F482755
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 833 | 361 | 1666 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0021282|Ga0395899_0021282_1817_2374 |
| Length | 185 |
| Sequence | MSAASAADCIRLLDAASEPRADNMEKKMTLNLRRVVTGHDAQGRAKVLIDEQVSNRFSPRPGAEYSVIWSSEGFPVDNDDDADPSRKKIGTTISNGTVFRIVSFGPGVSPRNHRTDSIDYAVVMSGEIDMVLDDETVHLKAGDVLVQRGTIHNWVNNGTVPCVIAFTLVSAKPVSPGGKTLDARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 228 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 236 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 300 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 356 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 358 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0 |
| Rhizoplane | 8.64 |
| Rhizosphere | 87.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395899_0021282 | 3300037312 | Bacteria | 4920 |
| 2 | JGI24742J22300_10095685 | 3300002244 | Unclassified | 571 |
| 3 | rootH1_10061561 | 3300003323 | Bacteria | 2305 |
| 4 | JGI25404J52841_10003048 | 3300003659 | Bacteria | 3266 |
| 5 | Ga0070658_10100128 | 3300005327 | Bacteria | 2395 |
| 6 | Ga0070658_10377474 | 3300005327 | Bacteria | 1216 |
| 7 | Ga0070658_10536026 | 3300005327 | Bacteria | 1012 |
| 8 | Ga0070670_100014533 | 3300005331 | Bacteria | 6760 |
| 9 | Ga0070670_100168559 | 3300005331 | Bacteria | 1899 |
| 10 | Ga0070670_101776014 | 3300005331 | Bacteria | 568 |
| 11 | Ga0068869_100588517 | 3300005334 | Unclassified | 939 |
| 12 | Ga0068869_101491642 | 3300005334 | Bacteria | 600 |
| 13 | Ga0070666_10266697 | 3300005335 | Bacteria | 1215 |
| 14 | Ga0070680_100000532 | 3300005336 | Bacteria | 25987 |
| 15 | Ga0070680_100014359 | 3300005336 | Bacteria | 6187 |
| 16 | Ga0070680_100017152 | 3300005336 | Bacteria | 5705 |
| 17 | Ga0070680_100020767 | 3300005336 | Bacteria | 5210 |
| 18 | Ga0070680_100160707 | 3300005336 | Bacteria | 1888 |
| 19 | Ga0070680_100242614 | 3300005336 | Bacteria | 1523 |
| 20 | Ga0070680_100872646 | 3300005336 | Bacteria | 776 |
| 21 | Ga0070682_101450804 | 3300005337 | Bacteria | 588 |
| 22 | Ga0068868_100091031 | 3300005338 | Bacteria | 2457 |
| 23 | Ga0068868_100285186 | 3300005338 | Bacteria | 1399 |
| 24 | Ga0070660_100706299 | 3300005339 | Bacteria | 845 |
| 25 | Ga0070689_100110227 | 3300005340 | Bacteria | 2188 |
| 26 | Ga0070691_10002110 | 3300005341 | Bacteria | 8800 |
| 27 | Ga0070691_10062538 | 3300005341 | Unclassified | 1793 |
| 28 | Ga0070691_10397687 | 3300005341 | Unclassified | 776 |
| 29 | Ga0070661_100563738 | 3300005344 | Bacteria | 918 |
| 30 | Ga0070669_100665495 | 3300005353 | Unclassified | 877 |
| 31 | Ga0070669_100968731 | 3300005353 | Unclassified | 729 |
| 32 | Ga0070669_100993732 | 3300005353 | Bacteria | 720 |
| 33 | Ga0070675_100029273 | 3300005354 | Bacteria | 4441 |
| 34 | Ga0070675_100045254 | 3300005354 | Bacteria | 3601 |
| 35 | Ga0070671_100198986 | 3300005355 | Unclassified | 1699 |
| 36 | Ga0070671_100850983 | 3300005355 | Bacteria | 795 |
| 37 | Ga0070671_100997742 | 3300005355 | Bacteria | 734 |
| 38 | Ga0070674_100226208 | 3300005356 | Bacteria | 1458 |
| 39 | Ga0070674_100538772 | 3300005356 | Unclassified | 978 |
| 40 | Ga0070674_100587061 | 3300005356 | Bacteria | 940 |
| 41 | Ga0070673_100286294 | 3300005364 | Bacteria | 1447 |
| 42 | Ga0070673_100719972 | 3300005364 | Unclassified | 917 |
| 43 | Ga0070688_100208329 | 3300005365 | Bacteria | 1371 |
| 44 | Ga0070667_100957747 | 3300005367 | Bacteria | 798 |
| 45 | Ga0070703_10183005 | 3300005406 | Bacteria | 810 |
| 46 | Ga0070709_10121933 | 3300005434 | Bacteria | 1768 |
| 47 | Ga0070709_10187558 | 3300005434 | Bacteria | 1456 |
| 48 | Ga0070709_10468587 | 3300005434 | Bacteria | 952 |
| 49 | Ga0070709_11032296 | 3300005434 | Unclassified | 655 |
| 50 | Ga0070714_100228591 | 3300005435 | Unclassified | 1713 |
| 51 | Ga0070714_100676094 | 3300005435 | Unclassified | 995 |
| 52 | Ga0070713_100007857 | 3300005436 | Bacteria | 7522 |
| 53 | Ga0070713_100228786 | 3300005436 | Unclassified | 1689 |
| 54 | Ga0070713_100678838 | 3300005436 | Bacteria | 983 |
| 55 | Ga0070713_100870209 | 3300005436 | Bacteria | 866 |
| 56 | Ga0070713_101703045 | 3300005436 | Unclassified | 612 |
| 57 | Ga0070710_10015505 | 3300005437 | Bacteria | 3859 |
| 58 | Ga0070710_10122263 | 3300005437 | Bacteria | 1577 |
| 59 | Ga0070710_10476080 | 3300005437 | Bacteria | 851 |
| 60 | Ga0070710_10825724 | 3300005437 | Unclassified | 664 |
| 61 | Ga0070701_10124105 | 3300005438 | Bacteria | 1459 |
| 62 | Ga0070711_100089546 | 3300005439 | Unclassified | 2214 |
| 63 | Ga0070711_100439584 | 3300005439 | Bacteria | 1066 |
| 64 | Ga0070700_100233024 | 3300005441 | Bacteria | 1311 |
| 65 | Ga0070700_100244875 | 3300005441 | Bacteria | 1283 |
| 66 | Ga0070700_101194406 | 3300005441 | Unclassified | 635 |
| 67 | Ga0070694_100876857 | 3300005444 | Bacteria | 740 |
| 68 | Ga0070708_100205704 | 3300005445 | Bacteria | 1844 |
| 69 | Ga0070663_100156117 | 3300005455 | Bacteria | 1753 |
| 70 | Ga0070663_100882224 | 3300005455 | Bacteria | 771 |
| 71 | Ga0070678_100011639 | 3300005456 | Bacteria | 5435 |
| 72 | Ga0070678_100854028 | 3300005456 | Unclassified | 830 |
| 73 | Ga0070662_101182524 | 3300005457 | Unclassified | 657 |
| 74 | Ga0070681_10001471 | 3300005458 | Bacteria | 20783 |
| 75 | Ga0070681_10001868 | 3300005458 | Bacteria | 19014 |
| 76 | Ga0070681_10039836 | 3300005458 | Bacteria | 4710 |
| 77 | Ga0070681_10128482 | 3300005458 | Bacteria | 2467 |
| 78 | Ga0070681_10175776 | 3300005458 | Bacteria | 2063 |
| 79 | Ga0070681_10244293 | 3300005458 | Bacteria | 1708 |
| 80 | Ga0070681_11244242 | 3300005458 | Bacteria | 667 |
| 81 | Ga0070685_10030546 | 3300005466 | Bacteria | 3004 |
| 82 | Ga0070698_100189732 | 3300005471 | Bacteria | 1993 |
| 83 | Ga0070698_100687673 | 3300005471 | Bacteria | 965 |
| 84 | Ga0070699_100004042 | 3300005518 | Bacteria | 12963 |
| 85 | Ga0070699_100197651 | 3300005518 | Bacteria | 1788 |
| 86 | Ga0070679_100005709 | 3300005530 | Bacteria | 11537 |
| 87 | Ga0070679_100022471 | 3300005530 | Bacteria | 6164 |
| 88 | Ga0070679_100060758 | 3300005530 | Bacteria | 3766 |
| 89 | Ga0070679_100062165 | 3300005530 | Bacteria | 3722 |
| 90 | Ga0070679_100116665 | 3300005530 | Bacteria | 2654 |
| 91 | Ga0070679_100163240 | 3300005530 | Bacteria | 2201 |
| 92 | Ga0070679_100573260 | 3300005530 | Bacteria | 1072 |
| 93 | Ga0070679_101314173 | 3300005530 | Bacteria | 669 |
| 94 | Ga0070679_101578407 | 3300005530 | Bacteria | 604 |
| 95 | Ga0070684_100218023 | 3300005535 | Bacteria | 1740 |
| 96 | Ga0070684_100493541 | 3300005535 | Bacteria | 1134 |
| 97 | Ga0070684_100517396 | 3300005535 | Bacteria | 1106 |
| 98 | Ga0070697_100086086 | 3300005536 | Bacteria | 2593 |
| 99 | Ga0070696_100683759 | 3300005546 | Bacteria | 835 |
| 100 | Ga0070693_100037524 | 3300005547 | Bacteria | 2702 |
| 101 | Ga0070693_100058118 | 3300005547 | Bacteria | 2238 |
| 102 | Ga0070665_100643538 | 3300005548 | Unclassified | 1073 |
| 103 | Ga0068855_100031168 | 3300005563 | Bacteria | 6369 |
| 104 | Ga0068855_100425065 | 3300005563 | Bacteria | 1453 |
| 105 | Ga0068855_100617644 | 3300005563 | Bacteria | 1167 |
| 106 | Ga0070664_100253593 | 3300005564 | Bacteria | 1582 |
| 107 | Ga0070664_100912970 | 3300005564 | Bacteria | 824 |
| 108 | Ga0068857_100214533 | 3300005577 | Bacteria | 1757 |
| 109 | Ga0068857_100493149 | 3300005577 | Bacteria | 1149 |
| 110 | Ga0068854_100397257 | 3300005578 | Bacteria | 1140 |
| 111 | Ga0068854_100885233 | 3300005578 | Bacteria | 784 |
| 112 | Ga0068856_100064801 | 3300005614 | Bacteria | 3611 |
| 113 | Ga0068856_100442108 | 3300005614 | Bacteria | 1321 |
| 114 | Ga0070702_100246058 | 3300005615 | Bacteria | 1209 |
| 115 | Ga0070702_100276003 | 3300005615 | Bacteria | 1152 |
| 116 | Ga0068852_100039541 | 3300005616 | Bacteria | 3972 |
| 117 | Ga0068852_100133712 | 3300005616 | Bacteria | 2287 |
| 118 | Ga0068859_100498756 | 3300005617 | Bacteria | 1313 |
| 119 | Ga0068864_100062130 | 3300005618 | Bacteria | 3236 |
| 120 | Ga0068866_10355943 | 3300005718 | Bacteria | 932 |
| 121 | Ga0068861_100781231 | 3300005719 | Bacteria | 895 |
| 122 | Ga0068861_100944605 | 3300005719 | Bacteria | 819 |
| 123 | Ga0068861_100987504 | 3300005719 | Bacteria | 803 |
| 124 | Ga0068851_10177725 | 3300005834 | Bacteria | 1177 |
| 125 | Ga0068851_10248012 | 3300005834 | Bacteria | 1009 |
| 126 | Ga0068863_100064913 | 3300005841 | Bacteria | 3453 |
| 127 | Ga0068858_100485880 | 3300005842 | Bacteria | 1192 |
| 128 | Ga0068858_100768551 | 3300005842 | Bacteria | 939 |
| 129 | Ga0068860_100315563 | 3300005843 | Bacteria | 1533 |
| 130 | Ga0068860_100686055 | 3300005843 | Bacteria | 1033 |
| 131 | Ga0068862_100530381 | 3300005844 | Bacteria | 1122 |
| 132 | Ga0068862_100577174 | 3300005844 | Bacteria | 1077 |
| 133 | Ga0068862_101450777 | 3300005844 | Bacteria | 690 |
| 134 | Ga0081455_10004063 | 3300005937 | Bacteria | 16576 |
| 135 | Ga0081455_10006691 | 3300005937 | Bacteria | 12317 |
| 136 | Ga0081455_10188604 | 3300005937 | Bacteria | 1555 |
| 137 | Ga0081455_10699478 | 3300005937 | Unclassified | 646 |
| 138 | Ga0081538_10013890 | 3300005981 | Bacteria | 6345 |
| 139 | Ga0081538_10104212 | 3300005981 | Bacteria | 1416 |
| 140 | Ga0081538_10216687 | 3300005981 | Unclassified | 764 |
| 141 | Ga0081540_1000068 | 3300005983 | Bacteria | 112697 |
| 142 | Ga0081540_1007636 | 3300005983 | Bacteria | 7675 |
| 143 | Ga0081540_1049542 | 3300005983 | Bacteria | 2094 |
| 144 | Ga0081540_1092555 | 3300005983 | Bacteria | 1326 |
| 145 | Ga0070717_10226629 | 3300006028 | Bacteria | 1644 |
| 146 | Ga0070717_10286756 | 3300006028 | Unclassified | 1461 |
| 147 | Ga0070717_10572477 | 3300006028 | Bacteria | 1024 |
| 148 | Ga0070717_10859629 | 3300006028 | Bacteria | 825 |
| 149 | Ga0075365_10015218 | 3300006038 | Bacteria | 4648 |
| 150 | Ga0075365_10018821 | 3300006038 | Bacteria | 4253 |
| 151 | Ga0075365_10302639 | 3300006038 | Bacteria | 1125 |
| 152 | Ga0075363_100048975 | 3300006048 | Bacteria | 2248 |
| 153 | Ga0075363_100117284 | 3300006048 | Bacteria | 1484 |
| 154 | Ga0075364_10413454 | 3300006051 | Unclassified | 921 |
| 155 | Ga0070715_10102597 | 3300006163 | Bacteria | 1337 |
| 156 | Ga0070715_10177680 | 3300006163 | Unclassified | 1065 |
| 157 | Ga0070716_101794603 | 3300006173 | Bacteria | 508 |
| 158 | Ga0070712_100174383 | 3300006175 | Bacteria | 1671 |
| 159 | Ga0070712_100238937 | 3300006175 | Bacteria | 1446 |
| 160 | Ga0070712_100820646 | 3300006175 | Bacteria | 799 |
| 161 | Ga0070712_101354732 | 3300006175 | Bacteria | 620 |
| 162 | Ga0075362_10521090 | 3300006177 | Bacteria | 609 |
| 163 | Ga0075366_10482154 | 3300006195 | Bacteria | 766 |
| 164 | Ga0097621_100051940 | 3300006237 | Bacteria | 3337 |
| 165 | Ga0097621_100094989 | 3300006237 | Bacteria | 2500 |
| 166 | Ga0068871_101095445 | 3300006358 | Unclassified | 745 |
| 167 | Ga0075428_100094169 | 3300006844 | Bacteria | 3266 |
| 168 | Ga0075428_100168066 | 3300006844 | Bacteria | 2379 |
| 169 | Ga0075428_100178024 | 3300006844 | Bacteria | 2303 |
| 170 | Ga0075428_100289922 | 3300006844 | Bacteria | 1760 |
| 171 | Ga0075428_101010683 | 3300006844 | Unclassified | 880 |
| 172 | Ga0075428_102054257 | 3300006844 | Bacteria | 592 |
| 173 | Ga0075430_100031870 | 3300006846 | Bacteria | 4474 |
| 174 | Ga0075430_100667622 | 3300006846 | Unclassified | 857 |
| 175 | Ga0075431_100053442 | 3300006847 | Bacteria | 4165 |
| 176 | Ga0075431_100268002 | 3300006847 | Bacteria | 1732 |
| 177 | Ga0075431_100269032 | 3300006847 | Unclassified | 1728 |
| 178 | Ga0075433_10230811 | 3300006852 | Bacteria | 1644 |
| 179 | Ga0075433_10919858 | 3300006852 | Unclassified | 763 |
| 180 | Ga0075434_100040273 | 3300006871 | Bacteria | 4627 |
| 181 | Ga0075429_100254854 | 3300006880 | Unclassified | 1536 |
| 182 | Ga0075429_100424157 | 3300006880 | Bacteria | 1165 |
| 183 | Ga0075429_100628377 | 3300006880 | Unclassified | 941 |
| 184 | Ga0068865_100322438 | 3300006881 | Bacteria | 1243 |
| 185 | Ga0068865_100331929 | 3300006881 | Bacteria | 1226 |
| 186 | Ga0068865_100895085 | 3300006881 | Bacteria | 771 |
| 187 | Ga0075436_100017742 | 3300006914 | Bacteria | 4872 |
| 188 | Ga0075436_100619313 | 3300006914 | Bacteria | 798 |
| 189 | Ga0097620_100498714 | 3300006931 | Bacteria | 1313 |
| 190 | Ga0075435_100572691 | 3300007076 | Bacteria | 979 |
| 191 | Ga0099794_10048661 | 3300007265 | Bacteria | 2035 |
| 192 | Ga0099795_10015498 | 3300007788 | Bacteria | 2389 |
| 193 | Ga0099795_10288849 | 3300007788 | Bacteria | 718 |
| 194 | Ga0099795_10445570 | 3300007788 | Bacteria | 595 |
| 195 | Ga0105240_10003482 | 3300009093 | Bacteria | 24419 |
| 196 | Ga0105240_10029418 | 3300009093 | Bacteria | 7157 |
| 197 | Ga0105240_10185602 | 3300009093 | Bacteria | 2450 |
| 198 | Ga0105240_10643314 | 3300009093 | Bacteria | 1163 |
| 199 | Ga0105240_11097916 | 3300009093 | Bacteria | 847 |
| 200 | Ga0111539_10018297 | 3300009094 | Bacteria | 8679 |
| 201 | Ga0111539_10041142 | 3300009094 | Bacteria | 5558 |
| 202 | Ga0111539_10473801 | 3300009094 | Bacteria | 1458 |
| 203 | Ga0111539_10824096 | 3300009094 | Bacteria | 1080 |
| 204 | Ga0111539_11470483 | 3300009094 | Bacteria | 790 |
| 205 | Ga0111539_12542096 | 3300009094 | Bacteria | 594 |
| 206 | Ga0105245_10007194 | 3300009098 | Bacteria | 9752 |
| 207 | Ga0105245_10245251 | 3300009098 | Bacteria | 1738 |
| 208 | Ga0105247_10316839 | 3300009101 | Bacteria | 1087 |
| 209 | Ga0114129_10014687 | 3300009147 | Bacteria | 11158 |
| 210 | Ga0114129_10483879 | 3300009147 | Bacteria | 1619 |
| 211 | Ga0114129_11729769 | 3300009147 | Bacteria | 762 |
| 212 | Ga0105243_10938370 | 3300009148 | Unclassified | 863 |
| 213 | Ga0105243_10994120 | 3300009148 | Unclassified | 841 |
| 214 | Ga0105243_11448815 | 3300009148 | Bacteria | 709 |
| 215 | Ga0105241_10412811 | 3300009174 | Bacteria | 1186 |
| 216 | Ga0105241_10523306 | 3300009174 | Bacteria | 1061 |
| 217 | Ga0105242_11677675 | 3300009176 | Unclassified | 671 |
| 218 | Ga0105248_10027688 | 3300009177 | Bacteria | 6312 |
| 219 | Ga0105248_10218075 | 3300009177 | Bacteria | 2148 |
| 220 | Ga0105248_11668763 | 3300009177 | Unclassified | 722 |
| 221 | Ga0105237_10828155 | 3300009545 | Bacteria | 932 |
| 222 | Ga0105238_10011409 | 3300009551 | Bacteria | 8948 |
| 223 | Ga0105238_10132631 | 3300009551 | Bacteria | 2469 |
| 224 | Ga0105238_10637521 | 3300009551 | Bacteria | 1075 |
| 225 | Ga0105249_10538486 | 3300009553 | Unclassified | 1217 |
| 226 | Ga0099796_10017549 | 3300010159 | Bacteria | 2133 |
| 227 | Ga0105239_11376848 | 3300010375 | Unclassified | 814 |
| 228 | Ga0105239_12666317 | 3300010375 | Unclassified | 583 |
| 229 | Ga0105246_10453684 | 3300011119 | Bacteria | 1078 |
| 230 | Ga0157347_1016424 | 3300012502 | Bacteria | 833 |
| 231 | Ga0157373_10068119 | 3300013100 | Bacteria | 2516 |
| 232 | Ga0157373_10072811 | 3300013100 | Bacteria | 2425 |
| 233 | Ga0157373_10075187 | 3300013100 | Bacteria | 2383 |
| 234 | Ga0157371_10162056 | 3300013102 | Bacteria | 1597 |
| 235 | Ga0157371_10164667 | 3300013102 | Bacteria | 1584 |
| 236 | Ga0157370_10002489 | 3300013104 | Bacteria | 22197 |
| 237 | Ga0157370_10045586 | 3300013104 | Bacteria | 4205 |
| 238 | Ga0157370_10103934 | 3300013104 | Bacteria | 2659 |
| 239 | Ga0157370_10937366 | 3300013104 | Bacteria | 785 |
| 240 | Ga0157369_10364362 | 3300013105 | Bacteria | 1500 |
| 241 | Ga0157369_10511848 | 3300013105 | Bacteria | 1242 |
| 242 | Ga0157369_11472327 | 3300013105 | Unclassified | 693 |
| 243 | Ga0157374_10106839 | 3300013296 | Unclassified | 2689 |
| 244 | Ga0157374_10592351 | 3300013296 | Bacteria | 1118 |
| 245 | Ga0157378_10200316 | 3300013297 | Bacteria | 1888 |
| 246 | Ga0157378_10822153 | 3300013297 | Bacteria | 956 |
| 247 | Ga0157378_11387785 | 3300013297 | Bacteria | 745 |
| 248 | Ga0163162_10077112 | 3300013306 | Bacteria | 3396 |
| 249 | Ga0163162_10088372 | 3300013306 | Bacteria | 3178 |
| 250 | Ga0163162_10968260 | 3300013306 | Bacteria | 961 |
| 251 | Ga0163162_11246561 | 3300013306 | Unclassified | 844 |
| 252 | Ga0157372_10082809 | 3300013307 | Bacteria | 3633 |
| 253 | Ga0157372_10371677 | 3300013307 | Bacteria | 1666 |
| 254 | Ga0157372_10941723 | 3300013307 | Bacteria | 1001 |
| 255 | Ga0157372_11539135 | 3300013307 | Bacteria | 766 |
| 256 | Ga0157375_10063653 | 3300013308 | Bacteria | 3670 |
| 257 | Ga0157375_11822674 | 3300013308 | Unclassified | 721 |
| 258 | Ga0163163_10113546 | 3300014325 | Bacteria | 2739 |
| 259 | Ga0163163_10437559 | 3300014325 | Bacteria | 1367 |
| 260 | Ga0157380_11292428 | 3300014326 | Bacteria | 776 |
| 261 | Ga0182008_10581622 | 3300014497 | Bacteria | 626 |
| 262 | Ga0157377_10208472 | 3300014745 | Bacteria | 1245 |
| 263 | Ga0157379_10650681 | 3300014968 | Bacteria | 987 |
| 264 | Ga0157379_10720888 | 3300014968 | Bacteria | 937 |
| 265 | Ga0157379_10889064 | 3300014968 | Unclassified | 844 |
| 266 | Ga0157376_10029373 | 3300014969 | Bacteria | 4378 |
| 267 | Ga0157376_10662024 | 3300014969 | Bacteria | 1046 |
| 268 | Ga0157376_11651397 | 3300014969 | Bacteria | 675 |
| 269 | Ga0163161_10761170 | 3300017792 | Bacteria | 811 |
| 270 | Ga0163161_11026704 | 3300017792 | Bacteria | 705 |
| 271 | Ga0163161_11513349 | 3300017792 | Unclassified | 589 |
| 272 | Ga0213876_10051631 | 3300021384 | Bacteria | 2173 |
| 273 | Ga0213876_10190909 | 3300021384 | Bacteria | 1089 |
| 274 | Ga0213876_10240472 | 3300021384 | Bacteria | 962 |
| 275 | Ga0207656_10056127 | 3300025321 | Bacteria | 1716 |
| 276 | Ga0207692_10123246 | 3300025898 | Bacteria | 1454 |
| 277 | Ga0207692_10348740 | 3300025898 | Bacteria | 912 |
| 278 | Ga0207692_10352079 | 3300025898 | Bacteria | 908 |
| 279 | Ga0207692_10490495 | 3300025898 | Unclassified | 778 |
| 280 | Ga0207642_10017305 | 3300025899 | Bacteria | 2738 |
| 281 | Ga0207642_10091233 | 3300025899 | Bacteria | 1505 |
| 282 | Ga0207710_10227364 | 3300025900 | Unclassified | 928 |
| 283 | Ga0207710_10382594 | 3300025900 | Bacteria | 720 |
| 284 | Ga0207688_10114003 | 3300025901 | Bacteria | 1572 |
| 285 | Ga0207680_10338459 | 3300025903 | Bacteria | 1055 |
| 286 | Ga0207699_10383479 | 3300025906 | Bacteria | 998 |
| 287 | Ga0207699_10813606 | 3300025906 | Bacteria | 687 |
| 288 | Ga0207645_10079675 | 3300025907 | Bacteria | 2099 |
| 289 | Ga0207645_10691055 | 3300025907 | Bacteria | 693 |
| 290 | Ga0207705_10023664 | 3300025909 | Bacteria | 4382 |
| 291 | Ga0207705_10033896 | 3300025909 | Bacteria | 3648 |
| 292 | Ga0207705_10165287 | 3300025909 | Bacteria | 1664 |
| 293 | Ga0207705_10532328 | 3300025909 | Bacteria | 913 |
| 294 | Ga0207684_10794851 | 3300025910 | Bacteria | 800 |
| 295 | Ga0207707_10012084 | 3300025912 | Bacteria | 7508 |
| 296 | Ga0207707_10015854 | 3300025912 | Bacteria | 6572 |
| 297 | Ga0207707_10024122 | 3300025912 | Bacteria | 5320 |
| 298 | Ga0207707_10041100 | 3300025912 | Bacteria | 4038 |
| 299 | Ga0207695_10120980 | 3300025913 | Bacteria | 2586 |
| 300 | Ga0207695_10906826 | 3300025913 | Bacteria | 761 |
| 301 | Ga0207693_10010728 | 3300025915 | Bacteria | 7437 |
| 302 | Ga0207693_10100071 | 3300025915 | Unclassified | 2273 |
| 303 | Ga0207693_10180388 | 3300025915 | Bacteria | 1661 |
| 304 | Ga0207693_10183157 | 3300025915 | Unclassified | 1649 |
| 305 | Ga0207693_10276185 | 3300025915 | Bacteria | 1316 |
| 306 | Ga0207663_10037278 | 3300025916 | Bacteria | 2930 |
| 307 | Ga0207663_10355080 | 3300025916 | Bacteria | 1111 |
| 308 | Ga0207663_10460575 | 3300025916 | Bacteria | 982 |
| 309 | Ga0207663_10623122 | 3300025916 | Bacteria | 849 |
| 310 | Ga0207663_10780830 | 3300025916 | Bacteria | 760 |
| 311 | Ga0207660_10003904 | 3300025917 | Bacteria | 9716 |
| 312 | Ga0207660_10036831 | 3300025917 | Bacteria | 3403 |
| 313 | Ga0207660_10431128 | 3300025917 | Unclassified | 1064 |
| 314 | Ga0207660_10755667 | 3300025917 | Bacteria | 793 |
| 315 | Ga0207662_10008714 | 3300025918 | Bacteria | 5564 |
| 316 | Ga0207662_10055613 | 3300025918 | Bacteria | 2362 |
| 317 | Ga0207657_10028544 | 3300025919 | Bacteria | 5089 |
| 318 | Ga0207657_10618087 | 3300025919 | Bacteria | 845 |
| 319 | Ga0207652_10006133 | 3300025921 | Bacteria | 9720 |
| 320 | Ga0207652_10018723 | 3300025921 | Bacteria | 5683 |
| 321 | Ga0207652_10083338 | 3300025921 | Bacteria | 2800 |
| 322 | Ga0207652_10370980 | 3300025921 | Bacteria | 1292 |
| 323 | Ga0207652_10392550 | 3300025921 | Bacteria | 1252 |
| 324 | Ga0207652_11040336 | 3300025921 | Bacteria | 718 |
| 325 | Ga0207652_11271331 | 3300025921 | Bacteria | 638 |
| 326 | Ga0207681_11199316 | 3300025923 | Unclassified | 638 |
| 327 | Ga0207694_10089709 | 3300025924 | Bacteria | 2425 |
| 328 | Ga0207694_10315496 | 3300025924 | Bacteria | 1289 |
| 329 | Ga0207694_10454387 | 3300025924 | Bacteria | 1069 |
| 330 | Ga0207650_10026548 | 3300025925 | Bacteria | 4133 |
| 331 | Ga0207659_10393114 | 3300025926 | Bacteria | 1158 |
| 332 | Ga0207687_10050158 | 3300025927 | Bacteria | 2904 |
| 333 | Ga0207687_10100493 | 3300025927 | Bacteria | 2128 |
| 334 | Ga0207700_11219003 | 3300025928 | Unclassified | 671 |
| 335 | Ga0207700_11243491 | 3300025928 | Unclassified | 664 |
| 336 | Ga0207664_10129974 | 3300025929 | Bacteria | 2119 |
| 337 | Ga0207690_10065141 | 3300025932 | Bacteria | 2491 |
| 338 | Ga0207706_10012271 | 3300025933 | Bacteria | 7808 |
| 339 | Ga0207706_10869276 | 3300025933 | Bacteria | 763 |
| 340 | Ga0207709_10020359 | 3300025935 | Bacteria | 3741 |
| 341 | Ga0207670_10038888 | 3300025936 | Bacteria | 3110 |
| 342 | Ga0207669_10171999 | 3300025937 | Bacteria | 1543 |
| 343 | Ga0207669_10390901 | 3300025937 | Unclassified | 1086 |
| 344 | Ga0207669_10529717 | 3300025937 | Bacteria | 947 |
| 345 | Ga0207704_10670083 | 3300025938 | Bacteria | 856 |
| 346 | Ga0207704_11317725 | 3300025938 | Bacteria | 618 |
| 347 | Ga0207665_11384929 | 3300025939 | Bacteria | 560 |
| 348 | Ga0207691_10043196 | 3300025940 | Bacteria | 4155 |
| 349 | Ga0207691_10536759 | 3300025940 | Bacteria | 992 |
| 350 | Ga0207711_10256644 | 3300025941 | Bacteria | 1606 |
| 351 | Ga0207689_10009474 | 3300025942 | Bacteria | 8408 |
| 352 | Ga0207689_10635508 | 3300025942 | Bacteria | 899 |
| 353 | Ga0207689_10647442 | 3300025942 | Unclassified | 890 |
| 354 | Ga0207689_11363723 | 3300025942 | Bacteria | 595 |
| 355 | Ga0207661_10490055 | 3300025944 | Bacteria | 1123 |
| 356 | Ga0207667_10297011 | 3300025949 | Bacteria | 1650 |
| 357 | Ga0207667_10318718 | 3300025949 | Bacteria | 1588 |
| 358 | Ga0207651_10168920 | 3300025960 | Bacteria | 1723 |
| 359 | Ga0207651_10504497 | 3300025960 | Bacteria | 1046 |
| 360 | Ga0207651_10868824 | 3300025960 | Unclassified | 802 |
| 361 | Ga0207712_10250670 | 3300025961 | Bacteria | 1431 |
| 362 | Ga0207668_10133548 | 3300025972 | Bacteria | 1899 |
| 363 | Ga0207640_10296798 | 3300025981 | Bacteria | 1276 |
| 364 | Ga0207677_10021380 | 3300026023 | Bacteria | 3952 |
| 365 | Ga0207677_10115874 | 3300026023 | Bacteria | 2005 |
| 366 | Ga0207677_10198682 | 3300026023 | Bacteria | 1592 |
| 367 | Ga0207703_10019096 | 3300026035 | Bacteria | 5355 |
| 368 | Ga0207703_10638620 | 3300026035 | Bacteria | 1009 |
| 369 | Ga0207639_10085909 | 3300026041 | Bacteria | 2504 |
| 370 | Ga0207639_10416622 | 3300026041 | Bacteria | 1213 |
| 371 | Ga0207639_10680914 | 3300026041 | Bacteria | 953 |
| 372 | Ga0207678_10078006 | 3300026067 | Bacteria | 2837 |
| 373 | Ga0207678_10190387 | 3300026067 | Bacteria | 1753 |
| 374 | Ga0207708_10021260 | 3300026075 | Bacteria | 4892 |
| 375 | Ga0207708_10351050 | 3300026075 | Bacteria | 1210 |
| 376 | Ga0207702_10064258 | 3300026078 | Bacteria | 3140 |
| 377 | Ga0207702_10077085 | 3300026078 | Bacteria | 2882 |
| 378 | Ga0207702_10180680 | 3300026078 | Bacteria | 1943 |
| 379 | Ga0207702_11103310 | 3300026078 | Bacteria | 787 |
| 380 | Ga0207641_10377318 | 3300026088 | Unclassified | 1357 |
| 381 | Ga0207648_10373803 | 3300026089 | Bacteria | 1288 |
| 382 | Ga0207648_10555775 | 3300026089 | Bacteria | 1055 |
| 383 | Ga0207676_10016006 | 3300026095 | Bacteria | 5427 |
| 384 | Ga0207676_10178089 | 3300026095 | Bacteria | 1859 |
| 385 | Ga0207676_10434509 | 3300026095 | Bacteria | 1234 |
| 386 | Ga0207674_10067339 | 3300026116 | Bacteria | 3605 |
| 387 | Ga0207674_10095871 | 3300026116 | Bacteria | 2952 |
| 388 | Ga0207674_10754095 | 3300026116 | Bacteria | 939 |
| 389 | Ga0207674_11711839 | 3300026116 | Bacteria | 597 |
| 390 | Ga0207675_100605076 | 3300026118 | Bacteria | 1099 |
| 391 | Ga0207683_10045559 | 3300026121 | Bacteria | 3836 |
| 392 | Ga0207683_10348475 | 3300026121 | Bacteria | 1359 |
| 393 | Ga0207683_12101514 | 3300026121 | Unclassified | 513 |
| 394 | Ga0207698_10040697 | 3300026142 | Bacteria | 3457 |
| 395 | Ga0207698_10166548 | 3300026142 | Bacteria | 1935 |
| 396 | Ga0207698_10360751 | 3300026142 | Bacteria | 1376 |
| 397 | Ga0207698_11649120 | 3300026142 | Bacteria | 657 |
| 398 | Ga0207428_10176070 | 3300027907 | Unclassified | 1618 |
| 399 | Ga0268266_10492635 | 3300028379 | Unclassified | 1169 |
| 400 | Ga0268266_10885560 | 3300028379 | Bacteria | 863 |
| 401 | Ga0268265_10285823 | 3300028380 | Bacteria | 1478 |
| 402 | Ga0268265_10919325 | 3300028380 | Bacteria | 860 |
| 403 | Ga0268264_10519945 | 3300028381 | Bacteria | 1163 |
| 404 | Ga0265338_10044761 | 3300028800 | Bacteria | 4080 |
| 405 | Ga0265338_10178817 | 3300028800 | Bacteria | 1620 |
| 406 | Ga0265338_10367886 | 3300028800 | Bacteria | 1030 |
| 407 | Ga0265332_10002624 | 3300031238 | Bacteria | 9065 |
| 408 | Ga0265332_10184891 | 3300031238 | Bacteria | 868 |
| 409 | Ga0265328_10276597 | 3300031239 | Bacteria | 646 |
| 410 | Ga0265325_10000093 | 3300031241 | Bacteria | 63498 |
| 411 | Ga0265325_10011946 | 3300031241 | Bacteria | 4976 |
| 412 | Ga0265325_10040411 | 3300031241 | Bacteria | 2450 |
| 413 | Ga0265325_10052422 | 3300031241 | Bacteria | 2095 |
| 414 | Ga0265325_10082024 | 3300031241 | Bacteria | 1601 |
| 415 | Ga0265340_10001806 | 3300031247 | Bacteria | 12218 |
| 416 | Ga0265340_10046308 | 3300031247 | Bacteria | 2122 |
| 417 | Ga0265339_10037937 | 3300031249 | Bacteria | 2690 |
| 418 | Ga0265331_10015974 | 3300031250 | Bacteria | 3950 |
| 419 | Ga0265316_10342677 | 3300031344 | Bacteria | 1083 |
| 420 | Ga0307513_10341113 | 3300031456 | Bacteria | 1249 |
| 421 | Ga0307513_10451896 | 3300031456 | Bacteria | 1009 |
| 422 | Ga0265313_10004184 | 3300031595 | Bacteria | 11198 |
| 423 | Ga0265313_10004593 | 3300031595 | Bacteria | 10500 |
| 424 | Ga0265313_10017649 | 3300031595 | Bacteria | 4042 |
| 425 | Ga0265313_10062905 | 3300031595 | Unclassified | 1732 |
| 426 | Ga0265313_10289248 | 3300031595 | Bacteria | 661 |
| 427 | Ga0265313_10331107 | 3300031595 | Unclassified | 607 |
| 428 | Ga0316575_10138170 | 3300031665 | Bacteria | 1002 |
| 429 | Ga0265314_10009933 | 3300031711 | Bacteria | 7979 |
| 430 | Ga0265314_10204412 | 3300031711 | Bacteria | 1165 |
| 431 | Ga0265314_10321225 | 3300031711 | Unclassified | 861 |
| 432 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 433 | Ga0265342_10004077 | 3300031712 | Bacteria | 11650 |
| 434 | Ga0265342_10005903 | 3300031712 | Bacteria | 9230 |
| 435 | Ga0307405_10772364 | 3300031731 | Bacteria | 802 |
| 436 | Ga0307405_11662638 | 3300031731 | Bacteria | 565 |
| 437 | Ga0307407_10154549 | 3300031903 | Bacteria | 1495 |
| 438 | Ga0307412_10535371 | 3300031911 | Bacteria | 981 |
| 439 | Ga0307409_100037395 | 3300031995 | Bacteria | 3579 |
| 440 | Ga0307416_102849148 | 3300032002 | Bacteria | 578 |
| 441 | Ga0307414_11591800 | 3300032004 | Unclassified | 609 |
| 442 | Ga0316583_10006570 | 3300032133 | Bacteria | 4179 |
| 443 | Ga0316583_10051647 | 3300032133 | Bacteria | 1447 |
| 444 | Ga0373930_0008949 | 3300034816 | Bacteria | 1762 |
| 445 | Ga0373930_0120618 | 3300034816 | Bacteria | 638 |
| 446 | Ga0373926_0061157 | 3300035083 | Bacteria | 1373 |
| 447 | Ga0373929_0008642 | 3300035085 | Bacteria | 1879 |
| 448 | Ga0373929_0033797 | 3300035085 | Unclassified | 1107 |
| 449 | Ga0373934_0015879 | 3300035086 | Bacteria | 2861 |
| 450 | Ga0373944_0013671 | 3300035089 | Bacteria | 2256 |
| 451 | Ga0373949_0156178 | 3300035090 | Unclassified | 663 |
| 452 | Ga0373923_0126914 | 3300035111 | Bacteria | 1144 |
| 453 | Ga0373936_0053390 | 3300035113 | Bacteria | 1639 |
| 454 | Ga0373936_0106597 | 3300035113 | Unclassified | 1187 |
| 455 | Ga0373939_0271639 | 3300035114 | Bacteria | 667 |
| 456 | Ga0373941_0123492 | 3300035115 | Bacteria | 925 |
| 457 | Ga0373945_0009911 | 3300035116 | Bacteria | 3127 |
| 458 | Ga0373945_0043030 | 3300035116 | Bacteria | 1638 |
| 459 | Ga0373953_0048401 | 3300035117 | Bacteria | 1713 |
| 460 | Ga0373953_0075832 | 3300035117 | Bacteria | 1393 |
| 461 | Ga0373954_0017797 | 3300035118 | Bacteria | 3195 |
| 462 | Ga0373956_0313432 | 3300035119 | Bacteria | 747 |
| 463 | Ga0373957_0231902 | 3300035120 | Unclassified | 774 |
| 464 | Ga0373960_0054927 | 3300035121 | Bacteria | 1192 |
| 465 | Ga0373943_0069495 | 3300035170 | Bacteria | 1780 |
| 466 | Ga0373943_0147143 | 3300035170 | Bacteria | 1273 |
| 467 | Ga0373943_0196088 | 3300035170 | Bacteria | 1116 |
| 468 | Ga0373946_0025694 | 3300035171 | Bacteria | 2317 |
| 469 | Ga0373955_0005085 | 3300035172 | Bacteria | 5877 |
| 470 | Ga0373942_0003214 | 3300035207 | Bacteria | 3864 |
| 471 | Ga0373961_0094364 | 3300035241 | Bacteria | 960 |
| 472 | Ga0373924_0102896 | 3300035410 | Unclassified | 1229 |
| 473 | Ga0373935_0076414 | 3300035692 | Bacteria | 2168 |
| 474 | Ga0373935_0097912 | 3300035692 | Bacteria | 1930 |
| 475 | Ga0373935_0392411 | 3300035692 | Bacteria | 995 |
| 476 | Ga0373927_0008790 | 3300035695 | Bacteria | 6789 |
| 477 | Ga0373927_0129613 | 3300035695 | Bacteria | 1647 |
| 478 | Ga0373927_0148091 | 3300035695 | Unclassified | 1537 |
| 479 | Ga0373933_0005755 | 3300035724 | Bacteria | 6741 |
| 480 | Ga0373933_0062054 | 3300035724 | Bacteria | 2256 |
| 481 | Ga0373947_0058919 | 3300035725 | Bacteria | 2327 |
| 482 | Ga0373947_0130567 | 3300035725 | Bacteria | 1603 |
| 483 | Ga0373947_0479990 | 3300035725 | Bacteria | 843 |
| 484 | Ga0373937_0009762 | 3300036401 | Bacteria | 8368 |
| 485 | Ga0373937_0012997 | 3300036401 | Bacteria | 7332 |
| 486 | Ga0373937_0029122 | 3300036401 | Bacteria | 5000 |
| 487 | Ga0373937_0603033 | 3300036401 | Unclassified | 1042 |
| 488 | Ga0373937_1891769 | 3300036401 | Unclassified | 543 |
| 489 | Ga0373925_0098549 | 3300037068 | Bacteria | 2243 |
| 490 | Ga0373925_0228222 | 3300037068 | Bacteria | 1488 |
| 491 | Ga0373925_1445184 | 3300037068 | Bacteria | 563 |
| 492 | Ga0395900_0003409 | 3300037418 | Bacteria | 17178 |
| 493 | Ga0395900_0031012 | 3300037418 | Bacteria | 5491 |
| 494 | Ga0395900_0084690 | 3300037418 | Bacteria | 3258 |
| 495 | Ga0395898_0004890 | 3300037466 | Bacteria | 14548 |
| 496 | Ga0395898_0043106 | 3300037466 | Bacteria | 4447 |
| 497 | Ga0395898_0089749 | 3300037466 | Bacteria | 2958 |
| 498 | Ga0395898_0455564 | 3300037466 | Bacteria | 1218 |
| 499 | Ga0436364_0135547 | 3300037853 | Bacteria | 922 |
| 500 | Ga0436364_1278643 | 3300037853 | Bacteria | 3800 |
| 501 | Ga0395901_0066218 | 3300038443 | Bacteria | 3763 |
| 502 | Ga0395901_0083425 | 3300038443 | Bacteria | 3340 |
| 503 | Ga0395901_0355132 | 3300038443 | Bacteria | 1512 |
| 504 | Ga0395901_0612153 | 3300038443 | Bacteria | 1097 |
| 505 | Ga0436365_0080885 | 3300039437 | Bacteria | 2175 |
| 506 | Ga0436365_0228691 | 3300039437 | Bacteria | 6281 |
| 507 | Ga0436365_0258563 | 3300039437 | Bacteria | 1174 |
| 508 | Ga0436365_0364923 | 3300039437 | Bacteria | 799 |
| 509 | Ga0436365_0420225 | 3300039437 | Bacteria | 7863 |
| 510 | Ga0436365_1935734 | 3300039437 | Bacteria | 2060 |
| 511 | Ga0436360_0029211 | 3300039438 | Bacteria | 971 |
| 512 | Ga0436360_0286970 | 3300039438 | Bacteria | 2439 |
| 513 | Ga0436360_0395899 | 3300039438 | Bacteria | 1558 |
| 514 | Ga0436360_0524608 | 3300039438 | Bacteria | 1246 |
| 515 | Ga0436360_0807994 | 3300039438 | Bacteria | 3083 |
| 516 | Ga0436360_0817002 | 3300039438 | Unclassified | 547 |
| 517 | Ga0436360_1056072 | 3300039438 | Bacteria | 1028 |
| 518 | Ga0436360_1083614 | 3300039438 | Bacteria | 4290 |
| 519 | Ga0436360_1174518 | 3300039438 | Bacteria | 3461 |
| 520 | Ga0436361_1033080 | 3300039447 | Unclassified | 647 |
| 521 | Ga0436361_1127209 | 3300039447 | Bacteria | 1308 |
| 522 | Ga0436363_0232716 | 3300039450 | Unclassified | 657 |
| 523 | Ga0436363_0843885 | 3300039450 | Unclassified | 1099 |
| 524 | Ga0439441_074850 | 3300042001 | Bacteria | 730 |
| 525 | Ga0466961_0296685 | 3300044693 | Bacteria | 988 |
| 526 | Ga0466963_0054091 | 3300044694 | Unclassified | 2667 |
| 527 | Ga0466971_0242908 | 3300044719 | Bacteria | 857 |
| 528 | Ga0466970_0654927 | 3300044765 | Bacteria | 611 |
| 529 | Ga0466957_0264843 | 3300044842 | Bacteria | 1146 |
| 530 | Ga0466957_0365656 | 3300044842 | Bacteria | 981 |
| 531 | Ga0466957_0626902 | 3300044842 | Bacteria | 754 |
| 532 | Ga0466957_0877865 | 3300044842 | Bacteria | 640 |
| 533 | Ga0466959_0974282 | 3300045049 | Unclassified | 565 |
| 534 | Ga0466958_0217546 | 3300045836 | Bacteria | 1218 |
| 535 | Ga0466958_0447679 | 3300045836 | Bacteria | 836 |
| 536 | Ga0466967_0183152 | 3300045976 | Bacteria | 1976 |
| 537 | Ga0466967_1122116 | 3300045976 | Bacteria | 784 |
| 538 | Ga0495592_0105995 | 3300046454 | Bacteria | 1996 |
| 539 | Ga0495592_0107693 | 3300046454 | Bacteria | 1977 |
| 540 | Ga0495592_0814260 | 3300046454 | Bacteria | 554 |
| 541 | Ga0495603_0247896 | 3300046455 | Bacteria | 1025 |
| 542 | Ga0495590_0031250 | 3300046457 | Bacteria | 1865 |
| 543 | Ga0495629_0229183 | 3300046459 | Bacteria | 1281 |
| 544 | Ga0495629_0428416 | 3300046459 | Bacteria | 897 |
| 545 | Ga0495641_0075635 | 3300046461 | Bacteria | 1510 |
| 546 | Ga0495651_0080248 | 3300046462 | Bacteria | 2465 |
| 547 | Ga0495651_0543680 | 3300046462 | Unclassified | 739 |
| 548 | Ga0495580_0002052 | 3300046472 | Bacteria | 17682 |
| 549 | Ga0495580_0088606 | 3300046472 | Bacteria | 2155 |
| 550 | Ga0495580_0170521 | 3300046472 | Bacteria | 1505 |
| 551 | Ga0495580_0198559 | 3300046472 | Bacteria | 1383 |
| 552 | Ga0495580_0251880 | 3300046472 | Unclassified | 1209 |
| 553 | Ga0495580_0617517 | 3300046472 | Bacteria | 715 |
| 554 | Ga0495582_0063249 | 3300046473 | Bacteria | 2044 |
| 555 | Ga0495605_0109056 | 3300046474 | Bacteria | 1265 |
| 556 | Ga0495639_0018096 | 3300046475 | Bacteria | 3064 |
| 557 | Ga0495662_0120502 | 3300046476 | Bacteria | 1288 |
| 558 | Ga0495662_0306238 | 3300046476 | Bacteria | 781 |
| 559 | Ga0495664_0338073 | 3300046477 | Bacteria | 907 |
| 560 | Ga0495607_0546456 | 3300046501 | Bacteria | 509 |
| 561 | Ga0495616_0055684 | 3300046513 | Bacteria | 1957 |
| 562 | Ga0495618_0164167 | 3300046514 | Bacteria | 1415 |
| 563 | Ga0495628_0013920 | 3300046516 | Bacteria | 6755 |
| 564 | Ga0495628_0257822 | 3300046516 | Bacteria | 1300 |
| 565 | Ga0495628_0260740 | 3300046516 | Bacteria | 1292 |
| 566 | Ga0495630_0455814 | 3300046517 | Bacteria | 980 |
| 567 | Ga0495630_0993111 | 3300046517 | Bacteria | 638 |
| 568 | Ga0495631_0055914 | 3300046518 | Bacteria | 1719 |
| 569 | Ga0495663_0030132 | 3300046525 | Bacteria | 1606 |
| 570 | Ga0495666_0095955 | 3300046526 | Bacteria | 1398 |
| 571 | Ga0495666_0385872 | 3300046526 | Bacteria | 630 |
| 572 | Ga0495642_0069433 | 3300046528 | Bacteria | 1472 |
| 573 | Ga0495652_0024293 | 3300046529 | Bacteria | 5366 |
| 574 | Ga0495652_0095258 | 3300046529 | Bacteria | 2426 |
| 575 | Ga0495652_0353649 | 3300046529 | Bacteria | 1052 |
| 576 | Ga0495652_0368303 | 3300046529 | Bacteria | 1025 |
| 577 | Ga0495665_0151730 | 3300046531 | Bacteria | 1209 |
| 578 | Ga0495640_0028513 | 3300046533 | Bacteria | 4019 |
| 579 | Ga0495640_0250719 | 3300046533 | Bacteria | 1109 |
| 580 | Ga0495640_0458136 | 3300046533 | Bacteria | 778 |
| 581 | Ga0495587_0093933 | 3300046536 | Unclassified | 1732 |
| 582 | Ga0495587_0537436 | 3300046536 | Archaea | 645 |
| 583 | Ga0495598_0005428 | 3300046537 | Bacteria | 2824 |
| 584 | Ga0495645_0014092 | 3300046543 | Bacteria | 5665 |
| 585 | Ga0495645_0224988 | 3300046543 | Bacteria | 1260 |
| 586 | Ga0495645_0264898 | 3300046543 | Bacteria | 1136 |
| 587 | Ga0495622_0081231 | 3300046557 | Bacteria | 1491 |
| 588 | Ga0495622_0128223 | 3300046557 | Bacteria | 1156 |
| 589 | Ga0495667_0176170 | 3300046559 | Bacteria | 1373 |
| 590 | Ga0495656_0086454 | 3300046615 | Bacteria | 1426 |
| 591 | Ga0495656_0219427 | 3300046615 | Bacteria | 950 |
| 592 | Ga0495634_0161902 | 3300046642 | Unclassified | 1410 |
| 593 | Ga0495634_0305443 | 3300046642 | Bacteria | 961 |
| 594 | Ga0495661_0055265 | 3300046665 | Bacteria | 2380 |
| 595 | Ga0495657_0187588 | 3300046675 | Bacteria | 1265 |
| 596 | Ga0495599_0018786 | 3300046678 | Bacteria | 4309 |
| 597 | Ga0495599_0181294 | 3300046678 | Unclassified | 1298 |
| 598 | Ga0495599_0608386 | 3300046678 | Unclassified | 636 |
| 599 | Ga0495623_0014531 | 3300046679 | Bacteria | 5094 |
| 600 | Ga0495646_0142463 | 3300046680 | Bacteria | 1339 |
| 601 | Ga0495658_0460051 | 3300046683 | Bacteria | 813 |
| 602 | Ga0495613_0130213 | 3300046689 | Bacteria | 1802 |
| 603 | Ga0495624_0024582 | 3300046690 | Bacteria | 3962 |
| 604 | Ga0495670_0009666 | 3300046691 | Bacteria | 4740 |
| 605 | Ga0495589_0166784 | 3300046794 | Bacteria | 1048 |
| 606 | Ga0495600_0031905 | 3300046809 | Bacteria | 3415 |
| 607 | Ga0495581_0727573 | 3300047315 | Bacteria | 572 |
| 608 | Ga0495604_0097542 | 3300047317 | Bacteria | 2167 |
| 609 | Ga0495604_0469178 | 3300047317 | Unclassified | 820 |
| 610 | Ga0495636_0238230 | 3300047318 | Bacteria | 839 |
| 611 | Ga0495674_0112575 | 3300047319 | Bacteria | 2306 |
| 612 | Ga0495676_0030885 | 3300047321 | Bacteria | 4538 |
| 613 | Ga0495676_0069725 | 3300047321 | Bacteria | 2711 |
| 614 | Ga0495680_0136860 | 3300047322 | Bacteria | 1795 |
| 615 | Ga0495675_0346195 | 3300047444 | Bacteria | 875 |
| 616 | Ga0495684_0214979 | 3300047471 | Bacteria | 1412 |
| 617 | Ga0495684_0355385 | 3300047471 | Bacteria | 1039 |
| 618 | Ga0495602_0022774 | 3300048088 | Bacteria | 6124 |
| 619 | Ga0495602_0078864 | 3300048088 | Bacteria | 2780 |
| 620 | Ga0495602_0570332 | 3300048088 | Bacteria | 782 |
| 621 | Ga0495602_0580665 | 3300048088 | Bacteria | 773 |
| 622 | Ga0495614_0234874 | 3300048089 | Bacteria | 836 |
| 623 | Ga0495626_0195197 | 3300048091 | Bacteria | 833 |
| 624 | Ga0495626_0202287 | 3300048091 | Unclassified | 814 |
| 625 | Ga0496100_0058018 | 3300048903 | Bacteria | 2538 |
| 626 | Ga0496100_0121832 | 3300048903 | Bacteria | 1825 |
| 627 | Ga0496101_0040026 | 3300048904 | Bacteria | 3337 |
| 628 | Ga0496101_0817180 | 3300048904 | Unclassified | 735 |
| 629 | Ga0496102_0107728 | 3300048905 | Unclassified | 2595 |
| 630 | Ga0496102_0154698 | 3300048905 | Bacteria | 2155 |
| 631 | Ga0496102_0165540 | 3300048905 | Bacteria | 2080 |
| 632 | Ga0496102_0318350 | 3300048905 | Bacteria | 1465 |
| 633 | Ga0496103_0024104 | 3300048906 | Bacteria | 3670 |
| 634 | Ga0496104_0002917 | 3300048907 | Bacteria | 14731 |
| 635 | Ga0496104_0003793 | 3300048907 | Bacteria | 13077 |
| 636 | Ga0496104_0182634 | 3300048907 | Unclassified | 2008 |
| 637 | Ga0496104_0273892 | 3300048907 | Bacteria | 1600 |
| 638 | Ga0496104_0655619 | 3300048907 | Bacteria | 958 |
| 639 | Ga0496104_0888082 | 3300048907 | Unclassified | 796 |
| 640 | Ga0496105_0000307 | 3300048908 | Bacteria | 32178 |
| 641 | Ga0496105_0000442 | 3300048908 | Bacteria | 27287 |
| 642 | Ga0496105_0025142 | 3300048908 | Bacteria | 4844 |
| 643 | Ga0496105_0093240 | 3300048908 | Bacteria | 2486 |
| 644 | Ga0496105_0225748 | 3300048908 | Bacteria | 1523 |
| 645 | Ga0496105_0622772 | 3300048908 | Bacteria | 835 |
| 646 | Ga0496105_0768748 | 3300048908 | Unclassified | 734 |
| 647 | Ga0496106_0024744 | 3300048909 | Bacteria | 4464 |
| 648 | Ga0496106_0058240 | 3300048909 | Bacteria | 2924 |
| 649 | Ga0496106_0130881 | 3300048909 | Bacteria | 1967 |
| 650 | Ga0496106_0319362 | 3300048909 | Bacteria | 1246 |
| 651 | Ga0496106_0679505 | 3300048909 | Unclassified | 821 |
| 652 | Ga0496107_0185615 | 3300048910 | Bacteria | 1544 |
| 653 | Ga0496107_0446140 | 3300048910 | Unclassified | 961 |
| 654 | Ga0496108_0004617 | 3300048911 | Bacteria | 11096 |
| 655 | Ga0496108_0132920 | 3300048911 | Bacteria | 2139 |
| 656 | Ga0496108_0219069 | 3300048911 | Bacteria | 1653 |
| 657 | Ga0496108_0271821 | 3300048911 | Bacteria | 1475 |
| 658 | Ga0496108_0585117 | 3300048911 | Unclassified | 973 |
| 659 | Ga0496108_0655205 | 3300048911 | Bacteria | 912 |
| 660 | Ga0496108_0670545 | 3300048911 | Unclassified | 900 |
| 661 | Ga0496109_0001446 | 3300048912 | Bacteria | 19677 |
| 662 | Ga0496109_0179658 | 3300048912 | Bacteria | 1987 |
| 663 | Ga0496109_0208069 | 3300048912 | Unclassified | 1840 |
| 664 | Ga0496109_0822456 | 3300048912 | Bacteria | 867 |
| 665 | Ga0496109_1427953 | 3300048912 | Bacteria | 627 |
| 666 | Ga0496110_0039351 | 3300048913 | Bacteria | 4116 |
| 667 | Ga0496110_0078831 | 3300048913 | Bacteria | 2932 |
| 668 | Ga0496110_0289759 | 3300048913 | Bacteria | 1491 |
| 669 | Ga0496110_0501053 | 3300048913 | Bacteria | 1105 |
| 670 | Ga0496111_0062707 | 3300048914 | Bacteria | 2695 |
| 671 | Ga0496111_0096031 | 3300048914 | Bacteria | 2175 |
| 672 | Ga0496111_0703115 | 3300048914 | Archaea | 735 |
| 673 | Ga0496112_0067724 | 3300048915 | Bacteria | 3524 |
| 674 | Ga0496112_0079771 | 3300048915 | Bacteria | 3237 |
| 675 | Ga0496112_0181360 | 3300048915 | Bacteria | 2069 |
| 676 | Ga0496112_0184245 | 3300048915 | Bacteria | 2051 |
| 677 | Ga0496112_0198553 | 3300048915 | Unclassified | 1966 |
| 678 | Ga0496112_0265622 | 3300048915 | Unclassified | 1665 |
| 679 | Ga0496112_0356957 | 3300048915 | Bacteria | 1404 |
| 680 | Ga0496112_0431644 | 3300048915 | Unclassified | 1256 |
| 681 | Ga0496112_0535694 | 3300048915 | Bacteria | 1105 |
| 682 | Ga0496112_0755304 | 3300048915 | Unclassified | 898 |
| 683 | Ga0496112_0930999 | 3300048915 | Unclassified | 790 |
| 684 | Ga0496112_1081388 | 3300048915 | Bacteria | 720 |
| 685 | Ga0496113_0002540 | 3300048916 | Bacteria | 10641 |
| 686 | Ga0496113_0081568 | 3300048916 | Bacteria | 2479 |
| 687 | Ga0496113_0466533 | 3300048916 | Bacteria | 1015 |
| 688 | Ga0496113_0557903 | 3300048916 | Unclassified | 918 |
| 689 | Ga0496114_0143543 | 3300048917 | Bacteria | 2068 |
| 690 | Ga0496114_0650587 | 3300048917 | Unclassified | 927 |
| 691 | Ga0496114_0818496 | 3300048917 | Unclassified | 810 |
| 692 | Ga0496115_0073476 | 3300048918 | Bacteria | 2776 |
| 693 | Ga0496115_0116080 | 3300048918 | Bacteria | 2201 |
| 694 | Ga0496115_0197017 | 3300048918 | Bacteria | 1664 |
| 695 | Ga0496115_0317768 | 3300048918 | Bacteria | 1274 |
| 696 | Ga0496115_0320591 | 3300048918 | Unclassified | 1267 |
| 697 | Ga0501032_0045249 | 3300049569 | Bacteria | 2977 |
| 698 | Ga0501032_0144370 | 3300049569 | Bacteria | 1567 |
| 699 | Ga0501032_0684432 | 3300049569 | Bacteria | 650 |
| 700 | Ga0501033_0093201 | 3300049570 | Bacteria | 2202 |
| 701 | Ga0501033_0216723 | 3300049570 | Unclassified | 1364 |
| 702 | Ga0501033_0239058 | 3300049570 | Bacteria | 1289 |
| 703 | Ga0501034_0010927 | 3300049571 | Bacteria | 9434 |
| 704 | Ga0501034_0020219 | 3300049571 | Bacteria | 6798 |
| 705 | Ga0501034_0023518 | 3300049571 | Bacteria | 6278 |
| 706 | Ga0501034_0330033 | 3300049571 | Bacteria | 1457 |
| 707 | Ga0501036_0062714 | 3300049572 | Bacteria | 3148 |
| 708 | Ga0501036_0071626 | 3300049572 | Bacteria | 2930 |
| 709 | Ga0501037_0026512 | 3300049573 | Bacteria | 4284 |
| 710 | Ga0501037_0173483 | 3300049573 | Bacteria | 1532 |
| 711 | Ga0501037_0174170 | 3300049573 | Bacteria | 1529 |
| 712 | Ga0501037_0414913 | 3300049573 | Bacteria | 922 |
| 713 | Ga0501038_0030603 | 3300049574 | Bacteria | 4760 |
| 714 | Ga0501038_0110450 | 3300049574 | Bacteria | 2278 |
| 715 | Ga0501038_0748504 | 3300049574 | Bacteria | 729 |
| 716 | Ga0501039_0043435 | 3300049575 | Bacteria | 3472 |
| 717 | Ga0501039_0289423 | 3300049575 | Unclassified | 1288 |
| 718 | Ga0501039_0669656 | 3300049575 | Bacteria | 812 |
| 719 | Ga0501040_0352693 | 3300049576 | Bacteria | 1054 |
| 720 | Ga0501041_0130310 | 3300049577 | Bacteria | 1567 |
| 721 | Ga0501043_0103366 | 3300049579 | Bacteria | 2239 |
| 722 | Ga0501047_0033645 | 3300049581 | Bacteria | 4947 |
| 723 | Ga0501047_0153604 | 3300049581 | Bacteria | 2176 |
| 724 | Ga0501047_0154886 | 3300049581 | Bacteria | 2166 |
| 725 | Ga0501047_0224194 | 3300049581 | Bacteria | 1735 |
| 726 | Ga0501048_0772571 | 3300049582 | Bacteria | 690 |
| 727 | Ga0501069_0287542 | 3300049585 | Bacteria | 963 |
| 728 | Ga0501069_0758402 | 3300049585 | Bacteria | 587 |
| 729 | Ga0501070_0027648 | 3300049586 | Bacteria | 4758 |
| 730 | Ga0501070_0035656 | 3300049586 | Bacteria | 4155 |
| 731 | Ga0501070_0216997 | 3300049586 | Unclassified | 1569 |
| 732 | Ga0501070_0229734 | 3300049586 | Bacteria | 1520 |
| 733 | Ga0501070_0490989 | 3300049586 | Bacteria | 987 |
| 734 | Ga0501071_0020074 | 3300049587 | Bacteria | 4643 |
| 735 | Ga0501071_0100679 | 3300049587 | Bacteria | 2130 |
| 736 | Ga0501071_1074199 | 3300049587 | Bacteria | 622 |
| 737 | Ga0501072_0669156 | 3300049588 | Bacteria | 817 |
| 738 | Ga0501072_0689403 | 3300049588 | Bacteria | 803 |
| 739 | Ga0501072_1197779 | 3300049588 | Bacteria | 590 |
| 740 | Ga0501072_1608839 | 3300049588 | Unclassified | 501 |
| 741 | Ga0501073_0068822 | 3300049589 | Bacteria | 2467 |
| 742 | Ga0501075_0012425 | 3300049591 | Bacteria | 6052 |
| 743 | Ga0501075_0176758 | 3300049591 | Bacteria | 1629 |
| 744 | Ga0501075_0297182 | 3300049591 | Bacteria | 1230 |
| 745 | Ga0501077_0046931 | 3300049593 | Bacteria | 2744 |
| 746 | Ga0501077_0063279 | 3300049593 | Bacteria | 2347 |
| 747 | Ga0501077_0311352 | 3300049593 | Bacteria | 1003 |
| 748 | Ga0501077_0340402 | 3300049593 | Bacteria | 957 |
| 749 | Ga0501079_0032746 | 3300049741 | Bacteria | 3997 |
| 750 | Ga0501079_0684904 | 3300049741 | Unclassified | 807 |
| 751 | Ga0501080_0065875 | 3300049742 | Bacteria | 3369 |
| 752 | Ga0501080_0087739 | 3300049742 | Bacteria | 2890 |
| 753 | Ga0501080_0562616 | 3300049742 | Bacteria | 1015 |
| 754 | Ga0501081_0007046 | 3300049743 | Bacteria | 7310 |
| 755 | Ga0501081_0672099 | 3300049743 | Bacteria | 777 |
| 756 | Ga0501083_0023402 | 3300049744 | Bacteria | 4285 |
| 757 | Ga0501083_0754277 | 3300049744 | Bacteria | 633 |
| 758 | Ga0501035_0062179 | 3300049822 | Bacteria | 3322 |
| 759 | Ga0501035_0163950 | 3300049822 | Bacteria | 1923 |
| 760 | Ga0501035_0466592 | 3300049822 | Bacteria | 1043 |
| 761 | Ga0501035_0641369 | 3300049822 | Bacteria | 862 |
| 762 | Ga0501044_0000674 | 3300049823 | Bacteria | 41281 |
| 763 | Ga0501044_0087153 | 3300049823 | Bacteria | 3153 |
| 764 | Ga0501044_0115448 | 3300049823 | Bacteria | 2690 |
| 765 | Ga0501044_0168198 | 3300049823 | Bacteria | 2165 |
| 766 | Ga0501044_0183276 | 3300049823 | Bacteria | 2060 |
| 767 | Ga0501044_0326455 | 3300049823 | Bacteria | 1458 |
| 768 | Ga0501044_0673135 | 3300049823 | Bacteria | 922 |
| 769 | nmdc:mga0yw44_21378_c1 | 3300050492 | Bacteria | 3608 |
| 770 | nmdc:mga0yw44_62794_c1 | 3300050492 | Bacteria | 2282 |
| 771 | nmdc:mga0yw44_773624_c1 | 3300050492 | Bacteria | 652 |
| 772 | nmdc:mga0yw44_79317_c1 | 3300050492 | Bacteria | 2054 |
| 773 | nmdc:mga06z11_190124_c1 | 3300050494 | Bacteria | 1188 |
| 774 | nmdc:mga06z11_66690_c1 | 3300050494 | Bacteria | 1893 |
| 775 | nmdc:mga06z11_739500_c1 | 3300050494 | Bacteria | 599 |
| 776 | nmdc:mga04h51_32786_c1 | 3300050495 | Bacteria | 1649 |
| 777 | nmdc:mga05p37_188592_c1 | 3300050507 | Bacteria | 2505 |
| 778 | nmdc:mga05p37_647825_c1 | 3300050507 | Bacteria | 1183 |
| 779 | nmdc:mga05p37_652336_c1 | 3300050507 | Bacteria | 1178 |
| 780 | nmdc:mga09592_150370_c1 | 3300050508 | Bacteria | 2008 |
| 781 | nmdc:mga09592_217499_c1 | 3300050508 | Bacteria | 1655 |
| 782 | nmdc:mga09592_456676_c1 | 3300050508 | Bacteria | 1102 |
| 783 | nmdc:mga0qj67_1198069_c1 | 3300050509 | Bacteria | 591 |
| 784 | nmdc:mga06r32_1084294_c1 | 3300050510 | Unclassified | 750 |
| 785 | nmdc:mga06r32_1326057_c1 | 3300050510 | Unclassified | 663 |
| 786 | nmdc:mga06r32_199621_c1 | 3300050510 | Bacteria | 1988 |
| 787 | nmdc:mga06r32_444104_c1 | 3300050510 | Bacteria | 1277 |
| 788 | nmdc:mga08y16_193475_c1 | 3300050511 | Bacteria | 2109 |
| 789 | nmdc:mga08y16_37367_c1 | 3300050511 | Bacteria | 5100 |
| 790 | nmdc:mga08y16_80669_c1 | 3300050511 | Bacteria | 3392 |
| 791 | nmdc:mga0n895_138188_c1 | 3300050512 | Bacteria | 2464 |
| 792 | nmdc:mga0n895_246115_c1 | 3300050512 | Bacteria | 1815 |
| 793 | nmdc:mga0n895_412322_c1 | 3300050512 | Unclassified | 1366 |
| 794 | nmdc:mga0rr50_40351_c1 | 3300050513 | Bacteria | 3393 |
| 795 | nmdc:mga08x19_259862_c1 | 3300050514 | Bacteria | 1200 |
| 796 | nmdc:mga08x19_799657_c1 | 3300050514 | Bacteria | 670 |
| 797 | nmdc:mga0a205_174724_c1 | 3300050515 | Bacteria | 2044 |
| 798 | nmdc:mga0a205_658790_c1 | 3300050515 | Unclassified | 898 |
| 799 | Ga0495601_0015050 | 3300053077 | Bacteria | 4671 |
| 800 | Ga0495601_0053986 | 3300053077 | Bacteria | 2541 |
| 801 | Ga0495601_0127203 | 3300053077 | Unclassified | 1658 |
| 802 | Ga0495601_0729289 | 3300053077 | Bacteria | 631 |
| 803 | Ga0495612_0040979 | 3300053078 | Bacteria | 1888 |
| 804 | Ga0495612_0158383 | 3300053078 | Unclassified | 988 |
| 805 | Ga0495612_0159712 | 3300053078 | Unclassified | 984 |
| 806 | Ga0495655_0125121 | 3300053083 | Unclassified | 786 |
| 807 | Ga0495595_0028759 | 3300053084 | Bacteria | 2484 |
| 808 | Ga0495595_0028867 | 3300053084 | Bacteria | 2479 |
| 809 | Ga0495595_0041543 | 3300053084 | Bacteria | 2104 |
| 810 | Ga0495595_0105952 | 3300053084 | Bacteria | 1360 |
| 811 | Ga0495595_0287743 | 3300053084 | Unclassified | 826 |
| 812 | Ga0495595_0312585 | 3300053084 | Bacteria | 791 |
| 813 | Ga0495619_0006374 | 3300053085 | Bacteria | 7476 |
| 814 | Ga0495619_0018585 | 3300053085 | Bacteria | 4410 |
| 815 | Ga0495619_0020300 | 3300053085 | Unclassified | 4230 |
| 816 | Ga0495619_0026083 | 3300053085 | Bacteria | 3758 |
| 817 | Ga0495619_0039105 | 3300053085 | Bacteria | 3096 |
| 818 | Ga0495619_0100887 | 3300053085 | Bacteria | 1964 |
| 819 | Ga0495619_0119810 | 3300053085 | Bacteria | 1804 |
| 820 | Ga0495619_0245279 | 3300053085 | Bacteria | 1241 |
| 821 | Ga0500646_0100896 | 3300053090 | Bacteria | 906 |
| 822 | Ga0500595_037983 | 3300053119 | Bacteria | 1567 |
| 823 | Ga0500614_047453 | 3300053123 | Bacteria | 1116 |
| 824 | Ga0500636_0230338 | 3300053177 | Bacteria | 959 |
| 825 | Ga0501084_0054919 | 3300054114 | Unclassified | 3332 |
| 826 | Ga0501084_0147484 | 3300054114 | Bacteria | 1982 |
| 827 | Ga0501084_0856466 | 3300054114 | Unclassified | 765 |
| 828 | Ga0501082_0029742 | 3300060353 | Bacteria | 4706 |
| 829 | Ga0501082_0049287 | 3300060353 | Bacteria | 3632 |
| 830 | Ga0501082_0055210 | 3300060353 | Bacteria | 3422 |
| 831 | Ga0501082_0263834 | 3300060353 | Bacteria | 1498 |
| 832 | Ga0530510_0307797 | 3300061734 | Unclassified | 1186 |
| 833 | Ga0530510_1042790 | 3300061734 | Bacteria | 626 |
| 834 | Ga0395899_0021282 | |||
| 835 | JGI24742J22300_10095685 | |||
| 836 | rootH1_10061561 | |||
| 837 | JGI25404J52841_10003048 | |||
| 838 | Ga0070658_10100128 | |||
| 839 | Ga0070658_10377474 | |||
| 840 | Ga0070658_10536026 | |||
| 841 | Ga0070670_100014533 | |||
| 842 | Ga0070670_100168559 | |||
| 843 | Ga0070670_101776014 | |||
| 844 | Ga0068869_100588517 | |||
| 845 | Ga0068869_101491642 | |||
| 846 | Ga0070666_10266697 | |||
| 847 | Ga0070680_100000532 | |||
| 848 | Ga0070680_100014359 | |||
| 849 | Ga0070680_100017152 | |||
| 850 | Ga0070680_100020767 | |||
| 851 | Ga0070680_100160707 | |||
| 852 | Ga0070680_100242614 | |||
| 853 | Ga0070680_100872646 | |||
| 854 | Ga0070682_101450804 | |||
| 855 | Ga0068868_100091031 | |||
| 856 | Ga0068868_100285186 | |||
| 857 | Ga0070660_100706299 | |||
| 858 | Ga0070689_100110227 | |||
| 859 | Ga0070691_10002110 | |||
| 860 | Ga0070691_10062538 | |||
| 861 | Ga0070691_10397687 | |||
| 862 | Ga0070661_100563738 | |||
| 863 | Ga0070669_100665495 | |||
| 864 | Ga0070669_100968731 | |||
| 865 | Ga0070669_100993732 | |||
| 866 | Ga0070675_100029273 | |||
| 867 | Ga0070675_100045254 | |||
| 868 | Ga0070671_100198986 | |||
| 869 | Ga0070671_100850983 | |||
| 870 | Ga0070671_100997742 | |||
| 871 | Ga0070674_100226208 | |||
| 872 | Ga0070674_100538772 | |||
| 873 | Ga0070674_100587061 | |||
| 874 | Ga0070673_100286294 | |||
| 875 | Ga0070673_100719972 | |||
| 876 | Ga0070688_100208329 | |||
| 877 | Ga0070667_100957747 | |||
| 878 | Ga0070703_10183005 | |||
| 879 | Ga0070709_10121933 | |||
| 880 | Ga0070709_10187558 | |||
| 881 | Ga0070709_10468587 | |||
| 882 | Ga0070709_11032296 | |||
| 883 | Ga0070714_100228591 | |||
| 884 | Ga0070714_100676094 | |||
| 885 | Ga0070713_100007857 | |||
| 886 | Ga0070713_100228786 | |||
| 887 | Ga0070713_100678838 | |||
| 888 | Ga0070713_100870209 | |||
| 889 | Ga0070713_101703045 | |||
| 890 | Ga0070710_10015505 | |||
| 891 | Ga0070710_10122263 | |||
| 892 | Ga0070710_10476080 | |||
| 893 | Ga0070710_10825724 | |||
| 894 | Ga0070701_10124105 | |||
| 895 | Ga0070711_100089546 | |||
| 896 | Ga0070711_100439584 | |||
| 897 | Ga0070700_100233024 | |||
| 898 | Ga0070700_100244875 | |||
| 899 | Ga0070700_101194406 | |||
| 900 | Ga0070694_100876857 | |||
| 901 | Ga0070708_100205704 | |||
| 902 | Ga0070663_100156117 | |||
| 903 | Ga0070663_100882224 | |||
| 904 | Ga0070678_100011639 | |||
| 905 | Ga0070678_100854028 | |||
| 906 | Ga0070662_101182524 | |||
| 907 | Ga0070681_10001471 | |||
| 908 | Ga0070681_10001868 | |||
| 909 | Ga0070681_10039836 | |||
| 910 | Ga0070681_10128482 | |||
| 911 | Ga0070681_10175776 | |||
| 912 | Ga0070681_10244293 | |||
| 913 | Ga0070681_11244242 | |||
| 914 | Ga0070685_10030546 | |||
| 915 | Ga0070698_100189732 | |||
| 916 | Ga0070698_100687673 | |||
| 917 | Ga0070699_100004042 | |||
| 918 | Ga0070699_100197651 | |||
| 919 | Ga0070679_100005709 | |||
| 920 | Ga0070679_100022471 | |||
| 921 | Ga0070679_100060758 | |||
| 922 | Ga0070679_100062165 | |||
| 923 | Ga0070679_100116665 | |||
| 924 | Ga0070679_100163240 | |||
| 925 | Ga0070679_100573260 | |||
| 926 | Ga0070679_101314173 | |||
| 927 | Ga0070679_101578407 | |||
| 928 | Ga0070684_100218023 | |||
| 929 | Ga0070684_100493541 | |||
| 930 | Ga0070684_100517396 | |||
| 931 | Ga0070697_100086086 | |||
| 932 | Ga0070696_100683759 | |||
| 933 | Ga0070693_100037524 | |||
| 934 | Ga0070693_100058118 | |||
| 935 | Ga0070665_100643538 | |||
| 936 | Ga0068855_100031168 | |||
| 937 | Ga0068855_100425065 | |||
| 938 | Ga0068855_100617644 | |||
| 939 | Ga0070664_100253593 | |||
| 940 | Ga0070664_100912970 | |||
| 941 | Ga0068857_100214533 | |||
| 942 | Ga0068857_100493149 | |||
| 943 | Ga0068854_100397257 | |||
| 944 | Ga0068854_100885233 | |||
| 945 | Ga0068856_100064801 | |||
| 946 | Ga0068856_100442108 | |||
| 947 | Ga0070702_100246058 | |||
| 948 | Ga0070702_100276003 | |||
| 949 | Ga0068852_100039541 | |||
| 950 | Ga0068852_100133712 | |||
| 951 | Ga0068859_100498756 | |||
| 952 | Ga0068864_100062130 | |||
| 953 | Ga0068866_10355943 | |||
| 954 | Ga0068861_100781231 | |||
| 955 | Ga0068861_100944605 | |||
| 956 | Ga0068861_100987504 | |||
| 957 | Ga0068851_10177725 | |||
| 958 | Ga0068851_10248012 | |||
| 959 | Ga0068863_100064913 | |||
| 960 | Ga0068858_100485880 | |||
| 961 | Ga0068858_100768551 | |||
| 962 | Ga0068860_100315563 | |||
| 963 | Ga0068860_100686055 | |||
| 964 | Ga0068862_100530381 | |||
| 965 | Ga0068862_100577174 | |||
| 966 | Ga0068862_101450777 | |||
| 967 | Ga0081455_10004063 | |||
| 968 | Ga0081455_10006691 | |||
| 969 | Ga0081455_10188604 | |||
| 970 | Ga0081455_10699478 | |||
| 971 | Ga0081538_10013890 | |||
| 972 | Ga0081538_10104212 | |||
| 973 | Ga0081538_10216687 | |||
| 974 | Ga0081540_1000068 | |||
| 975 | Ga0081540_1007636 | |||
| 976 | Ga0081540_1049542 | |||
| 977 | Ga0081540_1092555 | |||
| 978 | Ga0070717_10226629 | |||
| 979 | Ga0070717_10286756 | |||
| 980 | Ga0070717_10572477 | |||
| 981 | Ga0070717_10859629 | |||
| 982 | Ga0075365_10015218 | |||
| 983 | Ga0075365_10018821 | |||
| 984 | Ga0075365_10302639 | |||
| 985 | Ga0075363_100048975 | |||
| 986 | Ga0075363_100117284 | |||
| 987 | Ga0075364_10413454 | |||
| 988 | Ga0070715_10102597 | |||
| 989 | Ga0070715_10177680 | |||
| 990 | Ga0070716_101794603 | |||
| 991 | Ga0070712_100174383 | |||
| 992 | Ga0070712_100238937 | |||
| 993 | Ga0070712_100820646 | |||
| 994 | Ga0070712_101354732 | |||
| 995 | Ga0075362_10521090 | |||
| 996 | Ga0075366_10482154 | |||
| 997 | Ga0097621_100051940 | |||
| 998 | Ga0097621_100094989 | |||
| 999 | Ga0068871_101095445 | |||
| 1000 | Ga0075428_100094169 | |||
| 1001 | Ga0075428_100168066 | |||
| 1002 | Ga0075428_100178024 | |||
| 1003 | Ga0075428_100289922 | |||
| 1004 | Ga0075428_101010683 | |||
| 1005 | Ga0075428_102054257 | |||
| 1006 | Ga0075430_100031870 | |||
| 1007 | Ga0075430_100667622 | |||
| 1008 | Ga0075431_100053442 | |||
| 1009 | Ga0075431_100268002 | |||
| 1010 | Ga0075431_100269032 | |||
| 1011 | Ga0075433_10230811 | |||
| 1012 | Ga0075433_10919858 | |||
| 1013 | Ga0075434_100040273 | |||
| 1014 | Ga0075429_100254854 | |||
| 1015 | Ga0075429_100424157 | |||
| 1016 | Ga0075429_100628377 | |||
| 1017 | Ga0068865_100322438 | |||
| 1018 | Ga0068865_100331929 | |||
| 1019 | Ga0068865_100895085 | |||
| 1020 | Ga0075436_100017742 | |||
| 1021 | Ga0075436_100619313 | |||
| 1022 | Ga0097620_100498714 | |||
| 1023 | Ga0075435_100572691 | |||
| 1024 | Ga0099794_10048661 | |||
| 1025 | Ga0099795_10015498 | |||
| 1026 | Ga0099795_10288849 | |||
| 1027 | Ga0099795_10445570 | |||
| 1028 | Ga0105240_10003482 | |||
| 1029 | Ga0105240_10029418 | |||
| 1030 | Ga0105240_10185602 | |||
| 1031 | Ga0105240_10643314 | |||
| 1032 | Ga0105240_11097916 | |||
| 1033 | Ga0111539_10018297 | |||
| 1034 | Ga0111539_10041142 | |||
| 1035 | Ga0111539_10473801 | |||
| 1036 | Ga0111539_10824096 | |||
| 1037 | Ga0111539_11470483 | |||
| 1038 | Ga0111539_12542096 | |||
| 1039 | Ga0105245_10007194 | |||
| 1040 | Ga0105245_10245251 | |||
| 1041 | Ga0105247_10316839 | |||
| 1042 | Ga0114129_10014687 | |||
| 1043 | Ga0114129_10483879 | |||
| 1044 | Ga0114129_11729769 | |||
| 1045 | Ga0105243_10938370 | |||
| 1046 | Ga0105243_10994120 | |||
| 1047 | Ga0105243_11448815 | |||
| 1048 | Ga0105241_10412811 | |||
| 1049 | Ga0105241_10523306 | |||
| 1050 | Ga0105242_11677675 | |||
| 1051 | Ga0105248_10027688 | |||
| 1052 | Ga0105248_10218075 | |||
| 1053 | Ga0105248_11668763 | |||
| 1054 | Ga0105237_10828155 | |||
| 1055 | Ga0105238_10011409 | |||
| 1056 | Ga0105238_10132631 | |||
| 1057 | Ga0105238_10637521 | |||
| 1058 | Ga0105249_10538486 | |||
| 1059 | Ga0099796_10017549 | |||
| 1060 | Ga0105239_11376848 | |||
| 1061 | Ga0105239_12666317 | |||
| 1062 | Ga0105246_10453684 | |||
| 1063 | Ga0157347_1016424 | |||
| 1064 | Ga0157373_10068119 | |||
| 1065 | Ga0157373_10072811 | |||
| 1066 | Ga0157373_10075187 | |||
| 1067 | Ga0157371_10162056 | |||
| 1068 | Ga0157371_10164667 | |||
| 1069 | Ga0157370_10002489 | |||
| 1070 | Ga0157370_10045586 | |||
| 1071 | Ga0157370_10103934 | |||
| 1072 | Ga0157370_10937366 | |||
| 1073 | Ga0157369_10364362 | |||
| 1074 | Ga0157369_10511848 | |||
| 1075 | Ga0157369_11472327 | |||
| 1076 | Ga0157374_10106839 | |||
| 1077 | Ga0157374_10592351 | |||
| 1078 | Ga0157378_10200316 | |||
| 1079 | Ga0157378_10822153 | |||
| 1080 | Ga0157378_11387785 | |||
| 1081 | Ga0163162_10077112 | |||
| 1082 | Ga0163162_10088372 | |||
| 1083 | Ga0163162_10968260 | |||
| 1084 | Ga0163162_11246561 | |||
| 1085 | Ga0157372_10082809 | |||
| 1086 | Ga0157372_10371677 | |||
| 1087 | Ga0157372_10941723 | |||
| 1088 | Ga0157372_11539135 | |||
| 1089 | Ga0157375_10063653 | |||
| 1090 | Ga0157375_11822674 | |||
| 1091 | Ga0163163_10113546 | |||
| 1092 | Ga0163163_10437559 | |||
| 1093 | Ga0157380_11292428 | |||
| 1094 | Ga0182008_10581622 | |||
| 1095 | Ga0157377_10208472 | |||
| 1096 | Ga0157379_10650681 | |||
| 1097 | Ga0157379_10720888 | |||
| 1098 | Ga0157379_10889064 | |||
| 1099 | Ga0157376_10029373 | |||
| 1100 | Ga0157376_10662024 | |||
| 1101 | Ga0157376_11651397 | |||
| 1102 | Ga0163161_10761170 | |||
| 1103 | Ga0163161_11026704 | |||
| 1104 | Ga0163161_11513349 | |||
| 1105 | Ga0213876_10051631 | |||
| 1106 | Ga0213876_10190909 | |||
| 1107 | Ga0213876_10240472 | |||
| 1108 | Ga0207656_10056127 | |||
| 1109 | Ga0207692_10123246 | |||
| 1110 | Ga0207692_10348740 | |||
| 1111 | Ga0207692_10352079 | |||
| 1112 | Ga0207692_10490495 | |||
| 1113 | Ga0207642_10017305 | |||
| 1114 | Ga0207642_10091233 | |||
| 1115 | Ga0207710_10227364 | |||
| 1116 | Ga0207710_10382594 | |||
| 1117 | Ga0207688_10114003 | |||
| 1118 | Ga0207680_10338459 | |||
| 1119 | Ga0207699_10383479 | |||
| 1120 | Ga0207699_10813606 | |||
| 1121 | Ga0207645_10079675 | |||
| 1122 | Ga0207645_10691055 | |||
| 1123 | Ga0207705_10023664 | |||
| 1124 | Ga0207705_10033896 | |||
| 1125 | Ga0207705_10165287 | |||
| 1126 | Ga0207705_10532328 | |||
| 1127 | Ga0207684_10794851 | |||
| 1128 | Ga0207707_10012084 | |||
| 1129 | Ga0207707_10015854 | |||
| 1130 | Ga0207707_10024122 | |||
| 1131 | Ga0207707_10041100 | |||
| 1132 | Ga0207695_10120980 | |||
| 1133 | Ga0207695_10906826 | |||
| 1134 | Ga0207693_10010728 | |||
| 1135 | Ga0207693_10100071 | |||
| 1136 | Ga0207693_10180388 | |||
| 1137 | Ga0207693_10183157 | |||
| 1138 | Ga0207693_10276185 | |||
| 1139 | Ga0207663_10037278 | |||
| 1140 | Ga0207663_10355080 | |||
| 1141 | Ga0207663_10460575 | |||
| 1142 | Ga0207663_10623122 | |||
| 1143 | Ga0207663_10780830 | |||
| 1144 | Ga0207660_10003904 | |||
| 1145 | Ga0207660_10036831 | |||
| 1146 | Ga0207660_10431128 | |||
| 1147 | Ga0207660_10755667 | |||
| 1148 | Ga0207662_10008714 | |||
| 1149 | Ga0207662_10055613 | |||
| 1150 | Ga0207657_10028544 | |||
| 1151 | Ga0207657_10618087 | |||
| 1152 | Ga0207652_10006133 | |||
| 1153 | Ga0207652_10018723 | |||
| 1154 | Ga0207652_10083338 | |||
| 1155 | Ga0207652_10370980 | |||
| 1156 | Ga0207652_10392550 | |||
| 1157 | Ga0207652_11040336 | |||
| 1158 | Ga0207652_11271331 | |||
| 1159 | Ga0207681_11199316 | |||
| 1160 | Ga0207694_10089709 | |||
| 1161 | Ga0207694_10315496 | |||
| 1162 | Ga0207694_10454387 | |||
| 1163 | Ga0207650_10026548 | |||
| 1164 | Ga0207659_10393114 | |||
| 1165 | Ga0207687_10050158 | |||
| 1166 | Ga0207687_10100493 | |||
| 1167 | Ga0207700_11219003 | |||
| 1168 | Ga0207700_11243491 | |||
| 1169 | Ga0207664_10129974 | |||
| 1170 | Ga0207690_10065141 | |||
| 1171 | Ga0207706_10012271 | |||
| 1172 | Ga0207706_10869276 | |||
| 1173 | Ga0207709_10020359 | |||
| 1174 | Ga0207670_10038888 | |||
| 1175 | Ga0207669_10171999 | |||
| 1176 | Ga0207669_10390901 | |||
| 1177 | Ga0207669_10529717 | |||
| 1178 | Ga0207704_10670083 | |||
| 1179 | Ga0207704_11317725 | |||
| 1180 | Ga0207665_11384929 | |||
| 1181 | Ga0207691_10043196 | |||
| 1182 | Ga0207691_10536759 | |||
| 1183 | Ga0207711_10256644 | |||
| 1184 | Ga0207689_10009474 | |||
| 1185 | Ga0207689_10635508 | |||
| 1186 | Ga0207689_10647442 | |||
| 1187 | Ga0207689_11363723 | |||
| 1188 | Ga0207661_10490055 | |||
| 1189 | Ga0207667_10297011 | |||
| 1190 | Ga0207667_10318718 | |||
| 1191 | Ga0207651_10168920 | |||
| 1192 | Ga0207651_10504497 | |||
| 1193 | Ga0207651_10868824 | |||
| 1194 | Ga0207712_10250670 | |||
| 1195 | Ga0207668_10133548 | |||
| 1196 | Ga0207640_10296798 | |||
| 1197 | Ga0207677_10021380 | |||
| 1198 | Ga0207677_10115874 | |||
| 1199 | Ga0207677_10198682 | |||
| 1200 | Ga0207703_10019096 | |||
| 1201 | Ga0207703_10638620 | |||
| 1202 | Ga0207639_10085909 | |||
| 1203 | Ga0207639_10416622 | |||
| 1204 | Ga0207639_10680914 | |||
| 1205 | Ga0207678_10078006 | |||
| 1206 | Ga0207678_10190387 | |||
| 1207 | Ga0207708_10021260 | |||
| 1208 | Ga0207708_10351050 | |||
| 1209 | Ga0207702_10064258 | |||
| 1210 | Ga0207702_10077085 | |||
| 1211 | Ga0207702_10180680 | |||
| 1212 | Ga0207702_11103310 | |||
| 1213 | Ga0207641_10377318 | |||
| 1214 | Ga0207648_10373803 | |||
| 1215 | Ga0207648_10555775 | |||
| 1216 | Ga0207676_10016006 | |||
| 1217 | Ga0207676_10178089 | |||
| 1218 | Ga0207676_10434509 | |||
| 1219 | Ga0207674_10067339 | |||
| 1220 | Ga0207674_10095871 | |||
| 1221 | Ga0207674_10754095 | |||
| 1222 | Ga0207674_11711839 | |||
| 1223 | Ga0207675_100605076 | |||
| 1224 | Ga0207683_10045559 | |||
| 1225 | Ga0207683_10348475 | |||
| 1226 | Ga0207683_12101514 | |||
| 1227 | Ga0207698_10040697 | |||
| 1228 | Ga0207698_10166548 | |||
| 1229 | Ga0207698_10360751 | |||
| 1230 | Ga0207698_11649120 | |||
| 1231 | Ga0207428_10176070 | |||
| 1232 | Ga0268266_10492635 | |||
| 1233 | Ga0268266_10885560 | |||
| 1234 | Ga0268265_10285823 | |||
| 1235 | Ga0268265_10919325 | |||
| 1236 | Ga0268264_10519945 | |||
| 1237 | Ga0265338_10044761 | |||
| 1238 | Ga0265338_10178817 | |||
| 1239 | Ga0265338_10367886 | |||
| 1240 | Ga0265332_10002624 | |||
| 1241 | Ga0265332_10184891 | |||
| 1242 | Ga0265328_10276597 | |||
| 1243 | Ga0265325_10000093 | |||
| 1244 | Ga0265325_10011946 | |||
| 1245 | Ga0265325_10040411 | |||
| 1246 | Ga0265325_10052422 | |||
| 1247 | Ga0265325_10082024 | |||
| 1248 | Ga0265340_10001806 | |||
| 1249 | Ga0265340_10046308 | |||
| 1250 | Ga0265339_10037937 | |||
| 1251 | Ga0265331_10015974 | |||
| 1252 | Ga0265316_10342677 | |||
| 1253 | Ga0307513_10341113 | |||
| 1254 | Ga0307513_10451896 | |||
| 1255 | Ga0265313_10004184 | |||
| 1256 | Ga0265313_10004593 | |||
| 1257 | Ga0265313_10017649 | |||
| 1258 | Ga0265313_10062905 | |||
| 1259 | Ga0265313_10289248 | |||
| 1260 | Ga0265313_10331107 | |||
| 1261 | Ga0316575_10138170 | |||
| 1262 | Ga0265314_10009933 | |||
| 1263 | Ga0265314_10204412 | |||
| 1264 | Ga0265314_10321225 | |||
| 1265 | Ga0265342_10000011 | |||
| 1266 | Ga0265342_10004077 | |||
| 1267 | Ga0265342_10005903 | |||
| 1268 | Ga0307405_10772364 | |||
| 1269 | Ga0307405_11662638 | |||
| 1270 | Ga0307407_10154549 | |||
| 1271 | Ga0307412_10535371 | |||
| 1272 | Ga0307409_100037395 | |||
| 1273 | Ga0307416_102849148 | |||
| 1274 | Ga0307414_11591800 | |||
| 1275 | Ga0316583_10006570 | |||
| 1276 | Ga0316583_10051647 | |||
| 1277 | Ga0373930_0008949 | |||
| 1278 | Ga0373930_0120618 | |||
| 1279 | Ga0373926_0061157 | |||
| 1280 | Ga0373929_0008642 | |||
| 1281 | Ga0373929_0033797 | |||
| 1282 | Ga0373934_0015879 | |||
| 1283 | Ga0373944_0013671 | |||
| 1284 | Ga0373949_0156178 | |||
| 1285 | Ga0373923_0126914 | |||
| 1286 | Ga0373936_0053390 | |||
| 1287 | Ga0373936_0106597 | |||
| 1288 | Ga0373939_0271639 | |||
| 1289 | Ga0373941_0123492 | |||
| 1290 | Ga0373945_0009911 | |||
| 1291 | Ga0373945_0043030 | |||
| 1292 | Ga0373953_0048401 | |||
| 1293 | Ga0373953_0075832 | |||
| 1294 | Ga0373954_0017797 | |||
| 1295 | Ga0373956_0313432 | |||
| 1296 | Ga0373957_0231902 | |||
| 1297 | Ga0373960_0054927 | |||
| 1298 | Ga0373943_0069495 | |||
| 1299 | Ga0373943_0147143 | |||
| 1300 | Ga0373943_0196088 | |||
| 1301 | Ga0373946_0025694 | |||
| 1302 | Ga0373955_0005085 | |||
| 1303 | Ga0373942_0003214 | |||
| 1304 | Ga0373961_0094364 | |||
| 1305 | Ga0373924_0102896 | |||
| 1306 | Ga0373935_0076414 | |||
| 1307 | Ga0373935_0097912 | |||
| 1308 | Ga0373935_0392411 | |||
| 1309 | Ga0373927_0008790 | |||
| 1310 | Ga0373927_0129613 | |||
| 1311 | Ga0373927_0148091 | |||
| 1312 | Ga0373933_0005755 | |||
| 1313 | Ga0373933_0062054 | |||
| 1314 | Ga0373947_0058919 | |||
| 1315 | Ga0373947_0130567 | |||
| 1316 | Ga0373947_0479990 | |||
| 1317 | Ga0373937_0009762 | |||
| 1318 | Ga0373937_0012997 | |||
| 1319 | Ga0373937_0029122 | |||
| 1320 | Ga0373937_0603033 | |||
| 1321 | Ga0373937_1891769 | |||
| 1322 | Ga0373925_0098549 | |||
| 1323 | Ga0373925_0228222 | |||
| 1324 | Ga0373925_1445184 | |||
| 1325 | Ga0395900_0003409 | |||
| 1326 | Ga0395900_0031012 | |||
| 1327 | Ga0395900_0084690 | |||
| 1328 | Ga0395898_0004890 | |||
| 1329 | Ga0395898_0043106 | |||
| 1330 | Ga0395898_0089749 | |||
| 1331 | Ga0395898_0455564 | |||
| 1332 | Ga0436364_0135547 | |||
| 1333 | Ga0436364_1278643 | |||
| 1334 | Ga0395901_0066218 | |||
| 1335 | Ga0395901_0083425 | |||
| 1336 | Ga0395901_0355132 | |||
| 1337 | Ga0395901_0612153 | |||
| 1338 | Ga0436365_0080885 | |||
| 1339 | Ga0436365_0228691 | |||
| 1340 | Ga0436365_0258563 | |||
| 1341 | Ga0436365_0364923 | |||
| 1342 | Ga0436365_0420225 | |||
| 1343 | Ga0436365_1935734 | |||
| 1344 | Ga0436360_0029211 | |||
| 1345 | Ga0436360_0286970 | |||
| 1346 | Ga0436360_0395899 | |||
| 1347 | Ga0436360_0524608 | |||
| 1348 | Ga0436360_0807994 | |||
| 1349 | Ga0436360_0817002 | |||
| 1350 | Ga0436360_1056072 | |||
| 1351 | Ga0436360_1083614 | |||
| 1352 | Ga0436360_1174518 | |||
| 1353 | Ga0436361_1033080 | |||
| 1354 | Ga0436361_1127209 | |||
| 1355 | Ga0436363_0232716 | |||
| 1356 | Ga0436363_0843885 | |||
| 1357 | Ga0439441_074850 | |||
| 1358 | Ga0466961_0296685 | |||
| 1359 | Ga0466963_0054091 | |||
| 1360 | Ga0466971_0242908 | |||
| 1361 | Ga0466970_0654927 | |||
| 1362 | Ga0466957_0264843 | |||
| 1363 | Ga0466957_0365656 | |||
| 1364 | Ga0466957_0626902 | |||
| 1365 | Ga0466957_0877865 | |||
| 1366 | Ga0466959_0974282 | |||
| 1367 | Ga0466958_0217546 | |||
| 1368 | Ga0466958_0447679 | |||
| 1369 | Ga0466967_0183152 | |||
| 1370 | Ga0466967_1122116 | |||
| 1371 | Ga0495592_0105995 | |||
| 1372 | Ga0495592_0107693 | |||
| 1373 | Ga0495592_0814260 | |||
| 1374 | Ga0495603_0247896 | |||
| 1375 | Ga0495590_0031250 | |||
| 1376 | Ga0495629_0229183 | |||
| 1377 | Ga0495629_0428416 | |||
| 1378 | Ga0495641_0075635 | |||
| 1379 | Ga0495651_0080248 | |||
| 1380 | Ga0495651_0543680 | |||
| 1381 | Ga0495580_0002052 | |||
| 1382 | Ga0495580_0088606 | |||
| 1383 | Ga0495580_0170521 | |||
| 1384 | Ga0495580_0198559 | |||
| 1385 | Ga0495580_0251880 | |||
| 1386 | Ga0495580_0617517 | |||
| 1387 | Ga0495582_0063249 | |||
| 1388 | Ga0495605_0109056 | |||
| 1389 | Ga0495639_0018096 | |||
| 1390 | Ga0495662_0120502 | |||
| 1391 | Ga0495662_0306238 | |||
| 1392 | Ga0495664_0338073 | |||
| 1393 | Ga0495607_0546456 | |||
| 1394 | Ga0495616_0055684 | |||
| 1395 | Ga0495618_0164167 | |||
| 1396 | Ga0495628_0013920 | |||
| 1397 | Ga0495628_0257822 | |||
| 1398 | Ga0495628_0260740 | |||
| 1399 | Ga0495630_0455814 | |||
| 1400 | Ga0495630_0993111 | |||
| 1401 | Ga0495631_0055914 | |||
| 1402 | Ga0495663_0030132 | |||
| 1403 | Ga0495666_0095955 | |||
| 1404 | Ga0495666_0385872 | |||
| 1405 | Ga0495642_0069433 | |||
| 1406 | Ga0495652_0024293 | |||
| 1407 | Ga0495652_0095258 | |||
| 1408 | Ga0495652_0353649 | |||
| 1409 | Ga0495652_0368303 | |||
| 1410 | Ga0495665_0151730 | |||
| 1411 | Ga0495640_0028513 | |||
| 1412 | Ga0495640_0250719 | |||
| 1413 | Ga0495640_0458136 | |||
| 1414 | Ga0495587_0093933 | |||
| 1415 | Ga0495587_0537436 | |||
| 1416 | Ga0495598_0005428 | |||
| 1417 | Ga0495645_0014092 | |||
| 1418 | Ga0495645_0224988 | |||
| 1419 | Ga0495645_0264898 | |||
| 1420 | Ga0495622_0081231 | |||
| 1421 | Ga0495622_0128223 | |||
| 1422 | Ga0495667_0176170 | |||
| 1423 | Ga0495656_0086454 | |||
| 1424 | Ga0495656_0219427 | |||
| 1425 | Ga0495634_0161902 | |||
| 1426 | Ga0495634_0305443 | |||
| 1427 | Ga0495661_0055265 | |||
| 1428 | Ga0495657_0187588 | |||
| 1429 | Ga0495599_0018786 | |||
| 1430 | Ga0495599_0181294 | |||
| 1431 | Ga0495599_0608386 | |||
| 1432 | Ga0495623_0014531 | |||
| 1433 | Ga0495646_0142463 | |||
| 1434 | Ga0495658_0460051 | |||
| 1435 | Ga0495613_0130213 | |||
| 1436 | Ga0495624_0024582 | |||
| 1437 | Ga0495670_0009666 | |||
| 1438 | Ga0495589_0166784 | |||
| 1439 | Ga0495600_0031905 | |||
| 1440 | Ga0495581_0727573 | |||
| 1441 | Ga0495604_0097542 | |||
| 1442 | Ga0495604_0469178 | |||
| 1443 | Ga0495636_0238230 | |||
| 1444 | Ga0495674_0112575 | |||
| 1445 | Ga0495676_0030885 | |||
| 1446 | Ga0495676_0069725 | |||
| 1447 | Ga0495680_0136860 | |||
| 1448 | Ga0495675_0346195 | |||
| 1449 | Ga0495684_0214979 | |||
| 1450 | Ga0495684_0355385 | |||
| 1451 | Ga0495602_0022774 | |||
| 1452 | Ga0495602_0078864 | |||
| 1453 | Ga0495602_0570332 | |||
| 1454 | Ga0495602_0580665 | |||
| 1455 | Ga0495614_0234874 | |||
| 1456 | Ga0495626_0195197 | |||
| 1457 | Ga0495626_0202287 | |||
| 1458 | Ga0496100_0058018 | |||
| 1459 | Ga0496100_0121832 | |||
| 1460 | Ga0496101_0040026 | |||
| 1461 | Ga0496101_0817180 | |||
| 1462 | Ga0496102_0107728 | |||
| 1463 | Ga0496102_0154698 | |||
| 1464 | Ga0496102_0165540 | |||
| 1465 | Ga0496102_0318350 | |||
| 1466 | Ga0496103_0024104 | |||
| 1467 | Ga0496104_0002917 | |||
| 1468 | Ga0496104_0003793 | |||
| 1469 | Ga0496104_0182634 | |||
| 1470 | Ga0496104_0273892 | |||
| 1471 | Ga0496104_0655619 | |||
| 1472 | Ga0496104_0888082 | |||
| 1473 | Ga0496105_0000307 | |||
| 1474 | Ga0496105_0000442 | |||
| 1475 | Ga0496105_0025142 | |||
| 1476 | Ga0496105_0093240 | |||
| 1477 | Ga0496105_0225748 | |||
| 1478 | Ga0496105_0622772 | |||
| 1479 | Ga0496105_0768748 | |||
| 1480 | Ga0496106_0024744 | |||
| 1481 | Ga0496106_0058240 | |||
| 1482 | Ga0496106_0130881 | |||
| 1483 | Ga0496106_0319362 | |||
| 1484 | Ga0496106_0679505 | |||
| 1485 | Ga0496107_0185615 | |||
| 1486 | Ga0496107_0446140 | |||
| 1487 | Ga0496108_0004617 | |||
| 1488 | Ga0496108_0132920 | |||
| 1489 | Ga0496108_0219069 | |||
| 1490 | Ga0496108_0271821 | |||
| 1491 | Ga0496108_0585117 | |||
| 1492 | Ga0496108_0655205 | |||
| 1493 | Ga0496108_0670545 | |||
| 1494 | Ga0496109_0001446 | |||
| 1495 | Ga0496109_0179658 | |||
| 1496 | Ga0496109_0208069 | |||
| 1497 | Ga0496109_0822456 | |||
| 1498 | Ga0496109_1427953 | |||
| 1499 | Ga0496110_0039351 | |||
| 1500 | Ga0496110_0078831 | |||
| 1501 | Ga0496110_0289759 | |||
| 1502 | Ga0496110_0501053 | |||
| 1503 | Ga0496111_0062707 | |||
| 1504 | Ga0496111_0096031 | |||
| 1505 | Ga0496111_0703115 | |||
| 1506 | Ga0496112_0067724 | |||
| 1507 | Ga0496112_0079771 | |||
| 1508 | Ga0496112_0181360 | |||
| 1509 | Ga0496112_0184245 | |||
| 1510 | Ga0496112_0198553 | |||
| 1511 | Ga0496112_0265622 | |||
| 1512 | Ga0496112_0356957 | |||
| 1513 | Ga0496112_0431644 | |||
| 1514 | Ga0496112_0535694 | |||
| 1515 | Ga0496112_0755304 | |||
| 1516 | Ga0496112_0930999 | |||
| 1517 | Ga0496112_1081388 | |||
| 1518 | Ga0496113_0002540 | |||
| 1519 | Ga0496113_0081568 | |||
| 1520 | Ga0496113_0466533 | |||
| 1521 | Ga0496113_0557903 | |||
| 1522 | Ga0496114_0143543 | |||
| 1523 | Ga0496114_0650587 | |||
| 1524 | Ga0496114_0818496 | |||
| 1525 | Ga0496115_0073476 | |||
| 1526 | Ga0496115_0116080 | |||
| 1527 | Ga0496115_0197017 | |||
| 1528 | Ga0496115_0317768 | |||
| 1529 | Ga0496115_0320591 | |||
| 1530 | Ga0501032_0045249 | |||
| 1531 | Ga0501032_0144370 | |||
| 1532 | Ga0501032_0684432 | |||
| 1533 | Ga0501033_0093201 | |||
| 1534 | Ga0501033_0216723 | |||
| 1535 | Ga0501033_0239058 | |||
| 1536 | Ga0501034_0010927 | |||
| 1537 | Ga0501034_0020219 | |||
| 1538 | Ga0501034_0023518 | |||
| 1539 | Ga0501034_0330033 | |||
| 1540 | Ga0501036_0062714 | |||
| 1541 | Ga0501036_0071626 | |||
| 1542 | Ga0501037_0026512 | |||
| 1543 | Ga0501037_0173483 | |||
| 1544 | Ga0501037_0174170 | |||
| 1545 | Ga0501037_0414913 | |||
| 1546 | Ga0501038_0030603 | |||
| 1547 | Ga0501038_0110450 | |||
| 1548 | Ga0501038_0748504 | |||
| 1549 | Ga0501039_0043435 | |||
| 1550 | Ga0501039_0289423 | |||
| 1551 | Ga0501039_0669656 | |||
| 1552 | Ga0501040_0352693 | |||
| 1553 | Ga0501041_0130310 | |||
| 1554 | Ga0501043_0103366 | |||
| 1555 | Ga0501047_0033645 | |||
| 1556 | Ga0501047_0153604 | |||
| 1557 | Ga0501047_0154886 | |||
| 1558 | Ga0501047_0224194 | |||
| 1559 | Ga0501048_0772571 | |||
| 1560 | Ga0501069_0287542 | |||
| 1561 | Ga0501069_0758402 | |||
| 1562 | Ga0501070_0027648 | |||
| 1563 | Ga0501070_0035656 | |||
| 1564 | Ga0501070_0216997 | |||
| 1565 | Ga0501070_0229734 | |||
| 1566 | Ga0501070_0490989 | |||
| 1567 | Ga0501071_0020074 | |||
| 1568 | Ga0501071_0100679 | |||
| 1569 | Ga0501071_1074199 | |||
| 1570 | Ga0501072_0669156 | |||
| 1571 | Ga0501072_0689403 | |||
| 1572 | Ga0501072_1197779 | |||
| 1573 | Ga0501072_1608839 | |||
| 1574 | Ga0501073_0068822 | |||
| 1575 | Ga0501075_0012425 | |||
| 1576 | Ga0501075_0176758 | |||
| 1577 | Ga0501075_0297182 | |||
| 1578 | Ga0501077_0046931 | |||
| 1579 | Ga0501077_0063279 | |||
| 1580 | Ga0501077_0311352 | |||
| 1581 | Ga0501077_0340402 | |||
| 1582 | Ga0501079_0032746 | |||
| 1583 | Ga0501079_0684904 | |||
| 1584 | Ga0501080_0065875 | |||
| 1585 | Ga0501080_0087739 | |||
| 1586 | Ga0501080_0562616 | |||
| 1587 | Ga0501081_0007046 | |||
| 1588 | Ga0501081_0672099 | |||
| 1589 | Ga0501083_0023402 | |||
| 1590 | Ga0501083_0754277 | |||
| 1591 | Ga0501035_0062179 | |||
| 1592 | Ga0501035_0163950 | |||
| 1593 | Ga0501035_0466592 | |||
| 1594 | Ga0501035_0641369 | |||
| 1595 | Ga0501044_0000674 | |||
| 1596 | Ga0501044_0087153 | |||
| 1597 | Ga0501044_0115448 | |||
| 1598 | Ga0501044_0168198 | |||
| 1599 | Ga0501044_0183276 | |||
| 1600 | Ga0501044_0326455 | |||
| 1601 | Ga0501044_0673135 | |||
| 1602 | nmdc:mga0yw44_21378_c1 | |||
| 1603 | nmdc:mga0yw44_62794_c1 | |||
| 1604 | nmdc:mga0yw44_773624_c1 | |||
| 1605 | nmdc:mga0yw44_79317_c1 | |||
| 1606 | nmdc:mga06z11_190124_c1 | |||
| 1607 | nmdc:mga06z11_66690_c1 | |||
| 1608 | nmdc:mga06z11_739500_c1 | |||
| 1609 | nmdc:mga04h51_32786_c1 | |||
| 1610 | nmdc:mga05p37_188592_c1 | |||
| 1611 | nmdc:mga05p37_647825_c1 | |||
| 1612 | nmdc:mga05p37_652336_c1 | |||
| 1613 | nmdc:mga09592_150370_c1 | |||
| 1614 | nmdc:mga09592_217499_c1 | |||
| 1615 | nmdc:mga09592_456676_c1 | |||
| 1616 | nmdc:mga0qj67_1198069_c1 | |||
| 1617 | nmdc:mga06r32_1084294_c1 | |||
| 1618 | nmdc:mga06r32_1326057_c1 | |||
| 1619 | nmdc:mga06r32_199621_c1 | |||
| 1620 | nmdc:mga06r32_444104_c1 | |||
| 1621 | nmdc:mga08y16_193475_c1 | |||
| 1622 | nmdc:mga08y16_37367_c1 | |||
| 1623 | nmdc:mga08y16_80669_c1 | |||
| 1624 | nmdc:mga0n895_138188_c1 | |||
| 1625 | nmdc:mga0n895_246115_c1 | |||
| 1626 | nmdc:mga0n895_412322_c1 | |||
| 1627 | nmdc:mga0rr50_40351_c1 | |||
| 1628 | nmdc:mga08x19_259862_c1 | |||
| 1629 | nmdc:mga08x19_799657_c1 | |||
| 1630 | nmdc:mga0a205_174724_c1 | |||
| 1631 | nmdc:mga0a205_658790_c1 | |||
| 1632 | Ga0495601_0015050 | |||
| 1633 | Ga0495601_0053986 | |||
| 1634 | Ga0495601_0127203 | |||
| 1635 | Ga0495601_0729289 | |||
| 1636 | Ga0495612_0040979 | |||
| 1637 | Ga0495612_0158383 | |||
| 1638 | Ga0495612_0159712 | |||
| 1639 | Ga0495655_0125121 | |||
| 1640 | Ga0495595_0028759 | |||
| 1641 | Ga0495595_0028867 | |||
| 1642 | Ga0495595_0041543 | |||
| 1643 | Ga0495595_0105952 | |||
| 1644 | Ga0495595_0287743 | |||
| 1645 | Ga0495595_0312585 | |||
| 1646 | Ga0495619_0006374 | |||
| 1647 | Ga0495619_0018585 | |||
| 1648 | Ga0495619_0020300 | |||
| 1649 | Ga0495619_0026083 | |||
| 1650 | Ga0495619_0039105 | |||
| 1651 | Ga0495619_0100887 | |||
| 1652 | Ga0495619_0119810 | |||
| 1653 | Ga0495619_0245279 | |||
| 1654 | Ga0500646_0100896 | |||
| 1655 | Ga0500595_037983 | |||
| 1656 | Ga0500614_047453 | |||
| 1657 | Ga0500636_0230338 | |||
| 1658 | Ga0501084_0054919 | |||
| 1659 | Ga0501084_0147484 | |||
| 1660 | Ga0501084_0856466 | |||
| 1661 | Ga0501082_0029742 | |||
| 1662 | Ga0501082_0049287 | |||
| 1663 | Ga0501082_0055210 | |||
| 1664 | Ga0501082_0263834 | |||
| 1665 | Ga0530510_0307797 | |||
| 1666 | Ga0530510_1042790 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3es1-assembly1.cif.gz_A-2 | crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution | 0.8944 | 4 | 156 |
| 7zvy-assembly4.cif.gz_H | thermococcus kadokarensis phosphomannose isomerase | 0.864 | 28 | 143 |
| 2d40-assembly1.cif.gz_A | crystal structure of z3393 from escherichia coli o157:h7 | 0.8596 | 70 | 143 |
| 3h8u-assembly1.cif.gz_B | crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution | 0.8585 | 70 | 145 |
| 3es1-assembly1.cif.gz_A-2 | crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution | 0.8575 | 4 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3es1A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8989 | 34 | 156 | 2.60.120.10 |
| 4i4aA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8728 | 70 | 143 | 2.60.120.10 |
| 3es1A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8718 | 34 | 156 | 2.60.120.10 |
| 3nvcA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8713 | 70 | 143 | 2.60.120.10 |
| 4e4hC01 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8551 | 70 | 143 | 2.60.120.650 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8DA14-F1-model_v4 | Cupin domain-containing protein | 0.9853 | 3 | 159 |
|
| AF-A0A345ZQL0-F1-model_v4 | Cupin domain-containing protein | 0.984 | 4 | 159 |
|
| AF-A0A2V8DA14-F1-model_v4 | Cupin domain-containing protein | 0.9792 | 3 | 159 |
|
| AF-A0A2V6XK96-F1-model_v4 | Cupin domain-containing protein | 0.9744 | 1 | 128 |
|
| AF-A0A2V6TWW3-F1-model_v4 | Cupin domain-containing protein | 0.9742 | 22 | 159 |
|