845938 3300031548 Bacteria 578
429 Ga0307408_102262748 3300031548 Bacteria 526
430 Ga0307514_10000954 3300031649 Bacteria 43472
431 Ga0307514_10138226 3300031649 Bacteria 1662
432 Ga0265314_10007074 3300031711 Bacteria 9791
433 Ga0307405_10022681 3300031731 Bacteria 3553
434 Ga0307405_10203872 3300031731 Bacteria 1438
435 Ga0307405_10313310 3300031731 Bacteria 1195
436 Ga0307405_10474225 3300031731 Bacteria 997
437 Ga0307413_10138982 3300031824 Bacteria 1675
438 Ga0307413_10454530 3300031824 Bacteria 1017
439 Ga0307413_10903079 3300031824 Bacteria 750
440 Ga0307410_10510404 3300031852 Bacteria 990
441 Ga0307410_10530941 3300031852 Bacteria 972
442 Ga0307410_11552995 3300031852 Bacteria 584
443 Ga0307406_10001705 3300031901 Bacteria 12082
444 Ga0307406_10029763 3300031901 Bacteria 3309
445 Ga0307406_10444781 3300031901 Bacteria 1038
446 Ga0307406_10880524 3300031901 Bacteria 761
447 Ga0307406_10985024 3300031901 Bacteria 722
448 Ga0307406_11055058 3300031901 Bacteria 700
449 Ga0307407_10127011 3300031903 Bacteria 1625
450 Ga0307407_10219229 3300031903 Bacteria 1285
451 Ga0307412_10009231 3300031911 Bacteria 5653
452 Ga0307412_10018497 3300031911 Bacteria 4194
453 Ga0307412_10040329 3300031911 Bacteria 3020
454 Ga0307412_10069765 3300031911 Bacteria 2393
455 Ga0307412_10164512 3300031911 Bacteria 1652
456 Ga0307412_10239149 3300031911 Bacteria 1403
457 Ga0307412_10434341 3300031911 Bacteria 1077
458 Ga0307412_10818926 3300031911 Bacteria 810
459 Ga0307412_10882358 3300031911 Bacteria 782
460 Ga0307412_11066941 3300031911 Bacteria 717
461 Ga0307412_11218498 3300031911 Bacteria 674
462 Ga0307409_100360040 3300031995 Bacteria 1376
463 Ga0307409_101306064 3300031995 Bacteria 751
464 Ga0307416_100090654 3300032002 Bacteria 2622
465 Ga0307416_100648391 3300032002 Bacteria 1140
466 Ga0307416_100665749 3300032002 Bacteria 1127
467 Ga0307416_100692627 3300032002 Bacteria 1107
468 Ga0307416_101187508 3300032002 Bacteria 868
469 Ga0307416_101387557 3300032002 Bacteria 808
470 Ga0307416_102124172 3300032002 Bacteria 663
471 Ga0307416_103302620 3300032002 Bacteria 540
472 Ga0307414_10068974 3300032004 Bacteria 2539
473 Ga0307414_10091564 3300032004 Bacteria 2260
474 Ga0307414_10593157 3300032004 Bacteria 993
475 Ga0307414_10877261 3300032004 Bacteria 822
476 Ga0307414_12203709 3300032004 Bacteria 514
477 Ga0307411_10024402 3300032005 Bacteria 3604
478 Ga0307411_10178581 3300032005 Bacteria 1609
479 Ga0307411_10311964 3300032005 Bacteria 1266
480 Ga0307411_10454826 3300032005 Bacteria 1072
481 Ga0307411_10974878 3300032005 Bacteria 757
482 Ga0307411_11479876 3300032005 Bacteria 623
483 Ga0307411_12260670 3300032005 Bacteria 510
484 Ga0307415_101084036 3300032126 Bacteria 749
485 Ga0373943_0428727 3300035170 Bacteria 766
486 Ga0373931_0089159 3300035691 Bacteria 1716
487 Ga0395899_0104110 3300037312 Bacteria 2046
488 Ga0395900_0161473 3300037418 Bacteria 2285
489 Ga0395898_0294881 3300037466 Bacteria 1547
490 Ga0395905_0050498 3300037471 Bacteria 3896
491 Ga0395905_0633031 3300037471 Bacteria 971
492 Ga0395901_0074087 3300038443 Bacteria 3552
493 Ga0395901_0435328 3300038443 Bacteria 1343
494 Ga0395901_1223270 3300038443 Bacteria 716
495 Ga0436361_0070738 3300039447 Bacteria 27213
496 Ga0439436_0001048 3300041404 Bacteria 7765
497 Ga0439436_0049230 3300041404 Bacteria 1194
498 Ga0439436_0265955 3300041404 Bacteria 500
499 Ga0439438_081388 3300041405 Bacteria 794
500 Ga0439439_0000268 3300041406 Bacteria 8200
501 Ga0439439_0039004 3300041406 Bacteria 1227
502 Ga0439447_023051 3300041407 Bacteria 1625
503 Ga0439461_0006198 3300041410 Bacteria 2077
504 Ga0439461_0051778 3300041410 Bacteria 912
505 Ga0439461_0077677 3300041410 Bacteria 779
506 Ga0439461_0101819 3300041410 Bacteria 700
507 Ga0439466_0004086 3300041411 Bacteria 5638
508 Ga0439466_0051658 3300041411 Bacteria 1345
509 Ga0439466_0106718 3300041411 Bacteria 870
510 Ga0439466_0238257 3300041411 Bacteria 551
511 Ga0439465_0003993 3300041413 Bacteria 4808
512 Ga0439465_0023149 3300041413 Bacteria 1954
513 Ga0451787_019627 3300041441 Bacteria 828
514 Ga0451789_0111381 3300041443 Bacteria 523
515 Ga0451791_1495823 3300041451 Bacteria 572
516 Ga0451793_0435770 3300041452 Bacteria 960
517 Ga0451793_1075355 3300041452 Bacteria 1045
518 Ga0451793_1159892 3300041452 Bacteria 628
519 Ga0451797_0157609 3300041453 Bacteria 578
520 Ga0451795_1558984 3300041456 Bacteria 531
521 Ga0451798_0238516 3300041458 Bacteria 585
522 Ga0451800_1458506 3300041459 Bacteria 631
523 Ga0451802_0624242 3300041460 Bacteria 863
524 Ga0451807_0286398 3300041486 Bacteria 846
525 Ga0451807_1888789 3300041486 Bacteria 510
526 Ga0451833_0083665 3300041491 Bacteria 559
527 Ga0451837_0663527 3300041494 Bacteria 596
528 Ga0451841_0595886 3300041498 Bacteria 901
529 Ga0451849_1011591 3300041505 Bacteria 562
530 Ga0451853_1220038 3300041512 Bacteria 535
531 Ga0439431_0000483 3300041997 Bacteria 8459
532 Ga0439431_0022187 3300041997 Bacteria 1529
533 Ga0439433_0002772 3300041999 Bacteria 3733
534 Ga0439433_0007775 3300041999 Bacteria 2317
535 Ga0439437_038995 3300042000 Bacteria 613
536 Ga0439437_044912 3300042000 Bacteria 578
537 Ga0439442_026084 3300042002 Bacteria 1216
538 Ga0439442_035387 3300042002 Bacteria 1044
539 Ga0439445_0255926 3300042004 Bacteria 523
540 Ga0439432_001040 3300042006 Bacteria 10528
541 Ga0439432_096329 3300042006 Bacteria 887
542 Ga0439432_213823 3300042006 Bacteria 557
543 Ga0439449_0019219 3300042007 Bacteria 2561
544 Ga0439449_0130775 3300042007 Bacteria 933
545 Ga0439452_003891 3300042010 Bacteria 5118
546 Ga0439452_006902 3300042010 Bacteria 3517
547 Ga0439454_012408 3300042011 Bacteria 1156
548 Ga0439457_012603 3300042014 Bacteria 1905
549 Ga0439457_046768 3300042014 Bacteria 968
550 Ga0439457_065680 3300042014 Bacteria 824
551 Ga0439462_0001318 3300042015 Bacteria 5467
552 Ga0439462_0079804 3300042015 Bacteria 893
553 Ga0450911_030684 3300042115 Bacteria 697
554 Ga0450912_032470 3300042116 Bacteria 545
555 Ga0450919_015142 3300042121 Bacteria 871
556 Ga0450920_033381 3300042122 Bacteria 1017
557 Ga0450921_005413 3300042123 Bacteria 964
558 Ga0450922_022460 3300042124 Bacteria 657
559 Ga0450923_005097 3300042125 Bacteria 2103
560 Ga0450888_039612 3300042126 Bacteria 652
561 Ga0450890_078893 3300042127 Bacteria 535
562 Ga0450894_041805 3300042131 Bacteria 659
563 Ga0450896_015628 3300042133 Bacteria 1087
564 Ga0450896_036011 3300042133 Bacteria 761
565 Ga0450898_006200 3300042134 Bacteria 1829
566 Ga0450898_018085 3300042134 Bacteria 1218
567 Ga0450900_033416 3300042136 Bacteria 753
568 Ga0450906_005730 3300042145 Bacteria 2536
569 Ga0450910_010111 3300042147 Bacteria 1340
570 Ga0450910_054393 3300042147 Bacteria 666
571 Ga0439446_0005262 3300042156 Bacteria 3322
572 Ga0439446_0048173 3300042156 Bacteria 1269
573 Ga0439446_0124007 3300042156 Bacteria 833
574 Ga0439446_0139013 3300042156 Bacteria 792
575 Ga0439446_0182861 3300042156 Bacteria 701
576 Ga0450908_004957 3300042184 Bacteria 2557
577 Ga0450908_005518 3300042184 Bacteria 2424
578 Ga0439434_0004240 3300042435 Bacteria 4188
579 Ga0439434_0006113 3300042435 Bacteria 3511
580 Ga0439434_0024175 3300042435 Bacteria 1832
581 Ga0450918_007011 3300042531 Bacteria 2002
582 Ga0450893_0001626 3300042532 Bacteria 3452
583 Ga0450893_0027591 3300042532 Bacteria 1001
584 Ga0450893_0064141 3300042532 Bacteria 706
585 Ga0450893_0112883 3300042532 Bacteria 562
586 Ga0451577_0007910 3300042876 Bacteria 10388
587 Ga0451577_0129918 3300042876 Bacteria 2259
588 Ga0453683_0009185 3300044673 Bacteria 6605
589 Ga0466965_0050739 3300044683 Bacteria 2057
590 Ga0453684_0026869 3300044712 Bacteria 8292
591 Ga0453684_0763732 3300044712 Bacteria 1045
592 Ga0453684_1589321 3300044712 Bacteria 671
593 Ga0466971_0401815 3300044719 Bacteria 668
594 Ga0466957_0394886 3300044842 Bacteria 945
595 Ga0466960_0024961 3300044901 Bacteria 2701
596 Ga0451576_0018182 3300045051 Bacteria 7710
597 Ga0451576_0788109 3300045051 Bacteria 998
598 Ga0466967_0959779 3300045976 Bacteria 851
599 Ga0495627_001913 3300046453 Bacteria 10880
600 Ga0495627_084868 3300046453 Bacteria 914
601 Ga0495629_0801468 3300046459 Bacteria 621
602 Ga0495638_0119583 3300046460 Bacteria 1558
603 Ga0495651_0382814 3300046462 Bacteria 922
604 Ga0495653_0500140 3300046463 Bacteria 758
605 Ga0495653_0969763 3300046463 Bacteria 504
606 Ga0495650_0113844 3300046471 Bacteria 1002
607 Ga0495639_0023242 3300046475 Bacteria 2723
608 Ga0495610_0024818 3300046512 Bacteria 3229
609 Ga0495610_0212363 3300046512 Bacteria 786
610 Ga0495616_0010183 3300046513 Bacteria 5456
611 Ga0495620_0002466 3300046515 Bacteria 10724
612 Ga0495620_0218188 3300046515 Bacteria 730
613 Ga0495628_0750912 3300046516 Bacteria 686
614 Ga0495630_0489811 3300046517 Bacteria 943
615 Ga0495631_0003037 3300046518 Bacteria 9274
616 Ga0495637_0003474 3300046520 Bacteria 8367
617 Ga0495663_0153113 3300046525 Bacteria 788
618 Ga0495642_0240402 3300046528 Bacteria 791
619 Ga0495652_0731076 3300046529 Bacteria 664
620 Ga0495654_0011433 3300046530 Bacteria 4802
621 Ga0495621_0013869 3300046539 Bacteria 2541
622 Ga0495621_0019672 3300046539 Bacteria 2207
623 Ga0495621_0302859 3300046539 Bacteria 663
624 Ga0495622_0104723 3300046557 Bacteria 1296
625 Ga0495633_0270865 3300046558 Bacteria 773
626 Ga0495656_0000746 3300046615 Bacteria 10523
627 Ga0495634_0699015 3300046642 Bacteria 583
628 Ga0495625_0005468 3300046660 Bacteria 11573
629 Ga0495625_0069851 3300046660 Bacteria 2467
630 Ga0495625_0238885 3300046660 Bacteria 1183
631 Ga0495661_0328406 3300046665 Bacteria 758
632 Ga0495661_0420979 3300046665 Bacteria 647
633 Ga0495588_0102512 3300046674 Bacteria 1504
634 Ga0495588_0373218 3300046674 Bacteria 749
635 Ga0495658_0063297 3300046683 Bacteria 2128
636 Ga0495658_1072531 3300046683 Bacteria 514
637 Ga0495669_0657056 3300046684 Bacteria 510
638 Ga0495624_0128461 3300046690 Bacteria 1555
639 Ga0495624_0344680 3300046690 Bacteria 896
640 Ga0495670_0212498 3300046691 Bacteria 1026
641 Ga0495670_0255194 3300046691 Bacteria 935
642 Ga0495670_0393707 3300046691 Bacteria 748
643 Ga0495670_0529958 3300046691 Bacteria 640
644 Ga0495671_0009329 3300046692 Bacteria 5482
645 Ga0495581_0353461 3300047315 Bacteria 858
646 Ga0495604_1012317 3300047317 Bacteria 514
647 Ga0495676_0102050 3300047321 Bacteria 2120
648 Ga0495677_0467489 3300047445 Bacteria 500
649 Ga0495681_0345125 3300047470 Bacteria 567
650 Ga0495686_0214275 3300047472 Bacteria 1099
651 Ga0495593_0012263 3300047673 Bacteria 4898
652 Ga0495602_0384296 3300048088 Bacteria 1005
653 Ga0495614_0051869 3300048089 Bacteria 1758
654 Ga0495614_0262777 3300048089 Bacteria 792
655 Ga0495615_0096335 3300048090 Bacteria 831
656 Ga0495615_0120639 3300048090 Bacteria 758
657 Ga0496100_0009165 3300048903 Bacteria 5553
658 Ga0496101_0004382 3300048904 Bacteria 8872
659 Ga0496101_0005001 3300048904 Bacteria 8419
660 Ga0496102_0006127 3300048905 Bacteria 10246
661 Ga0496103_0210241 3300048906 Bacteria 1251
662 Ga0496104_0029955 3300048907 Bacteria 5053
663 Ga0496105_0004053 3300048908 Bacteria 10967
664 Ga0496106_0009081 3300048909 Bacteria 7347
665 Ga0496107_0054704 3300048910 Bacteria 2881
666 Ga0496107_0175066 3300048910 Bacteria 1593
667 Ga0496108_0571847 3300048911 Bacteria 985
668 Ga0496109_0227502 3300048912 Bacteria 1754
669 Ga0496109_0594722 3300048912 Bacteria 1042
670 Ga0496110_0446642 3300048913 Bacteria 1178
671 Ga0496111_0071605 3300048914 Bacteria 2523
672 Ga0496111_0812564 3300048914 Bacteria 676
673 Ga0496112_0325183 3300048915 Bacteria 1482
674 Ga0496113_0518479 3300048916 Bacteria 957
675 Ga0496114_1021945 3300048917 Bacteria 710
676 Ga0496114_1132328 3300048917 Bacteria 668
677 Ga0496115_0941435 3300048918 Bacteria 664
678 Ga0496116_0039510 3300048919 Bacteria 3262
679 Ga0496117_0023000 3300048920 Bacteria 4983
680 Ga0496117_0043622 3300048920 Bacteria 3258
681 Ga0496118_0006363 3300048921 Bacteria 13016
682 Ga0496118_0019829 3300048921 Bacteria 5994
683 Ga0496119_0082193 3300048922 Bacteria 1853
684 Ga0496119_0175820 3300048922 Bacteria 1127
685 Ga0496121_0052610 3300048924 Bacteria 3417
686 Ga0496121_0121176 3300048924 Bacteria 1975
687 Ga0496122_0582460 3300048925 Bacteria 527
688 Ga0496123_0377373 3300048926 Bacteria 651
689 Ga0496124_0176704 3300048927 Bacteria 1647
690 Ga0496124_0544698 3300048927 Bacteria 767
691 Ga0496125_0046359 3300048928 Bacteria 3647
692 Ga0496125_0053320 3300048928 Bacteria 3316
693 Ga0496125_0617063 3300048928 Bacteria 589
694 Ga0501315_012151 3300049531 Bacteria 1061
695 Ga0501317_049401 3300049533 Bacteria 664
696 Ga0501323_015594 3300049539 Bacteria 961
697 Ga0501323_067597 3300049539 Bacteria 567
698 Ga0501037_0145399 3300049573 Bacteria 1696
699 Ga0501046_0281209 3300049580 Bacteria 1219
700 Ga0501223_144669 3300049663 Bacteria 513
701 Ga0501233_289805 3300049668 Bacteria 503
702 Ga0501243_142071 3300049675 Bacteria 508
703 Ga0501249_050489 3300049679 Bacteria 954
704 Ga0501225_0046999 3300049705 Bacteria 1197
705 Ga0501280_027411 3300049776 Bacteria 876
706 nmdc:mga03683_105991_c1 3300050489 Bacteria 1239
707 nmdc:mga03683_162337_c1 3300050489 Bacteria 1013
708 nmdc:mga03683_197312_c2 3300050489 Bacteria 520
709 nmdc:mga03683_343496_c1 3300050489 Bacteria 705
710 nmdc:mga03683_345433_c1 3300050489 Bacteria 704
711 nmdc:mga03683_456182_c1 3300050489 Bacteria 615
712 nmdc:mga03683_468576_c1 3300050489 Bacteria 607
713 nmdc:mga03683_73810_c1 3300050489 Bacteria 1463
714 nmdc:mga03n38_116333_c1 3300050490 Bacteria 1309
715 nmdc:mga03n38_258017_c1 3300050490 Bacteria 923
716 nmdc:mga03n38_330806_c1 3300050490 Bacteria 825
717 nmdc:mga03n38_430839_c1 3300050490 Bacteria 731
718 nmdc:mga03n38_500810_c1 3300050490 Bacteria 682
719 nmdc:mga00v17_315474_c1 3300050491 Bacteria 1016
720 nmdc:mga00v17_42986_c1 3300050491 Bacteria 2720
721 nmdc:mga00v17_565297_c1 3300050491 Bacteria 735
722 nmdc:mga00v17_585738_c1 3300050491 Bacteria 720
723 nmdc:mga00v17_636184_c1 3300050491 Bacteria 686
724 nmdc:mga00v17_767875_c1 3300050491 Bacteria 615
725 nmdc:mga0yw44_138048_c1 3300050492 Bacteria 1583
726 nmdc:mga0yw44_658365_c1 3300050492 Bacteria 712
727 nmdc:mga0k408_111441_c1 3300050493 Bacteria 1617
728 nmdc:mga0k408_231329_c1 3300050493 Bacteria 1103
729 nmdc:mga0k408_26362_c1 3300050493 Bacteria 3295
730 nmdc:mga0k408_305574_c1 3300050493 Bacteria 949
731 nmdc:mga0k408_6011_c1 3300050493 Bacteria 6476
732 nmdc:mga0k408_81457_c1 3300050493 Bacteria 1895
733 nmdc:mga0k408_89457_c1 3300050493 Bacteria 1808
734 nmdc:mga06z11_154388_c1 3300050494 Bacteria 834
735 nmdc:mga06z11_72127_c1 3300050494 Bacteria 1830
736 nmdc:mga04h51_283906_c1 3300050495 Bacteria 671
737 nmdc:mga07m45_206558_c1 3300050496 Bacteria 1142
738 nmdc:mga07m45_25369_c1 3300050496 Bacteria 3251
739 nmdc:mga07m45_277484_c1 3300050496 Bacteria 975
740 nmdc:mga07m45_289043_c1 3300050496 Bacteria 954
741 nmdc:mga07m45_36823_c1 3300050496 Bacteria 2727
742 nmdc:mga07m45_383745_c1 3300050496 Bacteria 816
743 nmdc:mga07m45_5257_c1 3300050496 Bacteria 6430
744 nmdc:mga07m45_532405_c1 3300050496 Bacteria 680
745 nmdc:mga07m45_5339_c1 3300050496 Bacteria 6394
746 nmdc:mga07m45_56345_c1 3300050496 Bacteria 2222
747 nmdc:mga07m45_758688_c1 3300050496 Bacteria 557
748 nmdc:mga07m45_768095_c1 3300050496 Bacteria 553
749 nmdc:mga0sz30_271917_c1 3300050516 Bacteria 755
750 nmdc:mga0sz30_388442_c1 3300050516 Bacteria 625
751 Ga0495612_0168246 3300053078 Bacteria 959
752 Ga0500610_0056696 3300053079 Bacteria 2044
753 Ga0495655_0148787 3300053083 Bacteria 735
754 Ga0500643_019521 3300053087 Bacteria 2229
755 Ga0500651_0000347 3300053093 Bacteria 26028
756 Ga0500566_0114122 3300053094 Bacteria 1465
757 Ga0500555_159784 3300053103 Bacteria 550
758 Ga0500562_006293 3300053108 Bacteria 2995
759 Ga0500562_144760 3300053108 Bacteria 647
760 Ga0500571_001746 3300053110 Bacteria 10443
761 Ga0500572_175521 3300053111 Bacteria 702
762 Ga0500593_018569 3300053117 Bacteria 3034
763 Ga0500593_118317 3300053117 Bacteria 1078
764 Ga0500594_0033579 3300053118 Bacteria 1365
765 Ga0500607_006984 3300053121 Bacteria 7040
766 Ga0500607_197701 3300053121 Bacteria 868
767 Ga0500608_017372 3300053122 Bacteria 3267
768 Ga0500608_358475 3300053122 Bacteria 513
769 Ga0500628_111204 3300053129 Bacteria 735
770 Ga0500655_055511 3300053133 Bacteria 793
771 Ga0500658_0000560 3300053134 Bacteria 15661
772 Ga0500658_0000589 3300053134 Bacteria 15190
773 Ga0500564_131856 3300053138 Bacteria 1080
774 Ga0500568_0006650 3300053139 Bacteria 5780
775 Ga0500577_0220196 3300053142 Bacteria 821
776 Ga0500586_158012 3300053145 Bacteria 770
777 Ga0500616_0021860 3300053153 Bacteria 3578
778 Ga0500624_015969 3300053157 Bacteria 1154
779 Ga0500627_0044221 3300053158 Bacteria 1922
780 Ga0500634_0257925 3300053161 Bacteria 719
781 Ga0500634_0325631 3300053161 Bacteria 597
782 Ga0500638_051737 3300053162 Bacteria 1985
783 Ga0500636_0352800 3300053177 Bacteria 701
784 Ga0500625_202069 3300053729 Bacteria 663
785 Ga0500645_198453 3300053730 Bacteria 542
786 Ga0500565_017652 3300053734 Bacteria 824
787 Ga0500596_018659 3300053735 Bacteria 1041
788 Ga0590075_049907 3300059424 Bacteria 1073
789 Ga0590077_137847 3300059426 Bacteria 581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513020051 2513230074 76
2 iso_pu_bacteria 2547132374 2548499081 76
3 iso_pu_bacteria 2599185214 2599620577 76
4 iso_pu_bacteria 2599185226 2599673876 76
5 iso_pu_bacteria 2599185227 2599678807 76
6 iso_pu_bacteria 2599185229 2599690088 76
7 iso_pu_bacteria 2643221570 2643867715 76
8 iso_pu_bacteria 2643221596 2643991578 76
9 iso_pu_bacteria 2643221609 2644062256 76
10 iso_pu_bacteria 2643221611 2644071443 76
11 iso_pu_bacteria 2643221628 2644162160 76
12 iso_pu_bacteria 2643221652 2644293324 76
13 iso_pu_bacteria 2643221658 2644324283 76
14 iso_pu_bacteria 2643221672 2644396124 76
15 iso_pu_bacteria 2643221683 2644464964 76
16 iso_pu_bacteria 2643221717 2644648538 76
17 iso_pu_bacteria 2738541277 2738720472 76
18 iso_pu_bacteria 2738541307 2738884043 76
19 iso_pu_bacteria 2738543012 2739245866 76
20 iso_pu_bacteria 2738543019 2739279671 76
21 iso_pu_bacteria 2816332133 2816470560 76
22 iso_pu_bacteria 2818991446 2819601154 76
23 iso_pu_bacteria 2831265667 2831271532 76
24 iso_pu_bacteria 2838054893 2838055433 76
25 iso_pu_bacteria 2842677519 2842680582 76
26 iso_pu_bacteria 2842718218 2842718659 76
27 iso_pu_bacteria 2881101125 2881103401 76
28 iso_pu_bacteria 2885198086 2885201034 76
29 iso_pu_bacteria 2885211737 2885214183 76
30 iso_pu_bacteria 2899924645 2899927499 76
31 iso_pu_bacteria 2904449895 2904450772 76
32 iso_pu_bacteria 2904456579 2904459728 76
33 iso_pu_bacteria 2904541872 2904547995 76
34 iso_pu_bacteria 2919462493 2919462697 76
35 iso_pu_bacteria 2919704043 2919707086 76
36 iso_pu_bacteria 2928037797 2928042588 76
37 iso_pu_bacteria 2928044640 2928048985 76
38 iso_pu_bacteria 2928051484 2928051535 76
39 iso_pu_bacteria 2928064002 2928068746 76
40 iso_pu_bacteria 2928070936 2928073256 76
41 iso_pu_bacteria 2928084124 2928087017 76
42 iso_pu_bacteria 2929160207 2929161610 76
43 iso_pu_bacteria 2929520902 2929521490 76
44 iso_pu_bacteria 2945909444 2945913949 76
45 iso_pu_bacteria 2945945610 2945949504 76
46 iso_pu_bacteria 2945972063 2945973548 76
47 iso_pu_bacteria 2945984333 2945990653 76
48 iso_pu_bacteria 2954767861 2954770838 76
49 iso_pu_bacteria 2990710928 2990713976 76
50 3300006237 Ga0097621_101014025 Ga0097621_1010140252 79
51 3300006358 Ga0068871_100737242 Ga0068871_1007372422 79
52 3300013306 Ga0163162_10698347 Ga0163162_106983472 79
53 3300041456 Ga0451795_1558984 Ga0451795_1558984_164_406 79
54 3300046463 Ga0495653_0969763 Ga0495653_0969763_159_398 79
55 3300001979 JGI24740J21852_10004290 JGI24740J21852_100042902 80
56 3300001989 JGI24739J22299_10008905 JGI24739J22299_100089052 80
57 3300001989 JGI24739J22299_10009598 JGI24739J22299_100095985 80
58 3300002739 JGI25158J39367_1004285 JGI25158J39367_10042852 80
59 3300002987 JGI25159J45721_1029844 JGI25159J45721_10298442 80
60 3300003187 JGI25151J46595_10003000 JGI25151J46595_1000300011 80
61 3300003187 JGI25151J46595_10028625 JGI25151J46595_100286253 80
62 3300003187 JGI25151J46595_10071196 JGI25151J46595_100711962 80
63 3300003215 JGI25153J46596_10009310 JGI25153J46596_100093102 80
64 3300003323 rootH1_10079751 rootH1_100797512 80
65 3300003354 JGI25160J50197_1010452 JGI25160J50197_10104522 80
66 3300003578 Ga0006562J51391_1089139 Ga0006562J51391_10891392 80
67 3300003578 Ga0006562J51391_1089141 Ga0006562J51391_10891412 80
68 3300003760 Ga0055527_1014119 Ga0055527_10141192 80
69 3300003761 Ga0055535_1000966 Ga0055535_100096611 80
70 3300003762 Ga0055542_1000080 Ga0055542_100008081 80
71 3300003773 Ga0055537_1000150 Ga0055537_10001502 80
72 3300003773 Ga0055537_1003599 Ga0055537_10035993 80
73 3300003775 Ga0055524_1064407 Ga0055524_10644071 80
74 3300003781 Ga0055536_1006807 Ga0055536_10068077 80
75 3300003781 Ga0055536_1027523 Ga0055536_10275232 80
76 3300003781 Ga0055536_1035061 Ga0055536_10350612 80
77 3300003784 Ga0055534_1000016 Ga0055534_1000016108 80
78 3300003784 Ga0055534_1017802 Ga0055534_10178021 80
79 3300003790 Ga0055528_1000894 Ga0055528_100089418 80
80 3300003790 Ga0055528_1021050 Ga0055528_10210503 80
81 3300003790 Ga0055528_1043582 Ga0055528_10435822 80
82 3300003790 Ga0055528_1094440 Ga0055528_10944401 80
83 3300003791 Ga0055530_10003550 Ga0055530_1000355010 80
84 3300003791 Ga0055530_10005191 Ga0055530_100051919 80
85 3300003791 Ga0055530_10061295 Ga0055530_100612952 80
86 3300003792 Ga0055540_1019292 Ga0055540_10192923 80
87 3300003792 Ga0055540_1021120 Ga0055540_10211203 80
88 3300003792 Ga0055540_1023163 Ga0055540_10231632 80
89 3300003792 Ga0055540_1043939 Ga0055540_10439392 80
90 3300003794 Ga0055531_10001826 Ga0055531_1000182611 80
91 3300003794 Ga0055531_10004420 Ga0055531_100044202 80
92 3300005288 Ga0065714_10004675 Ga0065714_100046759 80
93 3300005288 Ga0065714_10080808 Ga0065714_100808082 80
94 3300005288 Ga0065714_10479621 Ga0065714_104796211 80
95 3300005289 Ga0065704_10185663 Ga0065704_101856632 80
96 3300005289 Ga0065704_10296250 Ga0065704_102962502 80
97 3300005289 Ga0065704_10364268 Ga0065704_103642681 80
98 3300005289 Ga0065704_10444071 Ga0065704_104440712 80
99 3300005327 Ga0070658_10139715 Ga0070658_101397153 80
100 3300005327 Ga0070658_10269609 Ga0070658_102696092 80
101 3300005327 Ga0070658_10817630 Ga0070658_108176302 80
102 3300005334 Ga0068869_100022576 Ga0068869_1000225762 80
103 3300005334 Ga0068869_100593224 Ga0068869_1005932242 80
104 3300005335 Ga0070666_10270584 Ga0070666_102705841 80
105 3300005338 Ga0068868_100159375 Ga0068868_1001593752 80
106 3300005339 Ga0070660_100010089 Ga0070660_1000100893 80
107 3300005339 Ga0070660_100782922 Ga0070660_1007829222 80
108 3300005344 Ga0070661_100647509 Ga0070661_1006475091 80
109 3300005344 Ga0070661_101085177 Ga0070661_1010851772 80
110 3300005347 Ga0070668_100766997 Ga0070668_1007669972 80
111 3300005353 Ga0070669_100287905 Ga0070669_1002879052 80
112 3300005356 Ga0070674_100181127 Ga0070674_1001811273 80
113 3300005356 Ga0070674_100524611 Ga0070674_1005246112 80
114 3300005356 Ga0070674_100629391 Ga0070674_1006293911 80
115 3300005356 Ga0070674_101776554 Ga0070674_1017765542 80
116 3300005364 Ga0070673_100945336 Ga0070673_1009453362 80
117 3300005364 Ga0070673_101209985 Ga0070673_1012099852 80
118 3300005365 Ga0070688_101789278 Ga0070688_1017892782 80
119 3300005366 Ga0070659_100183936 Ga0070659_1001839362 80
120 3300005367 Ga0070667_100179365 Ga0070667_1001793653 80
121 3300005435 Ga0070714_100904660 Ga0070714_1009046602 80
122 3300005455 Ga0070663_102137943 Ga0070663_1021379432 80
123 3300005456 Ga0070678_100243295 Ga0070678_1002432953 80
124 3300005456 Ga0070678_100630753 Ga0070678_1006307532 80
125 3300005456 Ga0070678_101979127 Ga0070678_1019791271 80
126 3300005457 Ga0070662_100039907 Ga0070662_1000399073 80
127 3300005459 Ga0068867_101691058 Ga0068867_1016910581 80
128 3300005466 Ga0070685_10929949 Ga0070685_109299492 80
129 3300005530 Ga0070679_100054548 Ga0070679_1000545483 80
130 3300005539 Ga0068853_100147073 Ga0068853_1001470732 80
131 3300005539 Ga0068853_101617070 Ga0068853_1016170702 80
132 3300005548 Ga0070665_100010145 Ga0070665_10001014510 80
133 3300005548 Ga0070665_101595040 Ga0070665_1015950401 80
134 3300005548 Ga0070665_101802463 Ga0070665_1018024631 80
135 3300005563 Ga0068855_100119841 Ga0068855_1001198413 80
136 3300005563 Ga0068855_100241413 Ga0068855_1002414133 80
137 3300005563 Ga0068855_101141513 Ga0068855_1011415132 80
138 3300005564 Ga0070664_100040580 Ga0070664_1000405803 80
139 3300005577 Ga0068857_100073208 Ga0068857_1000732082 80
140 3300005577 Ga0068857_100157874 Ga0068857_1001578742 80
141 3300005577 Ga0068857_100927464 Ga0068857_1009274642 80
142 3300005577 Ga0068857_101816737 Ga0068857_1018167372 80
143 3300005614 Ga0068856_100206139 Ga0068856_1002061392 80
144 3300005614 Ga0068856_100391387 Ga0068856_1003913872 80
145 3300005614 Ga0068856_101525123 Ga0068856_1015251232 80
146 3300005616 Ga0068852_100107707 Ga0068852_1001077073 80
147 3300005616 Ga0068852_101034290 Ga0068852_1010342902 80
148 3300005617 Ga0068859_101314464 Ga0068859_1013144642 80
149 3300005618 Ga0068864_101278132 Ga0068864_1012781322 80
150 3300005718 Ga0068866_11377083 Ga0068866_113770831 80
151 3300005719 Ga0068861_102635540 Ga0068861_1026355402 80
152 3300005834 Ga0068851_10002741 Ga0068851_100027414 80
153 3300005840 Ga0068870_11118470 Ga0068870_111184702 80
154 3300005841 Ga0068863_100134033 Ga0068863_1001340333 80
155 3300005842 Ga0068858_101685273 Ga0068858_1016852731 80
156 3300005844 Ga0068862_100298255 Ga0068862_1002982551 80
157 3300006038 Ga0075365_10022096 Ga0075365_100220964 80
158 3300006038 Ga0075365_10071228 Ga0075365_100712283 80
159 3300006038 Ga0075365_10930983 Ga0075365_109309832 80
160 3300006042 Ga0075368_10251250 Ga0075368_102512502 80
161 3300006048 Ga0075363_100007907 Ga0075363_1000079078 80
162 3300006048 Ga0075363_100258058 Ga0075363_1002580582 80
163 3300006048 Ga0075363_100816840 Ga0075363_1008168402 80
164 3300006048 Ga0075363_100876610 Ga0075363_1008766102 80
165 3300006048 Ga0075363_100897483 Ga0075363_1008974831 80
166 3300006051 Ga0075364_10020170 Ga0075364_100201704 80
167 3300006051 Ga0075364_10081814 Ga0075364_100818142 80
168 3300006051 Ga0075364_10210045 Ga0075364_102100452 80
169 3300006051 Ga0075364_10227248 Ga0075364_102272482 80
170 3300006051 Ga0075364_10970552 Ga0075364_109705522 80
171 3300006058 Ga0075432_10002614 Ga0075432_100026146 80
172 3300006058 Ga0075432_10072540 Ga0075432_100725403 80
173 3300006177 Ga0075362_10037995 Ga0075362_100379953 80
174 3300006177 Ga0075362_10038214 Ga0075362_100382142 80
175 3300006177 Ga0075362_10056377 Ga0075362_100563772 80
176 3300006177 Ga0075362_10135941 Ga0075362_101359412 80
177 3300006177 Ga0075362_10179908 Ga0075362_101799082 80
178 3300006177 Ga0075362_10183140 Ga0075362_101831402 80
179 3300006178 Ga0075367_10136738 Ga0075367_101367383 80
180 3300006178 Ga0075367_10255335 Ga0075367_102553352 80
181 3300006178 Ga0075367_10440384 Ga0075367_104403842 80
182 3300006186 Ga0075369_10082983 Ga0075369_100829832 80
183 3300006186 Ga0075369_10225578 Ga0075369_102255782 80
184 3300006195 Ga0075366_10016366 Ga0075366_100163665 80
185 3300006195 Ga0075366_10025817 Ga0075366_100258172 80
186 3300006195 Ga0075366_10045854 Ga0075366_100458543 80
187 3300006195 Ga0075366_10077444 Ga0075366_100774443 80
188 3300006195 Ga0075366_10084748 Ga0075366_100847483 80
189 3300006195 Ga0075366_10116986 Ga0075366_101169862 80
190 3300006195 Ga0075366_10462917 Ga0075366_104629172 80
191 3300006195 Ga0075366_10877728 Ga0075366_108777282 80
192 3300006237 Ga0097621_100169928 Ga0097621_1001699282 80
193 3300006353 Ga0075370_10001499 Ga0075370_1000149912 80
194 3300006353 Ga0075370_10002475 Ga0075370_100024759 80
195 3300006353 Ga0075370_10004243 Ga0075370_100042432 80
196 3300006353 Ga0075370_10088484 Ga0075370_100884842 80
197 3300006353 Ga0075370_10094291 Ga0075370_100942913 80
198 3300006353 Ga0075370_10226115 Ga0075370_102261152 80
199 3300006353 Ga0075370_10247279 Ga0075370_102472792 80
200 3300006353 Ga0075370_10258840 Ga0075370_102588402 80
201 3300006353 Ga0075370_10311167 Ga0075370_103111672 80
202 3300006353 Ga0075370_10590513 Ga0075370_105905132 80
203 3300006353 Ga0075370_10866468 Ga0075370_108664682 80
204 3300006358 Ga0068871_100023433 Ga0068871_1000234335 80
205 3300006358 Ga0068871_101324974 Ga0068871_1013249742 80
206 3300006881 Ga0068865_100498852 Ga0068865_1004988522 80
207 3300006881 Ga0068865_100848700 Ga0068865_1008487002 80
208 3300006881 Ga0068865_101090828 Ga0068865_1010908282 80
209 3300006914 Ga0075436_101513180 Ga0075436_1015131802 80
210 3300006931 Ga0097620_101314383 Ga0097620_1013143832 80
211 3300006946 Ga0079104_1021469 Ga0079104_10214692 80
212 3300006948 Ga0099826_10000101 Ga0099826_1000010136 80
213 3300009011 Ga0105251_10646693 Ga0105251_106466932 80
214 3300009036 Ga0105244_10010520 Ga0105244_100105207 80
215 3300009036 Ga0105244_10117797 Ga0105244_101177972 80
216 3300009036 Ga0105244_10126774 Ga0105244_101267742 80
217 3300009092 Ga0105250_10009366 Ga0105250_100093665 80
218 3300009093 Ga0105240_10006365 Ga0105240_1000636511 80
219 3300009093 Ga0105240_10254488 Ga0105240_102544882 80
220 3300009093 Ga0105240_11010638 Ga0105240_110106382 80
221 3300009098 Ga0105245_10872035 Ga0105245_108720352 80
222 3300009148 Ga0105243_10003361 Ga0105243_100033614 80
223 3300009148 Ga0105243_10260122 Ga0105243_102601222 80
224 3300009148 Ga0105243_11061208 Ga0105243_110612082 80
225 3300009174 Ga0105241_10419025 Ga0105241_104190252 80
226 3300009176 Ga0105242_10000553 Ga0105242_1000055319 80
227 3300009176 Ga0105242_10201925 Ga0105242_102019252 80
228 3300009176 Ga0105242_10689738 Ga0105242_106897382 80
229 3300009176 Ga0105242_10707822 Ga0105242_107078222 80
230 3300009177 Ga0105248_10166463 Ga0105248_101664632 80
231 3300009177 Ga0105248_11054050 Ga0105248_110540502 80
232 3300009177 Ga0105248_11159186 Ga0105248_111591862 80
233 3300009545 Ga0105237_11331089 Ga0105237_113310892 80
234 3300009545 Ga0105237_11629785 Ga0105237_116297852 80
235 3300009551 Ga0105238_10017091 Ga0105238_100170912 80
236 3300009551 Ga0105238_10543900 Ga0105238_105439002 80
237 3300009551 Ga0105238_11705029 Ga0105238_117050292 80
238 3300009551 Ga0105238_11867165 Ga0105238_118671652 80
239 3300009553 Ga0105249_12090763 Ga0105249_120907631 80
240 3300010375 Ga0105239_10200838 Ga0105239_102008382 80
241 3300010375 Ga0105239_11114608 Ga0105239_111146082 80
242 3300011119 Ga0105246_10130197 Ga0105246_101301973 80
243 3300011119 Ga0105246_10352106 Ga0105246_103521062 80
244 3300011119 Ga0105246_11000133 Ga0105246_110001332 80
245 3300011119 Ga0105246_11534058 Ga0105246_115340582 80
246 3300011119 Ga0105246_11799169 Ga0105246_117991691 80
247 3300012497 Ga0157319_1014482 Ga0157319_10144822 80
248 3300012502 Ga0157347_1002744 Ga0157347_10027441 80
249 3300012502 Ga0157347_1026183 Ga0157347_10261832 80
250 3300012505 Ga0157339_1032486 Ga0157339_10324862 80
251 3300012513 Ga0157326_1012389 Ga0157326_10123892 80
252 3300013100 Ga0157373_10094943 Ga0157373_100949432 80
253 3300013100 Ga0157373_10626851 Ga0157373_106268512 80
254 3300013100 Ga0157373_10850502 Ga0157373_108505022 80
255 3300013102 Ga0157371_10059656 Ga0157371_100596562 80
256 3300013102 Ga0157371_10960774 Ga0157371_109607742 80
257 3300013104 Ga0157370_10011514 Ga0157370_1001151410 80
258 3300013104 Ga0157370_10072910 Ga0157370_100729103 80
259 3300013104 Ga0157370_10485367 Ga0157370_104853672 80
260 3300013104 Ga0157370_11952806 Ga0157370_119528061 80
261 3300013105 Ga0157369_10013149 Ga0157369_1001314910 80
262 3300013105 Ga0157369_12189830 Ga0157369_121898301 80
263 3300013296 Ga0157374_10585406 Ga0157374_105854062 80
264 3300013297 Ga0157378_11576671 Ga0157378_115766712 80
265 3300013306 Ga0163162_10362486 Ga0163162_103624862 80
266 3300013306 Ga0163162_10817893 Ga0163162_108178932 80
267 3300013306 Ga0163162_12441603 Ga0163162_124416032 80
268 3300013307 Ga0157372_10576067 Ga0157372_105760672 80
269 3300013308 Ga0157375_11511848 Ga0157375_115118482 80
270 3300013308 Ga0157375_11772195 Ga0157375_117721952 80
271 3300014325 Ga0163163_11594957 Ga0163163_115949572 80
272 3300014326 Ga0157380_10114627 Ga0157380_101146273 80
273 3300014326 Ga0157380_10967518 Ga0157380_109675182 80
274 3300014326 Ga0157380_12835996 Ga0157380_128359962 80
275 3300014497 Ga0182008_10001633 Ga0182008_100016339 80
276 3300014497 Ga0182008_10058827 Ga0182008_100588272 80
277 3300014497 Ga0182008_10075865 Ga0182008_100758652 80
278 3300014497 Ga0182008_10141243 Ga0182008_101412432 80
279 3300014497 Ga0182008_10565055 Ga0182008_105650552 80
280 3300014497 Ga0182008_10688862 Ga0182008_106888622 80
281 3300014745 Ga0157377_11375600 Ga0157377_113756002 80
282 3300014968 Ga0157379_10208061 Ga0157379_102080612 80
283 3300014969 Ga0157376_10344535 Ga0157376_103445352 80
284 3300014969 Ga0157376_10709139 Ga0157376_107091392 80
285 3300014969 Ga0157376_10825833 Ga0157376_108258332 80
286 3300015261 Ga0182006_1010501 Ga0182006_10105014 80
287 3300015261 Ga0182006_1025900 Ga0182006_10259002 80
288 3300015261 Ga0182006_1150238 Ga0182006_11502382 80
289 3300015261 Ga0182006_1176170 Ga0182006_11761701 80
290 3300015261 Ga0182006_1233599 Ga0182006_12335992 80
291 3300015262 Ga0182007_10000853 Ga0182007_1000085315 80
292 3300015262 Ga0182007_10003809 Ga0182007_100038093 80
293 3300015262 Ga0182007_10343066 Ga0182007_103430662 80
294 3300015265 Ga0182005_1052265 Ga0182005_10522652 80
295 3300015265 Ga0182005_1072204 Ga0182005_10722042 80
296 3300015265 Ga0182005_1078107 Ga0182005_10781072 80
297 3300017792 Ga0163161_10001891 Ga0163161_1000189110 80
298 3300017792 Ga0163161_10007216 Ga0163161_100072169 80
299 3300017792 Ga0163161_10008493 Ga0163161_100084932 80
300 3300017792 Ga0163161_10042751 Ga0163161_100427512 80
301 3300017792 Ga0163161_10122988 Ga0163161_101229882 80
302 3300025208 Ga0209436_123904 Ga0209436_1239042 80
303 3300025228 Ga0209672_100642 Ga0209672_1006423 80
304 3300025229 Ga0209147_100995 Ga0209147_1009951 80
305 3300025242 Ga0209258_100093 Ga0209258_10009329 80
306 3300025245 Ga0207425_1000989 Ga0207425_100098911 80
307 3300025245 Ga0207425_1009140 Ga0207425_10091404 80
308 3300025254 Ga0209148_1000007 Ga0209148_1000007996 80
309 3300025258 Ga0209129_1000024 Ga0209129_100002481 80
310 3300025258 Ga0209129_1006303 Ga0209129_10063033 80
311 3300025258 Ga0209129_1010886 Ga0209129_10108862 80
312 3300025263 Ga0209565_1000098 Ga0209565_100009870 80
313 3300025263 Ga0209565_1000633 Ga0209565_100063328 80
314 3300025263 Ga0209565_1042110 Ga0209565_10421102 80
315 3300025273 Ga0209673_1000058 Ga0209673_1000058181 80
316 3300025273 Ga0209673_1001034 Ga0209673_10010342 80
317 3300025273 Ga0209673_1039935 Ga0209673_10399352 80
318 3300025273 Ga0209673_1041386 Ga0209673_10413862 80
319 3300025273 Ga0209673_1052393 Ga0209673_10523932 80
320 3300025284 Ga0209130_1000654 Ga0209130_100065417 80
321 3300025284 Ga0209130_1001114 Ga0209130_100111412 80
322 3300025291 Ga0209675_1000010 Ga0209675_100001084 80
323 3300025291 Ga0209675_1000151 Ga0209675_10001512 80
324 3300025291 Ga0209675_1003092 Ga0209675_10030922 80
325 3300025291 Ga0209675_1007033 Ga0209675_10070337 80
326 3300025292 Ga0209676_1000028 Ga0209676_1000028275 80
327 3300025292 Ga0209676_1001046 Ga0209676_100104630 80
328 3300025292 Ga0209676_1003308 Ga0209676_10033082 80
329 3300025292 Ga0209676_1025199 Ga0209676_10251992 80
330 3300025292 Ga0209676_1027854 Ga0209676_10278543 80
331 3300025292 Ga0209676_1064029 Ga0209676_10640292 80
332 3300025294 Ga0209025_1000685 Ga0209025_100068512 80
333 3300025294 Ga0209025_1001904 Ga0209025_100190413 80
334 3300025294 Ga0209025_1005469 Ga0209025_10054695 80
335 3300025294 Ga0209025_1078148 Ga0209025_10781482 80
336 3300025295 Ga0209564_1000209 Ga0209564_100020992 80
337 3300025295 Ga0209564_1002281 Ga0209564_100228120 80
338 3300025297 Ga0209758_1001224 Ga0209758_10012242 80
339 3300025297 Ga0209758_1037536 Ga0209758_10375362 80
340 3300025298 Ga0209050_1000072 Ga0209050_100007231 80
341 3300025298 Ga0209050_1000927 Ga0209050_100092713 80
342 3300025298 Ga0209050_1004050 Ga0209050_10040502 80
343 3300025298 Ga0209050_1008317 Ga0209050_10083174 80
344 3300025299 Ga0209256_1000088 Ga0209256_1000088184 80
345 3300025299 Ga0209256_1023010 Ga0209256_10230102 80
346 3300025299 Ga0209256_1025808 Ga0209256_10258082 80
347 3300025302 Ga0207426_1000038 Ga0207426_1000038378 80
348 3300025302 Ga0207426_1000053 Ga0207426_100005336 80
349 3300025303 Ga0209051_1000015 Ga0209051_1000015204 80
350 3300025303 Ga0209051_1000056 Ga0209051_1000056196 80
351 3300025303 Ga0209051_1000196 Ga0209051_1000196110 80
352 3300025303 Ga0209051_1000392 Ga0209051_10003922 80
353 3300025303 Ga0209051_1000424 Ga0209051_100042411 80
354 3300025303 Ga0209051_1000545 Ga0209051_100054541 80
355 3300025304 Ga0209257_1000305 Ga0209257_10003059 80
356 3300025304 Ga0209257_1002205 Ga0209257_10022052 80
357 3300025304 Ga0209257_1004602 Ga0209257_100460213 80
358 3300025304 Ga0209257_1009796 Ga0209257_10097962 80
359 3300025304 Ga0209257_1059782 Ga0209257_10597822 80
360 3300025321 Ga0207656_10012795 Ga0207656_100127954 80
361 3300025728 Ga0207655_1006555 Ga0207655_10065556 80
362 3300025728 Ga0207655_1222623 Ga0207655_12226232 80
363 3300025893 Ga0207682_10318236 Ga0207682_103182361 80
364 3300025901 Ga0207688_10900022 Ga0207688_109000222 80
365 3300025903 Ga0207680_10255063 Ga0207680_102550632 80
366 3300025909 Ga0207705_10022490 Ga0207705_100224903 80
367 3300025909 Ga0207705_10074648 Ga0207705_100746483 80
368 3300025909 Ga0207705_10472555 Ga0207705_104725552 80
369 3300025911 Ga0207654_10240763 Ga0207654_102407632 80
370 3300025913 Ga0207695_10060685 Ga0207695_100606853 80
371 3300025914 Ga0207671_10088086 Ga0207671_100880862 80
372 3300025914 Ga0207671_10806075 Ga0207671_108060752 80
373 3300025917 Ga0207660_10181378 Ga0207660_101813782 80
374 3300025919 Ga0207657_10014060 Ga0207657_100140605 80
375 3300025919 Ga0207657_10282786 Ga0207657_102827862 80
376 3300025920 Ga0207649_10704367 Ga0207649_107043672 80
377 3300025920 Ga0207649_10810040 Ga0207649_108100402 80
378 3300025921 Ga0207652_10088927 Ga0207652_100889273 80
379 3300025921 Ga0207652_10161675 Ga0207652_101616752 80
380 3300025924 Ga0207694_10022934 Ga0207694_100229344 80
381 3300025924 Ga0207694_10250337 Ga0207694_102503372 80
382 3300025924 Ga0207694_10767923 Ga0207694_107679232 80
383 3300025925 Ga0207650_10312000 Ga0207650_103120002 80
384 3300025926 Ga0207659_10732672 Ga0207659_107326722 80
385 3300025926 Ga0207659_11340761 Ga0207659_113407611 80
386 3300025927 Ga0207687_10015912 Ga0207687_100159124 80
387 3300025929 Ga0207664_10600294 Ga0207664_106002942 80
388 3300025932 Ga0207690_10127659 Ga0207690_101276593 80
389 3300025932 Ga0207690_11043904 Ga0207690_110439042 80
390 3300025933 Ga0207706_10075902 Ga0207706_100759023 80
391 3300025933 Ga0207706_10275666 Ga0207706_102756662 80
392 3300025934 Ga0207686_10001796 Ga0207686_100017962 80
393 3300025934 Ga0207686_10224147 Ga0207686_102241472 80
394 3300025934 Ga0207686_10579039 Ga0207686_105790392 80
395 3300025935 Ga0207709_10000958 Ga0207709_100009589 80
396 3300025935 Ga0207709_10001025 Ga0207709_100010259 80
397 3300025935 Ga0207709_10001291 Ga0207709_1000129112 80
398 3300025935 Ga0207709_10002267 Ga0207709_100022677 80
399 3300025935 Ga0207709_10002735 Ga0207709_100027356 80
400 3300025935 Ga0207709_10203263 Ga0207709_102032632 80
401 3300025937 Ga0207669_10822658 Ga0207669_108226582 80
402 3300025938 Ga0207704_10521793 Ga0207704_105217932 80
403 3300025938 Ga0207704_10843252 Ga0207704_108432522 80
404 3300025938 Ga0207704_11670850 Ga0207704_116708502 80
405 3300025940 Ga0207691_10759872 Ga0207691_107598722 80
406 3300025940 Ga0207691_11492302 Ga0207691_114923021 80
407 3300025941 Ga0207711_10494626 Ga0207711_104946262 80
408 3300025941 Ga0207711_12098101 Ga0207711_120981011 80
409 3300025942 Ga0207689_10065726 Ga0207689_100657264 80
410 3300025942 Ga0207689_10081640 Ga0207689_100816402 80
411 3300025942 Ga0207689_10482507 Ga0207689_104825071 80
412 3300025942 Ga0207689_10670999 Ga0207689_106709992 80
413 3300025945 Ga0207679_10066316 Ga0207679_100663164 80
414 3300025949 Ga0207667_10341672 Ga0207667_103416722 80
415 3300025949 Ga0207667_10374716 Ga0207667_103747163 80
416 3300025949 Ga0207667_10674686 Ga0207667_106746862 80
417 3300025949 Ga0207667_11952205 Ga0207667_119522052 80
418 3300025960 Ga0207651_10255794 Ga0207651_102557942 80
419 3300025960 Ga0207651_10421668 Ga0207651_104216682 80
420 3300025972 Ga0207668_10248284 Ga0207668_102482842 80
421 3300025972 Ga0207668_12032824 Ga0207668_120328242 80
422 3300025981 Ga0207640_10178836 Ga0207640_101788362 80
423 3300025981 Ga0207640_10754190 Ga0207640_107541902 80
424 3300025986 Ga0207658_10267667 Ga0207658_102676672 80
425 3300025986 Ga0207658_10747812 Ga0207658_107478122 80
426 3300025986 Ga0207658_11007527 Ga0207658_110075272 80
427 3300026023 Ga0207677_10181460 Ga0207677_101814602 80
428 3300026023 Ga0207677_10493446 Ga0207677_104934463 80
429 3300026041 Ga0207639_10010944 Ga0207639_100109449 80
430 3300026041 Ga0207639_11073821 Ga0207639_110738212 80
431 3300026041 Ga0207639_11245984 Ga0207639_112459842 80
432 3300026067 Ga0207678_10395257 Ga0207678_103952572 80
433 3300026078 Ga0207702_10246572 Ga0207702_102465722 80
434 3300026078 Ga0207702_11035726 Ga0207702_110357262 80
435 3300026088 Ga0207641_10024357 Ga0207641_100243573 80
436 3300026089 Ga0207648_10874461 Ga0207648_108744612 80
437 3300026089 Ga0207648_11344358 Ga0207648_113443582 80
438 3300026116 Ga0207674_10202033 Ga0207674_102020333 80
439 3300026116 Ga0207674_10486044 Ga0207674_104860442 80
440 3300026116 Ga0207674_10713668 Ga0207674_107136682 80
441 3300026121 Ga0207683_10180083 Ga0207683_101800832 80
442 3300026121 Ga0207683_10332354 Ga0207683_103323542 80
443 3300026142 Ga0207698_10296757 Ga0207698_102967572 80
444 3300026142 Ga0207698_11526489 Ga0207698_115264892 80
445 3300027111 Ga0209281_1033796 Ga0209281_10337962 80
446 3300027666 Ga0209282_1001024 Ga0209282_100102412 80
447 3300027866 Ga0209813_10141295 Ga0209813_101412952 80
448 3300027876 Ga0209974_10085254 Ga0209974_100852542 80
449 3300027907 Ga0207428_10127051 Ga0207428_101270512 80
450 3300028379 Ga0268266_10218330 Ga0268266_102183302 80
451 3300028380 Ga0268265_10386394 Ga0268265_103863941 80
452 3300028381 Ga0268264_12398864 Ga0268264_123988642 80
453 3300028794 Ga0307515_10000084 Ga0307515_10000084178 80
454 3300028794 Ga0307515_10072156 Ga0307515_100721562 80
455 3300028794 Ga0307515_10483798 Ga0307515_104837981 80
456 3300028794 Ga0307515_10538684 Ga0307515_105386842 80
457 3300030522 Ga0307512_10121381 Ga0307512_101213812 80
458 3300030731 Ga0316177_1148101 Ga0316177_11481013 80
459 3300030733 Ga0314311_1237239 Ga0314311_12372392 80
460 3300030735 Ga0316178_1016090 Ga0316178_10160902 80
461 3300030736 Ga0316180_1033885 Ga0316180_10338852 80
462 3300030742 Ga0316183_1122753 Ga0316183_11227532 80
463 3300030744 Ga0316181_1085526 Ga0316181_10855262 80
464 3300030745 Ga0316182_1238099 Ga0316182_12380992 80
465 3300030745 Ga0316182_1399987 Ga0316182_13999873 80
466 3300031251 Ga0265327_10148026 Ga0265327_101480262 80
467 3300031456 Ga0307513_10026225 Ga0307513_100262258 80
468 3300031456 Ga0307513_10519366 Ga0307513_105193662 80
469 3300031548 Ga0307408_100073371 Ga0307408_1000733712 80
470 3300031548 Ga0307408_100080304 Ga0307408_1000803042 80
471 3300031548 Ga0307408_100161448 Ga0307408_1001614482 80
472 3300031548 Ga0307408_100266625 Ga0307408_1002666252 80
473 3300031548 Ga0307408_100280671 Ga0307408_1002806712 80
474 3300031548 Ga0307408_100316751 Ga0307408_1003167512 80
475 3300031548 Ga0307408_100464861 Ga0307408_1004648611 80
476 3300031548 Ga0307408_100480893 Ga0307408_1004808932 80
477 3300031548 Ga0307408_100546985 Ga0307408_1005469852 80
478 3300031548 Ga0307408_101249100 Ga0307408_1012491002 80
479 3300031548 Ga0307408_101845938 Ga0307408_1018459382 80
480 3300031548 Ga0307408_102262748 Ga0307408_1022627482 80
481 3300031649 Ga0307514_10000954 Ga0307514_1000095428 80
482 3300031649 Ga0307514_10138226 Ga0307514_101382262 80
483 3300031711 Ga0265314_10007074 Ga0265314_100070746 80
484 3300031731 Ga0307405_10022681 Ga0307405_100226813 80
485 3300031731 Ga0307405_10203872 Ga0307405_102038721 80
486 3300031731 Ga0307405_10313310 Ga0307405_103133102 80
487 3300031731 Ga0307405_10474225 Ga0307405_104742252 80
488 3300031824 Ga0307413_10138982 Ga0307413_101389822 80
489 3300031824 Ga0307413_10454530 Ga0307413_104545302 80
490 3300031824 Ga0307413_10903079 Ga0307413_109030792 80
491 3300031852 Ga0307410_10510404 Ga0307410_105104042 80
492 3300031852 Ga0307410_10530941 Ga0307410_105309412 80
493 3300031852 Ga0307410_11552995 Ga0307410_115529952 80
494 3300031901 Ga0307406_10001705 Ga0307406_100017052 80
495 3300031901 Ga0307406_10029763 Ga0307406_100297633 80
496 3300031901 Ga0307406_10444781 Ga0307406_104447812 80
497 3300031901 Ga0307406_10880524 Ga0307406_108805242 80
498 3300031901 Ga0307406_10985024 Ga0307406_109850242 80
499 3300031901 Ga0307406_11055058 Ga0307406_110550582 80
500 3300031903 Ga0307407_10127011 Ga0307407_101270112 80
501 3300031903 Ga0307407_10219229 Ga0307407_102192292 80
502 3300031911 Ga0307412_10009231 Ga0307412_100092317 80
503 3300031911 Ga0307412_10018497 Ga0307412_100184975 80
504 3300031911 Ga0307412_10040329 Ga0307412_100403295 80
505 3300031911 Ga0307412_10069765 Ga0307412_100697652 80
506 3300031911 Ga0307412_10164512 Ga0307412_101645122 80
507 3300031911 Ga0307412_10239149 Ga0307412_102391492 80
508 3300031911 Ga0307412_10434341 Ga0307412_104343412 80
509 3300031911 Ga0307412_10818926 Ga0307412_108189262 80
510 3300031911 Ga0307412_10882358 Ga0307412_108823582 80
511 3300031911 Ga0307412_11066941 Ga0307412_110669412 80
512 3300031911 Ga0307412_11218498 Ga0307412_112184982 80
513 3300031995 Ga0307409_100360040 Ga0307409_1003600402 80
514 3300031995 Ga0307409_101306064 Ga0307409_1013060642 80
515 3300032002 Ga0307416_100090654 Ga0307416_1000906542 80
516 3300032002 Ga0307416_100648391 Ga0307416_1006483912 80
517 3300032002 Ga0307416_100665749 Ga0307416_1006657492 80
518 3300032002 Ga0307416_100692627 Ga0307416_1006926272 80
519 3300032002 Ga0307416_101187508 Ga0307416_1011875082 80
520 3300032002 Ga0307416_101387557 Ga0307416_1013875572 80
521 3300032002 Ga0307416_102124172 Ga0307416_1021241721 80
522 3300032002 Ga0307416_103302620 Ga0307416_1033026202 80
523 3300032004 Ga0307414_10068974 Ga0307414_100689742 80
524 3300032004 Ga0307414_10091564 Ga0307414_100915642 80
525 3300032004 Ga0307414_10593157 Ga0307414_105931571 80
526 3300032004 Ga0307414_10877261 Ga0307414_108772611 80
527 3300032004 Ga0307414_12203709 Ga0307414_122037092 80
528 3300032005 Ga0307411_10024402 Ga0307411_100244022 80
529 3300032005 Ga0307411_10178581 Ga0307411_101785812 80
530 3300032005 Ga0307411_10311964 Ga0307411_103119642 80
531 3300032005 Ga0307411_10454826 Ga0307411_104548262 80
532 3300032005 Ga0307411_10974878 Ga0307411_109748782 80
533 3300032005 Ga0307411_11479876 Ga0307411_114798762 80
534 3300032005 Ga0307411_12260670 Ga0307411_122606702 80
535 3300032126 Ga0307415_101084036 Ga0307415_1010840361 80
536 3300035170 Ga0373943_0428727 Ga0373943_0428727_73_315 80
537 3300035691 Ga0373931_0089159 Ga0373931_0089159_172_414 80
538 3300037312 Ga0395899_0104110 Ga0395899_0104110_180_428 80
539 3300037418 Ga0395900_0161473 Ga0395900_0161473_443_688 80
540 3300037466 Ga0395898_0294881 Ga0395898_0294881_213_461 80
541 3300037471 Ga0395905_0050498 Ga0395905_0050498_3414_3662 80
542 3300037471 Ga0395905_0633031 Ga0395905_0633031_353_598 80
543 3300038443 Ga0395901_0074087 Ga0395901_0074087_1998_2240 80
544 3300038443 Ga0395901_0435328 Ga0395901_0435328_105_350 80
545 3300038443 Ga0395901_1223270 Ga0395901_1223270_14_262 80
546 3300039447 Ga0436361_0070738 Ga0436361_0070738_18275_18517 80
547 3300041404 Ga0439436_0001048 Ga0439436_0001048_5892_6134 80
548 3300041404 Ga0439436_0049230 Ga0439436_0049230_459_701 80
549 3300041404 Ga0439436_0265955 Ga0439436_0265955_105_347 80
550 3300041405 Ga0439438_081388 Ga0439438_081388_335_577 80
551 3300041406 Ga0439439_0000268 Ga0439439_0000268_5305_5547 80
552 3300041406 Ga0439439_0039004 Ga0439439_0039004_883_1125 80
553 3300041407 Ga0439447_023051 Ga0439447_023051_1090_1332 80
554 3300041410 Ga0439461_0006198 Ga0439461_0006198_1242_1484 80
555 3300041410 Ga0439461_0051778 Ga0439461_0051778_163_405 80
556 3300041410 Ga0439461_0077677 Ga0439461_0077677_16_258 80
557 3300041410 Ga0439461_0101819 Ga0439461_0101819_61_303 80
558 3300041411 Ga0439466_0004086 Ga0439466_0004086_3020_3262 80
559 3300041411 Ga0439466_0051658 Ga0439466_0051658_923_1165 80
560 3300041411 Ga0439466_0106718 Ga0439466_0106718_98_340 80
561 3300041411 Ga0439466_0238257 Ga0439466_0238257_215_457 80
562 3300041413 Ga0439465_0003993 Ga0439465_0003993_4069_4311 80
563 3300041413 Ga0439465_0023149 Ga0439465_0023149_263_505 80
564 3300041441 Ga0451787_019627 Ga0451787_019627_545_787 80
565 3300041443 Ga0451789_0111381 Ga0451789_0111381_222_464 80
566 3300041451 Ga0451791_1495823 Ga0451791_1495823_18_260 80
567 3300041452 Ga0451793_0435770 Ga0451793_0435770_687_929 80
568 3300041452 Ga0451793_1075355 Ga0451793_1075355_421_663 80
569 3300041452 Ga0451793_1159892 Ga0451793_1159892_115_357 80
570 3300041453 Ga0451797_0157609 Ga0451797_0157609_224_466 80
571 3300041458 Ga0451798_0238516 Ga0451798_0238516_85_336 80
572 3300041459 Ga0451800_1458506 Ga0451800_1458506_273_515 80
573 3300041460 Ga0451802_0624242 Ga0451802_0624242_149_391 80
574 3300041486 Ga0451807_0286398 Ga0451807_0286398_152_394 80
575 3300041486 Ga0451807_1888789 Ga0451807_1888789_78_320 80
576 3300041491 Ga0451833_0083665 Ga0451833_0083665_207_449 80
577 3300041494 Ga0451837_0663527 Ga0451837_0663527_267_509 80
578 3300041498 Ga0451841_0595886 Ga0451841_0595886_400_642 80
579 3300041505 Ga0451849_1011591 Ga0451849_1011591_168_410 80
580 3300041512 Ga0451853_1220038 Ga0451853_1220038_231_479 80
581 3300041997 Ga0439431_0000483 Ga0439431_0000483_2805_3047 80
582 3300041997 Ga0439431_0022187 Ga0439431_0022187_17_259 80
583 3300041999 Ga0439433_0002772 Ga0439433_0002772_2122_2364 80
584 3300041999 Ga0439433_0007775 Ga0439433_0007775_602_844 80
585 3300042000 Ga0439437_038995 Ga0439437_038995_191_436 80
586 3300042000 Ga0439437_044912 Ga0439437_044912_259_501 80
587 3300042002 Ga0439442_026084 Ga0439442_026084_421_663 80
588 3300042002 Ga0439442_035387 Ga0439442_035387_26_268 80
589 3300042004 Ga0439445_0255926 Ga0439445_0255926_126_368 80
590 3300042006 Ga0439432_001040 Ga0439432_001040_6822_7064 80
591 3300042006 Ga0439432_096329 Ga0439432_096329_474_716 80
592 3300042006 Ga0439432_213823 Ga0439432_213823_287_529 80
593 3300042007 Ga0439449_0019219 Ga0439449_0019219_1457_1699 80
594 3300042007 Ga0439449_0130775 Ga0439449_0130775_379_621 80
595 3300042010 Ga0439452_003891 Ga0439452_003891_491_733 80
596 3300042010 Ga0439452_006902 Ga0439452_006902_1321_1563 80
597 3300042011 Ga0439454_012408 Ga0439454_012408_493_735 80
598 3300042014 Ga0439457_012603 Ga0439457_012603_228_470 80
599 3300042014 Ga0439457_046768 Ga0439457_046768_131_373 80
600 3300042014 Ga0439457_065680 Ga0439457_065680_150_392 80
601 3300042015 Ga0439462_0001318 Ga0439462_0001318_4575_4817 80
602 3300042015 Ga0439462_0079804 Ga0439462_0079804_491_733 80
603 3300042115 Ga0450911_030684 Ga0450911_030684_163_405 80
604 3300042116 Ga0450912_032470 Ga0450912_032470_141_383 80
605 3300042121 Ga0450919_015142 Ga0450919_015142_422_664 80
606 3300042122 Ga0450920_033381 Ga0450920_033381_268_510 80
607 3300042123 Ga0450921_005413 Ga0450921_005413_278_520 80
608 3300042124 Ga0450922_022460 Ga0450922_022460_384_626 80
609 3300042125 Ga0450923_005097 Ga0450923_005097_140_382 80
610 3300042126 Ga0450888_039612 Ga0450888_039612_294_539 80
611 3300042127 Ga0450890_078893 Ga0450890_078893_129_374 80
612 3300042131 Ga0450894_041805 Ga0450894_041805_57_299 80
613 3300042133 Ga0450896_015628 Ga0450896_015628_341_583 80
614 3300042133 Ga0450896_036011 Ga0450896_036011_227_469 80
615 3300042134 Ga0450898_006200 Ga0450898_006200_471_713 80
616 3300042134 Ga0450898_018085 Ga0450898_018085_413_655 80
617 3300042136 Ga0450900_033416 Ga0450900_033416_23_265 80
618 3300042145 Ga0450906_005730 Ga0450906_005730_1816_2058 80
619 3300042147 Ga0450910_010111 Ga0450910_010111_839_1081 80
620 3300042147 Ga0450910_054393 Ga0450910_054393_187_429 80
621 3300042156 Ga0439446_0005262 Ga0439446_0005262_1265_1507 80
622 3300042156 Ga0439446_0048173 Ga0439446_0048173_252_494 80
623 3300042156 Ga0439446_0124007 Ga0439446_0124007_75_317 80
624 3300042156 Ga0439446_0139013 Ga0439446_0139013_445_687 80
625 3300042156 Ga0439446_0182861 Ga0439446_0182861_77_319 80
626 3300042184 Ga0450908_004957 Ga0450908_004957_1823_2065 80
627 3300042184 Ga0450908_005518 Ga0450908_005518_2025_2267 80
628 3300042435 Ga0439434_0004240 Ga0439434_0004240_487_729 80
629 3300042435 Ga0439434_0006113 Ga0439434_0006113_1457_1699 80
630 3300042435 Ga0439434_0024175 Ga0439434_0024175_587_829 80
631 3300042531 Ga0450918_007011 Ga0450918_007011_786_1028 80
632 3300042532 Ga0450893_0001626 Ga0450893_0001626_1272_1517 80
633 3300042532 Ga0450893_0027591 Ga0450893_0027591_457_699 80
634 3300042532 Ga0450893_0064141 Ga0450893_0064141_89_331 80
635 3300042532 Ga0450893_0112883 Ga0450893_0112883_271_513 80
636 3300042876 Ga0451577_0007910 Ga0451577_0007910_9248_9490 80
637 3300042876 Ga0451577_0129918 Ga0451577_0129918_1770_2015 80
638 3300044673 Ga0453683_0009185 Ga0453683_0009185_956_1198 80
639 3300044683 Ga0466965_0050739 Ga0466965_0050739_1384_1626 80
640 3300044712 Ga0453684_0026869 Ga0453684_0026869_8015_8257 80
641 3300044712 Ga0453684_0763732 Ga0453684_0763732_502_747 80
642 3300044712 Ga0453684_1589321 Ga0453684_1589321_36_278 80
643 3300044719 Ga0466971_0401815 Ga0466971_0401815_68_313 80
644 3300044842 Ga0466957_0394886 Ga0466957_0394886_305_550 80
645 3300044901 Ga0466960_0024961 Ga0466960_0024961_1922_2164 80
646 3300045051 Ga0451576_0018182 Ga0451576_0018182_366_608 80
647 3300045051 Ga0451576_0788109 Ga0451576_0788109_457_702 80
648 3300045976 Ga0466967_0959779 Ga0466967_0959779_324_569 80
649 3300046453 Ga0495627_001913 Ga0495627_001913_5513_5755 80
650 3300046453 Ga0495627_084868 Ga0495627_084868_494_736 80
651 3300046459 Ga0495629_0801468 Ga0495629_0801468_221_463 80
652 3300046460 Ga0495638_0119583 Ga0495638_0119583_609_851 80
653 3300046462 Ga0495651_0382814 Ga0495651_0382814_479_721 80
654 3300046463 Ga0495653_0500140 Ga0495653_0500140_213_455 80
655 3300046471 Ga0495650_0113844 Ga0495650_0113844_547_789 80
656 3300046475 Ga0495639_0023242 Ga0495639_0023242_772_1014 80
657 3300046512 Ga0495610_0024818 Ga0495610_0024818_2400_2642 80
658 3300046512 Ga0495610_0212363 Ga0495610_0212363_206_448 80
659 3300046513 Ga0495616_0010183 Ga0495616_0010183_2382_2624 80
660 3300046515 Ga0495620_0002466 Ga0495620_0002466_6589_6831 80
661 3300046515 Ga0495620_0218188 Ga0495620_0218188_402_644 80
662 3300046516 Ga0495628_0750912 Ga0495628_0750912_25_267 80
663 3300046517 Ga0495630_0489811 Ga0495630_0489811_564_806 80
664 3300046518 Ga0495631_0003037 Ga0495631_0003037_6284_6526 80
665 3300046520 Ga0495637_0003474 Ga0495637_0003474_1071_1313 80
666 3300046525 Ga0495663_0153113 Ga0495663_0153113_485_739 80
667 3300046528 Ga0495642_0240402 Ga0495642_0240402_370_612 80
668 3300046529 Ga0495652_0731076 Ga0495652_0731076_136_378 80
669 3300046530 Ga0495654_0011433 Ga0495654_0011433_4386_4628 80
670 3300046539 Ga0495621_0013869 Ga0495621_0013869_496_750 80
671 3300046539 Ga0495621_0019672 Ga0495621_0019672_121_363 80
672 3300046539 Ga0495621_0302859 Ga0495621_0302859_233_475 80
673 3300046557 Ga0495622_0104723 Ga0495622_0104723_684_926 80
674 3300046558 Ga0495633_0270865 Ga0495633_0270865_399_641 80
675 3300046615 Ga0495656_0000746 Ga0495656_0000746_8853_9107 80
676 3300046642 Ga0495634_0699015 Ga0495634_0699015_146_388 80
677 3300046660 Ga0495625_0005468 Ga0495625_0005468_503_745 80
678 3300046660 Ga0495625_0069851 Ga0495625_0069851_2055_2297 80
679 3300046660 Ga0495625_0238885 Ga0495625_0238885_402_644 80
680 3300046665 Ga0495661_0328406 Ga0495661_0328406_212_454 80
681 3300046665 Ga0495661_0420979 Ga0495661_0420979_209_451 80
682 3300046674 Ga0495588_0102512 Ga0495588_0102512_1112_1354 80
683 3300046674 Ga0495588_0373218 Ga0495588_0373218_103_345 80
684 3300046683 Ga0495658_0063297 Ga0495658_0063297_1390_1632 80
685 3300046683 Ga0495658_1072531 Ga0495658_1072531_50_292 80
686 3300046684 Ga0495669_0657056 Ga0495669_0657056_133_375 80
687 3300046690 Ga0495624_0128461 Ga0495624_0128461_655_897 80
688 3300046690 Ga0495624_0344680 Ga0495624_0344680_267_509 80
689 3300046691 Ga0495670_0212498 Ga0495670_0212498_263_505 80
690 3300046691 Ga0495670_0255194 Ga0495670_0255194_422_664 80
691 3300046691 Ga0495670_0393707 Ga0495670_0393707_240_482 80
692 3300046691 Ga0495670_0529958 Ga0495670_0529958_95_349 80
693 3300046692 Ga0495671_0009329 Ga0495671_0009329_2529_2771 80
694 3300047315 Ga0495581_0353461 Ga0495581_0353461_427_669 80
695 3300047317 Ga0495604_1012317 Ga0495604_1012317_120_362 80
696 3300047321 Ga0495676_0102050 Ga0495676_0102050_1038_1280 80
697 3300047445 Ga0495677_0467489 Ga0495677_0467489_182_424 80
698 3300047470 Ga0495681_0345125 Ga0495681_0345125_143_385 80
699 3300047472 Ga0495686_0214275 Ga0495686_0214275_429_671 80
700 3300047673 Ga0495593_0012263 Ga0495593_0012263_189_431 80
701 3300048088 Ga0495602_0384296 Ga0495602_0384296_56_298 80
702 3300048089 Ga0495614_0051869 Ga0495614_0051869_1022_1264 80
703 3300048089 Ga0495614_0262777 Ga0495614_0262777_496_738 80
704 3300048090 Ga0495615_0096335 Ga0495615_0096335_553_795 80
705 3300048090 Ga0495615_0120639 Ga0495615_0120639_296_550 80
706 3300048903 Ga0496100_0009165 Ga0496100_0009165_2451_2693 80
707 3300048904 Ga0496101_0004382 Ga0496101_0004382_8357_8599 80
708 3300048904 Ga0496101_0005001 Ga0496101_0005001_1845_2087 80
709 3300048905 Ga0496102_0006127 Ga0496102_0006127_1035_1277 80
710 3300048906 Ga0496103_0210241 Ga0496103_0210241_296_538 80
711 3300048907 Ga0496104_0029955 Ga0496104_0029955_4237_4479 80
712 3300048908 Ga0496105_0004053 Ga0496105_0004053_10398_10640 80
713 3300048909 Ga0496106_0009081 Ga0496106_0009081_175_417 80
714 3300048910 Ga0496107_0054704 Ga0496107_0054704_1418_1660 80
715 3300048910 Ga0496107_0175066 Ga0496107_0175066_71_313 80
716 3300048911 Ga0496108_0571847 Ga0496108_0571847_231_473 80
717 3300048912 Ga0496109_0227502 Ga0496109_0227502_79_321 80
718 3300048912 Ga0496109_0594722 Ga0496109_0594722_458_700 80
719 3300048913 Ga0496110_0446642 Ga0496110_0446642_435_677 80
720 3300048914 Ga0496111_0071605 Ga0496111_0071605_1896_2138 80
721 3300048914 Ga0496111_0812564 Ga0496111_0812564_160_402 80
722 3300048915 Ga0496112_0325183 Ga0496112_0325183_1019_1261 80
723 3300048916 Ga0496113_0518479 Ga0496113_0518479_345_587 80
724 3300048917 Ga0496114_1021945 Ga0496114_1021945_88_330 80
725 3300048917 Ga0496114_1132328 Ga0496114_1132328_400_654 80
726 3300048918 Ga0496115_0941435 Ga0496115_0941435_37_279 80
727 3300048919 Ga0496116_0039510 Ga0496116_0039510_792_1034 80
728 3300048920 Ga0496117_0023000 Ga0496117_0023000_2779_3021 80
729 3300048920 Ga0496117_0043622 Ga0496117_0043622_2597_2839 80
730 3300048921 Ga0496118_0006363 Ga0496118_0006363_6409_6651 80
731 3300048921 Ga0496118_0019829 Ga0496118_0019829_2419_2661 80
732 3300048922 Ga0496119_0082193 Ga0496119_0082193_591_833 80
733 3300048922 Ga0496119_0175820 Ga0496119_0175820_155_403 80
734 3300048924 Ga0496121_0052610 Ga0496121_0052610_1510_1752 80
735 3300048924 Ga0496121_0121176 Ga0496121_0121176_113_355 80
736 3300048925 Ga0496122_0582460 Ga0496122_0582460_267_509 80
737 3300048926 Ga0496123_0377373 Ga0496123_0377373_84_326 80
738 3300048927 Ga0496124_0176704 Ga0496124_0176704_610_852 80
739 3300048927 Ga0496124_0544698 Ga0496124_0544698_233_475 80
740 3300048928 Ga0496125_0046359 Ga0496125_0046359_253_495 80
741 3300048928 Ga0496125_0053320 Ga0496125_0053320_399_641 80
742 3300048928 Ga0496125_0617063 Ga0496125_0617063_142_384 80
743 3300049531 Ga0501315_012151 Ga0501315_012151_480_722 80
744 3300049533 Ga0501317_049401 Ga0501317_049401_263_505 80
745 3300049539 Ga0501323_015594 Ga0501323_015594_439_681 80
746 3300049539 Ga0501323_067597 Ga0501323_067597_69_314 80
747 3300049573 Ga0501037_0145399 Ga0501037_0145399_1070_1315 80
748 3300049580 Ga0501046_0281209 Ga0501046_0281209_605_847 80
749 3300049663 Ga0501223_144669 Ga0501223_144669_82_324 80
750 3300049668 Ga0501233_289805 Ga0501233_289805_144_386 80
751 3300049675 Ga0501243_142071 Ga0501243_142071_99_344 80
752 3300049679 Ga0501249_050489 Ga0501249_050489_61_303 80
753 3300049705 Ga0501225_0046999 Ga0501225_0046999_303_545 80
754 3300049776 Ga0501280_027411 Ga0501280_027411_302_547 80
755 3300050489 nmdc:mga03683_105991_c1 nmdc:mga03683_105991_c1_409_651 80
756 3300050489 nmdc:mga03683_162337_c1 nmdc:mga03683_162337_c1_451_693 80
757 3300050489 nmdc:mga03683_197312_c2 nmdc:mga03683_197312_c2_97_339 80
758 3300050489 nmdc:mga03683_343496_c1 nmdc:mga03683_343496_c1_447_689 80
759 3300050489 nmdc:mga03683_345433_c1 nmdc:mga03683_345433_c1_182_424 80
760 3300050489 nmdc:mga03683_456182_c1 nmdc:mga03683_456182_c1_149_391 80
761 3300050489 nmdc:mga03683_468576_c1 nmdc:mga03683_468576_c1_264_506 80
762 3300050489 nmdc:mga03683_73810_c1 nmdc:mga03683_73810_c1_1144_1386 80
763 3300050490 nmdc:mga03n38_116333_c1 nmdc:mga03n38_116333_c1_938_1180 80
764 3300050490 nmdc:mga03n38_258017_c1 nmdc:mga03n38_258017_c1_540_782 80
765 3300050490 nmdc:mga03n38_330806_c1 nmdc:mga03n38_330806_c1_509_751 80
766 3300050490 nmdc:mga03n38_430839_c1 nmdc:mga03n38_430839_c1_174_416 80
767 3300050490 nmdc:mga03n38_500810_c1 nmdc:mga03n38_500810_c1_271_513 80
768 3300050491 nmdc:mga00v17_315474_c1 nmdc:mga00v17_315474_c1_576_818 80
769 3300050491 nmdc:mga00v17_42986_c1 nmdc:mga00v17_42986_c1_612_854 80
770 3300050491 nmdc:mga00v17_565297_c1 nmdc:mga00v17_565297_c1_71_319 80
771 3300050491 nmdc:mga00v17_585738_c1 nmdc:mga00v17_585738_c1_143_385 80
772 3300050491 nmdc:mga00v17_636184_c1 nmdc:mga00v17_636184_c1_278_520 80
773 3300050491 nmdc:mga00v17_767875_c1 nmdc:mga00v17_767875_c1_237_479 80
774 3300050492 nmdc:mga0yw44_138048_c1 nmdc:mga0yw44_138048_c1_224_472 80
775 3300050492 nmdc:mga0yw44_658365_c1 nmdc:mga0yw44_658365_c1_232_474 80
776 3300050493 nmdc:mga0k408_111441_c1 nmdc:mga0k408_111441_c1_231_473 80
777 3300050493 nmdc:mga0k408_231329_c1 nmdc:mga0k408_231329_c1_670_912 80
778 3300050493 nmdc:mga0k408_26362_c1 nmdc:mga0k408_26362_c1_2373_2615 80
779 3300050493 nmdc:mga0k408_305574_c1 nmdc:mga0k408_305574_c1_468_710 80
780 3300050493 nmdc:mga0k408_6011_c1 nmdc:mga0k408_6011_c1_5924_6166 80
781 3300050493 nmdc:mga0k408_81457_c1 nmdc:mga0k408_81457_c1_1176_1418 80
782 3300050493 nmdc:mga0k408_89457_c1 nmdc:mga0k408_89457_c1_1389_1631 80
783 3300050494 nmdc:mga06z11_154388_c1 nmdc:mga06z11_154388_c1_145_387 80
784 3300050494 nmdc:mga06z11_72127_c1 nmdc:mga06z11_72127_c1_434_676 80
785 3300050495 nmdc:mga04h51_283906_c1 nmdc:mga04h51_283906_c1_60_302 80
786 3300050496 nmdc:mga07m45_206558_c1 nmdc:mga07m45_206558_c1_290_532 80
787 3300050496 nmdc:mga07m45_25369_c1 nmdc:mga07m45_25369_c1_91_336 80
788 3300050496 nmdc:mga07m45_277484_c1 nmdc:mga07m45_277484_c1_566_808 80
789 3300050496 nmdc:mga07m45_289043_c1 nmdc:mga07m45_289043_c1_487_729 80
790 3300050496 nmdc:mga07m45_36823_c1 nmdc:mga07m45_36823_c1_558_800 80
791 3300050496 nmdc:mga07m45_383745_c1 nmdc:mga07m45_383745_c1_226_468 80
792 3300050496 nmdc:mga07m45_5257_c1 nmdc:mga07m45_5257_c1_811_1053 80
793 3300050496 nmdc:mga07m45_532405_c1 nmdc:mga07m45_532405_c1_422_664 80
794 3300050496 nmdc:mga07m45_5339_c1 nmdc:mga07m45_5339_c1_1163_1405 80
795 3300050496 nmdc:mga07m45_56345_c1 nmdc:mga07m45_56345_c1_1210_1452 80
796 3300050496 nmdc:mga07m45_758688_c1 nmdc:mga07m45_758688_c1_187_429 80
797 3300050496 nmdc:mga07m45_768095_c1 nmdc:mga07m45_768095_c1_78_323 80
798 3300050516 nmdc:mga0sz30_271917_c1 nmdc:mga0sz30_271917_c1_186_428 80
799 3300050516 nmdc:mga0sz30_388442_c1 nmdc:mga0sz30_388442_c1_287_529 80
800 3300053078 Ga0495612_0168246 Ga0495612_0168246_576_818 80
801 3300053079 Ga0500610_0056696 Ga0500610_0056696_1079_1321 80
802 3300053083 Ga0495655_0148787 Ga0495655_0148787_59_301 80
803 3300053087 Ga0500643_019521 Ga0500643_019521_1227_1469 80
804 3300053093 Ga0500651_0000347 Ga0500651_0000347_14075_14317 80
805 3300053094 Ga0500566_0114122 Ga0500566_0114122_738_980 80
806 3300053103 Ga0500555_159784 Ga0500555_159784_198_440 80
807 3300053108 Ga0500562_006293 Ga0500562_006293_1301_1552 80
808 3300053108 Ga0500562_144760 Ga0500562_144760_224_466 80
809 3300053110 Ga0500571_001746 Ga0500571_001746_7037_7279 80
810 3300053111 Ga0500572_175521 Ga0500572_175521_413_655 80
811 3300053117 Ga0500593_018569 Ga0500593_018569_287_529 80
812 3300053117 Ga0500593_118317 Ga0500593_118317_366_617 80
813 3300053118 Ga0500594_0033579 Ga0500594_0033579_659_901 80
814 3300053121 Ga0500607_006984 Ga0500607_006984_2568_2810 80
815 3300053121 Ga0500607_197701 Ga0500607_197701_213_455 80
816 3300053122 Ga0500608_017372 Ga0500608_017372_1836_2078 80
817 3300053122 Ga0500608_358475 Ga0500608_358475_153_395 80
818 3300053129 Ga0500628_111204 Ga0500628_111204_16_258 80
819 3300053133 Ga0500655_055511 Ga0500655_055511_431_673 80
820 3300053134 Ga0500658_0000560 Ga0500658_0000560_6483_6725 80
821 3300053134 Ga0500658_0000589 Ga0500658_0000589_5946_6188 80
822 3300053138 Ga0500564_131856 Ga0500564_131856_469_711 80
823 3300053139 Ga0500568_0006650 Ga0500568_0006650_615_857 80
824 3300053142 Ga0500577_0220196 Ga0500577_0220196_460_711 80
825 3300053145 Ga0500586_158012 Ga0500586_158012_115_366 80
826 3300053153 Ga0500616_0021860 Ga0500616_0021860_1394_1636 80
827 3300053157 Ga0500624_015969 Ga0500624_015969_343_585 80
828 3300053158 Ga0500627_0044221 Ga0500627_0044221_633_875 80
829 3300053161 Ga0500634_0257925 Ga0500634_0257925_286_528 80
830 3300053161 Ga0500634_0325631 Ga0500634_0325631_15_257 80
831 3300053162 Ga0500638_051737 Ga0500638_051737_1312_1554 80
832 3300053177 Ga0500636_0352800 Ga0500636_0352800_287_529 80
833 3300053729 Ga0500625_202069 Ga0500625_202069_409_651 80
834 3300053730 Ga0500645_198453 Ga0500645_198453_264_515 80
835 3300053734 Ga0500565_017652 Ga0500565_017652_507_749 80
836 3300053735 Ga0500596_018659 Ga0500596_018659_634_876 80
837 3300059424 Ga0590075_049907 Ga0590075_049907_733_975 80
838 3300059426 Ga0590077_137847 Ga0590077_137847_297_539 80

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

14

87

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.9082 1 76
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9015 3 74
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8978 3 74
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8854 1 80
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8819 1 75
ID Description Score Start End Superfamily
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9497 1 77 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9228 3 77 3.10.20.90
af_Q4DAW3_3_74_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9134 2 69 3.30.300.90
af_Q12238_9_101_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9116 4 74 3.30.300.90
af_Q5AKW1_24_116_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9083 4 74 3.30.300.90
ID Description Score Start End GO Terms
AF-L8XX10-F1-model_v4 BolA family transcriptional regulator 0.9845 1 78
AF-A0A6A5L5I3-F1-model_v4 deleted 0.9832 1 76
AF-A0A7V5V488-F1-model_v4 BolA/IbaG family iron-sulfur metabolism protein 0.9743 1 78 GO:0005829
GO:0006351
AF-A0A1F3ZBD0-F1-model_v4 BolA family transcriptional regulator 0.9679 1 77
AF-A0A4P7BH98-F1-model_v4 deleted 0.9646 1 79

Feature Viewer

pLDDT pTM Quality
89.06 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map