F482909

General Info

Members Datasets Scaffolds Average Seq Length
836 403 1672 354

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0097126|Ga0496112_0097126_370_1650
Length 426
Sequence VRRRIGRFRGRPAEHENGGDPCREQNVRARSEAAKAELWRQVRRFGIERHDASHWQHGDSDSMSDAQQRIRAAVAAFARGELVIVADDDDRENEGDLFVAAALCTPEKMAFMIRHTSGIVCAPLAPEEARRLHLDPMVARNDAPLGTAFTVSVDARHGLTTGISAEERTNTVRALANGNMGAGDFVRPGHVFPLVAKDGGVLMRSGHTEACVDLCRLAGLPPVGVLAELMNDDGTVMRGDDIAAFAERHKLQRVSIADLIAFRQSREKLIERVGEFPVESEIGTLAGYAFQTPFDPFYHMAFVHGRIGDGRNVLARLHRANLILDVFGGAKAIRRTLDRFKAEGRGVLVVLRDGAAGVPVVSIPKSDETLSGEARIRQWREVGLGAQILKDLGVTSIKLLSFSRPMTYVGLSGFGIEIVGTEPVEG

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
122 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
154 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
233 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
234 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
235 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
242 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
245 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
258 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
259 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
260 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
261 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
262 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
267 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
268 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
269 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
270 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
274 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
275 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
276 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
278 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
279 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
310 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
331 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
384 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
391 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
392 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
400 2902330777 Methylobacterium sp. 2A Isolate Unclassified
401 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
402 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
403 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.36
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.11
Nodule 0
Rhizoplane 8.85
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0097126 3300048915 Bacteria 2917
2 2214748016 2209111006 Bacteria 3432
3 ARcpr5oldR_c000166 3300000041 Bacteria 11417
4 ARSoilYngRDRAFT_c00122 3300000042 Bacteria 13299
5 ARcpr5yngRDRAFT_c000142 3300000043 Bacteria 11426
6 ARSoilOldRDRAFT_c000054 3300000044 Bacteria 23692
7 ARCol0oldRDRAFT_c00231 3300000045 Bacteria 5178
8 ARCol0yngRDRAFT_1000054 3300000652 Bacteria 20195
9 JGI24746J21847_1000620 3300001977 Bacteria 5412
10 JGI24747J21853_1000823 3300001978 Bacteria 2126
11 JGI24739J22299_10001041 3300001989 Bacteria 10288
12 JGI24737J22298_10007452 3300001990 Bacteria 3694
13 JGI24737J22298_10032157 3300001990 Bacteria 1636
14 JGI24743J22301_10002329 3300001991 Bacteria 2840
15 JGI24743J22301_10015912 3300001991 Bacteria 1399
16 JGI24750J21931_1000888 3300002070 Bacteria 4093
17 JGI24745J21846_1000131 3300002073 Bacteria 5781
18 JGI24745J21846_1003092 3300002073 Bacteria 1727
19 JGI24748J21848_1002641 3300002074 Bacteria 2036
20 JGI24748J21848_1003474 3300002074 Bacteria 1798
21 JGI24738J21930_10000571 3300002075 Bacteria 10549
22 JGI24738J21930_10006136 3300002075 Bacteria 2840
23 JGI24749J21850_1000415 3300002076 Bacteria 6366
24 JGI24744J21845_10023343 3300002077 Unclassified 1212
25 JGI24035J26624_1000352 3300002126 Bacteria 4327
26 JGI24033J26618_1002920 3300002155 Bacteria 1779
27 JGI24033J26618_1004471 3300002155 Bacteria 1510
28 JGI24034J26672_10001326 3300002239 Bacteria 3265
29 JGI24034J26672_10003461 3300002239 Bacteria 2203
30 JGI24742J22300_10000080 3300002244 Bacteria 13750
31 JGI24742J22300_10000818 3300002244 Bacteria 4752
32 JGI24751J29686_10002106 3300002459 Bacteria 4036
33 JGI24751J29686_10008295 3300002459 Bacteria 2126
34 JGI25405J52794_10001034 3300003911 Bacteria 4422
35 JGI25405J52794_10001779 3300003911 Bacteria 3602
36 JGI25405J52794_10005107 3300003911 Bacteria 2358
37 Ga0065704_10097323 3300005289 Bacteria 2400
38 Ga0065712_10107228 3300005290 Bacteria 1900
39 Ga0065715_10089280 3300005293 Bacteria 11642
40 Ga0065707_10118788 3300005295 Bacteria 2177
41 Ga0070658_10033486 3300005327 Bacteria 4134
42 Ga0070676_10000128 3300005328 Bacteria 28446
43 Ga0070683_100000289 3300005329 Bacteria 34698
44 Ga0070690_100000935 3300005330 Bacteria 14900
45 Ga0070670_100003173 3300005331 Bacteria 13581
46 Ga0070670_100005011 3300005331 Bacteria 11141
47 Ga0070670_100261240 3300005331 Bacteria 1509
48 Ga0070677_10000043 3300005333 Bacteria 39363
49 Ga0068869_100000289 3300005334 Bacteria 26851
50 Ga0068869_100050329 3300005334 Bacteria 3019
51 Ga0070666_10008412 3300005335 Bacteria 6407
52 Ga0070666_10065397 3300005335 Bacteria 2468
53 Ga0070680_100002347 3300005336 Bacteria 13977
54 Ga0070680_100008016 3300005336 Bacteria 8065
55 Ga0070680_100009986 3300005336 Bacteria 7311
56 Ga0070682_100000528 3300005337 Bacteria 23870
57 Ga0070682_100033183 3300005337 Bacteria 3135
58 Ga0070682_100089879 3300005337 Bacteria 2007
59 Ga0070682_100133225 3300005337 Bacteria 1684
60 Ga0068868_100000408 3300005338 Bacteria 29034
61 Ga0068868_100009197 3300005338 Bacteria 7097
62 Ga0070660_100000182 3300005339 Bacteria 41532
63 Ga0070660_100010085 3300005339 Bacteria 6665
64 Ga0070660_100080505 3300005339 Bacteria 2556
65 Ga0070660_100109897 3300005339 Bacteria 2192
66 Ga0070689_100000819 3300005340 Bacteria 19235
67 Ga0070689_100015827 3300005340 Bacteria 5510
68 Ga0070689_100044473 3300005340 Bacteria 3416
69 Ga0070691_10027149 3300005341 Bacteria 2670
70 Ga0070691_10044359 3300005341 Bacteria 2108
71 Ga0070687_100000689 3300005343 Bacteria 11282
72 Ga0070687_100028693 3300005343 Bacteria 2701
73 Ga0070661_100000314 3300005344 Bacteria 39090
74 Ga0070661_100043660 3300005344 Bacteria 3275
75 Ga0070692_10000310 3300005345 Bacteria 13896
76 Ga0070692_10023477 3300005345 Bacteria 3023
77 Ga0070692_10100899 3300005345 Bacteria 1582
78 Ga0070668_100000857 3300005347 Bacteria 21127
79 Ga0070668_100204345 3300005347 Bacteria 1623
80 Ga0070669_100002719 3300005353 Bacteria 12760
81 Ga0070669_100094670 3300005353 Bacteria 2245
82 Ga0070669_100098959 3300005353 Bacteria 2197
83 Ga0070675_100002240 3300005354 Bacteria 14349
84 Ga0070675_100020607 3300005354 Bacteria 5261
85 Ga0070671_100000598 3300005355 Bacteria 25820
86 Ga0070671_100003710 3300005355 Bacteria 11986
87 Ga0070671_100350004 3300005355 Bacteria 1261
88 Ga0070674_100002210 3300005356 Bacteria 10703
89 Ga0070674_100030183 3300005356 Bacteria 3579
90 Ga0070673_100000289 3300005364 Bacteria 26187
91 Ga0070673_100006328 3300005364 Bacteria 7691
92 Ga0070673_100067543 3300005364 Bacteria 2859
93 Ga0070688_100000189 3300005365 Bacteria 32631
94 Ga0070688_100011824 3300005365 Bacteria 4867
95 Ga0070659_100003195 3300005366 Bacteria 11664
96 Ga0070659_100009819 3300005366 Bacteria 7036
97 Ga0070659_100149780 3300005366 Bacteria 1903
98 Ga0070667_100000436 3300005367 Bacteria 43897
99 Ga0070667_100293204 3300005367 Bacteria 1463
100 Ga0070709_10017043 3300005434 Bacteria 4159
101 Ga0070709_10052528 3300005434 Bacteria 2562
102 Ga0070709_10082081 3300005434 Bacteria 2105
103 Ga0070714_100033561 3300005435 Bacteria 4291
104 Ga0070714_100124125 3300005435 Bacteria 2300
105 Ga0070714_100152032 3300005435 Bacteria 2087
106 Ga0070714_100286450 3300005435 Bacteria 1532
107 Ga0070713_100002527 3300005436 Bacteria 11956
108 Ga0070713_100003602 3300005436 Bacteria 10235
109 Ga0070713_100108419 3300005436 Bacteria 2418
110 Ga0070713_100115527 3300005436 Bacteria 2346
111 Ga0070713_100199378 3300005436 Bacteria 1807
112 Ga0070713_100285432 3300005436 Bacteria 1515
113 Ga0070710_10001160 3300005437 Bacteria 12470
114 Ga0070710_10095497 3300005437 Bacteria 1761
115 Ga0070701_10000608 3300005438 Bacteria 12508
116 Ga0070711_100001742 3300005439 Bacteria 12081
117 Ga0070705_100000781 3300005440 Bacteria 17954
118 Ga0070700_100001610 3300005441 Bacteria 11254
119 Ga0070700_100004962 3300005441 Bacteria 7003
120 Ga0070694_100001837 3300005444 Bacteria 12570
121 Ga0070694_100025113 3300005444 Bacteria 3853
122 Ga0070708_100038491 3300005445 Bacteria 4178
123 Ga0070708_100323976 3300005445 Bacteria 1452
124 Ga0070663_100000297 3300005455 Bacteria 25442
125 Ga0070678_100001856 3300005456 Bacteria 11388
126 Ga0070662_100011992 3300005457 Bacteria 5734
127 Ga0070662_100075885 3300005457 Bacteria 2490
128 Ga0070681_10005077 3300005458 Bacteria 12699
129 Ga0070681_10041223 3300005458 Bacteria 4626
130 Ga0070681_10048091 3300005458 Bacteria 4263
131 Ga0070681_10110421 3300005458 Bacteria 2689
132 Ga0068867_100003318 3300005459 Bacteria 11338
133 Ga0070685_10001152 3300005466 Bacteria 14147
134 Ga0070685_10003091 3300005466 Bacteria 8464
135 Ga0070679_100003016 3300005530 Bacteria 15378
136 Ga0070684_100002293 3300005535 Bacteria 14101
137 Ga0070684_100089245 3300005535 Bacteria 2740
138 Ga0068853_100011439 3300005539 Bacteria 7210
139 Ga0070672_100000106 3300005543 Bacteria 41858
140 Ga0070686_100000615 3300005544 Bacteria 20904
141 Ga0070686_100075821 3300005544 Bacteria 2213
142 Ga0070695_100001248 3300005545 Bacteria 13985
143 Ga0070695_100008461 3300005545 Bacteria 6104
144 Ga0070696_100024338 3300005546 Bacteria 4115
145 Ga0070696_100091614 3300005546 Bacteria 2165
146 Ga0070693_100001863 3300005547 Bacteria 9633
147 Ga0070665_100102019 3300005548 Bacteria 2873
148 Ga0070665_100213106 3300005548 Bacteria 1932
149 Ga0070704_100004061 3300005549 Bacteria 8447
150 Ga0070704_100035204 3300005549 Bacteria 3402
151 Ga0070704_100056522 3300005549 Bacteria 2786
152 Ga0068855_100032491 3300005563 Bacteria 6231
153 Ga0068855_100149552 3300005563 Bacteria 2655
154 Ga0068855_100156764 3300005563 Bacteria 2586
155 Ga0068855_100308129 3300005563 Bacteria 1752
156 Ga0070664_100009338 3300005564 Bacteria 7954
157 Ga0068857_100000047 3300005577 Bacteria 67784
158 Ga0068854_100003161 3300005578 Bacteria 10266
159 Ga0068854_100154713 3300005578 Bacteria 1771
160 Ga0068856_100001905 3300005614 Bacteria 21761
161 Ga0068856_100239367 3300005614 Bacteria 1830
162 Ga0070702_100001524 3300005615 Bacteria 9532
163 Ga0068852_100003513 3300005616 Bacteria 10963
164 Ga0068852_100219695 3300005616 Bacteria 1807
165 Ga0068859_100005879 3300005617 Bacteria 12451
166 Ga0068859_100033546 3300005617 Bacteria 5155
167 Ga0068859_100050366 3300005617 Bacteria 4183
168 Ga0068864_100000931 3300005618 Bacteria 24535
169 Ga0068864_100017647 3300005618 Bacteria 5951
170 Ga0068864_100372351 3300005618 Bacteria 1352
171 Ga0068866_10000077 3300005718 Bacteria 39340
172 Ga0068861_100004701 3300005719 Bacteria 9180
173 Ga0068861_100015325 3300005719 Bacteria 5399
174 Ga0068870_10000037 3300005840 Bacteria 42069
175 Ga0068863_100000543 3300005841 Bacteria 38366
176 Ga0068863_100008217 3300005841 Bacteria 10200
177 Ga0068858_100002073 3300005842 Bacteria 20401
178 Ga0068860_100006167 3300005843 Bacteria 12056
179 Ga0068860_100059322 3300005843 Bacteria 3638
180 Ga0068862_100000879 3300005844 Bacteria 29265
181 Ga0068862_100009120 3300005844 Bacteria 8212
182 Ga0068862_100056257 3300005844 Bacteria 3370
183 Ga0081455_10000007 3300005937 Bacteria 269394
184 Ga0081455_10000843 3300005937 Bacteria 39506
185 Ga0081455_10006809 3300005937 Bacteria 12183
186 Ga0081455_10063432 3300005937 Bacteria 3101
187 Ga0081538_10005025 3300005981 Bacteria 12041
188 Ga0081540_1027425 3300005983 Bacteria 3227
189 Ga0081539_10029786 3300005985 Bacteria 3402
190 Ga0070717_10001206 3300006028 Bacteria 17517
191 Ga0070717_10106841 3300006028 Bacteria 2383
192 Ga0070717_10217610 3300006028 Bacteria 1678
193 Ga0075365_10015983 3300006038 Bacteria 4552
194 Ga0075365_10083924 3300006038 Bacteria 2161
195 Ga0075365_10171368 3300006038 Bacteria 1515
196 Ga0075368_10022942 3300006042 Bacteria 2379
197 Ga0075364_10052394 3300006051 Bacteria 2666
198 Ga0070715_10000686 3300006163 Bacteria 9073
199 Ga0070715_10038301 3300006163 Bacteria 1990
200 Ga0070715_10110303 3300006163 Bacteria 1297
201 Ga0070716_100052034 3300006173 Bacteria 2331
202 Ga0070712_100014104 3300006175 Bacteria 5125
203 Ga0070712_100112271 3300006175 Bacteria 2036
204 Ga0075367_10006217 3300006178 Bacteria 6014
205 Ga0075367_10024187 3300006178 Bacteria 3426
206 Ga0075367_10060999 3300006178 Bacteria 2250
207 Ga0075366_10000374 3300006195 Bacteria 20807
208 Ga0097621_100000416 3300006237 Bacteria 29698
209 Ga0097621_100342625 3300006237 Bacteria 1327
210 Ga0068871_100000249 3300006358 Bacteria 37516
211 Ga0068871_100102618 3300006358 Bacteria 2398
212 Ga0075428_100013293 3300006844 Bacteria 9159
213 Ga0075431_100000213 3300006847 Bacteria 42816
214 Ga0075431_100066837 3300006847 Bacteria 3711
215 Ga0075434_100003092 3300006871 Bacteria 14816
216 Ga0075434_100077211 3300006871 Bacteria 3326
217 Ga0075434_100345251 3300006871 Bacteria 1509
218 Ga0075429_100006031 3300006880 Bacteria 10478
219 Ga0075429_100116911 3300006880 Bacteria 2331
220 Ga0068865_100000248 3300006881 Bacteria 30110
221 Ga0068865_100004118 3300006881 Bacteria 8743
222 Ga0075436_100000751 3300006914 Bacteria 21452
223 Ga0075436_100113020 3300006914 Bacteria 1896
224 Ga0097620_100005879 3300006931 Bacteria 12451
225 Ga0097620_100033546 3300006931 Bacteria 5155
226 Ga0097620_100050366 3300006931 Bacteria 4183
227 Ga0075435_100073765 3300007076 Bacteria 2790
228 Ga0075435_100157435 3300007076 Bacteria 1912
229 Ga0099794_10004175 3300007265 Bacteria 5634
230 Ga0099795_10014352 3300007788 Bacteria 2455
231 Ga0105250_10061735 3300009092 Bacteria 1507
232 Ga0105240_10024910 3300009093 Bacteria 7876
233 Ga0105240_10025786 3300009093 Bacteria 7720
234 Ga0105240_10483041 3300009093 Bacteria 1381
235 Ga0111539_10002489 3300009094 Bacteria 24423
236 Ga0111539_10005685 3300009094 Bacteria 16136
237 Ga0111539_10011158 3300009094 Bacteria 11301
238 Ga0111539_10082090 3300009094 Bacteria 3791
239 Ga0111539_10279419 3300009094 Bacteria 1943
240 Ga0105245_10004150 3300009098 Bacteria 12870
241 Ga0105245_10022971 3300009098 Bacteria 5473
242 Ga0105245_10039806 3300009098 Bacteria 4184
243 Ga0105247_10000908 3300009101 Bacteria 22289
244 Ga0114129_10000685 3300009147 Bacteria 42795
245 Ga0114129_10000908 3300009147 Bacteria 38524
246 Ga0114129_10012397 3300009147 Bacteria 12135
247 Ga0114129_10052993 3300009147 Bacteria 5691
248 Ga0105243_10001705 3300009148 Bacteria 18936
249 Ga0105241_10002306 3300009174 Bacteria 14330
250 Ga0105242_10003502 3300009176 Bacteria 12201
251 Ga0105248_10005936 3300009177 Bacteria 13420
252 Ga0105248_10006377 3300009177 Bacteria 12945
253 Ga0105237_10022803 3300009545 Bacteria 6423
254 Ga0105237_10236043 3300009545 Bacteria 1830
255 Ga0105238_10024601 3300009551 Bacteria 6138
256 Ga0105249_10000476 3300009553 Bacteria 37263
257 Ga0105239_10007529 3300010375 Bacteria 12486
258 Ga0105239_10144699 3300010375 Bacteria 2650
259 Ga0105239_10188263 3300010375 Bacteria 2310
260 Ga0105246_10000057 3300011119 Bacteria 44951
261 Ga0157373_10028635 3300013100 Bacteria 4018
262 Ga0157369_10106869 3300013105 Bacteria 2978
263 Ga0157374_10004809 3300013296 Bacteria 11335
264 Ga0157374_10057989 3300013296 Bacteria 3618
265 Ga0157378_10006604 3300013297 Bacteria 10133
266 Ga0157378_10202383 3300013297 Bacteria 1878
267 Ga0163162_10001937 3300013306 Bacteria 19439
268 Ga0163162_10171848 3300013306 Bacteria 2292
269 Ga0157372_10009498 3300013307 Bacteria 10344
270 Ga0157375_10003994 3300013308 Bacteria 12794
271 Ga0157375_10048018 3300013308 Bacteria 4173
272 Ga0157375_10157230 3300013308 Bacteria 2413
273 Ga0163163_10003757 3300014325 Bacteria 12927
274 Ga0163163_10005510 3300014325 Bacteria 10957
275 Ga0163163_10069845 3300014325 Bacteria 3497
276 Ga0163163_10143863 3300014325 Bacteria 2427
277 Ga0157380_10002362 3300014326 Bacteria 12682
278 Ga0157380_10007960 3300014326 Bacteria 7549
279 Ga0157377_10001240 3300014745 Bacteria 10912
280 Ga0157377_10056448 3300014745 Bacteria 2230
281 Ga0157379_10000293 3300014968 Bacteria 39625
282 Ga0157379_10007214 3300014968 Bacteria 9616
283 Ga0157379_10174308 3300014968 Bacteria 1941
284 Ga0157376_10000531 3300014969 Bacteria 24495
285 Ga0163161_10000209 3300017792 Bacteria 53534
286 Ga0206354_10351988 3300020081 Bacteria 1302
287 Ga0213875_10001189 3300021388 Bacteria 17806
288 Ga0213875_10043382 3300021388 Bacteria 2113
289 Ga0224572_1001510 3300024225 Bacteria 3470
290 Ga0207666_1000011 3300025271 Bacteria 46553
291 Ga0207673_1000294 3300025290 Bacteria 5034
292 Ga0207697_10000044 3300025315 Bacteria 48337
293 Ga0207653_10004900 3300025885 Bacteria 4182
294 Ga0207682_10000260 3300025893 Bacteria 23782
295 Ga0207692_10000613 3300025898 Bacteria 12553
296 Ga0207642_10001373 3300025899 Bacteria 7553
297 Ga0207642_10010355 3300025899 Bacteria 3283
298 Ga0207710_10003110 3300025900 Bacteria 7435
299 Ga0207710_10009455 3300025900 Bacteria 4100
300 Ga0207688_10000717 3300025901 Bacteria 16422
301 Ga0207688_10000723 3300025901 Bacteria 16367
302 Ga0207680_10004972 3300025903 Bacteria 6331
303 Ga0207647_10008700 3300025904 Bacteria 7251
304 Ga0207647_10034325 3300025904 Bacteria 3240
305 Ga0207647_10063403 3300025904 Bacteria 2248
306 Ga0207685_10001855 3300025905 Bacteria 4631
307 Ga0207685_10037159 3300025905 Bacteria 1791
308 Ga0207699_10107067 3300025906 Bacteria 1785
309 Ga0207645_10000281 3300025907 Bacteria 42381
310 Ga0207645_10010774 3300025907 Bacteria 6268
311 Ga0207645_10040113 3300025907 Bacteria 2998
312 Ga0207643_10000012 3300025908 Bacteria 133318
313 Ga0207643_10001287 3300025908 Bacteria 14631
314 Ga0207705_10111615 3300025909 Bacteria 2021
315 Ga0207684_10112647 3300025910 Bacteria 2329
316 Ga0207684_10169945 3300025910 Bacteria 1879
317 Ga0207654_10002060 3300025911 Bacteria 10312
318 Ga0207707_10000551 3300025912 Bacteria 38020
319 Ga0207707_10070266 3300025912 Bacteria 3051
320 Ga0207671_10031487 3300025914 Bacteria 3952
321 Ga0207671_10056615 3300025914 Bacteria 2905
322 Ga0207693_10099274 3300025915 Bacteria 2283
323 Ga0207693_10129461 3300025915 Bacteria 1984
324 Ga0207663_10006436 3300025916 Bacteria 6008
325 Ga0207663_10034591 3300025916 Bacteria 3023
326 Ga0207660_10000992 3300025917 Bacteria 18816
327 Ga0207660_10016384 3300025917 Bacteria 4905
328 Ga0207660_10089349 3300025917 Bacteria 2280
329 Ga0207660_10124788 3300025917 Bacteria 1954
330 Ga0207662_10000123 3300025918 Bacteria 37327
331 Ga0207662_10005962 3300025918 Bacteria 6547
332 Ga0207662_10066520 3300025918 Bacteria 2171
333 Ga0207657_10000358 3300025919 Bacteria 48238
334 Ga0207657_10013894 3300025919 Bacteria 7879
335 Ga0207657_10032767 3300025919 Bacteria 4690
336 Ga0207657_10072501 3300025919 Bacteria 2913
337 Ga0207649_10000545 3300025920 Bacteria 26032
338 Ga0207649_10155957 3300025920 Bacteria 1577
339 Ga0207652_10004318 3300025921 Bacteria 11589
340 Ga0207652_10072131 3300025921 Bacteria 3002
341 Ga0207652_10079520 3300025921 Bacteria 2864
342 Ga0207652_10118809 3300025921 Bacteria 2350
343 Ga0207681_10000286 3300025923 Bacteria 37397
344 Ga0207681_10240093 3300025923 Bacteria 1410
345 Ga0207650_10006950 3300025925 Bacteria 7716
346 Ga0207650_10079759 3300025925 Bacteria 2480
347 Ga0207650_10222435 3300025925 Bacteria 1520
348 Ga0207659_10000023 3300025926 Bacteria 142947
349 Ga0207659_10005686 3300025926 Bacteria 7588
350 Ga0207687_10000149 3300025927 Bacteria 46713
351 Ga0207687_10011780 3300025927 Bacteria 5721
352 Ga0207700_10029405 3300025928 Bacteria 3877
353 Ga0207664_10025759 3300025929 Bacteria 4436
354 Ga0207644_10000724 3300025931 Bacteria 20908
355 Ga0207644_10007078 3300025931 Bacteria 7312
356 Ga0207644_10012722 3300025931 Bacteria 5595
357 Ga0207644_10214303 3300025931 Bacteria 1524
358 Ga0207690_10000203 3300025932 Bacteria 46451
359 Ga0207690_10035633 3300025932 Bacteria 3216
360 Ga0207706_10001347 3300025933 Bacteria 24537
361 Ga0207706_10002188 3300025933 Bacteria 19056
362 Ga0207686_10007108 3300025934 Bacteria 6023
363 Ga0207709_10000607 3300025935 Bacteria 29669
364 Ga0207670_10000125 3300025936 Bacteria 50796
365 Ga0207670_10033086 3300025936 Bacteria 3329
366 Ga0207670_10269436 3300025936 Bacteria 1323
367 Ga0207669_10000357 3300025937 Bacteria 20792
368 Ga0207669_10019383 3300025937 Bacteria 3540
369 Ga0207704_10001003 3300025938 Bacteria 12514
370 Ga0207665_10021414 3300025939 Bacteria 4251
371 Ga0207665_10060707 3300025939 Bacteria 2561
372 Ga0207691_10000256 3300025940 Bacteria 52748
373 Ga0207691_10001091 3300025940 Bacteria 26989
374 Ga0207691_10092172 3300025940 Bacteria 2713
375 Ga0207711_10035444 3300025941 Bacteria 4229
376 Ga0207689_10000008 3300025942 Bacteria 127942
377 Ga0207689_10063168 3300025942 Bacteria 3046
378 Ga0207661_10000104 3300025944 Bacteria 53977
379 Ga0207661_10022650 3300025944 Bacteria 4736
380 Ga0207679_10000196 3300025945 Bacteria 48433
381 Ga0207679_10020897 3300025945 Bacteria 4428
382 Ga0207679_10201263 3300025945 Bacteria 1663
383 Ga0207667_10023002 3300025949 Bacteria 6871
384 Ga0207667_10284618 3300025949 Bacteria 1689
385 Ga0207651_10001000 3300025960 Bacteria 12479
386 Ga0207651_10015133 3300025960 Bacteria 4474
387 Ga0207712_10000967 3300025961 Bacteria 20676
388 Ga0207712_10013794 3300025961 Bacteria 5184
389 Ga0207668_10070301 3300025972 Bacteria 2495
390 Ga0207640_10000157 3300025981 Bacteria 49126
391 Ga0207640_10023741 3300025981 Bacteria 3690
392 Ga0207640_10284922 3300025981 Bacteria 1300
393 Ga0207658_10036309 3300025986 Bacteria 3532
394 Ga0207677_10000609 3300026023 Bacteria 22003
395 Ga0207677_10003120 3300026023 Bacteria 8746
396 Ga0207703_10003859 3300026035 Bacteria 12455
397 Ga0207639_10002440 3300026041 Bacteria 12492
398 Ga0207678_10004329 3300026067 Bacteria 12744
399 Ga0207678_10020490 3300026067 Bacteria 5797
400 Ga0207678_10100021 3300026067 Bacteria 2477
401 Ga0207678_10122078 3300026067 Bacteria 2223
402 Ga0207708_10002782 3300026075 Bacteria 12851
403 Ga0207708_10003027 3300026075 Bacteria 12394
404 Ga0207708_10336371 3300026075 Bacteria 1235
405 Ga0207702_10003955 3300026078 Bacteria 13300
406 Ga0207702_10041453 3300026078 Bacteria 3861
407 Ga0207702_10109740 3300026078 Bacteria 2450
408 Ga0207641_10002938 3300026088 Bacteria 15413
409 Ga0207648_10002628 3300026089 Bacteria 19224
410 Ga0207648_10005563 3300026089 Bacteria 12680
411 Ga0207648_10022367 3300026089 Bacteria 5680
412 Ga0207676_10003560 3300026095 Bacteria 11004
413 Ga0207676_10004603 3300026095 Bacteria 9767
414 Ga0207676_10149133 3300026095 Bacteria 2012
415 Ga0207674_10009174 3300026116 Bacteria 11343
416 Ga0207675_100000604 3300026118 Bacteria 35079
417 Ga0207675_100002508 3300026118 Bacteria 18169
418 Ga0207675_100407151 3300026118 Bacteria 1341
419 Ga0207683_10000006 3300026121 Bacteria 181260
420 Ga0207698_10000378 3300026142 Bacteria 25887
421 Ga0207698_10009646 3300026142 Bacteria 6164
422 Ga0207698_10195552 3300026142 Bacteria 1806
423 Ga0209984_1004221 3300027424 Bacteria 1684
424 Ga0209179_1000846 3300027512 Bacteria 3395
425 Ga0210002_1003918 3300027617 Bacteria 2208
426 Ga0209983_1006582 3300027665 Bacteria 2384
427 Ga0209998_10000566 3300027717 Bacteria 9989
428 Ga0209998_10001948 3300027717 Bacteria 4845
429 Ga0207428_10000165 3300027907 Bacteria 91701
430 Ga0207428_10000446 3300027907 Bacteria 50240
431 Ga0207428_10024147 3300027907 Bacteria 5106
432 Ga0207428_10081742 3300027907 Bacteria 2522
433 Ga0268266_10044658 3300028379 Bacteria 3788
434 Ga0268266_10054562 3300028379 Bacteria 3434
435 Ga0268266_10074462 3300028379 Bacteria 2948
436 Ga0268265_10001687 3300028380 Bacteria 18006
437 Ga0268265_10246208 3300028380 Bacteria 1580
438 Ga0268264_10002029 3300028381 Bacteria 18124
439 Ga0268264_10008544 3300028381 Bacteria 8512
440 Ga0265338_10012007 3300028800 Bacteria 9915
441 Ga0265338_10030503 3300028800 Bacteria 5310
442 Ga0265763_1000140 3300030763 Bacteria 3577
443 Ga0265760_10052991 3300031090 Bacteria 1224
444 Ga0265330_10022632 3300031235 Bacteria 2859
445 Ga0265328_10002945 3300031239 Bacteria 7599
446 Ga0265325_10009739 3300031241 Bacteria 5601
447 Ga0265325_10012475 3300031241 Bacteria 4859
448 Ga0265325_10021595 3300031241 Bacteria 3533
449 Ga0265325_10093896 3300031241 Bacteria 1476
450 Ga0265339_10004883 3300031249 Bacteria 9048
451 Ga0265313_10000069 3300031595 Bacteria 100065
452 Ga0265313_10000794 3300031595 Bacteria 31959
453 Ga0265313_10004781 3300031595 Bacteria 10206
454 Ga0265313_10011241 3300031595 Bacteria 5579
455 Ga0316579_10017096 3300031691 Bacteria 3178
456 Ga0265314_10005328 3300031711 Bacteria 11638
457 Ga0265314_10130253 3300031711 Bacteria 1570
458 Ga0265342_10000502 3300031712 Bacteria 41908
459 Ga0373930_0000066 3300034816 Bacteria 10144
460 Ga0373948_0000581 3300034817 Bacteria 4666
461 Ga0373950_0003960 3300034818 Bacteria 2151
462 Ga0373958_0000149 3300034819 Bacteria 7846
463 Ga0373959_0000484 3300034820 Bacteria 7248
464 Ga0373959_0001824 3300034820 Bacteria 3397
465 Ga0373938_0000806 3300034957 Bacteria 5081
466 Ga0373926_0006406 3300035083 Bacteria 3911
467 Ga0373928_0000912 3300035084 Bacteria 5781
468 Ga0373928_0003692 3300035084 Bacteria 2919
469 Ga0373929_0000596 3300035085 Bacteria 6986
470 Ga0373929_0001194 3300035085 Bacteria 5028
471 Ga0373940_0000711 3300035088 Bacteria 5398
472 Ga0373949_0001224 3300035090 Bacteria 7585
473 Ga0373949_0001578 3300035090 Bacteria 6424
474 Ga0373951_0000469 3300035091 Bacteria 11565
475 Ga0373951_0000642 3300035091 Bacteria 9641
476 Ga0373952_0000323 3300035092 Bacteria 8035
477 Ga0373952_0001223 3300035092 Bacteria 4674
478 Ga0373923_0000600 3300035111 Bacteria 8962
479 Ga0373923_0034016 3300035111 Bacteria 2067
480 Ga0373932_0000757 3300035112 Bacteria 9626
481 Ga0373932_0001683 3300035112 Bacteria 6030
482 Ga0373936_0000140 3300035113 Bacteria 25032
483 Ga0373936_0078699 3300035113 Bacteria 1369
484 Ga0373941_0000083 3300035115 Bacteria 15466
485 Ga0373941_0007438 3300035115 Bacteria 2679
486 Ga0373945_0004242 3300035116 Bacteria 4544
487 Ga0373945_0005199 3300035116 Bacteria 4159
488 Ga0373953_0002635 3300035117 Bacteria 5432
489 Ga0373954_0020918 3300035118 Bacteria 2961
490 Ga0373956_0008031 3300035119 Bacteria 4265
491 Ga0373956_0114562 3300035119 Bacteria 1256
492 Ga0373957_0091532 3300035120 Bacteria 1209
493 Ga0373960_0000185 3300035121 Bacteria 11147
494 Ga0373960_0000330 3300035121 Bacteria 9027
495 Ga0373943_0000723 3300035170 Bacteria 14457
496 Ga0373943_0005802 3300035170 Bacteria 5546
497 Ga0373943_0009931 3300035170 Bacteria 4266
498 Ga0373943_0087965 3300035170 Bacteria 1604
499 Ga0373946_0001669 3300035171 Bacteria 7732
500 Ga0373946_0001730 3300035171 Bacteria 7613
501 Ga0373955_0000121 3300035172 Bacteria 31151
502 Ga0373955_0024471 3300035172 Bacteria 3089
503 Ga0373955_0110807 3300035172 Bacteria 1587
504 Ga0373942_0001462 3300035207 Bacteria 6070
505 Ga0373942_0003399 3300035207 Bacteria 3741
506 Ga0373961_0000569 3300035241 Bacteria 13935
507 Ga0373962_0000149 3300035242 Bacteria 14459
508 Ga0373924_0000521 3300035410 Bacteria 11807
509 Ga0373924_0019444 3300035410 Bacteria 2631
510 Ga0373924_0057262 3300035410 Bacteria 1625
511 Ga0373931_0002244 3300035691 Bacteria 8538
512 Ga0373931_0061116 3300035691 Bacteria 2031
513 Ga0373931_0071457 3300035691 Bacteria 1896
514 Ga0373935_0024273 3300035692 Bacteria 3731
515 Ga0373935_0030967 3300035692 Bacteria 3317
516 Ga0373935_0046183 3300035692 Bacteria 2750
517 Ga0373935_0211080 3300035692 Bacteria 1345
518 Ga0373927_0001763 3300035695 Bacteria 16150
519 Ga0373927_0021556 3300035695 Bacteria 4223
520 Ga0373927_0023719 3300035695 Bacteria 4016
521 Ga0373927_0030831 3300035695 Bacteria 3498
522 Ga0373933_0001004 3300035724 Bacteria 17169
523 Ga0373933_0015592 3300035724 Bacteria 4237
524 Ga0373933_0087115 3300035724 Bacteria 1923
525 Ga0373947_0001341 3300035725 Bacteria 15139
526 Ga0373947_0005612 3300035725 Bacteria 7318
527 Ga0373947_0006555 3300035725 Bacteria 6753
528 Ga0373947_0031905 3300035725 Bacteria 3103
529 Ga0373947_0041783 3300035725 Bacteria 2736
530 Ga0373947_0044632 3300035725 Bacteria 2650
531 Ga0373947_0054692 3300035725 Bacteria 2409
532 Ga0373947_0111980 3300035725 Bacteria 1726
533 Ga0373937_0001420 3300036401 Bacteria 19998
534 Ga0373937_0002850 3300036401 Bacteria 14440
535 Ga0373937_0104592 3300036401 Bacteria 2630
536 Ga0373925_0000016 3300037068 Bacteria 176830
537 Ga0373925_0001095 3300037068 Bacteria 24265
538 Ga0373925_0123614 3300037068 Bacteria 2011
539 Ga0395900_0001539 3300037418 Bacteria 27389
540 Ga0395900_0075561 3300037418 Bacteria 3464
541 Ga0395898_0013503 3300037466 Bacteria 8409
542 Ga0395898_0024475 3300037466 Bacteria 6090
543 Ga0395898_0036924 3300037466 Bacteria 4849
544 Ga0436364_0170641 3300037853 Bacteria 30786
545 Ga0436364_1548064 3300037853 Bacteria 2419
546 Ga0395901_0027121 3300038443 Bacteria 5883
547 Ga0439441_007620 3300042001 Bacteria 1750
548 Ga0451577_0134237 3300042876 Bacteria 2222
549 Ga0466963_0138338 3300044694 Bacteria 1686
550 Ga0466968_0003779 3300044735 Bacteria 5610
551 Ga0466957_0008459 3300044842 Bacteria 5853
552 Ga0466959_0090981 3300045049 Bacteria 2191
553 Ga0466958_0026576 3300045836 Bacteria 3422
554 Ga0466967_0007437 3300045976 Bacteria 7900
555 Ga0466967_0354484 3300045976 Bacteria 1421
556 Ga0495592_0000044 3300046454 Bacteria 118749
557 Ga0495592_0036712 3300046454 Bacteria 3689
558 Ga0495629_0000798 3300046459 Bacteria 25474
559 Ga0495629_0004823 3300046459 Bacteria 10120
560 Ga0495641_0019161 3300046461 Bacteria 3510
561 Ga0495651_0000702 3300046462 Bacteria 26046
562 Ga0495651_0004981 3300046462 Bacteria 10147
563 Ga0495653_0000022 3300046463 Bacteria 169653
564 Ga0495653_0064111 3300046463 Bacteria 2769
565 Ga0495582_0016959 3300046473 Bacteria 3988
566 Ga0495582_0070011 3300046473 Bacteria 1940
567 Ga0495639_0026504 3300046475 Bacteria 2562
568 Ga0495662_0004014 3300046476 Bacteria 7415
569 Ga0495664_0000013 3300046477 Bacteria 204282
570 Ga0495664_0016952 3300046477 Bacteria 4160
571 Ga0495664_0159783 3300046477 Bacteria 1367
572 Ga0495584_0021641 3300046491 Bacteria 3266
573 Ga0495594_0073564 3300046499 Bacteria 1902
574 Ga0495608_0000004 3300046511 Bacteria 355027
575 Ga0495618_0000032 3300046514 Bacteria 104874
576 Ga0495618_0010451 3300046514 Bacteria 5614
577 Ga0495618_0056603 3300046514 Bacteria 2482
578 Ga0495618_0081759 3300046514 Bacteria 2063
579 Ga0495628_0000014 3300046516 Bacteria 205818
580 Ga0495628_0098574 3300046516 Bacteria 2257
581 Ga0495630_0006343 3300046517 Bacteria 8404
582 Ga0495630_0011540 3300046517 Bacteria 6397
583 Ga0495630_0208308 3300046517 Bacteria 1492
584 Ga0495666_0068797 3300046526 Bacteria 1685
585 Ga0495652_0000002 3300046529 Bacteria 946606
586 Ga0495652_0060214 3300046529 Bacteria 3209
587 Ga0495665_0048847 3300046531 Bacteria 2243
588 Ga0495640_0000001 3300046533 Bacteria 853827
589 Ga0495640_0005848 3300046533 Bacteria 9762
590 Ga0495640_0040037 3300046533 Bacteria 3284
591 Ga0495640_0093148 3300046533 Bacteria 1986
592 Ga0495586_0083366 3300046535 Bacteria 1759
593 Ga0495587_0000004 3300046536 Bacteria 358433
594 Ga0495587_0004639 3300046536 Bacteria 9033
595 Ga0495587_0115167 3300046536 Bacteria 1542
596 Ga0495609_0077875 3300046538 Bacteria 1451
597 Ga0495645_0000001 3300046543 Bacteria 657910
598 Ga0495645_0012073 3300046543 Bacteria 6087
599 Ga0495667_0000009 3300046559 Bacteria 223329
600 Ga0495667_0000967 3300046559 Bacteria 18583
601 Ga0495656_0037389 3300046615 Bacteria 2005
602 Ga0495634_0000033 3300046642 Bacteria 109811
603 Ga0495634_0006572 3300046642 Bacteria 8822
604 Ga0495634_0030799 3300046642 Bacteria 3700
605 Ga0495625_0086286 3300046660 Bacteria 2178
606 Ga0495635_0000003 3300046663 Bacteria 390055
607 Ga0495635_0010576 3300046663 Bacteria 6459
608 Ga0495657_0000342 3300046675 Bacteria 43000
609 Ga0495657_0121908 3300046675 Bacteria 1641
610 Ga0495599_0000030 3300046678 Bacteria 113715
611 Ga0495623_0000059 3300046679 Bacteria 67952
612 Ga0495623_0004459 3300046679 Bacteria 9191
613 Ga0495623_0008559 3300046679 Bacteria 6644
614 Ga0495646_0000031 3300046680 Bacteria 87445
615 Ga0495646_0005451 3300046680 Bacteria 8044
616 Ga0495658_0008450 3300046683 Bacteria 5102
617 Ga0495658_0035108 3300046683 Bacteria 2756
618 Ga0495658_0037237 3300046683 Bacteria 2688
619 Ga0495658_0124924 3300046683 Bacteria 1560
620 Ga0495613_0041141 3300046689 Bacteria 3423
621 Ga0495613_0058832 3300046689 Bacteria 2819
622 Ga0495613_0090427 3300046689 Bacteria 2217
623 Ga0495624_0009592 3300046690 Bacteria 6702
624 Ga0495624_0182624 3300046690 Bacteria 1278
625 Ga0495600_0000141 3300046809 Bacteria 41270
626 Ga0495581_0006241 3300047315 Bacteria 6912
627 Ga0495604_0000002 3300047317 Bacteria 530904
628 Ga0495604_0000619 3300047317 Bacteria 30531
629 Ga0495604_0028575 3300047317 Bacteria 4437
630 Ga0495604_0034208 3300047317 Bacteria 4022
631 Ga0495674_0000004 3300047319 Bacteria 531855
632 Ga0495674_0000575 3300047319 Bacteria 34286
633 Ga0495674_0024950 3300047319 Bacteria 5487
634 Ga0495674_0200114 3300047319 Bacteria 1657
635 Ga0495676_0079119 3300047321 Bacteria 2500
636 Ga0495680_0000481 3300047322 Bacteria 44868
637 Ga0495680_0008522 3300047322 Bacteria 9314
638 Ga0495675_0000048 3300047444 Bacteria 81486
639 Ga0495684_0000019 3300047471 Bacteria 153938
640 Ga0495684_0123805 3300047471 Bacteria 1946
641 Ga0495593_0000511 3300047673 Bacteria 21936
642 Ga0495593_0027144 3300047673 Bacteria 3154
643 Ga0495602_0000001 3300048088 Bacteria 510904
644 Ga0495602_0013129 3300048088 Bacteria 8473
645 Ga0495602_0084401 3300048088 Bacteria 2657
646 Ga0496100_0000610 3300048903 Bacteria 16923
647 Ga0496100_0006059 3300048903 Bacteria 6568
648 Ga0496100_0223614 3300048903 Bacteria 1382
649 Ga0496101_0000464 3300048904 Bacteria 25674
650 Ga0496101_0012807 3300048904 Bacteria 5608
651 Ga0496101_0037886 3300048904 Bacteria 3422
652 Ga0496101_0049295 3300048904 Bacteria 3029
653 Ga0496101_0074666 3300048904 Bacteria 2494
654 Ga0496102_0001120 3300048905 Bacteria 24582
655 Ga0496102_0017419 3300048905 Bacteria 6294
656 Ga0496102_0023365 3300048905 Bacteria 5490
657 Ga0496102_0065495 3300048905 Bacteria 3330
658 Ga0496102_0334518 3300048905 Bacteria 1426
659 Ga0496102_0397449 3300048905 Bacteria 1296
660 Ga0496103_0000611 3300048906 Bacteria 27883
661 Ga0496103_0002918 3300048906 Bacteria 10604
662 Ga0496103_0046347 3300048906 Bacteria 2684
663 Ga0496104_0001156 3300048907 Bacteria 22621
664 Ga0496104_0003012 3300048907 Bacteria 14510
665 Ga0496104_0029606 3300048907 Bacteria 5079
666 Ga0496105_0004387 3300048908 Bacteria 10622
667 Ga0496105_0032636 3300048908 Bacteria 4274
668 Ga0496105_0053941 3300048908 Bacteria 3320
669 Ga0496106_0000481 3300048909 Bacteria 28369
670 Ga0496106_0000541 3300048909 Bacteria 26824
671 Ga0496106_0059385 3300048909 Bacteria 2897
672 Ga0496106_0060089 3300048909 Bacteria 2880
673 Ga0496106_0073625 3300048909 Bacteria 2613
674 Ga0496107_0002295 3300048910 Bacteria 12344
675 Ga0496107_0005580 3300048910 Bacteria 8618
676 Ga0496107_0097140 3300048910 Bacteria 2156
677 Ga0496108_0001251 3300048911 Bacteria 19871
678 Ga0496108_0007993 3300048911 Bacteria 8579
679 Ga0496108_0023781 3300048911 Bacteria 5042
680 Ga0496108_0137277 3300048911 Bacteria 2105
681 Ga0496108_0258755 3300048911 Bacteria 1514
682 Ga0496109_0003885 3300048912 Bacteria 12475
683 Ga0496109_0008609 3300048912 Bacteria 8685
684 Ga0496109_0024306 3300048912 Bacteria 5386
685 Ga0496109_0037781 3300048912 Bacteria 4363
686 Ga0496109_0049834 3300048912 Bacteria 3813
687 Ga0496109_0201950 3300048912 Bacteria 1869
688 Ga0496109_0328789 3300048912 Bacteria 1443
689 Ga0496110_0013043 3300048913 Bacteria 6855
690 Ga0496110_0016839 3300048913 Bacteria 6108
691 Ga0496110_0023634 3300048913 Bacteria 5229
692 Ga0496110_0047895 3300048913 Bacteria 3745
693 Ga0496110_0291398 3300048913 Bacteria 1486
694 Ga0496111_0006454 3300048914 Bacteria 7618
695 Ga0496111_0008573 3300048914 Bacteria 6773
696 Ga0496111_0016437 3300048914 Bacteria 5097
697 Ga0496111_0067464 3300048914 Bacteria 2599
698 Ga0496111_0081003 3300048914 Bacteria 2369
699 Ga0496112_0009148 3300048915 Bacteria 8899
700 Ga0496112_0022787 3300048915 Bacteria 5975
701 Ga0496112_0035817 3300048915 Bacteria 4837
702 Ga0496112_0170603 3300048915 Bacteria 2141
703 Ga0496112_0276674 3300048915 Bacteria 1626
704 Ga0496112_0328433 3300048915 Bacteria 1473
705 Ga0496113_0001441 3300048916 Bacteria 13217
706 Ga0496113_0013130 3300048916 Bacteria 5594
707 Ga0496114_0005881 3300048917 Bacteria 9642
708 Ga0496114_0006370 3300048917 Bacteria 9287
709 Ga0496114_0019321 3300048917 Bacteria 5520
710 Ga0496114_0023227 3300048917 Bacteria 5059
711 Ga0496114_0098648 3300048917 Bacteria 2491
712 Ga0496114_0296429 3300048917 Bacteria 1427
713 Ga0496115_0004336 3300048918 Bacteria 10266
714 Ga0496115_0009733 3300048918 Bacteria 7158
715 Ga0496115_0010227 3300048918 Bacteria 7001
716 Ga0496115_0012138 3300048918 Bacteria 6479
717 Ga0496115_0030482 3300048918 Bacteria 4243
718 Ga0496115_0168699 3300048918 Bacteria 1810
719 Ga0501032_0007222 3300049569 Bacteria 8127
720 Ga0501033_0043907 3300049570 Bacteria 3327
721 Ga0501034_0032378 3300049571 Bacteria 5310
722 Ga0501034_0033286 3300049571 Bacteria 5230
723 Ga0501036_0001657 3300049572 Bacteria 17249
724 Ga0501036_0006781 3300049572 Bacteria 9302
725 Ga0501036_0024249 3300049572 Bacteria 5113
726 Ga0501037_0009558 3300049573 Bacteria 7118
727 Ga0501038_0011889 3300049574 Bacteria 7944
728 Ga0501038_0040577 3300049574 Bacteria 4063
729 Ga0501039_0340307 3300049575 Bacteria 1179
730 Ga0501043_0002225 3300049579 Bacteria 16540
731 Ga0501043_0072709 3300049579 Bacteria 2701
732 Ga0501046_0015198 3300049580 Bacteria 6473
733 Ga0501046_0055276 3300049580 Bacteria 3121
734 Ga0501047_0000314 3300049581 Bacteria 55906
735 Ga0501047_0036499 3300049581 Bacteria 4750
736 Ga0501047_0067324 3300049581 Bacteria 3451
737 Ga0501047_0074843 3300049581 Bacteria 3260
738 Ga0501047_0105953 3300049581 Bacteria 2692
739 Ga0501048_0002000 3300049582 Bacteria 15488
740 Ga0501048_0152016 3300049582 Bacteria 1638
741 Ga0501069_0005233 3300049585 Bacteria 6740
742 Ga0501070_0007677 3300049586 Bacteria 9150
743 Ga0501070_0008242 3300049586 Bacteria 8811
744 Ga0501070_0036638 3300049586 Bacteria 4096
745 Ga0501070_0120289 3300049586 Bacteria 2170
746 Ga0501070_0179273 3300049586 Bacteria 1744
747 Ga0501070_0187341 3300049586 Bacteria 1702
748 Ga0501071_0092413 3300049587 Bacteria 2224
749 Ga0501073_0021006 3300049589 Bacteria 4710
750 Ga0501073_0029354 3300049589 Bacteria 3931
751 Ga0501073_0151284 3300049589 Bacteria 1609
752 Ga0501074_0012343 3300049590 Bacteria 6210
753 Ga0501076_0037276 3300049592 Bacteria 3812
754 Ga0501077_0027575 3300049593 Bacteria 3606
755 Ga0501077_0090573 3300049593 Bacteria 1938
756 Ga0501079_0017339 3300049741 Bacteria 5499
757 Ga0501080_0005419 3300049742 Bacteria 11382
758 Ga0501080_0107373 3300049742 Bacteria 2587
759 Ga0501080_0174281 3300049742 Bacteria 1982
760 Ga0501081_0063257 3300049743 Bacteria 2568
761 Ga0501083_0001743 3300049744 Bacteria 14830
762 Ga0501083_0146733 3300049744 Bacteria 1545
763 Ga0501035_0000896 3300049822 Bacteria 31485
764 Ga0501035_0008967 3300049822 Bacteria 9304
765 Ga0501035_0097360 3300049822 Bacteria 2584
766 Ga0501044_0018297 3300049823 Bacteria 7508
767 Ga0501044_0029583 3300049823 Bacteria 5774
768 Ga0501044_0052167 3300049823 Bacteria 4215
769 Ga0501044_0068384 3300049823 Bacteria 3618
770 Ga0501044_0116445 3300049823 Bacteria 2678
771 Ga0501044_0163405 3300049823 Bacteria 2202
772 Ga0501044_0445252 3300049823 Bacteria 1203
773 nmdc:mga03683_14002_c1 3300050489 Bacteria 2960
774 nmdc:mga00v17_64993_c1 3300050491 Bacteria 2249
775 nmdc:mga0yw44_19513_c1 3300050492 Bacteria 3741
776 nmdc:mga0yw44_24505_c1 3300050492 Bacteria 3416
777 nmdc:mga0yw44_40242_c1 3300050492 Bacteria 1705
778 nmdc:mga0yw44_87501_c1 3300050492 Bacteria 1964
779 nmdc:mga06z11_168866_c1 3300050494 Bacteria 1255
780 nmdc:mga06z11_32793_c1 3300050494 Bacteria 2535
781 nmdc:mga06z11_45630_c1 3300050494 Bacteria 2217
782 nmdc:mga05p37_18721_c2 3300050507 Bacteria 7437
783 nmdc:mga05p37_2380_c1 3300050507 Bacteria 21888
784 nmdc:mga05p37_2506_c1 3300050507 Bacteria 12388
785 nmdc:mga05p37_28335_c1 3300050507 Bacteria 6830
786 nmdc:mga05p37_334629_c1 3300050507 Bacteria 1787
787 nmdc:mga05p37_43056_c1 3300050507 Bacteria 5551
788 nmdc:mga09592_770_c1 3300050508 Bacteria 16031
789 nmdc:mga0qj67_35325_c1 3300050509 Bacteria 3907
790 nmdc:mga0qj67_73509_c1 3300050509 Bacteria 2730
791 nmdc:mga06r32_105175_c1 3300050510 Bacteria 2773
792 nmdc:mga06r32_444_c1 3300050510 Bacteria 35056
793 nmdc:mga06r32_60077_c1 3300050510 Bacteria 3657
794 nmdc:mga08y16_218177_c1 3300050511 Bacteria 1975
795 nmdc:mga08y16_3020_c1 3300050511 Bacteria 17372
796 nmdc:mga08y16_3846_c1 3300050511 Bacteria 15611
797 nmdc:mga08y16_68976_c1 3300050511 Bacteria 3686
798 nmdc:mga08y16_939_c1 3300050511 Bacteria 28315
799 nmdc:mga0n895_131781_c1 3300050512 Bacteria 2525
800 nmdc:mga0n895_291_c1 3300050512 Bacteria 33000
801 nmdc:mga0n895_345461_c1 3300050512 Bacteria 1507
802 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
803 nmdc:mga0a205_467_c1 3300050515 Bacteria 29468
804 nmdc:mga0sz30_32691_c1 3300050516 Bacteria 2159
805 Ga0495601_0000002 3300053077 Bacteria 528704
806 Ga0495601_0003096 3300053077 Bacteria 9495
807 Ga0495601_0019818 3300053077 Bacteria 4106
808 Ga0495601_0169504 3300053077 Bacteria 1427
809 Ga0495612_0000012 3300053078 Bacteria 223883
810 Ga0495612_0000478 3300053078 Bacteria 16063
811 Ga0495612_0012953 3300053078 Bacteria 3359
812 Ga0495595_0000012 3300053084 Bacteria 174322
813 Ga0495595_0000277 3300053084 Bacteria 20328
814 Ga0495619_0000003 3300053085 Bacteria 515784
815 Ga0495619_0004362 3300053085 Bacteria 9022
816 Ga0495619_0008851 3300053085 Bacteria 6364
817 Ga0495619_0046591 3300053085 Bacteria 2851
818 Ga0500644_0000375 3300053088 Bacteria 21830
819 Ga0500566_0014900 3300053094 Bacteria 4567
820 Ga0500641_0002452 3300053096 Bacteria 6567
821 Ga0500595_000002 3300053119 Bacteria 1074388
822 Ga0500616_0000002 3300053153 Bacteria 1611257
823 Ga0500616_0017963 3300053153 Bacteria 4004
824 Ga0500645_000252 3300053730 Bacteria 39375
825 Ga0501084_0033972 3300054114 Bacteria 4265
826 Ga0501084_0049107 3300054114 Bacteria 3532
827 Ga0501084_0083511 3300054114 Bacteria 2681
828 Ga0501082_0038450 3300060353 Bacteria 4129
829 Ga0501082_0065703 3300060353 Bacteria 3124
830 Ga0501082_0100578 3300060353 Bacteria 2501
831 Ga0466962_0069688 3300061719 Bacteria 1679
832 2889307637 2889306138 Bacteria 6358934
833 2902333312 2902330777 Bacteria 6395352
834 2902407096 2902405164 Bacteria 6784948
835 2919454784 2919450847 Bacteria 5631160
836 8002063704 8002060224 Bacteria 4026565
837 Ga0496112_0097126
838 2214748016
839 ARcpr5oldR_c000166
840 ARSoilYngRDRAFT_c00122
841 ARcpr5yngRDRAFT_c000142
842 ARSoilOldRDRAFT_c000054
843 ARCol0oldRDRAFT_c00231
844 ARCol0yngRDRAFT_1000054
845 JGI24746J21847_1000620
846 JGI24747J21853_1000823
847 JGI24739J22299_10001041
848 JGI24737J22298_10007452
849 JGI24737J22298_10032157
850 JGI24743J22301_10002329
851 JGI24743J22301_10015912
852 JGI24750J21931_1000888
853 JGI24745J21846_1000131
854 JGI24745J21846_1003092
855 JGI24748J21848_1002641
856 JGI24748J21848_1003474
857 JGI24738J21930_10000571
858 JGI24738J21930_10006136
859 JGI24749J21850_1000415
860 JGI24744J21845_10023343
861 JGI24035J26624_1000352
862 JGI24033J26618_1002920
863 JGI24033J26618_1004471
864 JGI24034J26672_10001326
865 JGI24034J26672_10003461
866 JGI24742J22300_10000080
867 JGI24742J22300_10000818
868 JGI24751J29686_10002106
869 JGI24751J29686_10008295
870 JGI25405J52794_10001034
871 JGI25405J52794_10001779
872 JGI25405J52794_10005107
873 Ga0065704_10097323
874 Ga0065712_10107228
875 Ga0065715_10089280
876 Ga0065707_10118788
877 Ga0070658_10033486
878 Ga0070676_10000128
879 Ga0070683_100000289
880 Ga0070690_100000935
881 Ga0070670_100003173
882 Ga0070670_100005011
883 Ga0070670_100261240
884 Ga0070677_10000043
885 Ga0068869_100000289
886 Ga0068869_100050329
887 Ga0070666_10008412
888 Ga0070666_10065397
889 Ga0070680_100002347
890 Ga0070680_100008016
891 Ga0070680_100009986
892 Ga0070682_100000528
893 Ga0070682_100033183
894 Ga0070682_100089879
895 Ga0070682_100133225
896 Ga0068868_100000408
897 Ga0068868_100009197
898 Ga0070660_100000182
899 Ga0070660_100010085
900 Ga0070660_100080505
901 Ga0070660_100109897
902 Ga0070689_100000819
903 Ga0070689_100015827
904 Ga0070689_100044473
905 Ga0070691_10027149
906 Ga0070691_10044359
907 Ga0070687_100000689
908 Ga0070687_100028693
909 Ga0070661_100000314
910 Ga0070661_100043660
911 Ga0070692_10000310
912 Ga0070692_10023477
913 Ga0070692_10100899
914 Ga0070668_100000857
915 Ga0070668_100204345
916 Ga0070669_100002719
917 Ga0070669_100094670
918 Ga0070669_100098959
919 Ga0070675_100002240
920 Ga0070675_100020607
921 Ga0070671_100000598
922 Ga0070671_100003710
923 Ga0070671_100350004
924 Ga0070674_100002210
925 Ga0070674_100030183
926 Ga0070673_100000289
927 Ga0070673_100006328
928 Ga0070673_100067543
929 Ga0070688_100000189
930 Ga0070688_100011824
931 Ga0070659_100003195
932 Ga0070659_100009819
933 Ga0070659_100149780
934 Ga0070667_100000436
935 Ga0070667_100293204
936 Ga0070709_10017043
937 Ga0070709_10052528
938 Ga0070709_10082081
939 Ga0070714_100033561
940 Ga0070714_100124125
941 Ga0070714_100152032
942 Ga0070714_100286450
943 Ga0070713_100002527
944 Ga0070713_100003602
945 Ga0070713_100108419
946 Ga0070713_100115527
947 Ga0070713_100199378
948 Ga0070713_100285432
949 Ga0070710_10001160
950 Ga0070710_10095497
951 Ga0070701_10000608
952 Ga0070711_100001742
953 Ga0070705_100000781
954 Ga0070700_100001610
955 Ga0070700_100004962
956 Ga0070694_100001837
957 Ga0070694_100025113
958 Ga0070708_100038491
959 Ga0070708_100323976
960 Ga0070663_100000297
961 Ga0070678_100001856
962 Ga0070662_100011992
963 Ga0070662_100075885
964 Ga0070681_10005077
965 Ga0070681_10041223
966 Ga0070681_10048091
967 Ga0070681_10110421
968 Ga0068867_100003318
969 Ga0070685_10001152
970 Ga0070685_10003091
971 Ga0070679_100003016
972 Ga0070684_100002293
973 Ga0070684_100089245
974 Ga0068853_100011439
975 Ga0070672_100000106
976 Ga0070686_100000615
977 Ga0070686_100075821
978 Ga0070695_100001248
979 Ga0070695_100008461
980 Ga0070696_100024338
981 Ga0070696_100091614
982 Ga0070693_100001863
983 Ga0070665_100102019
984 Ga0070665_100213106
985 Ga0070704_100004061
986 Ga0070704_100035204
987 Ga0070704_100056522
988 Ga0068855_100032491
989 Ga0068855_100149552
990 Ga0068855_100156764
991 Ga0068855_100308129
992 Ga0070664_100009338
993 Ga0068857_100000047
994 Ga0068854_100003161
995 Ga0068854_100154713
996 Ga0068856_100001905
997 Ga0068856_100239367
998 Ga0070702_100001524
999 Ga0068852_100003513
1000 Ga0068852_100219695
1001 Ga0068859_100005879
1002 Ga0068859_100033546
1003 Ga0068859_100050366
1004 Ga0068864_100000931
1005 Ga0068864_100017647
1006 Ga0068864_100372351
1007 Ga0068866_10000077
1008 Ga0068861_100004701
1009 Ga0068861_100015325
1010 Ga0068870_10000037
1011 Ga0068863_100000543
1012 Ga0068863_100008217
1013 Ga0068858_100002073
1014 Ga0068860_100006167
1015 Ga0068860_100059322
1016 Ga0068862_100000879
1017 Ga0068862_100009120
1018 Ga0068862_100056257
1019 Ga0081455_10000007
1020 Ga0081455_10000843
1021 Ga0081455_10006809
1022 Ga0081455_10063432
1023 Ga0081538_10005025
1024 Ga0081540_1027425
1025 Ga0081539_10029786
1026 Ga0070717_10001206
1027 Ga0070717_10106841
1028 Ga0070717_10217610
1029 Ga0075365_10015983
1030 Ga0075365_10083924
1031 Ga0075365_10171368
1032 Ga0075368_10022942
1033 Ga0075364_10052394
1034 Ga0070715_10000686
1035 Ga0070715_10038301
1036 Ga0070715_10110303
1037 Ga0070716_100052034
1038 Ga0070712_100014104
1039 Ga0070712_100112271
1040 Ga0075367_10006217
1041 Ga0075367_10024187
1042 Ga0075367_10060999
1043 Ga0075366_10000374
1044 Ga0097621_100000416
1045 Ga0097621_100342625
1046 Ga0068871_100000249
1047 Ga0068871_100102618
1048 Ga0075428_100013293
1049 Ga0075431_100000213
1050 Ga0075431_100066837
1051 Ga0075434_100003092
1052 Ga0075434_100077211
1053 Ga0075434_100345251
1054 Ga0075429_100006031
1055 Ga0075429_100116911
1056 Ga0068865_100000248
1057 Ga0068865_100004118
1058 Ga0075436_100000751
1059 Ga0075436_100113020
1060 Ga0097620_100005879
1061 Ga0097620_100033546
1062 Ga0097620_100050366
1063 Ga0075435_100073765
1064 Ga0075435_100157435
1065 Ga0099794_10004175
1066 Ga0099795_10014352
1067 Ga0105250_10061735
1068 Ga0105240_10024910
1069 Ga0105240_10025786
1070 Ga0105240_10483041
1071 Ga0111539_10002489
1072 Ga0111539_10005685
1073 Ga0111539_10011158
1074 Ga0111539_10082090
1075 Ga0111539_10279419
1076 Ga0105245_10004150
1077 Ga0105245_10022971
1078 Ga0105245_10039806
1079 Ga0105247_10000908
1080 Ga0114129_10000685
1081 Ga0114129_10000908
1082 Ga0114129_10012397
1083 Ga0114129_10052993
1084 Ga0105243_10001705
1085 Ga0105241_10002306
1086 Ga0105242_10003502
1087 Ga0105248_10005936
1088 Ga0105248_10006377
1089 Ga0105237_10022803
1090 Ga0105237_10236043
1091 Ga0105238_10024601
1092 Ga0105249_10000476
1093 Ga0105239_10007529
1094 Ga0105239_10144699
1095 Ga0105239_10188263
1096 Ga0105246_10000057
1097 Ga0157373_10028635
1098 Ga0157369_10106869
1099 Ga0157374_10004809
1100 Ga0157374_10057989
1101 Ga0157378_10006604
1102 Ga0157378_10202383
1103 Ga0163162_10001937
1104 Ga0163162_10171848
1105 Ga0157372_10009498
1106 Ga0157375_10003994
1107 Ga0157375_10048018
1108 Ga0157375_10157230
1109 Ga0163163_10003757
1110 Ga0163163_10005510
1111 Ga0163163_10069845
1112 Ga0163163_10143863
1113 Ga0157380_10002362
1114 Ga0157380_10007960
1115 Ga0157377_10001240
1116 Ga0157377_10056448
1117 Ga0157379_10000293
1118 Ga0157379_10007214
1119 Ga0157379_10174308
1120 Ga0157376_10000531
1121 Ga0163161_10000209
1122 Ga0206354_10351988
1123 Ga0213875_10001189
1124 Ga0213875_10043382
1125 Ga0224572_1001510
1126 Ga0207666_1000011
1127 Ga0207673_1000294
1128 Ga0207697_10000044
1129 Ga0207653_10004900
1130 Ga0207682_10000260
1131 Ga0207692_10000613
1132 Ga0207642_10001373
1133 Ga0207642_10010355
1134 Ga0207710_10003110
1135 Ga0207710_10009455
1136 Ga0207688_10000717
1137 Ga0207688_10000723
1138 Ga0207680_10004972
1139 Ga0207647_10008700
1140 Ga0207647_10034325
1141 Ga0207647_10063403
1142 Ga0207685_10001855
1143 Ga0207685_10037159
1144 Ga0207699_10107067
1145 Ga0207645_10000281
1146 Ga0207645_10010774
1147 Ga0207645_10040113
1148 Ga0207643_10000012
1149 Ga0207643_10001287
1150 Ga0207705_10111615
1151 Ga0207684_10112647
1152 Ga0207684_10169945
1153 Ga0207654_10002060
1154 Ga0207707_10000551
1155 Ga0207707_10070266
1156 Ga0207671_10031487
1157 Ga0207671_10056615
1158 Ga0207693_10099274
1159 Ga0207693_10129461
1160 Ga0207663_10006436
1161 Ga0207663_10034591
1162 Ga0207660_10000992
1163 Ga0207660_10016384
1164 Ga0207660_10089349
1165 Ga0207660_10124788
1166 Ga0207662_10000123
1167 Ga0207662_10005962
1168 Ga0207662_10066520
1169 Ga0207657_10000358
1170 Ga0207657_10013894
1171 Ga0207657_10032767
1172 Ga0207657_10072501
1173 Ga0207649_10000545
1174 Ga0207649_10155957
1175 Ga0207652_10004318
1176 Ga0207652_10072131
1177 Ga0207652_10079520
1178 Ga0207652_10118809
1179 Ga0207681_10000286
1180 Ga0207681_10240093
1181 Ga0207650_10006950
1182 Ga0207650_10079759
1183 Ga0207650_10222435
1184 Ga0207659_10000023
1185 Ga0207659_10005686
1186 Ga0207687_10000149
1187 Ga0207687_10011780
1188 Ga0207700_10029405
1189 Ga0207664_10025759
1190 Ga0207644_10000724
1191 Ga0207644_10007078
1192 Ga0207644_10012722
1193 Ga0207644_10214303
1194 Ga0207690_10000203
1195 Ga0207690_10035633
1196 Ga0207706_10001347
1197 Ga0207706_10002188
1198 Ga0207686_10007108
1199 Ga0207709_10000607
1200 Ga0207670_10000125
1201 Ga0207670_10033086
1202 Ga0207670_10269436
1203 Ga0207669_10000357
1204 Ga0207669_10019383
1205 Ga0207704_10001003
1206 Ga0207665_10021414
1207 Ga0207665_10060707
1208 Ga0207691_10000256
1209 Ga0207691_10001091
1210 Ga0207691_10092172
1211 Ga0207711_10035444
1212 Ga0207689_10000008
1213 Ga0207689_10063168
1214 Ga0207661_10000104
1215 Ga0207661_10022650
1216 Ga0207679_10000196
1217 Ga0207679_10020897
1218 Ga0207679_10201263
1219 Ga0207667_10023002
1220 Ga0207667_10284618
1221 Ga0207651_10001000
1222 Ga0207651_10015133
1223 Ga0207712_10000967
1224 Ga0207712_10013794
1225 Ga0207668_10070301
1226 Ga0207640_10000157
1227 Ga0207640_10023741
1228 Ga0207640_10284922
1229 Ga0207658_10036309
1230 Ga0207677_10000609
1231 Ga0207677_10003120
1232 Ga0207703_10003859
1233 Ga0207639_10002440
1234 Ga0207678_10004329
1235 Ga0207678_10020490
1236 Ga0207678_10100021
1237 Ga0207678_10122078
1238 Ga0207708_10002782
1239 Ga0207708_10003027
1240 Ga0207708_10336371
1241 Ga0207702_10003955
1242 Ga0207702_10041453
1243 Ga0207702_10109740
1244 Ga0207641_10002938
1245 Ga0207648_10002628
1246 Ga0207648_10005563
1247 Ga0207648_10022367
1248 Ga0207676_10003560
1249 Ga0207676_10004603
1250 Ga0207676_10149133
1251 Ga0207674_10009174
1252 Ga0207675_100000604
1253 Ga0207675_100002508
1254 Ga0207675_100407151
1255 Ga0207683_10000006
1256 Ga0207698_10000378
1257 Ga0207698_10009646
1258 Ga0207698_10195552
1259 Ga0209984_1004221
1260 Ga0209179_1000846
1261 Ga0210002_1003918
1262 Ga0209983_1006582
1263 Ga0209998_10000566
1264 Ga0209998_10001948
1265 Ga0207428_10000165
1266 Ga0207428_10000446
1267 Ga0207428_10024147
1268 Ga0207428_10081742
1269 Ga0268266_10044658
1270 Ga0268266_10054562
1271 Ga0268266_10074462
1272 Ga0268265_10001687
1273 Ga0268265_10246208
1274 Ga0268264_10002029
1275 Ga0268264_10008544
1276 Ga0265338_10012007
1277 Ga0265338_10030503
1278 Ga0265763_1000140
1279 Ga0265760_10052991
1280 Ga0265330_10022632
1281 Ga0265328_10002945
1282 Ga0265325_10009739
1283 Ga0265325_10012475
1284 Ga0265325_10021595
1285 Ga0265325_10093896
1286 Ga0265339_10004883
1287 Ga0265313_10000069
1288 Ga0265313_10000794
1289 Ga0265313_10004781
1290 Ga0265313_10011241
1291 Ga0316579_10017096
1292 Ga0265314_10005328
1293 Ga0265314_10130253
1294 Ga0265342_10000502
1295 Ga0373930_0000066
1296 Ga0373948_0000581
1297 Ga0373950_0003960
1298 Ga0373958_0000149
1299 Ga0373959_0000484
1300 Ga0373959_0001824
1301 Ga0373938_0000806
1302 Ga0373926_0006406
1303 Ga0373928_0000912
1304 Ga0373928_0003692
1305 Ga0373929_0000596
1306 Ga0373929_0001194
1307 Ga0373940_0000711
1308 Ga0373949_0001224
1309 Ga0373949_0001578
1310 Ga0373951_0000469
1311 Ga0373951_0000642
1312 Ga0373952_0000323
1313 Ga0373952_0001223
1314 Ga0373923_0000600
1315 Ga0373923_0034016
1316 Ga0373932_0000757
1317 Ga0373932_0001683
1318 Ga0373936_0000140
1319 Ga0373936_0078699
1320 Ga0373941_0000083
1321 Ga0373941_0007438
1322 Ga0373945_0004242
1323 Ga0373945_0005199
1324 Ga0373953_0002635
1325 Ga0373954_0020918
1326 Ga0373956_0008031
1327 Ga0373956_0114562
1328 Ga0373957_0091532
1329 Ga0373960_0000185
1330 Ga0373960_0000330
1331 Ga0373943_0000723
1332 Ga0373943_0005802
1333 Ga0373943_0009931
1334 Ga0373943_0087965
1335 Ga0373946_0001669
1336 Ga0373946_0001730
1337 Ga0373955_0000121
1338 Ga0373955_0024471
1339 Ga0373955_0110807
1340 Ga0373942_0001462
1341 Ga0373942_0003399
1342 Ga0373961_0000569
1343 Ga0373962_0000149
1344 Ga0373924_0000521
1345 Ga0373924_0019444
1346 Ga0373924_0057262
1347 Ga0373931_0002244
1348 Ga0373931_0061116
1349 Ga0373931_0071457
1350 Ga0373935_0024273
1351 Ga0373935_0030967
1352 Ga0373935_0046183
1353 Ga0373935_0211080
1354 Ga0373927_0001763
1355 Ga0373927_0021556
1356 Ga0373927_0023719
1357 Ga0373927_0030831
1358 Ga0373933_0001004
1359 Ga0373933_0015592
1360 Ga0373933_0087115
1361 Ga0373947_0001341
1362 Ga0373947_0005612
1363 Ga0373947_0006555
1364 Ga0373947_0031905
1365 Ga0373947_0041783
1366 Ga0373947_0044632
1367 Ga0373947_0054692
1368 Ga0373947_0111980
1369 Ga0373937_0001420
1370 Ga0373937_0002850
1371 Ga0373937_0104592
1372 Ga0373925_0000016
1373 Ga0373925_0001095
1374 Ga0373925_0123614
1375 Ga0395900_0001539
1376 Ga0395900_0075561
1377 Ga0395898_0013503
1378 Ga0395898_0024475
1379 Ga0395898_0036924
1380 Ga0436364_0170641
1381 Ga0436364_1548064
1382 Ga0395901_0027121
1383 Ga0439441_007620
1384 Ga0451577_0134237
1385 Ga0466963_0138338
1386 Ga0466968_0003779
1387 Ga0466957_0008459
1388 Ga0466959_0090981
1389 Ga0466958_0026576
1390 Ga0466967_0007437
1391 Ga0466967_0354484
1392 Ga0495592_0000044
1393 Ga0495592_0036712
1394 Ga0495629_0000798
1395 Ga0495629_0004823
1396 Ga0495641_0019161
1397 Ga0495651_0000702
1398 Ga0495651_0004981
1399 Ga0495653_0000022
1400 Ga0495653_0064111
1401 Ga0495582_0016959
1402 Ga0495582_0070011
1403 Ga0495639_0026504
1404 Ga0495662_0004014
1405 Ga0495664_0000013
1406 Ga0495664_0016952
1407 Ga0495664_0159783
1408 Ga0495584_0021641
1409 Ga0495594_0073564
1410 Ga0495608_0000004
1411 Ga0495618_0000032
1412 Ga0495618_0010451
1413 Ga0495618_0056603
1414 Ga0495618_0081759
1415 Ga0495628_0000014
1416 Ga0495628_0098574
1417 Ga0495630_0006343
1418 Ga0495630_0011540
1419 Ga0495630_0208308
1420 Ga0495666_0068797
1421 Ga0495652_0000002
1422 Ga0495652_0060214
1423 Ga0495665_0048847
1424 Ga0495640_0000001
1425 Ga0495640_0005848
1426 Ga0495640_0040037
1427 Ga0495640_0093148
1428 Ga0495586_0083366
1429 Ga0495587_0000004
1430 Ga0495587_0004639
1431 Ga0495587_0115167
1432 Ga0495609_0077875
1433 Ga0495645_0000001
1434 Ga0495645_0012073
1435 Ga0495667_0000009
1436 Ga0495667_0000967
1437 Ga0495656_0037389
1438 Ga0495634_0000033
1439 Ga0495634_0006572
1440 Ga0495634_0030799
1441 Ga0495625_0086286
1442 Ga0495635_0000003
1443 Ga0495635_0010576
1444 Ga0495657_0000342
1445 Ga0495657_0121908
1446 Ga0495599_0000030
1447 Ga0495623_0000059
1448 Ga0495623_0004459
1449 Ga0495623_0008559
1450 Ga0495646_0000031
1451 Ga0495646_0005451
1452 Ga0495658_0008450
1453 Ga0495658_0035108
1454 Ga0495658_0037237
1455 Ga0495658_0124924
1456 Ga0495613_0041141
1457 Ga0495613_0058832
1458 Ga0495613_0090427
1459 Ga0495624_0009592
1460 Ga0495624_0182624
1461 Ga0495600_0000141
1462 Ga0495581_0006241
1463 Ga0495604_0000002
1464 Ga0495604_0000619
1465 Ga0495604_0028575
1466 Ga0495604_0034208
1467 Ga0495674_0000004
1468 Ga0495674_0000575
1469 Ga0495674_0024950
1470 Ga0495674_0200114
1471 Ga0495676_0079119
1472 Ga0495680_0000481
1473 Ga0495680_0008522
1474 Ga0495675_0000048
1475 Ga0495684_0000019
1476 Ga0495684_0123805
1477 Ga0495593_0000511
1478 Ga0495593_0027144
1479 Ga0495602_0000001
1480 Ga0495602_0013129
1481 Ga0495602_0084401
1482 Ga0496100_0000610
1483 Ga0496100_0006059
1484 Ga0496100_0223614
1485 Ga0496101_0000464
1486 Ga0496101_0012807
1487 Ga0496101_0037886
1488 Ga0496101_0049295
1489 Ga0496101_0074666
1490 Ga0496102_0001120
1491 Ga0496102_0017419
1492 Ga0496102_0023365
1493 Ga0496102_0065495
1494 Ga0496102_0334518
1495 Ga0496102_0397449
1496 Ga0496103_0000611
1497 Ga0496103_0002918
1498 Ga0496103_0046347
1499 Ga0496104_0001156
1500 Ga0496104_0003012
1501 Ga0496104_0029606
1502 Ga0496105_0004387
1503 Ga0496105_0032636
1504 Ga0496105_0053941
1505 Ga0496106_0000481
1506 Ga0496106_0000541
1507 Ga0496106_0059385
1508 Ga0496106_0060089
1509 Ga0496106_0073625
1510 Ga0496107_0002295
1511 Ga0496107_0005580
1512 Ga0496107_0097140
1513 Ga0496108_0001251
1514 Ga0496108_0007993
1515 Ga0496108_0023781
1516 Ga0496108_0137277
1517 Ga0496108_0258755
1518 Ga0496109_0003885
1519 Ga0496109_0008609
1520 Ga0496109_0024306
1521 Ga0496109_0037781
1522 Ga0496109_0049834
1523 Ga0496109_0201950
1524 Ga0496109_0328789
1525 Ga0496110_0013043
1526 Ga0496110_0016839
1527 Ga0496110_0023634
1528 Ga0496110_0047895
1529 Ga0496110_0291398
1530 Ga0496111_0006454
1531 Ga0496111_0008573
1532 Ga0496111_0016437
1533 Ga0496111_0067464
1534 Ga0496111_0081003
1535 Ga0496112_0009148
1536 Ga0496112_0022787
1537 Ga0496112_0035817
1538 Ga0496112_0170603
1539 Ga0496112_0276674
1540 Ga0496112_0328433
1541 Ga0496113_0001441
1542 Ga0496113_0013130
1543 Ga0496114_0005881
1544 Ga0496114_0006370
1545 Ga0496114_0019321
1546 Ga0496114_0023227
1547 Ga0496114_0098648
1548 Ga0496114_0296429
1549 Ga0496115_0004336
1550 Ga0496115_0009733
1551 Ga0496115_0010227
1552 Ga0496115_0012138
1553 Ga0496115_0030482
1554 Ga0496115_0168699
1555 Ga0501032_0007222
1556 Ga0501033_0043907
1557 Ga0501034_0032378
1558 Ga0501034_0033286
1559 Ga0501036_0001657
1560 Ga0501036_0006781
1561 Ga0501036_0024249
1562 Ga0501037_0009558
1563 Ga0501038_0011889
1564 Ga0501038_0040577
1565 Ga0501039_0340307
1566 Ga0501043_0002225
1567 Ga0501043_0072709
1568 Ga0501046_0015198
1569 Ga0501046_0055276
1570 Ga0501047_0000314
1571 Ga0501047_0036499
1572 Ga0501047_0067324
1573 Ga0501047_0074843
1574 Ga0501047_0105953
1575 Ga0501048_0002000
1576 Ga0501048_0152016
1577 Ga0501069_0005233
1578 Ga0501070_0007677
1579 Ga0501070_0008242
1580 Ga0501070_0036638
1581 Ga0501070_0120289
1582 Ga0501070_0179273
1583 Ga0501070_0187341
1584 Ga0501071_0092413
1585 Ga0501073_0021006
1586 Ga0501073_0029354
1587 Ga0501073_0151284
1588 Ga0501074_0012343
1589 Ga0501076_0037276
1590 Ga0501077_0027575
1591 Ga0501077_0090573
1592 Ga0501079_0017339
1593 Ga0501080_0005419
1594 Ga0501080_0107373
1595 Ga0501080_0174281
1596 Ga0501081_0063257
1597 Ga0501083_0001743
1598 Ga0501083_0146733
1599 Ga0501035_0000896
1600 Ga0501035_0008967
1601 Ga0501035_0097360
1602 Ga0501044_0018297
1603 Ga0501044_0029583
1604 Ga0501044_0052167
1605 Ga0501044_0068384
1606 Ga0501044_0116445
1607 Ga0501044_0163405
1608 Ga0501044_0445252
1609 nmdc:mga03683_14002_c1
1610 nmdc:mga00v17_64993_c1
1611 nmdc:mga0yw44_19513_c1
1612 nmdc:mga0yw44_24505_c1
1613 nmdc:mga0yw44_40242_c1
1614 nmdc:mga0yw44_87501_c1
1615 nmdc:mga06z11_168866_c1
1616 nmdc:mga06z11_32793_c1
1617 nmdc:mga06z11_45630_c1
1618 nmdc:mga05p37_18721_c2
1619 nmdc:mga05p37_2380_c1
1620 nmdc:mga05p37_2506_c1
1621 nmdc:mga05p37_28335_c1
1622 nmdc:mga05p37_334629_c1
1623 nmdc:mga05p37_43056_c1
1624 nmdc:mga09592_770_c1
1625 nmdc:mga0qj67_35325_c1
1626 nmdc:mga0qj67_73509_c1
1627 nmdc:mga06r32_105175_c1
1628 nmdc:mga06r32_444_c1
1629 nmdc:mga06r32_60077_c1
1630 nmdc:mga08y16_218177_c1
1631 nmdc:mga08y16_3020_c1
1632 nmdc:mga08y16_3846_c1
1633 nmdc:mga08y16_68976_c1
1634 nmdc:mga08y16_939_c1
1635 nmdc:mga0n895_131781_c1
1636 nmdc:mga0n895_291_c1
1637 nmdc:mga0n895_345461_c1
1638 nmdc:mga08x19_22_c1
1639 nmdc:mga0a205_467_c1
1640 nmdc:mga0sz30_32691_c1
1641 Ga0495601_0000002
1642 Ga0495601_0003096
1643 Ga0495601_0019818
1644 Ga0495601_0169504
1645 Ga0495612_0000012
1646 Ga0495612_0000478
1647 Ga0495612_0012953
1648 Ga0495595_0000012
1649 Ga0495595_0000277
1650 Ga0495619_0000003
1651 Ga0495619_0004362
1652 Ga0495619_0008851
1653 Ga0495619_0046591
1654 Ga0500644_0000375
1655 Ga0500566_0014900
1656 Ga0500641_0002452
1657 Ga0500595_000002
1658 Ga0500616_0000002
1659 Ga0500616_0017963
1660 Ga0500645_000252
1661 Ga0501084_0033972
1662 Ga0501084_0049107
1663 Ga0501084_0083511
1664 Ga0501082_0038450
1665 Ga0501082_0065703
1666 Ga0501082_0100578
1667 Ga0466962_0069688
1668 2889307637
1669 2902333312
1670 2902407096
1671 2919454784
1672 8002063704

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00926

DHBP_synthase

3,4-dihydroxy-2-butanone 4-phosphate synthase

71

262

0.99

PF00925

GTP_cyclohydro2

GTP cyclohydrolase II

271

423

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bwo-assembly1.cif.gz_A larc2, the c-terminal domain of a cyclometallase involved in the synthesis of the npn cofactor of lactate racemase, apo form 0.778 200 233
2bz0-assembly1.cif.gz_A crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc 0.6967 200 343
2bz1-assembly1.cif.gz_A-2 crystal structure of apo e. coli gtp cyclohydrolase ii 0.6896 200 343
4rl4-assembly1.cif.gz_B crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 0.6781 199 343
4rl4-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 0.6643 199 342
ID Description Score Start End Superfamily
4i14B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.7688 202 341 3.40.50.10990
af_A0A0R0GI97_331_502_3.40.50.10990 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.7599 202 343 3.40.50.10990
4i14B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II 0.7569 202 341 3.40.50.10990
af_K7MH01_9_91_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.7198 200 233 2.170.150.20
af_Q8I2Q2_13_105_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.7038 200 233 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A528CHV5-F1-model_v4 3,4-dihydroxy-2-butanone-4-phosphate synthase 0.8318 200 341 GO:0003935
GO:0005829
GO:0009231
AF-A0A075HBH4-F1-model_v4 GTP cyclohydrolase II (RibBA) (EC 3.5.4.25) 0.808 185 342 GO:0003935
GO:0005829
GO:0009231
AF-A0A134CFR1-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.7591 198 343 GO:0003935
GO:0005525
GO:0005829
GO:0009231
AF-A0A641RS98-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.7399 124 343 GO:0003935
GO:0005525
GO:0005829
GO:0008686
GO:0009231
GO:0046872
AF-A0A519X2E5-F1-model_v4 GTP cyclohydrolase II (EC 3.5.4.25) 0.7368 128 341 GO:0003935
GO:0005525
GO:0005829
GO:0008686
GO:0009231
GO:0046872

Map