F482909
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 403 | 1672 | 354 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0097126|Ga0496112_0097126_370_1650 |
| Length | 426 |
| Sequence | VRRRIGRFRGRPAEHENGGDPCREQNVRARSEAAKAELWRQVRRFGIERHDASHWQHGDSDSMSDAQQRIRAAVAAFARGELVIVADDDDRENEGDLFVAAALCTPEKMAFMIRHTSGIVCAPLAPEEARRLHLDPMVARNDAPLGTAFTVSVDARHGLTTGISAEERTNTVRALANGNMGAGDFVRPGHVFPLVAKDGGVLMRSGHTEACVDLCRLAGLPPVGVLAELMNDDGTVMRGDDIAAFAERHKLQRVSIADLIAFRQSREKLIERVGEFPVESEIGTLAGYAFQTPFDPFYHMAFVHGRIGDGRNVLARLHRANLILDVFGGAKAIRRTLDRFKAEGRGVLVVLRDGAAGVPVVSIPKSDETLSGEARIRQWREVGLGAQILKDLGVTSIKLLSFSRPMTYVGLSGFGIEIVGTEPVEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 119 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 121 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 153 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 154 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 257 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 262 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 274 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 275 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 278 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 279 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 396 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 399 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 400 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 401 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 402 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 403 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.11 |
| Nodule | 0 |
| Rhizoplane | 8.85 |
| Rhizosphere | 87.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496112_0097126 | 3300048915 | Bacteria | 2917 |
| 2 | 2214748016 | 2209111006 | Bacteria | 3432 |
| 3 | ARcpr5oldR_c000166 | 3300000041 | Bacteria | 11417 |
| 4 | ARSoilYngRDRAFT_c00122 | 3300000042 | Bacteria | 13299 |
| 5 | ARcpr5yngRDRAFT_c000142 | 3300000043 | Bacteria | 11426 |
| 6 | ARSoilOldRDRAFT_c000054 | 3300000044 | Bacteria | 23692 |
| 7 | ARCol0oldRDRAFT_c00231 | 3300000045 | Bacteria | 5178 |
| 8 | ARCol0yngRDRAFT_1000054 | 3300000652 | Bacteria | 20195 |
| 9 | JGI24746J21847_1000620 | 3300001977 | Bacteria | 5412 |
| 10 | JGI24747J21853_1000823 | 3300001978 | Bacteria | 2126 |
| 11 | JGI24739J22299_10001041 | 3300001989 | Bacteria | 10288 |
| 12 | JGI24737J22298_10007452 | 3300001990 | Bacteria | 3694 |
| 13 | JGI24737J22298_10032157 | 3300001990 | Bacteria | 1636 |
| 14 | JGI24743J22301_10002329 | 3300001991 | Bacteria | 2840 |
| 15 | JGI24743J22301_10015912 | 3300001991 | Bacteria | 1399 |
| 16 | JGI24750J21931_1000888 | 3300002070 | Bacteria | 4093 |
| 17 | JGI24745J21846_1000131 | 3300002073 | Bacteria | 5781 |
| 18 | JGI24745J21846_1003092 | 3300002073 | Bacteria | 1727 |
| 19 | JGI24748J21848_1002641 | 3300002074 | Bacteria | 2036 |
| 20 | JGI24748J21848_1003474 | 3300002074 | Bacteria | 1798 |
| 21 | JGI24738J21930_10000571 | 3300002075 | Bacteria | 10549 |
| 22 | JGI24738J21930_10006136 | 3300002075 | Bacteria | 2840 |
| 23 | JGI24749J21850_1000415 | 3300002076 | Bacteria | 6366 |
| 24 | JGI24744J21845_10023343 | 3300002077 | Unclassified | 1212 |
| 25 | JGI24035J26624_1000352 | 3300002126 | Bacteria | 4327 |
| 26 | JGI24033J26618_1002920 | 3300002155 | Bacteria | 1779 |
| 27 | JGI24033J26618_1004471 | 3300002155 | Bacteria | 1510 |
| 28 | JGI24034J26672_10001326 | 3300002239 | Bacteria | 3265 |
| 29 | JGI24034J26672_10003461 | 3300002239 | Bacteria | 2203 |
| 30 | JGI24742J22300_10000080 | 3300002244 | Bacteria | 13750 |
| 31 | JGI24742J22300_10000818 | 3300002244 | Bacteria | 4752 |
| 32 | JGI24751J29686_10002106 | 3300002459 | Bacteria | 4036 |
| 33 | JGI24751J29686_10008295 | 3300002459 | Bacteria | 2126 |
| 34 | JGI25405J52794_10001034 | 3300003911 | Bacteria | 4422 |
| 35 | JGI25405J52794_10001779 | 3300003911 | Bacteria | 3602 |
| 36 | JGI25405J52794_10005107 | 3300003911 | Bacteria | 2358 |
| 37 | Ga0065704_10097323 | 3300005289 | Bacteria | 2400 |
| 38 | Ga0065712_10107228 | 3300005290 | Bacteria | 1900 |
| 39 | Ga0065715_10089280 | 3300005293 | Bacteria | 11642 |
| 40 | Ga0065707_10118788 | 3300005295 | Bacteria | 2177 |
| 41 | Ga0070658_10033486 | 3300005327 | Bacteria | 4134 |
| 42 | Ga0070676_10000128 | 3300005328 | Bacteria | 28446 |
| 43 | Ga0070683_100000289 | 3300005329 | Bacteria | 34698 |
| 44 | Ga0070690_100000935 | 3300005330 | Bacteria | 14900 |
| 45 | Ga0070670_100003173 | 3300005331 | Bacteria | 13581 |
| 46 | Ga0070670_100005011 | 3300005331 | Bacteria | 11141 |
| 47 | Ga0070670_100261240 | 3300005331 | Bacteria | 1509 |
| 48 | Ga0070677_10000043 | 3300005333 | Bacteria | 39363 |
| 49 | Ga0068869_100000289 | 3300005334 | Bacteria | 26851 |
| 50 | Ga0068869_100050329 | 3300005334 | Bacteria | 3019 |
| 51 | Ga0070666_10008412 | 3300005335 | Bacteria | 6407 |
| 52 | Ga0070666_10065397 | 3300005335 | Bacteria | 2468 |
| 53 | Ga0070680_100002347 | 3300005336 | Bacteria | 13977 |
| 54 | Ga0070680_100008016 | 3300005336 | Bacteria | 8065 |
| 55 | Ga0070680_100009986 | 3300005336 | Bacteria | 7311 |
| 56 | Ga0070682_100000528 | 3300005337 | Bacteria | 23870 |
| 57 | Ga0070682_100033183 | 3300005337 | Bacteria | 3135 |
| 58 | Ga0070682_100089879 | 3300005337 | Bacteria | 2007 |
| 59 | Ga0070682_100133225 | 3300005337 | Bacteria | 1684 |
| 60 | Ga0068868_100000408 | 3300005338 | Bacteria | 29034 |
| 61 | Ga0068868_100009197 | 3300005338 | Bacteria | 7097 |
| 62 | Ga0070660_100000182 | 3300005339 | Bacteria | 41532 |
| 63 | Ga0070660_100010085 | 3300005339 | Bacteria | 6665 |
| 64 | Ga0070660_100080505 | 3300005339 | Bacteria | 2556 |
| 65 | Ga0070660_100109897 | 3300005339 | Bacteria | 2192 |
| 66 | Ga0070689_100000819 | 3300005340 | Bacteria | 19235 |
| 67 | Ga0070689_100015827 | 3300005340 | Bacteria | 5510 |
| 68 | Ga0070689_100044473 | 3300005340 | Bacteria | 3416 |
| 69 | Ga0070691_10027149 | 3300005341 | Bacteria | 2670 |
| 70 | Ga0070691_10044359 | 3300005341 | Bacteria | 2108 |
| 71 | Ga0070687_100000689 | 3300005343 | Bacteria | 11282 |
| 72 | Ga0070687_100028693 | 3300005343 | Bacteria | 2701 |
| 73 | Ga0070661_100000314 | 3300005344 | Bacteria | 39090 |
| 74 | Ga0070661_100043660 | 3300005344 | Bacteria | 3275 |
| 75 | Ga0070692_10000310 | 3300005345 | Bacteria | 13896 |
| 76 | Ga0070692_10023477 | 3300005345 | Bacteria | 3023 |
| 77 | Ga0070692_10100899 | 3300005345 | Bacteria | 1582 |
| 78 | Ga0070668_100000857 | 3300005347 | Bacteria | 21127 |
| 79 | Ga0070668_100204345 | 3300005347 | Bacteria | 1623 |
| 80 | Ga0070669_100002719 | 3300005353 | Bacteria | 12760 |
| 81 | Ga0070669_100094670 | 3300005353 | Bacteria | 2245 |
| 82 | Ga0070669_100098959 | 3300005353 | Bacteria | 2197 |
| 83 | Ga0070675_100002240 | 3300005354 | Bacteria | 14349 |
| 84 | Ga0070675_100020607 | 3300005354 | Bacteria | 5261 |
| 85 | Ga0070671_100000598 | 3300005355 | Bacteria | 25820 |
| 86 | Ga0070671_100003710 | 3300005355 | Bacteria | 11986 |
| 87 | Ga0070671_100350004 | 3300005355 | Bacteria | 1261 |
| 88 | Ga0070674_100002210 | 3300005356 | Bacteria | 10703 |
| 89 | Ga0070674_100030183 | 3300005356 | Bacteria | 3579 |
| 90 | Ga0070673_100000289 | 3300005364 | Bacteria | 26187 |
| 91 | Ga0070673_100006328 | 3300005364 | Bacteria | 7691 |
| 92 | Ga0070673_100067543 | 3300005364 | Bacteria | 2859 |
| 93 | Ga0070688_100000189 | 3300005365 | Bacteria | 32631 |
| 94 | Ga0070688_100011824 | 3300005365 | Bacteria | 4867 |
| 95 | Ga0070659_100003195 | 3300005366 | Bacteria | 11664 |
| 96 | Ga0070659_100009819 | 3300005366 | Bacteria | 7036 |
| 97 | Ga0070659_100149780 | 3300005366 | Bacteria | 1903 |
| 98 | Ga0070667_100000436 | 3300005367 | Bacteria | 43897 |
| 99 | Ga0070667_100293204 | 3300005367 | Bacteria | 1463 |
| 100 | Ga0070709_10017043 | 3300005434 | Bacteria | 4159 |
| 101 | Ga0070709_10052528 | 3300005434 | Bacteria | 2562 |
| 102 | Ga0070709_10082081 | 3300005434 | Bacteria | 2105 |
| 103 | Ga0070714_100033561 | 3300005435 | Bacteria | 4291 |
| 104 | Ga0070714_100124125 | 3300005435 | Bacteria | 2300 |
| 105 | Ga0070714_100152032 | 3300005435 | Bacteria | 2087 |
| 106 | Ga0070714_100286450 | 3300005435 | Bacteria | 1532 |
| 107 | Ga0070713_100002527 | 3300005436 | Bacteria | 11956 |
| 108 | Ga0070713_100003602 | 3300005436 | Bacteria | 10235 |
| 109 | Ga0070713_100108419 | 3300005436 | Bacteria | 2418 |
| 110 | Ga0070713_100115527 | 3300005436 | Bacteria | 2346 |
| 111 | Ga0070713_100199378 | 3300005436 | Bacteria | 1807 |
| 112 | Ga0070713_100285432 | 3300005436 | Bacteria | 1515 |
| 113 | Ga0070710_10001160 | 3300005437 | Bacteria | 12470 |
| 114 | Ga0070710_10095497 | 3300005437 | Bacteria | 1761 |
| 115 | Ga0070701_10000608 | 3300005438 | Bacteria | 12508 |
| 116 | Ga0070711_100001742 | 3300005439 | Bacteria | 12081 |
| 117 | Ga0070705_100000781 | 3300005440 | Bacteria | 17954 |
| 118 | Ga0070700_100001610 | 3300005441 | Bacteria | 11254 |
| 119 | Ga0070700_100004962 | 3300005441 | Bacteria | 7003 |
| 120 | Ga0070694_100001837 | 3300005444 | Bacteria | 12570 |
| 121 | Ga0070694_100025113 | 3300005444 | Bacteria | 3853 |
| 122 | Ga0070708_100038491 | 3300005445 | Bacteria | 4178 |
| 123 | Ga0070708_100323976 | 3300005445 | Bacteria | 1452 |
| 124 | Ga0070663_100000297 | 3300005455 | Bacteria | 25442 |
| 125 | Ga0070678_100001856 | 3300005456 | Bacteria | 11388 |
| 126 | Ga0070662_100011992 | 3300005457 | Bacteria | 5734 |
| 127 | Ga0070662_100075885 | 3300005457 | Bacteria | 2490 |
| 128 | Ga0070681_10005077 | 3300005458 | Bacteria | 12699 |
| 129 | Ga0070681_10041223 | 3300005458 | Bacteria | 4626 |
| 130 | Ga0070681_10048091 | 3300005458 | Bacteria | 4263 |
| 131 | Ga0070681_10110421 | 3300005458 | Bacteria | 2689 |
| 132 | Ga0068867_100003318 | 3300005459 | Bacteria | 11338 |
| 133 | Ga0070685_10001152 | 3300005466 | Bacteria | 14147 |
| 134 | Ga0070685_10003091 | 3300005466 | Bacteria | 8464 |
| 135 | Ga0070679_100003016 | 3300005530 | Bacteria | 15378 |
| 136 | Ga0070684_100002293 | 3300005535 | Bacteria | 14101 |
| 137 | Ga0070684_100089245 | 3300005535 | Bacteria | 2740 |
| 138 | Ga0068853_100011439 | 3300005539 | Bacteria | 7210 |
| 139 | Ga0070672_100000106 | 3300005543 | Bacteria | 41858 |
| 140 | Ga0070686_100000615 | 3300005544 | Bacteria | 20904 |
| 141 | Ga0070686_100075821 | 3300005544 | Bacteria | 2213 |
| 142 | Ga0070695_100001248 | 3300005545 | Bacteria | 13985 |
| 143 | Ga0070695_100008461 | 3300005545 | Bacteria | 6104 |
| 144 | Ga0070696_100024338 | 3300005546 | Bacteria | 4115 |
| 145 | Ga0070696_100091614 | 3300005546 | Bacteria | 2165 |
| 146 | Ga0070693_100001863 | 3300005547 | Bacteria | 9633 |
| 147 | Ga0070665_100102019 | 3300005548 | Bacteria | 2873 |
| 148 | Ga0070665_100213106 | 3300005548 | Bacteria | 1932 |
| 149 | Ga0070704_100004061 | 3300005549 | Bacteria | 8447 |
| 150 | Ga0070704_100035204 | 3300005549 | Bacteria | 3402 |
| 151 | Ga0070704_100056522 | 3300005549 | Bacteria | 2786 |
| 152 | Ga0068855_100032491 | 3300005563 | Bacteria | 6231 |
| 153 | Ga0068855_100149552 | 3300005563 | Bacteria | 2655 |
| 154 | Ga0068855_100156764 | 3300005563 | Bacteria | 2586 |
| 155 | Ga0068855_100308129 | 3300005563 | Bacteria | 1752 |
| 156 | Ga0070664_100009338 | 3300005564 | Bacteria | 7954 |
| 157 | Ga0068857_100000047 | 3300005577 | Bacteria | 67784 |
| 158 | Ga0068854_100003161 | 3300005578 | Bacteria | 10266 |
| 159 | Ga0068854_100154713 | 3300005578 | Bacteria | 1771 |
| 160 | Ga0068856_100001905 | 3300005614 | Bacteria | 21761 |
| 161 | Ga0068856_100239367 | 3300005614 | Bacteria | 1830 |
| 162 | Ga0070702_100001524 | 3300005615 | Bacteria | 9532 |
| 163 | Ga0068852_100003513 | 3300005616 | Bacteria | 10963 |
| 164 | Ga0068852_100219695 | 3300005616 | Bacteria | 1807 |
| 165 | Ga0068859_100005879 | 3300005617 | Bacteria | 12451 |
| 166 | Ga0068859_100033546 | 3300005617 | Bacteria | 5155 |
| 167 | Ga0068859_100050366 | 3300005617 | Bacteria | 4183 |
| 168 | Ga0068864_100000931 | 3300005618 | Bacteria | 24535 |
| 169 | Ga0068864_100017647 | 3300005618 | Bacteria | 5951 |
| 170 | Ga0068864_100372351 | 3300005618 | Bacteria | 1352 |
| 171 | Ga0068866_10000077 | 3300005718 | Bacteria | 39340 |
| 172 | Ga0068861_100004701 | 3300005719 | Bacteria | 9180 |
| 173 | Ga0068861_100015325 | 3300005719 | Bacteria | 5399 |
| 174 | Ga0068870_10000037 | 3300005840 | Bacteria | 42069 |
| 175 | Ga0068863_100000543 | 3300005841 | Bacteria | 38366 |
| 176 | Ga0068863_100008217 | 3300005841 | Bacteria | 10200 |
| 177 | Ga0068858_100002073 | 3300005842 | Bacteria | 20401 |
| 178 | Ga0068860_100006167 | 3300005843 | Bacteria | 12056 |
| 179 | Ga0068860_100059322 | 3300005843 | Bacteria | 3638 |
| 180 | Ga0068862_100000879 | 3300005844 | Bacteria | 29265 |
| 181 | Ga0068862_100009120 | 3300005844 | Bacteria | 8212 |
| 182 | Ga0068862_100056257 | 3300005844 | Bacteria | 3370 |
| 183 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 184 | Ga0081455_10000843 | 3300005937 | Bacteria | 39506 |
| 185 | Ga0081455_10006809 | 3300005937 | Bacteria | 12183 |
| 186 | Ga0081455_10063432 | 3300005937 | Bacteria | 3101 |
| 187 | Ga0081538_10005025 | 3300005981 | Bacteria | 12041 |
| 188 | Ga0081540_1027425 | 3300005983 | Bacteria | 3227 |
| 189 | Ga0081539_10029786 | 3300005985 | Bacteria | 3402 |
| 190 | Ga0070717_10001206 | 3300006028 | Bacteria | 17517 |
| 191 | Ga0070717_10106841 | 3300006028 | Bacteria | 2383 |
| 192 | Ga0070717_10217610 | 3300006028 | Bacteria | 1678 |
| 193 | Ga0075365_10015983 | 3300006038 | Bacteria | 4552 |
| 194 | Ga0075365_10083924 | 3300006038 | Bacteria | 2161 |
| 195 | Ga0075365_10171368 | 3300006038 | Bacteria | 1515 |
| 196 | Ga0075368_10022942 | 3300006042 | Bacteria | 2379 |
| 197 | Ga0075364_10052394 | 3300006051 | Bacteria | 2666 |
| 198 | Ga0070715_10000686 | 3300006163 | Bacteria | 9073 |
| 199 | Ga0070715_10038301 | 3300006163 | Bacteria | 1990 |
| 200 | Ga0070715_10110303 | 3300006163 | Bacteria | 1297 |
| 201 | Ga0070716_100052034 | 3300006173 | Bacteria | 2331 |
| 202 | Ga0070712_100014104 | 3300006175 | Bacteria | 5125 |
| 203 | Ga0070712_100112271 | 3300006175 | Bacteria | 2036 |
| 204 | Ga0075367_10006217 | 3300006178 | Bacteria | 6014 |
| 205 | Ga0075367_10024187 | 3300006178 | Bacteria | 3426 |
| 206 | Ga0075367_10060999 | 3300006178 | Bacteria | 2250 |
| 207 | Ga0075366_10000374 | 3300006195 | Bacteria | 20807 |
| 208 | Ga0097621_100000416 | 3300006237 | Bacteria | 29698 |
| 209 | Ga0097621_100342625 | 3300006237 | Bacteria | 1327 |
| 210 | Ga0068871_100000249 | 3300006358 | Bacteria | 37516 |
| 211 | Ga0068871_100102618 | 3300006358 | Bacteria | 2398 |
| 212 | Ga0075428_100013293 | 3300006844 | Bacteria | 9159 |
| 213 | Ga0075431_100000213 | 3300006847 | Bacteria | 42816 |
| 214 | Ga0075431_100066837 | 3300006847 | Bacteria | 3711 |
| 215 | Ga0075434_100003092 | 3300006871 | Bacteria | 14816 |
| 216 | Ga0075434_100077211 | 3300006871 | Bacteria | 3326 |
| 217 | Ga0075434_100345251 | 3300006871 | Bacteria | 1509 |
| 218 | Ga0075429_100006031 | 3300006880 | Bacteria | 10478 |
| 219 | Ga0075429_100116911 | 3300006880 | Bacteria | 2331 |
| 220 | Ga0068865_100000248 | 3300006881 | Bacteria | 30110 |
| 221 | Ga0068865_100004118 | 3300006881 | Bacteria | 8743 |
| 222 | Ga0075436_100000751 | 3300006914 | Bacteria | 21452 |
| 223 | Ga0075436_100113020 | 3300006914 | Bacteria | 1896 |
| 224 | Ga0097620_100005879 | 3300006931 | Bacteria | 12451 |
| 225 | Ga0097620_100033546 | 3300006931 | Bacteria | 5155 |
| 226 | Ga0097620_100050366 | 3300006931 | Bacteria | 4183 |
| 227 | Ga0075435_100073765 | 3300007076 | Bacteria | 2790 |
| 228 | Ga0075435_100157435 | 3300007076 | Bacteria | 1912 |
| 229 | Ga0099794_10004175 | 3300007265 | Bacteria | 5634 |
| 230 | Ga0099795_10014352 | 3300007788 | Bacteria | 2455 |
| 231 | Ga0105250_10061735 | 3300009092 | Bacteria | 1507 |
| 232 | Ga0105240_10024910 | 3300009093 | Bacteria | 7876 |
| 233 | Ga0105240_10025786 | 3300009093 | Bacteria | 7720 |
| 234 | Ga0105240_10483041 | 3300009093 | Bacteria | 1381 |
| 235 | Ga0111539_10002489 | 3300009094 | Bacteria | 24423 |
| 236 | Ga0111539_10005685 | 3300009094 | Bacteria | 16136 |
| 237 | Ga0111539_10011158 | 3300009094 | Bacteria | 11301 |
| 238 | Ga0111539_10082090 | 3300009094 | Bacteria | 3791 |
| 239 | Ga0111539_10279419 | 3300009094 | Bacteria | 1943 |
| 240 | Ga0105245_10004150 | 3300009098 | Bacteria | 12870 |
| 241 | Ga0105245_10022971 | 3300009098 | Bacteria | 5473 |
| 242 | Ga0105245_10039806 | 3300009098 | Bacteria | 4184 |
| 243 | Ga0105247_10000908 | 3300009101 | Bacteria | 22289 |
| 244 | Ga0114129_10000685 | 3300009147 | Bacteria | 42795 |
| 245 | Ga0114129_10000908 | 3300009147 | Bacteria | 38524 |
| 246 | Ga0114129_10012397 | 3300009147 | Bacteria | 12135 |
| 247 | Ga0114129_10052993 | 3300009147 | Bacteria | 5691 |
| 248 | Ga0105243_10001705 | 3300009148 | Bacteria | 18936 |
| 249 | Ga0105241_10002306 | 3300009174 | Bacteria | 14330 |
| 250 | Ga0105242_10003502 | 3300009176 | Bacteria | 12201 |
| 251 | Ga0105248_10005936 | 3300009177 | Bacteria | 13420 |
| 252 | Ga0105248_10006377 | 3300009177 | Bacteria | 12945 |
| 253 | Ga0105237_10022803 | 3300009545 | Bacteria | 6423 |
| 254 | Ga0105237_10236043 | 3300009545 | Bacteria | 1830 |
| 255 | Ga0105238_10024601 | 3300009551 | Bacteria | 6138 |
| 256 | Ga0105249_10000476 | 3300009553 | Bacteria | 37263 |
| 257 | Ga0105239_10007529 | 3300010375 | Bacteria | 12486 |
| 258 | Ga0105239_10144699 | 3300010375 | Bacteria | 2650 |
| 259 | Ga0105239_10188263 | 3300010375 | Bacteria | 2310 |
| 260 | Ga0105246_10000057 | 3300011119 | Bacteria | 44951 |
| 261 | Ga0157373_10028635 | 3300013100 | Bacteria | 4018 |
| 262 | Ga0157369_10106869 | 3300013105 | Bacteria | 2978 |
| 263 | Ga0157374_10004809 | 3300013296 | Bacteria | 11335 |
| 264 | Ga0157374_10057989 | 3300013296 | Bacteria | 3618 |
| 265 | Ga0157378_10006604 | 3300013297 | Bacteria | 10133 |
| 266 | Ga0157378_10202383 | 3300013297 | Bacteria | 1878 |
| 267 | Ga0163162_10001937 | 3300013306 | Bacteria | 19439 |
| 268 | Ga0163162_10171848 | 3300013306 | Bacteria | 2292 |
| 269 | Ga0157372_10009498 | 3300013307 | Bacteria | 10344 |
| 270 | Ga0157375_10003994 | 3300013308 | Bacteria | 12794 |
| 271 | Ga0157375_10048018 | 3300013308 | Bacteria | 4173 |
| 272 | Ga0157375_10157230 | 3300013308 | Bacteria | 2413 |
| 273 | Ga0163163_10003757 | 3300014325 | Bacteria | 12927 |
| 274 | Ga0163163_10005510 | 3300014325 | Bacteria | 10957 |
| 275 | Ga0163163_10069845 | 3300014325 | Bacteria | 3497 |
| 276 | Ga0163163_10143863 | 3300014325 | Bacteria | 2427 |
| 277 | Ga0157380_10002362 | 3300014326 | Bacteria | 12682 |
| 278 | Ga0157380_10007960 | 3300014326 | Bacteria | 7549 |
| 279 | Ga0157377_10001240 | 3300014745 | Bacteria | 10912 |
| 280 | Ga0157377_10056448 | 3300014745 | Bacteria | 2230 |
| 281 | Ga0157379_10000293 | 3300014968 | Bacteria | 39625 |
| 282 | Ga0157379_10007214 | 3300014968 | Bacteria | 9616 |
| 283 | Ga0157379_10174308 | 3300014968 | Bacteria | 1941 |
| 284 | Ga0157376_10000531 | 3300014969 | Bacteria | 24495 |
| 285 | Ga0163161_10000209 | 3300017792 | Bacteria | 53534 |
| 286 | Ga0206354_10351988 | 3300020081 | Bacteria | 1302 |
| 287 | Ga0213875_10001189 | 3300021388 | Bacteria | 17806 |
| 288 | Ga0213875_10043382 | 3300021388 | Bacteria | 2113 |
| 289 | Ga0224572_1001510 | 3300024225 | Bacteria | 3470 |
| 290 | Ga0207666_1000011 | 3300025271 | Bacteria | 46553 |
| 291 | Ga0207673_1000294 | 3300025290 | Bacteria | 5034 |
| 292 | Ga0207697_10000044 | 3300025315 | Bacteria | 48337 |
| 293 | Ga0207653_10004900 | 3300025885 | Bacteria | 4182 |
| 294 | Ga0207682_10000260 | 3300025893 | Bacteria | 23782 |
| 295 | Ga0207692_10000613 | 3300025898 | Bacteria | 12553 |
| 296 | Ga0207642_10001373 | 3300025899 | Bacteria | 7553 |
| 297 | Ga0207642_10010355 | 3300025899 | Bacteria | 3283 |
| 298 | Ga0207710_10003110 | 3300025900 | Bacteria | 7435 |
| 299 | Ga0207710_10009455 | 3300025900 | Bacteria | 4100 |
| 300 | Ga0207688_10000717 | 3300025901 | Bacteria | 16422 |
| 301 | Ga0207688_10000723 | 3300025901 | Bacteria | 16367 |
| 302 | Ga0207680_10004972 | 3300025903 | Bacteria | 6331 |
| 303 | Ga0207647_10008700 | 3300025904 | Bacteria | 7251 |
| 304 | Ga0207647_10034325 | 3300025904 | Bacteria | 3240 |
| 305 | Ga0207647_10063403 | 3300025904 | Bacteria | 2248 |
| 306 | Ga0207685_10001855 | 3300025905 | Bacteria | 4631 |
| 307 | Ga0207685_10037159 | 3300025905 | Bacteria | 1791 |
| 308 | Ga0207699_10107067 | 3300025906 | Bacteria | 1785 |
| 309 | Ga0207645_10000281 | 3300025907 | Bacteria | 42381 |
| 310 | Ga0207645_10010774 | 3300025907 | Bacteria | 6268 |
| 311 | Ga0207645_10040113 | 3300025907 | Bacteria | 2998 |
| 312 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 313 | Ga0207643_10001287 | 3300025908 | Bacteria | 14631 |
| 314 | Ga0207705_10111615 | 3300025909 | Bacteria | 2021 |
| 315 | Ga0207684_10112647 | 3300025910 | Bacteria | 2329 |
| 316 | Ga0207684_10169945 | 3300025910 | Bacteria | 1879 |
| 317 | Ga0207654_10002060 | 3300025911 | Bacteria | 10312 |
| 318 | Ga0207707_10000551 | 3300025912 | Bacteria | 38020 |
| 319 | Ga0207707_10070266 | 3300025912 | Bacteria | 3051 |
| 320 | Ga0207671_10031487 | 3300025914 | Bacteria | 3952 |
| 321 | Ga0207671_10056615 | 3300025914 | Bacteria | 2905 |
| 322 | Ga0207693_10099274 | 3300025915 | Bacteria | 2283 |
| 323 | Ga0207693_10129461 | 3300025915 | Bacteria | 1984 |
| 324 | Ga0207663_10006436 | 3300025916 | Bacteria | 6008 |
| 325 | Ga0207663_10034591 | 3300025916 | Bacteria | 3023 |
| 326 | Ga0207660_10000992 | 3300025917 | Bacteria | 18816 |
| 327 | Ga0207660_10016384 | 3300025917 | Bacteria | 4905 |
| 328 | Ga0207660_10089349 | 3300025917 | Bacteria | 2280 |
| 329 | Ga0207660_10124788 | 3300025917 | Bacteria | 1954 |
| 330 | Ga0207662_10000123 | 3300025918 | Bacteria | 37327 |
| 331 | Ga0207662_10005962 | 3300025918 | Bacteria | 6547 |
| 332 | Ga0207662_10066520 | 3300025918 | Bacteria | 2171 |
| 333 | Ga0207657_10000358 | 3300025919 | Bacteria | 48238 |
| 334 | Ga0207657_10013894 | 3300025919 | Bacteria | 7879 |
| 335 | Ga0207657_10032767 | 3300025919 | Bacteria | 4690 |
| 336 | Ga0207657_10072501 | 3300025919 | Bacteria | 2913 |
| 337 | Ga0207649_10000545 | 3300025920 | Bacteria | 26032 |
| 338 | Ga0207649_10155957 | 3300025920 | Bacteria | 1577 |
| 339 | Ga0207652_10004318 | 3300025921 | Bacteria | 11589 |
| 340 | Ga0207652_10072131 | 3300025921 | Bacteria | 3002 |
| 341 | Ga0207652_10079520 | 3300025921 | Bacteria | 2864 |
| 342 | Ga0207652_10118809 | 3300025921 | Bacteria | 2350 |
| 343 | Ga0207681_10000286 | 3300025923 | Bacteria | 37397 |
| 344 | Ga0207681_10240093 | 3300025923 | Bacteria | 1410 |
| 345 | Ga0207650_10006950 | 3300025925 | Bacteria | 7716 |
| 346 | Ga0207650_10079759 | 3300025925 | Bacteria | 2480 |
| 347 | Ga0207650_10222435 | 3300025925 | Bacteria | 1520 |
| 348 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 349 | Ga0207659_10005686 | 3300025926 | Bacteria | 7588 |
| 350 | Ga0207687_10000149 | 3300025927 | Bacteria | 46713 |
| 351 | Ga0207687_10011780 | 3300025927 | Bacteria | 5721 |
| 352 | Ga0207700_10029405 | 3300025928 | Bacteria | 3877 |
| 353 | Ga0207664_10025759 | 3300025929 | Bacteria | 4436 |
| 354 | Ga0207644_10000724 | 3300025931 | Bacteria | 20908 |
| 355 | Ga0207644_10007078 | 3300025931 | Bacteria | 7312 |
| 356 | Ga0207644_10012722 | 3300025931 | Bacteria | 5595 |
| 357 | Ga0207644_10214303 | 3300025931 | Bacteria | 1524 |
| 358 | Ga0207690_10000203 | 3300025932 | Bacteria | 46451 |
| 359 | Ga0207690_10035633 | 3300025932 | Bacteria | 3216 |
| 360 | Ga0207706_10001347 | 3300025933 | Bacteria | 24537 |
| 361 | Ga0207706_10002188 | 3300025933 | Bacteria | 19056 |
| 362 | Ga0207686_10007108 | 3300025934 | Bacteria | 6023 |
| 363 | Ga0207709_10000607 | 3300025935 | Bacteria | 29669 |
| 364 | Ga0207670_10000125 | 3300025936 | Bacteria | 50796 |
| 365 | Ga0207670_10033086 | 3300025936 | Bacteria | 3329 |
| 366 | Ga0207670_10269436 | 3300025936 | Bacteria | 1323 |
| 367 | Ga0207669_10000357 | 3300025937 | Bacteria | 20792 |
| 368 | Ga0207669_10019383 | 3300025937 | Bacteria | 3540 |
| 369 | Ga0207704_10001003 | 3300025938 | Bacteria | 12514 |
| 370 | Ga0207665_10021414 | 3300025939 | Bacteria | 4251 |
| 371 | Ga0207665_10060707 | 3300025939 | Bacteria | 2561 |
| 372 | Ga0207691_10000256 | 3300025940 | Bacteria | 52748 |
| 373 | Ga0207691_10001091 | 3300025940 | Bacteria | 26989 |
| 374 | Ga0207691_10092172 | 3300025940 | Bacteria | 2713 |
| 375 | Ga0207711_10035444 | 3300025941 | Bacteria | 4229 |
| 376 | Ga0207689_10000008 | 3300025942 | Bacteria | 127942 |
| 377 | Ga0207689_10063168 | 3300025942 | Bacteria | 3046 |
| 378 | Ga0207661_10000104 | 3300025944 | Bacteria | 53977 |
| 379 | Ga0207661_10022650 | 3300025944 | Bacteria | 4736 |
| 380 | Ga0207679_10000196 | 3300025945 | Bacteria | 48433 |
| 381 | Ga0207679_10020897 | 3300025945 | Bacteria | 4428 |
| 382 | Ga0207679_10201263 | 3300025945 | Bacteria | 1663 |
| 383 | Ga0207667_10023002 | 3300025949 | Bacteria | 6871 |
| 384 | Ga0207667_10284618 | 3300025949 | Bacteria | 1689 |
| 385 | Ga0207651_10001000 | 3300025960 | Bacteria | 12479 |
| 386 | Ga0207651_10015133 | 3300025960 | Bacteria | 4474 |
| 387 | Ga0207712_10000967 | 3300025961 | Bacteria | 20676 |
| 388 | Ga0207712_10013794 | 3300025961 | Bacteria | 5184 |
| 389 | Ga0207668_10070301 | 3300025972 | Bacteria | 2495 |
| 390 | Ga0207640_10000157 | 3300025981 | Bacteria | 49126 |
| 391 | Ga0207640_10023741 | 3300025981 | Bacteria | 3690 |
| 392 | Ga0207640_10284922 | 3300025981 | Bacteria | 1300 |
| 393 | Ga0207658_10036309 | 3300025986 | Bacteria | 3532 |
| 394 | Ga0207677_10000609 | 3300026023 | Bacteria | 22003 |
| 395 | Ga0207677_10003120 | 3300026023 | Bacteria | 8746 |
| 396 | Ga0207703_10003859 | 3300026035 | Bacteria | 12455 |
| 397 | Ga0207639_10002440 | 3300026041 | Bacteria | 12492 |
| 398 | Ga0207678_10004329 | 3300026067 | Bacteria | 12744 |
| 399 | Ga0207678_10020490 | 3300026067 | Bacteria | 5797 |
| 400 | Ga0207678_10100021 | 3300026067 | Bacteria | 2477 |
| 401 | Ga0207678_10122078 | 3300026067 | Bacteria | 2223 |
| 402 | Ga0207708_10002782 | 3300026075 | Bacteria | 12851 |
| 403 | Ga0207708_10003027 | 3300026075 | Bacteria | 12394 |
| 404 | Ga0207708_10336371 | 3300026075 | Bacteria | 1235 |
| 405 | Ga0207702_10003955 | 3300026078 | Bacteria | 13300 |
| 406 | Ga0207702_10041453 | 3300026078 | Bacteria | 3861 |
| 407 | Ga0207702_10109740 | 3300026078 | Bacteria | 2450 |
| 408 | Ga0207641_10002938 | 3300026088 | Bacteria | 15413 |
| 409 | Ga0207648_10002628 | 3300026089 | Bacteria | 19224 |
| 410 | Ga0207648_10005563 | 3300026089 | Bacteria | 12680 |
| 411 | Ga0207648_10022367 | 3300026089 | Bacteria | 5680 |
| 412 | Ga0207676_10003560 | 3300026095 | Bacteria | 11004 |
| 413 | Ga0207676_10004603 | 3300026095 | Bacteria | 9767 |
| 414 | Ga0207676_10149133 | 3300026095 | Bacteria | 2012 |
| 415 | Ga0207674_10009174 | 3300026116 | Bacteria | 11343 |
| 416 | Ga0207675_100000604 | 3300026118 | Bacteria | 35079 |
| 417 | Ga0207675_100002508 | 3300026118 | Bacteria | 18169 |
| 418 | Ga0207675_100407151 | 3300026118 | Bacteria | 1341 |
| 419 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 420 | Ga0207698_10000378 | 3300026142 | Bacteria | 25887 |
| 421 | Ga0207698_10009646 | 3300026142 | Bacteria | 6164 |
| 422 | Ga0207698_10195552 | 3300026142 | Bacteria | 1806 |
| 423 | Ga0209984_1004221 | 3300027424 | Bacteria | 1684 |
| 424 | Ga0209179_1000846 | 3300027512 | Bacteria | 3395 |
| 425 | Ga0210002_1003918 | 3300027617 | Bacteria | 2208 |
| 426 | Ga0209983_1006582 | 3300027665 | Bacteria | 2384 |
| 427 | Ga0209998_10000566 | 3300027717 | Bacteria | 9989 |
| 428 | Ga0209998_10001948 | 3300027717 | Bacteria | 4845 |
| 429 | Ga0207428_10000165 | 3300027907 | Bacteria | 91701 |
| 430 | Ga0207428_10000446 | 3300027907 | Bacteria | 50240 |
| 431 | Ga0207428_10024147 | 3300027907 | Bacteria | 5106 |
| 432 | Ga0207428_10081742 | 3300027907 | Bacteria | 2522 |
| 433 | Ga0268266_10044658 | 3300028379 | Bacteria | 3788 |
| 434 | Ga0268266_10054562 | 3300028379 | Bacteria | 3434 |
| 435 | Ga0268266_10074462 | 3300028379 | Bacteria | 2948 |
| 436 | Ga0268265_10001687 | 3300028380 | Bacteria | 18006 |
| 437 | Ga0268265_10246208 | 3300028380 | Bacteria | 1580 |
| 438 | Ga0268264_10002029 | 3300028381 | Bacteria | 18124 |
| 439 | Ga0268264_10008544 | 3300028381 | Bacteria | 8512 |
| 440 | Ga0265338_10012007 | 3300028800 | Bacteria | 9915 |
| 441 | Ga0265338_10030503 | 3300028800 | Bacteria | 5310 |
| 442 | Ga0265763_1000140 | 3300030763 | Bacteria | 3577 |
| 443 | Ga0265760_10052991 | 3300031090 | Bacteria | 1224 |
| 444 | Ga0265330_10022632 | 3300031235 | Bacteria | 2859 |
| 445 | Ga0265328_10002945 | 3300031239 | Bacteria | 7599 |
| 446 | Ga0265325_10009739 | 3300031241 | Bacteria | 5601 |
| 447 | Ga0265325_10012475 | 3300031241 | Bacteria | 4859 |
| 448 | Ga0265325_10021595 | 3300031241 | Bacteria | 3533 |
| 449 | Ga0265325_10093896 | 3300031241 | Bacteria | 1476 |
| 450 | Ga0265339_10004883 | 3300031249 | Bacteria | 9048 |
| 451 | Ga0265313_10000069 | 3300031595 | Bacteria | 100065 |
| 452 | Ga0265313_10000794 | 3300031595 | Bacteria | 31959 |
| 453 | Ga0265313_10004781 | 3300031595 | Bacteria | 10206 |
| 454 | Ga0265313_10011241 | 3300031595 | Bacteria | 5579 |
| 455 | Ga0316579_10017096 | 3300031691 | Bacteria | 3178 |
| 456 | Ga0265314_10005328 | 3300031711 | Bacteria | 11638 |
| 457 | Ga0265314_10130253 | 3300031711 | Bacteria | 1570 |
| 458 | Ga0265342_10000502 | 3300031712 | Bacteria | 41908 |
| 459 | Ga0373930_0000066 | 3300034816 | Bacteria | 10144 |
| 460 | Ga0373948_0000581 | 3300034817 | Bacteria | 4666 |
| 461 | Ga0373950_0003960 | 3300034818 | Bacteria | 2151 |
| 462 | Ga0373958_0000149 | 3300034819 | Bacteria | 7846 |
| 463 | Ga0373959_0000484 | 3300034820 | Bacteria | 7248 |
| 464 | Ga0373959_0001824 | 3300034820 | Bacteria | 3397 |
| 465 | Ga0373938_0000806 | 3300034957 | Bacteria | 5081 |
| 466 | Ga0373926_0006406 | 3300035083 | Bacteria | 3911 |
| 467 | Ga0373928_0000912 | 3300035084 | Bacteria | 5781 |
| 468 | Ga0373928_0003692 | 3300035084 | Bacteria | 2919 |
| 469 | Ga0373929_0000596 | 3300035085 | Bacteria | 6986 |
| 470 | Ga0373929_0001194 | 3300035085 | Bacteria | 5028 |
| 471 | Ga0373940_0000711 | 3300035088 | Bacteria | 5398 |
| 472 | Ga0373949_0001224 | 3300035090 | Bacteria | 7585 |
| 473 | Ga0373949_0001578 | 3300035090 | Bacteria | 6424 |
| 474 | Ga0373951_0000469 | 3300035091 | Bacteria | 11565 |
| 475 | Ga0373951_0000642 | 3300035091 | Bacteria | 9641 |
| 476 | Ga0373952_0000323 | 3300035092 | Bacteria | 8035 |
| 477 | Ga0373952_0001223 | 3300035092 | Bacteria | 4674 |
| 478 | Ga0373923_0000600 | 3300035111 | Bacteria | 8962 |
| 479 | Ga0373923_0034016 | 3300035111 | Bacteria | 2067 |
| 480 | Ga0373932_0000757 | 3300035112 | Bacteria | 9626 |
| 481 | Ga0373932_0001683 | 3300035112 | Bacteria | 6030 |
| 482 | Ga0373936_0000140 | 3300035113 | Bacteria | 25032 |
| 483 | Ga0373936_0078699 | 3300035113 | Bacteria | 1369 |
| 484 | Ga0373941_0000083 | 3300035115 | Bacteria | 15466 |
| 485 | Ga0373941_0007438 | 3300035115 | Bacteria | 2679 |
| 486 | Ga0373945_0004242 | 3300035116 | Bacteria | 4544 |
| 487 | Ga0373945_0005199 | 3300035116 | Bacteria | 4159 |
| 488 | Ga0373953_0002635 | 3300035117 | Bacteria | 5432 |
| 489 | Ga0373954_0020918 | 3300035118 | Bacteria | 2961 |
| 490 | Ga0373956_0008031 | 3300035119 | Bacteria | 4265 |
| 491 | Ga0373956_0114562 | 3300035119 | Bacteria | 1256 |
| 492 | Ga0373957_0091532 | 3300035120 | Bacteria | 1209 |
| 493 | Ga0373960_0000185 | 3300035121 | Bacteria | 11147 |
| 494 | Ga0373960_0000330 | 3300035121 | Bacteria | 9027 |
| 495 | Ga0373943_0000723 | 3300035170 | Bacteria | 14457 |
| 496 | Ga0373943_0005802 | 3300035170 | Bacteria | 5546 |
| 497 | Ga0373943_0009931 | 3300035170 | Bacteria | 4266 |
| 498 | Ga0373943_0087965 | 3300035170 | Bacteria | 1604 |
| 499 | Ga0373946_0001669 | 3300035171 | Bacteria | 7732 |
| 500 | Ga0373946_0001730 | 3300035171 | Bacteria | 7613 |
| 501 | Ga0373955_0000121 | 3300035172 | Bacteria | 31151 |
| 502 | Ga0373955_0024471 | 3300035172 | Bacteria | 3089 |
| 503 | Ga0373955_0110807 | 3300035172 | Bacteria | 1587 |
| 504 | Ga0373942_0001462 | 3300035207 | Bacteria | 6070 |
| 505 | Ga0373942_0003399 | 3300035207 | Bacteria | 3741 |
| 506 | Ga0373961_0000569 | 3300035241 | Bacteria | 13935 |
| 507 | Ga0373962_0000149 | 3300035242 | Bacteria | 14459 |
| 508 | Ga0373924_0000521 | 3300035410 | Bacteria | 11807 |
| 509 | Ga0373924_0019444 | 3300035410 | Bacteria | 2631 |
| 510 | Ga0373924_0057262 | 3300035410 | Bacteria | 1625 |
| 511 | Ga0373931_0002244 | 3300035691 | Bacteria | 8538 |
| 512 | Ga0373931_0061116 | 3300035691 | Bacteria | 2031 |
| 513 | Ga0373931_0071457 | 3300035691 | Bacteria | 1896 |
| 514 | Ga0373935_0024273 | 3300035692 | Bacteria | 3731 |
| 515 | Ga0373935_0030967 | 3300035692 | Bacteria | 3317 |
| 516 | Ga0373935_0046183 | 3300035692 | Bacteria | 2750 |
| 517 | Ga0373935_0211080 | 3300035692 | Bacteria | 1345 |
| 518 | Ga0373927_0001763 | 3300035695 | Bacteria | 16150 |
| 519 | Ga0373927_0021556 | 3300035695 | Bacteria | 4223 |
| 520 | Ga0373927_0023719 | 3300035695 | Bacteria | 4016 |
| 521 | Ga0373927_0030831 | 3300035695 | Bacteria | 3498 |
| 522 | Ga0373933_0001004 | 3300035724 | Bacteria | 17169 |
| 523 | Ga0373933_0015592 | 3300035724 | Bacteria | 4237 |
| 524 | Ga0373933_0087115 | 3300035724 | Bacteria | 1923 |
| 525 | Ga0373947_0001341 | 3300035725 | Bacteria | 15139 |
| 526 | Ga0373947_0005612 | 3300035725 | Bacteria | 7318 |
| 527 | Ga0373947_0006555 | 3300035725 | Bacteria | 6753 |
| 528 | Ga0373947_0031905 | 3300035725 | Bacteria | 3103 |
| 529 | Ga0373947_0041783 | 3300035725 | Bacteria | 2736 |
| 530 | Ga0373947_0044632 | 3300035725 | Bacteria | 2650 |
| 531 | Ga0373947_0054692 | 3300035725 | Bacteria | 2409 |
| 532 | Ga0373947_0111980 | 3300035725 | Bacteria | 1726 |
| 533 | Ga0373937_0001420 | 3300036401 | Bacteria | 19998 |
| 534 | Ga0373937_0002850 | 3300036401 | Bacteria | 14440 |
| 535 | Ga0373937_0104592 | 3300036401 | Bacteria | 2630 |
| 536 | Ga0373925_0000016 | 3300037068 | Bacteria | 176830 |
| 537 | Ga0373925_0001095 | 3300037068 | Bacteria | 24265 |
| 538 | Ga0373925_0123614 | 3300037068 | Bacteria | 2011 |
| 539 | Ga0395900_0001539 | 3300037418 | Bacteria | 27389 |
| 540 | Ga0395900_0075561 | 3300037418 | Bacteria | 3464 |
| 541 | Ga0395898_0013503 | 3300037466 | Bacteria | 8409 |
| 542 | Ga0395898_0024475 | 3300037466 | Bacteria | 6090 |
| 543 | Ga0395898_0036924 | 3300037466 | Bacteria | 4849 |
| 544 | Ga0436364_0170641 | 3300037853 | Bacteria | 30786 |
| 545 | Ga0436364_1548064 | 3300037853 | Bacteria | 2419 |
| 546 | Ga0395901_0027121 | 3300038443 | Bacteria | 5883 |
| 547 | Ga0439441_007620 | 3300042001 | Bacteria | 1750 |
| 548 | Ga0451577_0134237 | 3300042876 | Bacteria | 2222 |
| 549 | Ga0466963_0138338 | 3300044694 | Bacteria | 1686 |
| 550 | Ga0466968_0003779 | 3300044735 | Bacteria | 5610 |
| 551 | Ga0466957_0008459 | 3300044842 | Bacteria | 5853 |
| 552 | Ga0466959_0090981 | 3300045049 | Bacteria | 2191 |
| 553 | Ga0466958_0026576 | 3300045836 | Bacteria | 3422 |
| 554 | Ga0466967_0007437 | 3300045976 | Bacteria | 7900 |
| 555 | Ga0466967_0354484 | 3300045976 | Bacteria | 1421 |
| 556 | Ga0495592_0000044 | 3300046454 | Bacteria | 118749 |
| 557 | Ga0495592_0036712 | 3300046454 | Bacteria | 3689 |
| 558 | Ga0495629_0000798 | 3300046459 | Bacteria | 25474 |
| 559 | Ga0495629_0004823 | 3300046459 | Bacteria | 10120 |
| 560 | Ga0495641_0019161 | 3300046461 | Bacteria | 3510 |
| 561 | Ga0495651_0000702 | 3300046462 | Bacteria | 26046 |
| 562 | Ga0495651_0004981 | 3300046462 | Bacteria | 10147 |
| 563 | Ga0495653_0000022 | 3300046463 | Bacteria | 169653 |
| 564 | Ga0495653_0064111 | 3300046463 | Bacteria | 2769 |
| 565 | Ga0495582_0016959 | 3300046473 | Bacteria | 3988 |
| 566 | Ga0495582_0070011 | 3300046473 | Bacteria | 1940 |
| 567 | Ga0495639_0026504 | 3300046475 | Bacteria | 2562 |
| 568 | Ga0495662_0004014 | 3300046476 | Bacteria | 7415 |
| 569 | Ga0495664_0000013 | 3300046477 | Bacteria | 204282 |
| 570 | Ga0495664_0016952 | 3300046477 | Bacteria | 4160 |
| 571 | Ga0495664_0159783 | 3300046477 | Bacteria | 1367 |
| 572 | Ga0495584_0021641 | 3300046491 | Bacteria | 3266 |
| 573 | Ga0495594_0073564 | 3300046499 | Bacteria | 1902 |
| 574 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 575 | Ga0495618_0000032 | 3300046514 | Bacteria | 104874 |
| 576 | Ga0495618_0010451 | 3300046514 | Bacteria | 5614 |
| 577 | Ga0495618_0056603 | 3300046514 | Bacteria | 2482 |
| 578 | Ga0495618_0081759 | 3300046514 | Bacteria | 2063 |
| 579 | Ga0495628_0000014 | 3300046516 | Bacteria | 205818 |
| 580 | Ga0495628_0098574 | 3300046516 | Bacteria | 2257 |
| 581 | Ga0495630_0006343 | 3300046517 | Bacteria | 8404 |
| 582 | Ga0495630_0011540 | 3300046517 | Bacteria | 6397 |
| 583 | Ga0495630_0208308 | 3300046517 | Bacteria | 1492 |
| 584 | Ga0495666_0068797 | 3300046526 | Bacteria | 1685 |
| 585 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 586 | Ga0495652_0060214 | 3300046529 | Bacteria | 3209 |
| 587 | Ga0495665_0048847 | 3300046531 | Bacteria | 2243 |
| 588 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 589 | Ga0495640_0005848 | 3300046533 | Bacteria | 9762 |
| 590 | Ga0495640_0040037 | 3300046533 | Bacteria | 3284 |
| 591 | Ga0495640_0093148 | 3300046533 | Bacteria | 1986 |
| 592 | Ga0495586_0083366 | 3300046535 | Bacteria | 1759 |
| 593 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 594 | Ga0495587_0004639 | 3300046536 | Bacteria | 9033 |
| 595 | Ga0495587_0115167 | 3300046536 | Bacteria | 1542 |
| 596 | Ga0495609_0077875 | 3300046538 | Bacteria | 1451 |
| 597 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 598 | Ga0495645_0012073 | 3300046543 | Bacteria | 6087 |
| 599 | Ga0495667_0000009 | 3300046559 | Bacteria | 223329 |
| 600 | Ga0495667_0000967 | 3300046559 | Bacteria | 18583 |
| 601 | Ga0495656_0037389 | 3300046615 | Bacteria | 2005 |
| 602 | Ga0495634_0000033 | 3300046642 | Bacteria | 109811 |
| 603 | Ga0495634_0006572 | 3300046642 | Bacteria | 8822 |
| 604 | Ga0495634_0030799 | 3300046642 | Bacteria | 3700 |
| 605 | Ga0495625_0086286 | 3300046660 | Bacteria | 2178 |
| 606 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 607 | Ga0495635_0010576 | 3300046663 | Bacteria | 6459 |
| 608 | Ga0495657_0000342 | 3300046675 | Bacteria | 43000 |
| 609 | Ga0495657_0121908 | 3300046675 | Bacteria | 1641 |
| 610 | Ga0495599_0000030 | 3300046678 | Bacteria | 113715 |
| 611 | Ga0495623_0000059 | 3300046679 | Bacteria | 67952 |
| 612 | Ga0495623_0004459 | 3300046679 | Bacteria | 9191 |
| 613 | Ga0495623_0008559 | 3300046679 | Bacteria | 6644 |
| 614 | Ga0495646_0000031 | 3300046680 | Bacteria | 87445 |
| 615 | Ga0495646_0005451 | 3300046680 | Bacteria | 8044 |
| 616 | Ga0495658_0008450 | 3300046683 | Bacteria | 5102 |
| 617 | Ga0495658_0035108 | 3300046683 | Bacteria | 2756 |
| 618 | Ga0495658_0037237 | 3300046683 | Bacteria | 2688 |
| 619 | Ga0495658_0124924 | 3300046683 | Bacteria | 1560 |
| 620 | Ga0495613_0041141 | 3300046689 | Bacteria | 3423 |
| 621 | Ga0495613_0058832 | 3300046689 | Bacteria | 2819 |
| 622 | Ga0495613_0090427 | 3300046689 | Bacteria | 2217 |
| 623 | Ga0495624_0009592 | 3300046690 | Bacteria | 6702 |
| 624 | Ga0495624_0182624 | 3300046690 | Bacteria | 1278 |
| 625 | Ga0495600_0000141 | 3300046809 | Bacteria | 41270 |
| 626 | Ga0495581_0006241 | 3300047315 | Bacteria | 6912 |
| 627 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 628 | Ga0495604_0000619 | 3300047317 | Bacteria | 30531 |
| 629 | Ga0495604_0028575 | 3300047317 | Bacteria | 4437 |
| 630 | Ga0495604_0034208 | 3300047317 | Bacteria | 4022 |
| 631 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 632 | Ga0495674_0000575 | 3300047319 | Bacteria | 34286 |
| 633 | Ga0495674_0024950 | 3300047319 | Bacteria | 5487 |
| 634 | Ga0495674_0200114 | 3300047319 | Bacteria | 1657 |
| 635 | Ga0495676_0079119 | 3300047321 | Bacteria | 2500 |
| 636 | Ga0495680_0000481 | 3300047322 | Bacteria | 44868 |
| 637 | Ga0495680_0008522 | 3300047322 | Bacteria | 9314 |
| 638 | Ga0495675_0000048 | 3300047444 | Bacteria | 81486 |
| 639 | Ga0495684_0000019 | 3300047471 | Bacteria | 153938 |
| 640 | Ga0495684_0123805 | 3300047471 | Bacteria | 1946 |
| 641 | Ga0495593_0000511 | 3300047673 | Bacteria | 21936 |
| 642 | Ga0495593_0027144 | 3300047673 | Bacteria | 3154 |
| 643 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 644 | Ga0495602_0013129 | 3300048088 | Bacteria | 8473 |
| 645 | Ga0495602_0084401 | 3300048088 | Bacteria | 2657 |
| 646 | Ga0496100_0000610 | 3300048903 | Bacteria | 16923 |
| 647 | Ga0496100_0006059 | 3300048903 | Bacteria | 6568 |
| 648 | Ga0496100_0223614 | 3300048903 | Bacteria | 1382 |
| 649 | Ga0496101_0000464 | 3300048904 | Bacteria | 25674 |
| 650 | Ga0496101_0012807 | 3300048904 | Bacteria | 5608 |
| 651 | Ga0496101_0037886 | 3300048904 | Bacteria | 3422 |
| 652 | Ga0496101_0049295 | 3300048904 | Bacteria | 3029 |
| 653 | Ga0496101_0074666 | 3300048904 | Bacteria | 2494 |
| 654 | Ga0496102_0001120 | 3300048905 | Bacteria | 24582 |
| 655 | Ga0496102_0017419 | 3300048905 | Bacteria | 6294 |
| 656 | Ga0496102_0023365 | 3300048905 | Bacteria | 5490 |
| 657 | Ga0496102_0065495 | 3300048905 | Bacteria | 3330 |
| 658 | Ga0496102_0334518 | 3300048905 | Bacteria | 1426 |
| 659 | Ga0496102_0397449 | 3300048905 | Bacteria | 1296 |
| 660 | Ga0496103_0000611 | 3300048906 | Bacteria | 27883 |
| 661 | Ga0496103_0002918 | 3300048906 | Bacteria | 10604 |
| 662 | Ga0496103_0046347 | 3300048906 | Bacteria | 2684 |
| 663 | Ga0496104_0001156 | 3300048907 | Bacteria | 22621 |
| 664 | Ga0496104_0003012 | 3300048907 | Bacteria | 14510 |
| 665 | Ga0496104_0029606 | 3300048907 | Bacteria | 5079 |
| 666 | Ga0496105_0004387 | 3300048908 | Bacteria | 10622 |
| 667 | Ga0496105_0032636 | 3300048908 | Bacteria | 4274 |
| 668 | Ga0496105_0053941 | 3300048908 | Bacteria | 3320 |
| 669 | Ga0496106_0000481 | 3300048909 | Bacteria | 28369 |
| 670 | Ga0496106_0000541 | 3300048909 | Bacteria | 26824 |
| 671 | Ga0496106_0059385 | 3300048909 | Bacteria | 2897 |
| 672 | Ga0496106_0060089 | 3300048909 | Bacteria | 2880 |
| 673 | Ga0496106_0073625 | 3300048909 | Bacteria | 2613 |
| 674 | Ga0496107_0002295 | 3300048910 | Bacteria | 12344 |
| 675 | Ga0496107_0005580 | 3300048910 | Bacteria | 8618 |
| 676 | Ga0496107_0097140 | 3300048910 | Bacteria | 2156 |
| 677 | Ga0496108_0001251 | 3300048911 | Bacteria | 19871 |
| 678 | Ga0496108_0007993 | 3300048911 | Bacteria | 8579 |
| 679 | Ga0496108_0023781 | 3300048911 | Bacteria | 5042 |
| 680 | Ga0496108_0137277 | 3300048911 | Bacteria | 2105 |
| 681 | Ga0496108_0258755 | 3300048911 | Bacteria | 1514 |
| 682 | Ga0496109_0003885 | 3300048912 | Bacteria | 12475 |
| 683 | Ga0496109_0008609 | 3300048912 | Bacteria | 8685 |
| 684 | Ga0496109_0024306 | 3300048912 | Bacteria | 5386 |
| 685 | Ga0496109_0037781 | 3300048912 | Bacteria | 4363 |
| 686 | Ga0496109_0049834 | 3300048912 | Bacteria | 3813 |
| 687 | Ga0496109_0201950 | 3300048912 | Bacteria | 1869 |
| 688 | Ga0496109_0328789 | 3300048912 | Bacteria | 1443 |
| 689 | Ga0496110_0013043 | 3300048913 | Bacteria | 6855 |
| 690 | Ga0496110_0016839 | 3300048913 | Bacteria | 6108 |
| 691 | Ga0496110_0023634 | 3300048913 | Bacteria | 5229 |
| 692 | Ga0496110_0047895 | 3300048913 | Bacteria | 3745 |
| 693 | Ga0496110_0291398 | 3300048913 | Bacteria | 1486 |
| 694 | Ga0496111_0006454 | 3300048914 | Bacteria | 7618 |
| 695 | Ga0496111_0008573 | 3300048914 | Bacteria | 6773 |
| 696 | Ga0496111_0016437 | 3300048914 | Bacteria | 5097 |
| 697 | Ga0496111_0067464 | 3300048914 | Bacteria | 2599 |
| 698 | Ga0496111_0081003 | 3300048914 | Bacteria | 2369 |
| 699 | Ga0496112_0009148 | 3300048915 | Bacteria | 8899 |
| 700 | Ga0496112_0022787 | 3300048915 | Bacteria | 5975 |
| 701 | Ga0496112_0035817 | 3300048915 | Bacteria | 4837 |
| 702 | Ga0496112_0170603 | 3300048915 | Bacteria | 2141 |
| 703 | Ga0496112_0276674 | 3300048915 | Bacteria | 1626 |
| 704 | Ga0496112_0328433 | 3300048915 | Bacteria | 1473 |
| 705 | Ga0496113_0001441 | 3300048916 | Bacteria | 13217 |
| 706 | Ga0496113_0013130 | 3300048916 | Bacteria | 5594 |
| 707 | Ga0496114_0005881 | 3300048917 | Bacteria | 9642 |
| 708 | Ga0496114_0006370 | 3300048917 | Bacteria | 9287 |
| 709 | Ga0496114_0019321 | 3300048917 | Bacteria | 5520 |
| 710 | Ga0496114_0023227 | 3300048917 | Bacteria | 5059 |
| 711 | Ga0496114_0098648 | 3300048917 | Bacteria | 2491 |
| 712 | Ga0496114_0296429 | 3300048917 | Bacteria | 1427 |
| 713 | Ga0496115_0004336 | 3300048918 | Bacteria | 10266 |
| 714 | Ga0496115_0009733 | 3300048918 | Bacteria | 7158 |
| 715 | Ga0496115_0010227 | 3300048918 | Bacteria | 7001 |
| 716 | Ga0496115_0012138 | 3300048918 | Bacteria | 6479 |
| 717 | Ga0496115_0030482 | 3300048918 | Bacteria | 4243 |
| 718 | Ga0496115_0168699 | 3300048918 | Bacteria | 1810 |
| 719 | Ga0501032_0007222 | 3300049569 | Bacteria | 8127 |
| 720 | Ga0501033_0043907 | 3300049570 | Bacteria | 3327 |
| 721 | Ga0501034_0032378 | 3300049571 | Bacteria | 5310 |
| 722 | Ga0501034_0033286 | 3300049571 | Bacteria | 5230 |
| 723 | Ga0501036_0001657 | 3300049572 | Bacteria | 17249 |
| 724 | Ga0501036_0006781 | 3300049572 | Bacteria | 9302 |
| 725 | Ga0501036_0024249 | 3300049572 | Bacteria | 5113 |
| 726 | Ga0501037_0009558 | 3300049573 | Bacteria | 7118 |
| 727 | Ga0501038_0011889 | 3300049574 | Bacteria | 7944 |
| 728 | Ga0501038_0040577 | 3300049574 | Bacteria | 4063 |
| 729 | Ga0501039_0340307 | 3300049575 | Bacteria | 1179 |
| 730 | Ga0501043_0002225 | 3300049579 | Bacteria | 16540 |
| 731 | Ga0501043_0072709 | 3300049579 | Bacteria | 2701 |
| 732 | Ga0501046_0015198 | 3300049580 | Bacteria | 6473 |
| 733 | Ga0501046_0055276 | 3300049580 | Bacteria | 3121 |
| 734 | Ga0501047_0000314 | 3300049581 | Bacteria | 55906 |
| 735 | Ga0501047_0036499 | 3300049581 | Bacteria | 4750 |
| 736 | Ga0501047_0067324 | 3300049581 | Bacteria | 3451 |
| 737 | Ga0501047_0074843 | 3300049581 | Bacteria | 3260 |
| 738 | Ga0501047_0105953 | 3300049581 | Bacteria | 2692 |
| 739 | Ga0501048_0002000 | 3300049582 | Bacteria | 15488 |
| 740 | Ga0501048_0152016 | 3300049582 | Bacteria | 1638 |
| 741 | Ga0501069_0005233 | 3300049585 | Bacteria | 6740 |
| 742 | Ga0501070_0007677 | 3300049586 | Bacteria | 9150 |
| 743 | Ga0501070_0008242 | 3300049586 | Bacteria | 8811 |
| 744 | Ga0501070_0036638 | 3300049586 | Bacteria | 4096 |
| 745 | Ga0501070_0120289 | 3300049586 | Bacteria | 2170 |
| 746 | Ga0501070_0179273 | 3300049586 | Bacteria | 1744 |
| 747 | Ga0501070_0187341 | 3300049586 | Bacteria | 1702 |
| 748 | Ga0501071_0092413 | 3300049587 | Bacteria | 2224 |
| 749 | Ga0501073_0021006 | 3300049589 | Bacteria | 4710 |
| 750 | Ga0501073_0029354 | 3300049589 | Bacteria | 3931 |
| 751 | Ga0501073_0151284 | 3300049589 | Bacteria | 1609 |
| 752 | Ga0501074_0012343 | 3300049590 | Bacteria | 6210 |
| 753 | Ga0501076_0037276 | 3300049592 | Bacteria | 3812 |
| 754 | Ga0501077_0027575 | 3300049593 | Bacteria | 3606 |
| 755 | Ga0501077_0090573 | 3300049593 | Bacteria | 1938 |
| 756 | Ga0501079_0017339 | 3300049741 | Bacteria | 5499 |
| 757 | Ga0501080_0005419 | 3300049742 | Bacteria | 11382 |
| 758 | Ga0501080_0107373 | 3300049742 | Bacteria | 2587 |
| 759 | Ga0501080_0174281 | 3300049742 | Bacteria | 1982 |
| 760 | Ga0501081_0063257 | 3300049743 | Bacteria | 2568 |
| 761 | Ga0501083_0001743 | 3300049744 | Bacteria | 14830 |
| 762 | Ga0501083_0146733 | 3300049744 | Bacteria | 1545 |
| 763 | Ga0501035_0000896 | 3300049822 | Bacteria | 31485 |
| 764 | Ga0501035_0008967 | 3300049822 | Bacteria | 9304 |
| 765 | Ga0501035_0097360 | 3300049822 | Bacteria | 2584 |
| 766 | Ga0501044_0018297 | 3300049823 | Bacteria | 7508 |
| 767 | Ga0501044_0029583 | 3300049823 | Bacteria | 5774 |
| 768 | Ga0501044_0052167 | 3300049823 | Bacteria | 4215 |
| 769 | Ga0501044_0068384 | 3300049823 | Bacteria | 3618 |
| 770 | Ga0501044_0116445 | 3300049823 | Bacteria | 2678 |
| 771 | Ga0501044_0163405 | 3300049823 | Bacteria | 2202 |
| 772 | Ga0501044_0445252 | 3300049823 | Bacteria | 1203 |
| 773 | nmdc:mga03683_14002_c1 | 3300050489 | Bacteria | 2960 |
| 774 | nmdc:mga00v17_64993_c1 | 3300050491 | Bacteria | 2249 |
| 775 | nmdc:mga0yw44_19513_c1 | 3300050492 | Bacteria | 3741 |
| 776 | nmdc:mga0yw44_24505_c1 | 3300050492 | Bacteria | 3416 |
| 777 | nmdc:mga0yw44_40242_c1 | 3300050492 | Bacteria | 1705 |
| 778 | nmdc:mga0yw44_87501_c1 | 3300050492 | Bacteria | 1964 |
| 779 | nmdc:mga06z11_168866_c1 | 3300050494 | Bacteria | 1255 |
| 780 | nmdc:mga06z11_32793_c1 | 3300050494 | Bacteria | 2535 |
| 781 | nmdc:mga06z11_45630_c1 | 3300050494 | Bacteria | 2217 |
| 782 | nmdc:mga05p37_18721_c2 | 3300050507 | Bacteria | 7437 |
| 783 | nmdc:mga05p37_2380_c1 | 3300050507 | Bacteria | 21888 |
| 784 | nmdc:mga05p37_2506_c1 | 3300050507 | Bacteria | 12388 |
| 785 | nmdc:mga05p37_28335_c1 | 3300050507 | Bacteria | 6830 |
| 786 | nmdc:mga05p37_334629_c1 | 3300050507 | Bacteria | 1787 |
| 787 | nmdc:mga05p37_43056_c1 | 3300050507 | Bacteria | 5551 |
| 788 | nmdc:mga09592_770_c1 | 3300050508 | Bacteria | 16031 |
| 789 | nmdc:mga0qj67_35325_c1 | 3300050509 | Bacteria | 3907 |
| 790 | nmdc:mga0qj67_73509_c1 | 3300050509 | Bacteria | 2730 |
| 791 | nmdc:mga06r32_105175_c1 | 3300050510 | Bacteria | 2773 |
| 792 | nmdc:mga06r32_444_c1 | 3300050510 | Bacteria | 35056 |
| 793 | nmdc:mga06r32_60077_c1 | 3300050510 | Bacteria | 3657 |
| 794 | nmdc:mga08y16_218177_c1 | 3300050511 | Bacteria | 1975 |
| 795 | nmdc:mga08y16_3020_c1 | 3300050511 | Bacteria | 17372 |
| 796 | nmdc:mga08y16_3846_c1 | 3300050511 | Bacteria | 15611 |
| 797 | nmdc:mga08y16_68976_c1 | 3300050511 | Bacteria | 3686 |
| 798 | nmdc:mga08y16_939_c1 | 3300050511 | Bacteria | 28315 |
| 799 | nmdc:mga0n895_131781_c1 | 3300050512 | Bacteria | 2525 |
| 800 | nmdc:mga0n895_291_c1 | 3300050512 | Bacteria | 33000 |
| 801 | nmdc:mga0n895_345461_c1 | 3300050512 | Bacteria | 1507 |
| 802 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 803 | nmdc:mga0a205_467_c1 | 3300050515 | Bacteria | 29468 |
| 804 | nmdc:mga0sz30_32691_c1 | 3300050516 | Bacteria | 2159 |
| 805 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 806 | Ga0495601_0003096 | 3300053077 | Bacteria | 9495 |
| 807 | Ga0495601_0019818 | 3300053077 | Bacteria | 4106 |
| 808 | Ga0495601_0169504 | 3300053077 | Bacteria | 1427 |
| 809 | Ga0495612_0000012 | 3300053078 | Bacteria | 223883 |
| 810 | Ga0495612_0000478 | 3300053078 | Bacteria | 16063 |
| 811 | Ga0495612_0012953 | 3300053078 | Bacteria | 3359 |
| 812 | Ga0495595_0000012 | 3300053084 | Bacteria | 174322 |
| 813 | Ga0495595_0000277 | 3300053084 | Bacteria | 20328 |
| 814 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 815 | Ga0495619_0004362 | 3300053085 | Bacteria | 9022 |
| 816 | Ga0495619_0008851 | 3300053085 | Bacteria | 6364 |
| 817 | Ga0495619_0046591 | 3300053085 | Bacteria | 2851 |
| 818 | Ga0500644_0000375 | 3300053088 | Bacteria | 21830 |
| 819 | Ga0500566_0014900 | 3300053094 | Bacteria | 4567 |
| 820 | Ga0500641_0002452 | 3300053096 | Bacteria | 6567 |
| 821 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 822 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 823 | Ga0500616_0017963 | 3300053153 | Bacteria | 4004 |
| 824 | Ga0500645_000252 | 3300053730 | Bacteria | 39375 |
| 825 | Ga0501084_0033972 | 3300054114 | Bacteria | 4265 |
| 826 | Ga0501084_0049107 | 3300054114 | Bacteria | 3532 |
| 827 | Ga0501084_0083511 | 3300054114 | Bacteria | 2681 |
| 828 | Ga0501082_0038450 | 3300060353 | Bacteria | 4129 |
| 829 | Ga0501082_0065703 | 3300060353 | Bacteria | 3124 |
| 830 | Ga0501082_0100578 | 3300060353 | Bacteria | 2501 |
| 831 | Ga0466962_0069688 | 3300061719 | Bacteria | 1679 |
| 832 | 2889307637 | 2889306138 | Bacteria | 6358934 |
| 833 | 2902333312 | 2902330777 | Bacteria | 6395352 |
| 834 | 2902407096 | 2902405164 | Bacteria | 6784948 |
| 835 | 2919454784 | 2919450847 | Bacteria | 5631160 |
| 836 | 8002063704 | 8002060224 | Bacteria | 4026565 |
| 837 | Ga0496112_0097126 | |||
| 838 | 2214748016 | |||
| 839 | ARcpr5oldR_c000166 | |||
| 840 | ARSoilYngRDRAFT_c00122 | |||
| 841 | ARcpr5yngRDRAFT_c000142 | |||
| 842 | ARSoilOldRDRAFT_c000054 | |||
| 843 | ARCol0oldRDRAFT_c00231 | |||
| 844 | ARCol0yngRDRAFT_1000054 | |||
| 845 | JGI24746J21847_1000620 | |||
| 846 | JGI24747J21853_1000823 | |||
| 847 | JGI24739J22299_10001041 | |||
| 848 | JGI24737J22298_10007452 | |||
| 849 | JGI24737J22298_10032157 | |||
| 850 | JGI24743J22301_10002329 | |||
| 851 | JGI24743J22301_10015912 | |||
| 852 | JGI24750J21931_1000888 | |||
| 853 | JGI24745J21846_1000131 | |||
| 854 | JGI24745J21846_1003092 | |||
| 855 | JGI24748J21848_1002641 | |||
| 856 | JGI24748J21848_1003474 | |||
| 857 | JGI24738J21930_10000571 | |||
| 858 | JGI24738J21930_10006136 | |||
| 859 | JGI24749J21850_1000415 | |||
| 860 | JGI24744J21845_10023343 | |||
| 861 | JGI24035J26624_1000352 | |||
| 862 | JGI24033J26618_1002920 | |||
| 863 | JGI24033J26618_1004471 | |||
| 864 | JGI24034J26672_10001326 | |||
| 865 | JGI24034J26672_10003461 | |||
| 866 | JGI24742J22300_10000080 | |||
| 867 | JGI24742J22300_10000818 | |||
| 868 | JGI24751J29686_10002106 | |||
| 869 | JGI24751J29686_10008295 | |||
| 870 | JGI25405J52794_10001034 | |||
| 871 | JGI25405J52794_10001779 | |||
| 872 | JGI25405J52794_10005107 | |||
| 873 | Ga0065704_10097323 | |||
| 874 | Ga0065712_10107228 | |||
| 875 | Ga0065715_10089280 | |||
| 876 | Ga0065707_10118788 | |||
| 877 | Ga0070658_10033486 | |||
| 878 | Ga0070676_10000128 | |||
| 879 | Ga0070683_100000289 | |||
| 880 | Ga0070690_100000935 | |||
| 881 | Ga0070670_100003173 | |||
| 882 | Ga0070670_100005011 | |||
| 883 | Ga0070670_100261240 | |||
| 884 | Ga0070677_10000043 | |||
| 885 | Ga0068869_100000289 | |||
| 886 | Ga0068869_100050329 | |||
| 887 | Ga0070666_10008412 | |||
| 888 | Ga0070666_10065397 | |||
| 889 | Ga0070680_100002347 | |||
| 890 | Ga0070680_100008016 | |||
| 891 | Ga0070680_100009986 | |||
| 892 | Ga0070682_100000528 | |||
| 893 | Ga0070682_100033183 | |||
| 894 | Ga0070682_100089879 | |||
| 895 | Ga0070682_100133225 | |||
| 896 | Ga0068868_100000408 | |||
| 897 | Ga0068868_100009197 | |||
| 898 | Ga0070660_100000182 | |||
| 899 | Ga0070660_100010085 | |||
| 900 | Ga0070660_100080505 | |||
| 901 | Ga0070660_100109897 | |||
| 902 | Ga0070689_100000819 | |||
| 903 | Ga0070689_100015827 | |||
| 904 | Ga0070689_100044473 | |||
| 905 | Ga0070691_10027149 | |||
| 906 | Ga0070691_10044359 | |||
| 907 | Ga0070687_100000689 | |||
| 908 | Ga0070687_100028693 | |||
| 909 | Ga0070661_100000314 | |||
| 910 | Ga0070661_100043660 | |||
| 911 | Ga0070692_10000310 | |||
| 912 | Ga0070692_10023477 | |||
| 913 | Ga0070692_10100899 | |||
| 914 | Ga0070668_100000857 | |||
| 915 | Ga0070668_100204345 | |||
| 916 | Ga0070669_100002719 | |||
| 917 | Ga0070669_100094670 | |||
| 918 | Ga0070669_100098959 | |||
| 919 | Ga0070675_100002240 | |||
| 920 | Ga0070675_100020607 | |||
| 921 | Ga0070671_100000598 | |||
| 922 | Ga0070671_100003710 | |||
| 923 | Ga0070671_100350004 | |||
| 924 | Ga0070674_100002210 | |||
| 925 | Ga0070674_100030183 | |||
| 926 | Ga0070673_100000289 | |||
| 927 | Ga0070673_100006328 | |||
| 928 | Ga0070673_100067543 | |||
| 929 | Ga0070688_100000189 | |||
| 930 | Ga0070688_100011824 | |||
| 931 | Ga0070659_100003195 | |||
| 932 | Ga0070659_100009819 | |||
| 933 | Ga0070659_100149780 | |||
| 934 | Ga0070667_100000436 | |||
| 935 | Ga0070667_100293204 | |||
| 936 | Ga0070709_10017043 | |||
| 937 | Ga0070709_10052528 | |||
| 938 | Ga0070709_10082081 | |||
| 939 | Ga0070714_100033561 | |||
| 940 | Ga0070714_100124125 | |||
| 941 | Ga0070714_100152032 | |||
| 942 | Ga0070714_100286450 | |||
| 943 | Ga0070713_100002527 | |||
| 944 | Ga0070713_100003602 | |||
| 945 | Ga0070713_100108419 | |||
| 946 | Ga0070713_100115527 | |||
| 947 | Ga0070713_100199378 | |||
| 948 | Ga0070713_100285432 | |||
| 949 | Ga0070710_10001160 | |||
| 950 | Ga0070710_10095497 | |||
| 951 | Ga0070701_10000608 | |||
| 952 | Ga0070711_100001742 | |||
| 953 | Ga0070705_100000781 | |||
| 954 | Ga0070700_100001610 | |||
| 955 | Ga0070700_100004962 | |||
| 956 | Ga0070694_100001837 | |||
| 957 | Ga0070694_100025113 | |||
| 958 | Ga0070708_100038491 | |||
| 959 | Ga0070708_100323976 | |||
| 960 | Ga0070663_100000297 | |||
| 961 | Ga0070678_100001856 | |||
| 962 | Ga0070662_100011992 | |||
| 963 | Ga0070662_100075885 | |||
| 964 | Ga0070681_10005077 | |||
| 965 | Ga0070681_10041223 | |||
| 966 | Ga0070681_10048091 | |||
| 967 | Ga0070681_10110421 | |||
| 968 | Ga0068867_100003318 | |||
| 969 | Ga0070685_10001152 | |||
| 970 | Ga0070685_10003091 | |||
| 971 | Ga0070679_100003016 | |||
| 972 | Ga0070684_100002293 | |||
| 973 | Ga0070684_100089245 | |||
| 974 | Ga0068853_100011439 | |||
| 975 | Ga0070672_100000106 | |||
| 976 | Ga0070686_100000615 | |||
| 977 | Ga0070686_100075821 | |||
| 978 | Ga0070695_100001248 | |||
| 979 | Ga0070695_100008461 | |||
| 980 | Ga0070696_100024338 | |||
| 981 | Ga0070696_100091614 | |||
| 982 | Ga0070693_100001863 | |||
| 983 | Ga0070665_100102019 | |||
| 984 | Ga0070665_100213106 | |||
| 985 | Ga0070704_100004061 | |||
| 986 | Ga0070704_100035204 | |||
| 987 | Ga0070704_100056522 | |||
| 988 | Ga0068855_100032491 | |||
| 989 | Ga0068855_100149552 | |||
| 990 | Ga0068855_100156764 | |||
| 991 | Ga0068855_100308129 | |||
| 992 | Ga0070664_100009338 | |||
| 993 | Ga0068857_100000047 | |||
| 994 | Ga0068854_100003161 | |||
| 995 | Ga0068854_100154713 | |||
| 996 | Ga0068856_100001905 | |||
| 997 | Ga0068856_100239367 | |||
| 998 | Ga0070702_100001524 | |||
| 999 | Ga0068852_100003513 | |||
| 1000 | Ga0068852_100219695 | |||
| 1001 | Ga0068859_100005879 | |||
| 1002 | Ga0068859_100033546 | |||
| 1003 | Ga0068859_100050366 | |||
| 1004 | Ga0068864_100000931 | |||
| 1005 | Ga0068864_100017647 | |||
| 1006 | Ga0068864_100372351 | |||
| 1007 | Ga0068866_10000077 | |||
| 1008 | Ga0068861_100004701 | |||
| 1009 | Ga0068861_100015325 | |||
| 1010 | Ga0068870_10000037 | |||
| 1011 | Ga0068863_100000543 | |||
| 1012 | Ga0068863_100008217 | |||
| 1013 | Ga0068858_100002073 | |||
| 1014 | Ga0068860_100006167 | |||
| 1015 | Ga0068860_100059322 | |||
| 1016 | Ga0068862_100000879 | |||
| 1017 | Ga0068862_100009120 | |||
| 1018 | Ga0068862_100056257 | |||
| 1019 | Ga0081455_10000007 | |||
| 1020 | Ga0081455_10000843 | |||
| 1021 | Ga0081455_10006809 | |||
| 1022 | Ga0081455_10063432 | |||
| 1023 | Ga0081538_10005025 | |||
| 1024 | Ga0081540_1027425 | |||
| 1025 | Ga0081539_10029786 | |||
| 1026 | Ga0070717_10001206 | |||
| 1027 | Ga0070717_10106841 | |||
| 1028 | Ga0070717_10217610 | |||
| 1029 | Ga0075365_10015983 | |||
| 1030 | Ga0075365_10083924 | |||
| 1031 | Ga0075365_10171368 | |||
| 1032 | Ga0075368_10022942 | |||
| 1033 | Ga0075364_10052394 | |||
| 1034 | Ga0070715_10000686 | |||
| 1035 | Ga0070715_10038301 | |||
| 1036 | Ga0070715_10110303 | |||
| 1037 | Ga0070716_100052034 | |||
| 1038 | Ga0070712_100014104 | |||
| 1039 | Ga0070712_100112271 | |||
| 1040 | Ga0075367_10006217 | |||
| 1041 | Ga0075367_10024187 | |||
| 1042 | Ga0075367_10060999 | |||
| 1043 | Ga0075366_10000374 | |||
| 1044 | Ga0097621_100000416 | |||
| 1045 | Ga0097621_100342625 | |||
| 1046 | Ga0068871_100000249 | |||
| 1047 | Ga0068871_100102618 | |||
| 1048 | Ga0075428_100013293 | |||
| 1049 | Ga0075431_100000213 | |||
| 1050 | Ga0075431_100066837 | |||
| 1051 | Ga0075434_100003092 | |||
| 1052 | Ga0075434_100077211 | |||
| 1053 | Ga0075434_100345251 | |||
| 1054 | Ga0075429_100006031 | |||
| 1055 | Ga0075429_100116911 | |||
| 1056 | Ga0068865_100000248 | |||
| 1057 | Ga0068865_100004118 | |||
| 1058 | Ga0075436_100000751 | |||
| 1059 | Ga0075436_100113020 | |||
| 1060 | Ga0097620_100005879 | |||
| 1061 | Ga0097620_100033546 | |||
| 1062 | Ga0097620_100050366 | |||
| 1063 | Ga0075435_100073765 | |||
| 1064 | Ga0075435_100157435 | |||
| 1065 | Ga0099794_10004175 | |||
| 1066 | Ga0099795_10014352 | |||
| 1067 | Ga0105250_10061735 | |||
| 1068 | Ga0105240_10024910 | |||
| 1069 | Ga0105240_10025786 | |||
| 1070 | Ga0105240_10483041 | |||
| 1071 | Ga0111539_10002489 | |||
| 1072 | Ga0111539_10005685 | |||
| 1073 | Ga0111539_10011158 | |||
| 1074 | Ga0111539_10082090 | |||
| 1075 | Ga0111539_10279419 | |||
| 1076 | Ga0105245_10004150 | |||
| 1077 | Ga0105245_10022971 | |||
| 1078 | Ga0105245_10039806 | |||
| 1079 | Ga0105247_10000908 | |||
| 1080 | Ga0114129_10000685 | |||
| 1081 | Ga0114129_10000908 | |||
| 1082 | Ga0114129_10012397 | |||
| 1083 | Ga0114129_10052993 | |||
| 1084 | Ga0105243_10001705 | |||
| 1085 | Ga0105241_10002306 | |||
| 1086 | Ga0105242_10003502 | |||
| 1087 | Ga0105248_10005936 | |||
| 1088 | Ga0105248_10006377 | |||
| 1089 | Ga0105237_10022803 | |||
| 1090 | Ga0105237_10236043 | |||
| 1091 | Ga0105238_10024601 | |||
| 1092 | Ga0105249_10000476 | |||
| 1093 | Ga0105239_10007529 | |||
| 1094 | Ga0105239_10144699 | |||
| 1095 | Ga0105239_10188263 | |||
| 1096 | Ga0105246_10000057 | |||
| 1097 | Ga0157373_10028635 | |||
| 1098 | Ga0157369_10106869 | |||
| 1099 | Ga0157374_10004809 | |||
| 1100 | Ga0157374_10057989 | |||
| 1101 | Ga0157378_10006604 | |||
| 1102 | Ga0157378_10202383 | |||
| 1103 | Ga0163162_10001937 | |||
| 1104 | Ga0163162_10171848 | |||
| 1105 | Ga0157372_10009498 | |||
| 1106 | Ga0157375_10003994 | |||
| 1107 | Ga0157375_10048018 | |||
| 1108 | Ga0157375_10157230 | |||
| 1109 | Ga0163163_10003757 | |||
| 1110 | Ga0163163_10005510 | |||
| 1111 | Ga0163163_10069845 | |||
| 1112 | Ga0163163_10143863 | |||
| 1113 | Ga0157380_10002362 | |||
| 1114 | Ga0157380_10007960 | |||
| 1115 | Ga0157377_10001240 | |||
| 1116 | Ga0157377_10056448 | |||
| 1117 | Ga0157379_10000293 | |||
| 1118 | Ga0157379_10007214 | |||
| 1119 | Ga0157379_10174308 | |||
| 1120 | Ga0157376_10000531 | |||
| 1121 | Ga0163161_10000209 | |||
| 1122 | Ga0206354_10351988 | |||
| 1123 | Ga0213875_10001189 | |||
| 1124 | Ga0213875_10043382 | |||
| 1125 | Ga0224572_1001510 | |||
| 1126 | Ga0207666_1000011 | |||
| 1127 | Ga0207673_1000294 | |||
| 1128 | Ga0207697_10000044 | |||
| 1129 | Ga0207653_10004900 | |||
| 1130 | Ga0207682_10000260 | |||
| 1131 | Ga0207692_10000613 | |||
| 1132 | Ga0207642_10001373 | |||
| 1133 | Ga0207642_10010355 | |||
| 1134 | Ga0207710_10003110 | |||
| 1135 | Ga0207710_10009455 | |||
| 1136 | Ga0207688_10000717 | |||
| 1137 | Ga0207688_10000723 | |||
| 1138 | Ga0207680_10004972 | |||
| 1139 | Ga0207647_10008700 | |||
| 1140 | Ga0207647_10034325 | |||
| 1141 | Ga0207647_10063403 | |||
| 1142 | Ga0207685_10001855 | |||
| 1143 | Ga0207685_10037159 | |||
| 1144 | Ga0207699_10107067 | |||
| 1145 | Ga0207645_10000281 | |||
| 1146 | Ga0207645_10010774 | |||
| 1147 | Ga0207645_10040113 | |||
| 1148 | Ga0207643_10000012 | |||
| 1149 | Ga0207643_10001287 | |||
| 1150 | Ga0207705_10111615 | |||
| 1151 | Ga0207684_10112647 | |||
| 1152 | Ga0207684_10169945 | |||
| 1153 | Ga0207654_10002060 | |||
| 1154 | Ga0207707_10000551 | |||
| 1155 | Ga0207707_10070266 | |||
| 1156 | Ga0207671_10031487 | |||
| 1157 | Ga0207671_10056615 | |||
| 1158 | Ga0207693_10099274 | |||
| 1159 | Ga0207693_10129461 | |||
| 1160 | Ga0207663_10006436 | |||
| 1161 | Ga0207663_10034591 | |||
| 1162 | Ga0207660_10000992 | |||
| 1163 | Ga0207660_10016384 | |||
| 1164 | Ga0207660_10089349 | |||
| 1165 | Ga0207660_10124788 | |||
| 1166 | Ga0207662_10000123 | |||
| 1167 | Ga0207662_10005962 | |||
| 1168 | Ga0207662_10066520 | |||
| 1169 | Ga0207657_10000358 | |||
| 1170 | Ga0207657_10013894 | |||
| 1171 | Ga0207657_10032767 | |||
| 1172 | Ga0207657_10072501 | |||
| 1173 | Ga0207649_10000545 | |||
| 1174 | Ga0207649_10155957 | |||
| 1175 | Ga0207652_10004318 | |||
| 1176 | Ga0207652_10072131 | |||
| 1177 | Ga0207652_10079520 | |||
| 1178 | Ga0207652_10118809 | |||
| 1179 | Ga0207681_10000286 | |||
| 1180 | Ga0207681_10240093 | |||
| 1181 | Ga0207650_10006950 | |||
| 1182 | Ga0207650_10079759 | |||
| 1183 | Ga0207650_10222435 | |||
| 1184 | Ga0207659_10000023 | |||
| 1185 | Ga0207659_10005686 | |||
| 1186 | Ga0207687_10000149 | |||
| 1187 | Ga0207687_10011780 | |||
| 1188 | Ga0207700_10029405 | |||
| 1189 | Ga0207664_10025759 | |||
| 1190 | Ga0207644_10000724 | |||
| 1191 | Ga0207644_10007078 | |||
| 1192 | Ga0207644_10012722 | |||
| 1193 | Ga0207644_10214303 | |||
| 1194 | Ga0207690_10000203 | |||
| 1195 | Ga0207690_10035633 | |||
| 1196 | Ga0207706_10001347 | |||
| 1197 | Ga0207706_10002188 | |||
| 1198 | Ga0207686_10007108 | |||
| 1199 | Ga0207709_10000607 | |||
| 1200 | Ga0207670_10000125 | |||
| 1201 | Ga0207670_10033086 | |||
| 1202 | Ga0207670_10269436 | |||
| 1203 | Ga0207669_10000357 | |||
| 1204 | Ga0207669_10019383 | |||
| 1205 | Ga0207704_10001003 | |||
| 1206 | Ga0207665_10021414 | |||
| 1207 | Ga0207665_10060707 | |||
| 1208 | Ga0207691_10000256 | |||
| 1209 | Ga0207691_10001091 | |||
| 1210 | Ga0207691_10092172 | |||
| 1211 | Ga0207711_10035444 | |||
| 1212 | Ga0207689_10000008 | |||
| 1213 | Ga0207689_10063168 | |||
| 1214 | Ga0207661_10000104 | |||
| 1215 | Ga0207661_10022650 | |||
| 1216 | Ga0207679_10000196 | |||
| 1217 | Ga0207679_10020897 | |||
| 1218 | Ga0207679_10201263 | |||
| 1219 | Ga0207667_10023002 | |||
| 1220 | Ga0207667_10284618 | |||
| 1221 | Ga0207651_10001000 | |||
| 1222 | Ga0207651_10015133 | |||
| 1223 | Ga0207712_10000967 | |||
| 1224 | Ga0207712_10013794 | |||
| 1225 | Ga0207668_10070301 | |||
| 1226 | Ga0207640_10000157 | |||
| 1227 | Ga0207640_10023741 | |||
| 1228 | Ga0207640_10284922 | |||
| 1229 | Ga0207658_10036309 | |||
| 1230 | Ga0207677_10000609 | |||
| 1231 | Ga0207677_10003120 | |||
| 1232 | Ga0207703_10003859 | |||
| 1233 | Ga0207639_10002440 | |||
| 1234 | Ga0207678_10004329 | |||
| 1235 | Ga0207678_10020490 | |||
| 1236 | Ga0207678_10100021 | |||
| 1237 | Ga0207678_10122078 | |||
| 1238 | Ga0207708_10002782 | |||
| 1239 | Ga0207708_10003027 | |||
| 1240 | Ga0207708_10336371 | |||
| 1241 | Ga0207702_10003955 | |||
| 1242 | Ga0207702_10041453 | |||
| 1243 | Ga0207702_10109740 | |||
| 1244 | Ga0207641_10002938 | |||
| 1245 | Ga0207648_10002628 | |||
| 1246 | Ga0207648_10005563 | |||
| 1247 | Ga0207648_10022367 | |||
| 1248 | Ga0207676_10003560 | |||
| 1249 | Ga0207676_10004603 | |||
| 1250 | Ga0207676_10149133 | |||
| 1251 | Ga0207674_10009174 | |||
| 1252 | Ga0207675_100000604 | |||
| 1253 | Ga0207675_100002508 | |||
| 1254 | Ga0207675_100407151 | |||
| 1255 | Ga0207683_10000006 | |||
| 1256 | Ga0207698_10000378 | |||
| 1257 | Ga0207698_10009646 | |||
| 1258 | Ga0207698_10195552 | |||
| 1259 | Ga0209984_1004221 | |||
| 1260 | Ga0209179_1000846 | |||
| 1261 | Ga0210002_1003918 | |||
| 1262 | Ga0209983_1006582 | |||
| 1263 | Ga0209998_10000566 | |||
| 1264 | Ga0209998_10001948 | |||
| 1265 | Ga0207428_10000165 | |||
| 1266 | Ga0207428_10000446 | |||
| 1267 | Ga0207428_10024147 | |||
| 1268 | Ga0207428_10081742 | |||
| 1269 | Ga0268266_10044658 | |||
| 1270 | Ga0268266_10054562 | |||
| 1271 | Ga0268266_10074462 | |||
| 1272 | Ga0268265_10001687 | |||
| 1273 | Ga0268265_10246208 | |||
| 1274 | Ga0268264_10002029 | |||
| 1275 | Ga0268264_10008544 | |||
| 1276 | Ga0265338_10012007 | |||
| 1277 | Ga0265338_10030503 | |||
| 1278 | Ga0265763_1000140 | |||
| 1279 | Ga0265760_10052991 | |||
| 1280 | Ga0265330_10022632 | |||
| 1281 | Ga0265328_10002945 | |||
| 1282 | Ga0265325_10009739 | |||
| 1283 | Ga0265325_10012475 | |||
| 1284 | Ga0265325_10021595 | |||
| 1285 | Ga0265325_10093896 | |||
| 1286 | Ga0265339_10004883 | |||
| 1287 | Ga0265313_10000069 | |||
| 1288 | Ga0265313_10000794 | |||
| 1289 | Ga0265313_10004781 | |||
| 1290 | Ga0265313_10011241 | |||
| 1291 | Ga0316579_10017096 | |||
| 1292 | Ga0265314_10005328 | |||
| 1293 | Ga0265314_10130253 | |||
| 1294 | Ga0265342_10000502 | |||
| 1295 | Ga0373930_0000066 | |||
| 1296 | Ga0373948_0000581 | |||
| 1297 | Ga0373950_0003960 | |||
| 1298 | Ga0373958_0000149 | |||
| 1299 | Ga0373959_0000484 | |||
| 1300 | Ga0373959_0001824 | |||
| 1301 | Ga0373938_0000806 | |||
| 1302 | Ga0373926_0006406 | |||
| 1303 | Ga0373928_0000912 | |||
| 1304 | Ga0373928_0003692 | |||
| 1305 | Ga0373929_0000596 | |||
| 1306 | Ga0373929_0001194 | |||
| 1307 | Ga0373940_0000711 | |||
| 1308 | Ga0373949_0001224 | |||
| 1309 | Ga0373949_0001578 | |||
| 1310 | Ga0373951_0000469 | |||
| 1311 | Ga0373951_0000642 | |||
| 1312 | Ga0373952_0000323 | |||
| 1313 | Ga0373952_0001223 | |||
| 1314 | Ga0373923_0000600 | |||
| 1315 | Ga0373923_0034016 | |||
| 1316 | Ga0373932_0000757 | |||
| 1317 | Ga0373932_0001683 | |||
| 1318 | Ga0373936_0000140 | |||
| 1319 | Ga0373936_0078699 | |||
| 1320 | Ga0373941_0000083 | |||
| 1321 | Ga0373941_0007438 | |||
| 1322 | Ga0373945_0004242 | |||
| 1323 | Ga0373945_0005199 | |||
| 1324 | Ga0373953_0002635 | |||
| 1325 | Ga0373954_0020918 | |||
| 1326 | Ga0373956_0008031 | |||
| 1327 | Ga0373956_0114562 | |||
| 1328 | Ga0373957_0091532 | |||
| 1329 | Ga0373960_0000185 | |||
| 1330 | Ga0373960_0000330 | |||
| 1331 | Ga0373943_0000723 | |||
| 1332 | Ga0373943_0005802 | |||
| 1333 | Ga0373943_0009931 | |||
| 1334 | Ga0373943_0087965 | |||
| 1335 | Ga0373946_0001669 | |||
| 1336 | Ga0373946_0001730 | |||
| 1337 | Ga0373955_0000121 | |||
| 1338 | Ga0373955_0024471 | |||
| 1339 | Ga0373955_0110807 | |||
| 1340 | Ga0373942_0001462 | |||
| 1341 | Ga0373942_0003399 | |||
| 1342 | Ga0373961_0000569 | |||
| 1343 | Ga0373962_0000149 | |||
| 1344 | Ga0373924_0000521 | |||
| 1345 | Ga0373924_0019444 | |||
| 1346 | Ga0373924_0057262 | |||
| 1347 | Ga0373931_0002244 | |||
| 1348 | Ga0373931_0061116 | |||
| 1349 | Ga0373931_0071457 | |||
| 1350 | Ga0373935_0024273 | |||
| 1351 | Ga0373935_0030967 | |||
| 1352 | Ga0373935_0046183 | |||
| 1353 | Ga0373935_0211080 | |||
| 1354 | Ga0373927_0001763 | |||
| 1355 | Ga0373927_0021556 | |||
| 1356 | Ga0373927_0023719 | |||
| 1357 | Ga0373927_0030831 | |||
| 1358 | Ga0373933_0001004 | |||
| 1359 | Ga0373933_0015592 | |||
| 1360 | Ga0373933_0087115 | |||
| 1361 | Ga0373947_0001341 | |||
| 1362 | Ga0373947_0005612 | |||
| 1363 | Ga0373947_0006555 | |||
| 1364 | Ga0373947_0031905 | |||
| 1365 | Ga0373947_0041783 | |||
| 1366 | Ga0373947_0044632 | |||
| 1367 | Ga0373947_0054692 | |||
| 1368 | Ga0373947_0111980 | |||
| 1369 | Ga0373937_0001420 | |||
| 1370 | Ga0373937_0002850 | |||
| 1371 | Ga0373937_0104592 | |||
| 1372 | Ga0373925_0000016 | |||
| 1373 | Ga0373925_0001095 | |||
| 1374 | Ga0373925_0123614 | |||
| 1375 | Ga0395900_0001539 | |||
| 1376 | Ga0395900_0075561 | |||
| 1377 | Ga0395898_0013503 | |||
| 1378 | Ga0395898_0024475 | |||
| 1379 | Ga0395898_0036924 | |||
| 1380 | Ga0436364_0170641 | |||
| 1381 | Ga0436364_1548064 | |||
| 1382 | Ga0395901_0027121 | |||
| 1383 | Ga0439441_007620 | |||
| 1384 | Ga0451577_0134237 | |||
| 1385 | Ga0466963_0138338 | |||
| 1386 | Ga0466968_0003779 | |||
| 1387 | Ga0466957_0008459 | |||
| 1388 | Ga0466959_0090981 | |||
| 1389 | Ga0466958_0026576 | |||
| 1390 | Ga0466967_0007437 | |||
| 1391 | Ga0466967_0354484 | |||
| 1392 | Ga0495592_0000044 | |||
| 1393 | Ga0495592_0036712 | |||
| 1394 | Ga0495629_0000798 | |||
| 1395 | Ga0495629_0004823 | |||
| 1396 | Ga0495641_0019161 | |||
| 1397 | Ga0495651_0000702 | |||
| 1398 | Ga0495651_0004981 | |||
| 1399 | Ga0495653_0000022 | |||
| 1400 | Ga0495653_0064111 | |||
| 1401 | Ga0495582_0016959 | |||
| 1402 | Ga0495582_0070011 | |||
| 1403 | Ga0495639_0026504 | |||
| 1404 | Ga0495662_0004014 | |||
| 1405 | Ga0495664_0000013 | |||
| 1406 | Ga0495664_0016952 | |||
| 1407 | Ga0495664_0159783 | |||
| 1408 | Ga0495584_0021641 | |||
| 1409 | Ga0495594_0073564 | |||
| 1410 | Ga0495608_0000004 | |||
| 1411 | Ga0495618_0000032 | |||
| 1412 | Ga0495618_0010451 | |||
| 1413 | Ga0495618_0056603 | |||
| 1414 | Ga0495618_0081759 | |||
| 1415 | Ga0495628_0000014 | |||
| 1416 | Ga0495628_0098574 | |||
| 1417 | Ga0495630_0006343 | |||
| 1418 | Ga0495630_0011540 | |||
| 1419 | Ga0495630_0208308 | |||
| 1420 | Ga0495666_0068797 | |||
| 1421 | Ga0495652_0000002 | |||
| 1422 | Ga0495652_0060214 | |||
| 1423 | Ga0495665_0048847 | |||
| 1424 | Ga0495640_0000001 | |||
| 1425 | Ga0495640_0005848 | |||
| 1426 | Ga0495640_0040037 | |||
| 1427 | Ga0495640_0093148 | |||
| 1428 | Ga0495586_0083366 | |||
| 1429 | Ga0495587_0000004 | |||
| 1430 | Ga0495587_0004639 | |||
| 1431 | Ga0495587_0115167 | |||
| 1432 | Ga0495609_0077875 | |||
| 1433 | Ga0495645_0000001 | |||
| 1434 | Ga0495645_0012073 | |||
| 1435 | Ga0495667_0000009 | |||
| 1436 | Ga0495667_0000967 | |||
| 1437 | Ga0495656_0037389 | |||
| 1438 | Ga0495634_0000033 | |||
| 1439 | Ga0495634_0006572 | |||
| 1440 | Ga0495634_0030799 | |||
| 1441 | Ga0495625_0086286 | |||
| 1442 | Ga0495635_0000003 | |||
| 1443 | Ga0495635_0010576 | |||
| 1444 | Ga0495657_0000342 | |||
| 1445 | Ga0495657_0121908 | |||
| 1446 | Ga0495599_0000030 | |||
| 1447 | Ga0495623_0000059 | |||
| 1448 | Ga0495623_0004459 | |||
| 1449 | Ga0495623_0008559 | |||
| 1450 | Ga0495646_0000031 | |||
| 1451 | Ga0495646_0005451 | |||
| 1452 | Ga0495658_0008450 | |||
| 1453 | Ga0495658_0035108 | |||
| 1454 | Ga0495658_0037237 | |||
| 1455 | Ga0495658_0124924 | |||
| 1456 | Ga0495613_0041141 | |||
| 1457 | Ga0495613_0058832 | |||
| 1458 | Ga0495613_0090427 | |||
| 1459 | Ga0495624_0009592 | |||
| 1460 | Ga0495624_0182624 | |||
| 1461 | Ga0495600_0000141 | |||
| 1462 | Ga0495581_0006241 | |||
| 1463 | Ga0495604_0000002 | |||
| 1464 | Ga0495604_0000619 | |||
| 1465 | Ga0495604_0028575 | |||
| 1466 | Ga0495604_0034208 | |||
| 1467 | Ga0495674_0000004 | |||
| 1468 | Ga0495674_0000575 | |||
| 1469 | Ga0495674_0024950 | |||
| 1470 | Ga0495674_0200114 | |||
| 1471 | Ga0495676_0079119 | |||
| 1472 | Ga0495680_0000481 | |||
| 1473 | Ga0495680_0008522 | |||
| 1474 | Ga0495675_0000048 | |||
| 1475 | Ga0495684_0000019 | |||
| 1476 | Ga0495684_0123805 | |||
| 1477 | Ga0495593_0000511 | |||
| 1478 | Ga0495593_0027144 | |||
| 1479 | Ga0495602_0000001 | |||
| 1480 | Ga0495602_0013129 | |||
| 1481 | Ga0495602_0084401 | |||
| 1482 | Ga0496100_0000610 | |||
| 1483 | Ga0496100_0006059 | |||
| 1484 | Ga0496100_0223614 | |||
| 1485 | Ga0496101_0000464 | |||
| 1486 | Ga0496101_0012807 | |||
| 1487 | Ga0496101_0037886 | |||
| 1488 | Ga0496101_0049295 | |||
| 1489 | Ga0496101_0074666 | |||
| 1490 | Ga0496102_0001120 | |||
| 1491 | Ga0496102_0017419 | |||
| 1492 | Ga0496102_0023365 | |||
| 1493 | Ga0496102_0065495 | |||
| 1494 | Ga0496102_0334518 | |||
| 1495 | Ga0496102_0397449 | |||
| 1496 | Ga0496103_0000611 | |||
| 1497 | Ga0496103_0002918 | |||
| 1498 | Ga0496103_0046347 | |||
| 1499 | Ga0496104_0001156 | |||
| 1500 | Ga0496104_0003012 | |||
| 1501 | Ga0496104_0029606 | |||
| 1502 | Ga0496105_0004387 | |||
| 1503 | Ga0496105_0032636 | |||
| 1504 | Ga0496105_0053941 | |||
| 1505 | Ga0496106_0000481 | |||
| 1506 | Ga0496106_0000541 | |||
| 1507 | Ga0496106_0059385 | |||
| 1508 | Ga0496106_0060089 | |||
| 1509 | Ga0496106_0073625 | |||
| 1510 | Ga0496107_0002295 | |||
| 1511 | Ga0496107_0005580 | |||
| 1512 | Ga0496107_0097140 | |||
| 1513 | Ga0496108_0001251 | |||
| 1514 | Ga0496108_0007993 | |||
| 1515 | Ga0496108_0023781 | |||
| 1516 | Ga0496108_0137277 | |||
| 1517 | Ga0496108_0258755 | |||
| 1518 | Ga0496109_0003885 | |||
| 1519 | Ga0496109_0008609 | |||
| 1520 | Ga0496109_0024306 | |||
| 1521 | Ga0496109_0037781 | |||
| 1522 | Ga0496109_0049834 | |||
| 1523 | Ga0496109_0201950 | |||
| 1524 | Ga0496109_0328789 | |||
| 1525 | Ga0496110_0013043 | |||
| 1526 | Ga0496110_0016839 | |||
| 1527 | Ga0496110_0023634 | |||
| 1528 | Ga0496110_0047895 | |||
| 1529 | Ga0496110_0291398 | |||
| 1530 | Ga0496111_0006454 | |||
| 1531 | Ga0496111_0008573 | |||
| 1532 | Ga0496111_0016437 | |||
| 1533 | Ga0496111_0067464 | |||
| 1534 | Ga0496111_0081003 | |||
| 1535 | Ga0496112_0009148 | |||
| 1536 | Ga0496112_0022787 | |||
| 1537 | Ga0496112_0035817 | |||
| 1538 | Ga0496112_0170603 | |||
| 1539 | Ga0496112_0276674 | |||
| 1540 | Ga0496112_0328433 | |||
| 1541 | Ga0496113_0001441 | |||
| 1542 | Ga0496113_0013130 | |||
| 1543 | Ga0496114_0005881 | |||
| 1544 | Ga0496114_0006370 | |||
| 1545 | Ga0496114_0019321 | |||
| 1546 | Ga0496114_0023227 | |||
| 1547 | Ga0496114_0098648 | |||
| 1548 | Ga0496114_0296429 | |||
| 1549 | Ga0496115_0004336 | |||
| 1550 | Ga0496115_0009733 | |||
| 1551 | Ga0496115_0010227 | |||
| 1552 | Ga0496115_0012138 | |||
| 1553 | Ga0496115_0030482 | |||
| 1554 | Ga0496115_0168699 | |||
| 1555 | Ga0501032_0007222 | |||
| 1556 | Ga0501033_0043907 | |||
| 1557 | Ga0501034_0032378 | |||
| 1558 | Ga0501034_0033286 | |||
| 1559 | Ga0501036_0001657 | |||
| 1560 | Ga0501036_0006781 | |||
| 1561 | Ga0501036_0024249 | |||
| 1562 | Ga0501037_0009558 | |||
| 1563 | Ga0501038_0011889 | |||
| 1564 | Ga0501038_0040577 | |||
| 1565 | Ga0501039_0340307 | |||
| 1566 | Ga0501043_0002225 | |||
| 1567 | Ga0501043_0072709 | |||
| 1568 | Ga0501046_0015198 | |||
| 1569 | Ga0501046_0055276 | |||
| 1570 | Ga0501047_0000314 | |||
| 1571 | Ga0501047_0036499 | |||
| 1572 | Ga0501047_0067324 | |||
| 1573 | Ga0501047_0074843 | |||
| 1574 | Ga0501047_0105953 | |||
| 1575 | Ga0501048_0002000 | |||
| 1576 | Ga0501048_0152016 | |||
| 1577 | Ga0501069_0005233 | |||
| 1578 | Ga0501070_0007677 | |||
| 1579 | Ga0501070_0008242 | |||
| 1580 | Ga0501070_0036638 | |||
| 1581 | Ga0501070_0120289 | |||
| 1582 | Ga0501070_0179273 | |||
| 1583 | Ga0501070_0187341 | |||
| 1584 | Ga0501071_0092413 | |||
| 1585 | Ga0501073_0021006 | |||
| 1586 | Ga0501073_0029354 | |||
| 1587 | Ga0501073_0151284 | |||
| 1588 | Ga0501074_0012343 | |||
| 1589 | Ga0501076_0037276 | |||
| 1590 | Ga0501077_0027575 | |||
| 1591 | Ga0501077_0090573 | |||
| 1592 | Ga0501079_0017339 | |||
| 1593 | Ga0501080_0005419 | |||
| 1594 | Ga0501080_0107373 | |||
| 1595 | Ga0501080_0174281 | |||
| 1596 | Ga0501081_0063257 | |||
| 1597 | Ga0501083_0001743 | |||
| 1598 | Ga0501083_0146733 | |||
| 1599 | Ga0501035_0000896 | |||
| 1600 | Ga0501035_0008967 | |||
| 1601 | Ga0501035_0097360 | |||
| 1602 | Ga0501044_0018297 | |||
| 1603 | Ga0501044_0029583 | |||
| 1604 | Ga0501044_0052167 | |||
| 1605 | Ga0501044_0068384 | |||
| 1606 | Ga0501044_0116445 | |||
| 1607 | Ga0501044_0163405 | |||
| 1608 | Ga0501044_0445252 | |||
| 1609 | nmdc:mga03683_14002_c1 | |||
| 1610 | nmdc:mga00v17_64993_c1 | |||
| 1611 | nmdc:mga0yw44_19513_c1 | |||
| 1612 | nmdc:mga0yw44_24505_c1 | |||
| 1613 | nmdc:mga0yw44_40242_c1 | |||
| 1614 | nmdc:mga0yw44_87501_c1 | |||
| 1615 | nmdc:mga06z11_168866_c1 | |||
| 1616 | nmdc:mga06z11_32793_c1 | |||
| 1617 | nmdc:mga06z11_45630_c1 | |||
| 1618 | nmdc:mga05p37_18721_c2 | |||
| 1619 | nmdc:mga05p37_2380_c1 | |||
| 1620 | nmdc:mga05p37_2506_c1 | |||
| 1621 | nmdc:mga05p37_28335_c1 | |||
| 1622 | nmdc:mga05p37_334629_c1 | |||
| 1623 | nmdc:mga05p37_43056_c1 | |||
| 1624 | nmdc:mga09592_770_c1 | |||
| 1625 | nmdc:mga0qj67_35325_c1 | |||
| 1626 | nmdc:mga0qj67_73509_c1 | |||
| 1627 | nmdc:mga06r32_105175_c1 | |||
| 1628 | nmdc:mga06r32_444_c1 | |||
| 1629 | nmdc:mga06r32_60077_c1 | |||
| 1630 | nmdc:mga08y16_218177_c1 | |||
| 1631 | nmdc:mga08y16_3020_c1 | |||
| 1632 | nmdc:mga08y16_3846_c1 | |||
| 1633 | nmdc:mga08y16_68976_c1 | |||
| 1634 | nmdc:mga08y16_939_c1 | |||
| 1635 | nmdc:mga0n895_131781_c1 | |||
| 1636 | nmdc:mga0n895_291_c1 | |||
| 1637 | nmdc:mga0n895_345461_c1 | |||
| 1638 | nmdc:mga08x19_22_c1 | |||
| 1639 | nmdc:mga0a205_467_c1 | |||
| 1640 | nmdc:mga0sz30_32691_c1 | |||
| 1641 | Ga0495601_0000002 | |||
| 1642 | Ga0495601_0003096 | |||
| 1643 | Ga0495601_0019818 | |||
| 1644 | Ga0495601_0169504 | |||
| 1645 | Ga0495612_0000012 | |||
| 1646 | Ga0495612_0000478 | |||
| 1647 | Ga0495612_0012953 | |||
| 1648 | Ga0495595_0000012 | |||
| 1649 | Ga0495595_0000277 | |||
| 1650 | Ga0495619_0000003 | |||
| 1651 | Ga0495619_0004362 | |||
| 1652 | Ga0495619_0008851 | |||
| 1653 | Ga0495619_0046591 | |||
| 1654 | Ga0500644_0000375 | |||
| 1655 | Ga0500566_0014900 | |||
| 1656 | Ga0500641_0002452 | |||
| 1657 | Ga0500595_000002 | |||
| 1658 | Ga0500616_0000002 | |||
| 1659 | Ga0500616_0017963 | |||
| 1660 | Ga0500645_000252 | |||
| 1661 | Ga0501084_0033972 | |||
| 1662 | Ga0501084_0049107 | |||
| 1663 | Ga0501084_0083511 | |||
| 1664 | Ga0501082_0038450 | |||
| 1665 | Ga0501082_0065703 | |||
| 1666 | Ga0501082_0100578 | |||
| 1667 | Ga0466962_0069688 | |||
| 1668 | 2889307637 | |||
| 1669 | 2902333312 | |||
| 1670 | 2902407096 | |||
| 1671 | 2919454784 | |||
| 1672 | 8002063704 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bwo-assembly1.cif.gz_A | larc2, the c-terminal domain of a cyclometallase involved in the synthesis of the npn cofactor of lactate racemase, apo form | 0.778 | 200 | 233 |
| 2bz0-assembly1.cif.gz_A | crystal structure of e. coli gtp cyclohydrolase ii in complex with gtp analogue, gmpcpp, and zinc | 0.6967 | 200 | 343 |
| 2bz1-assembly1.cif.gz_A-2 | crystal structure of apo e. coli gtp cyclohydrolase ii | 0.6896 | 200 | 343 |
| 4rl4-assembly1.cif.gz_B | crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 | 0.6781 | 199 | 343 |
| 4rl4-assembly1.cif.gz_A | crystal structure of gtp cyclohydrolase ii from helicobacter pylori 26695 | 0.6643 | 199 | 342 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4i14B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.7688 | 202 | 341 | 3.40.50.10990 |
| af_A0A0R0GI97_331_502_3.40.50.10990 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.7599 | 202 | 343 | 3.40.50.10990 |
| 4i14B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;GTP cyclohydrolase II | 0.7569 | 202 | 341 | 3.40.50.10990 |
| af_K7MH01_9_91_2.170.150.20 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.7198 | 200 | 233 | 2.170.150.20 |
| af_Q8I2Q2_13_105_2.170.150.20 | Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. | 0.7038 | 200 | 233 | 2.170.150.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528CHV5-F1-model_v4 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | 0.8318 | 200 | 341 |
GO:0003935
GO:0005829 GO:0009231 |
| AF-A0A075HBH4-F1-model_v4 | GTP cyclohydrolase II (RibBA) (EC 3.5.4.25) | 0.808 | 185 | 342 |
GO:0003935
GO:0005829 GO:0009231 |
| AF-A0A134CFR1-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.7591 | 198 | 343 |
GO:0003935
GO:0005525 GO:0005829 GO:0009231 |
| AF-A0A641RS98-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.7399 | 124 | 343 |
GO:0003935
GO:0005525 GO:0005829 GO:0008686 GO:0009231 GO:0046872 |
| AF-A0A519X2E5-F1-model_v4 | GTP cyclohydrolase II (EC 3.5.4.25) | 0.7368 | 128 | 341 |
GO:0003935
GO:0005525 GO:0005829 GO:0008686 GO:0009231 GO:0046872 |