F482755

General Info

Members Datasets Scaffolds Average Seq Length
833 361 1666 159

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0021282|Ga0395899_0021282_1817_2374
Length 185
Sequence MSAASAADCIRLLDAASEPRADNMEKKMTLNLRRVVTGHDAQGRAKVLIDEQVSNRFSPRPGAEYSVIWSSEGFPVDNDDDADPSRKKIGTTISNGTVFRIVSFGPGVSPRNHRTDSIDYAVVMSGEIDMVLDDETVHLKAGDVLVQRGTIHNWVNNGTVPCVIAFTLVSAKPVSPGGKTLDARG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
296 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 8.64
Rhizosphere 87.03
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0021282 3300037312 Bacteria 4920
2 JGI24742J22300_10095685 3300002244 Unclassified 571
3 rootH1_10061561 3300003323 Bacteria 2305
4 JGI25404J52841_10003048 3300003659 Bacteria 3266
5 Ga0070658_10100128 3300005327 Bacteria 2395
6 Ga0070658_10377474 3300005327 Bacteria 1216
7 Ga0070658_10536026 3300005327 Bacteria 1012
8 Ga0070670_100014533 3300005331 Bacteria 6760
9 Ga0070670_100168559 3300005331 Bacteria 1899
10 Ga0070670_101776014 3300005331 Bacteria 568
11 Ga0068869_100588517 3300005334 Unclassified 939
12 Ga0068869_101491642 3300005334 Bacteria 600
13 Ga0070666_10266697 3300005335 Bacteria 1215
14 Ga0070680_100000532 3300005336 Bacteria 25987
15 Ga0070680_100014359 3300005336 Bacteria 6187
16 Ga0070680_100017152 3300005336 Bacteria 5705
17 Ga0070680_100020767 3300005336 Bacteria 5210
18 Ga0070680_100160707 3300005336 Bacteria 1888
19 Ga0070680_100242614 3300005336 Bacteria 1523
20 Ga0070680_100872646 3300005336 Bacteria 776
21 Ga0070682_101450804 3300005337 Bacteria 588
22 Ga0068868_100091031 3300005338 Bacteria 2457
23 Ga0068868_100285186 3300005338 Bacteria 1399
24 Ga0070660_100706299 3300005339 Bacteria 845
25 Ga0070689_100110227 3300005340 Bacteria 2188
26 Ga0070691_10002110 3300005341 Bacteria 8800
27 Ga0070691_10062538 3300005341 Unclassified 1793
28 Ga0070691_10397687 3300005341 Unclassified 776
29 Ga0070661_100563738 3300005344 Bacteria 918
30 Ga0070669_100665495 3300005353 Unclassified 877
31 Ga0070669_100968731 3300005353 Unclassified 729
32 Ga0070669_100993732 3300005353 Bacteria 720
33 Ga0070675_100029273 3300005354 Bacteria 4441
34 Ga0070675_100045254 3300005354 Bacteria 3601
35 Ga0070671_100198986 3300005355 Unclassified 1699
36 Ga0070671_100850983 3300005355 Bacteria 795
37 Ga0070671_100997742 3300005355 Bacteria 734
38 Ga0070674_100226208 3300005356 Bacteria 1458
39 Ga0070674_100538772 3300005356 Unclassified 978
40 Ga0070674_100587061 3300005356 Bacteria 940
41 Ga0070673_100286294 3300005364 Bacteria 1447
42 Ga0070673_100719972 3300005364 Unclassified 917
43 Ga0070688_100208329 3300005365 Bacteria 1371
44 Ga0070667_100957747 3300005367 Bacteria 798
45 Ga0070703_10183005 3300005406 Bacteria 810
46 Ga0070709_10121933 3300005434 Bacteria 1768
47 Ga0070709_10187558 3300005434 Bacteria 1456
48 Ga0070709_10468587 3300005434 Bacteria 952
49 Ga0070709_11032296 3300005434 Unclassified 655
50 Ga0070714_100228591 3300005435 Unclassified 1713
51 Ga0070714_100676094 3300005435 Unclassified 995
52 Ga0070713_100007857 3300005436 Bacteria 7522
53 Ga0070713_100228786 3300005436 Unclassified 1689
54 Ga0070713_100678838 3300005436 Bacteria 983
55 Ga0070713_100870209 3300005436 Bacteria 866
56 Ga0070713_101703045 3300005436 Unclassified 612
57 Ga0070710_10015505 3300005437 Bacteria 3859
58 Ga0070710_10122263 3300005437 Bacteria 1577
59 Ga0070710_10476080 3300005437 Bacteria 851
60 Ga0070710_10825724 3300005437 Unclassified 664
61 Ga0070701_10124105 3300005438 Bacteria 1459
62 Ga0070711_100089546 3300005439 Unclassified 2214
63 Ga0070711_100439584 3300005439 Bacteria 1066
64 Ga0070700_100233024 3300005441 Bacteria 1311
65 Ga0070700_100244875 3300005441 Bacteria 1283
66 Ga0070700_101194406 3300005441 Unclassified 635
67 Ga0070694_100876857 3300005444 Bacteria 740
68 Ga0070708_100205704 3300005445 Bacteria 1844
69 Ga0070663_100156117 3300005455 Bacteria 1753
70 Ga0070663_100882224 3300005455 Bacteria 771
71 Ga0070678_100011639 3300005456 Bacteria 5435
72 Ga0070678_100854028 3300005456 Unclassified 830
73 Ga0070662_101182524 3300005457 Unclassified 657
74 Ga0070681_10001471 3300005458 Bacteria 20783
75 Ga0070681_10001868 3300005458 Bacteria 19014
76 Ga0070681_10039836 3300005458 Bacteria 4710
77 Ga0070681_10128482 3300005458 Bacteria 2467
78 Ga0070681_10175776 3300005458 Bacteria 2063
79 Ga0070681_10244293 3300005458 Bacteria 1708
80 Ga0070681_11244242 3300005458 Bacteria 667
81 Ga0070685_10030546 3300005466 Bacteria 3004
82 Ga0070698_100189732 3300005471 Bacteria 1993
83 Ga0070698_100687673 3300005471 Bacteria 965
84 Ga0070699_100004042 3300005518 Bacteria 12963
85 Ga0070699_100197651 3300005518 Bacteria 1788
86 Ga0070679_100005709 3300005530 Bacteria 11537
87 Ga0070679_100022471 3300005530 Bacteria 6164
88 Ga0070679_100060758 3300005530 Bacteria 3766
89 Ga0070679_100062165 3300005530 Bacteria 3722
90 Ga0070679_100116665 3300005530 Bacteria 2654
91 Ga0070679_100163240 3300005530 Bacteria 2201
92 Ga0070679_100573260 3300005530 Bacteria 1072
93 Ga0070679_101314173 3300005530 Bacteria 669
94 Ga0070679_101578407 3300005530 Bacteria 604
95 Ga0070684_100218023 3300005535 Bacteria 1740
96 Ga0070684_100493541 3300005535 Bacteria 1134
97 Ga0070684_100517396 3300005535 Bacteria 1106
98 Ga0070697_100086086 3300005536 Bacteria 2593
99 Ga0070696_100683759 3300005546 Bacteria 835
100 Ga0070693_100037524 3300005547 Bacteria 2702
101 Ga0070693_100058118 3300005547 Bacteria 2238
102 Ga0070665_100643538 3300005548 Unclassified 1073
103 Ga0068855_100031168 3300005563 Bacteria 6369
104 Ga0068855_100425065 3300005563 Bacteria 1453
105 Ga0068855_100617644 3300005563 Bacteria 1167
106 Ga0070664_100253593 3300005564 Bacteria 1582
107 Ga0070664_100912970 3300005564 Bacteria 824
108 Ga0068857_100214533 3300005577 Bacteria 1757
109 Ga0068857_100493149 3300005577 Bacteria 1149
110 Ga0068854_100397257 3300005578 Bacteria 1140
111 Ga0068854_100885233 3300005578 Bacteria 784
112 Ga0068856_100064801 3300005614 Bacteria 3611
113 Ga0068856_100442108 3300005614 Bacteria 1321
114 Ga0070702_100246058 3300005615 Bacteria 1209
115 Ga0070702_100276003 3300005615 Bacteria 1152
116 Ga0068852_100039541 3300005616 Bacteria 3972
117 Ga0068852_100133712 3300005616 Bacteria 2287
118 Ga0068859_100498756 3300005617 Bacteria 1313
119 Ga0068864_100062130 3300005618 Bacteria 3236
120 Ga0068866_10355943 3300005718 Bacteria 932
121 Ga0068861_100781231 3300005719 Bacteria 895
122 Ga0068861_100944605 3300005719 Bacteria 819
123 Ga0068861_100987504 3300005719 Bacteria 803
124 Ga0068851_10177725 3300005834 Bacteria 1177
125 Ga0068851_10248012 3300005834 Bacteria 1009
126 Ga0068863_100064913 3300005841 Bacteria 3453
127 Ga0068858_100485880 3300005842 Bacteria 1192
128 Ga0068858_100768551 3300005842 Bacteria 939
129 Ga0068860_100315563 3300005843 Bacteria 1533
130 Ga0068860_100686055 3300005843 Bacteria 1033
131 Ga0068862_100530381 3300005844 Bacteria 1122
132 Ga0068862_100577174 3300005844 Bacteria 1077
133 Ga0068862_101450777 3300005844 Bacteria 690
134 Ga0081455_10004063 3300005937 Bacteria 16576
135 Ga0081455_10006691 3300005937 Bacteria 12317
136 Ga0081455_10188604 3300005937 Bacteria 1555
137 Ga0081455_10699478 3300005937 Unclassified 646
138 Ga0081538_10013890 3300005981 Bacteria 6345
139 Ga0081538_10104212 3300005981 Bacteria 1416
140 Ga0081538_10216687 3300005981 Unclassified 764
141 Ga0081540_1000068 3300005983 Bacteria 112697
142 Ga0081540_1007636 3300005983 Bacteria 7675
143 Ga0081540_1049542 3300005983 Bacteria 2094
144 Ga0081540_1092555 3300005983 Bacteria 1326
145 Ga0070717_10226629 3300006028 Bacteria 1644
146 Ga0070717_10286756 3300006028 Unclassified 1461
147 Ga0070717_10572477 3300006028 Bacteria 1024
148 Ga0070717_10859629 3300006028 Bacteria 825
149 Ga0075365_10015218 3300006038 Bacteria 4648
150 Ga0075365_10018821 3300006038 Bacteria 4253
151 Ga0075365_10302639 3300006038 Bacteria 1125
152 Ga0075363_100048975 3300006048 Bacteria 2248
153 Ga0075363_100117284 3300006048 Bacteria 1484
154 Ga0075364_10413454 3300006051 Unclassified 921
155 Ga0070715_10102597 3300006163 Bacteria 1337
156 Ga0070715_10177680 3300006163 Unclassified 1065
157 Ga0070716_101794603 3300006173 Bacteria 508
158 Ga0070712_100174383 3300006175 Bacteria 1671
159 Ga0070712_100238937 3300006175 Bacteria 1446
160 Ga0070712_100820646 3300006175 Bacteria 799
161 Ga0070712_101354732 3300006175 Bacteria 620
162 Ga0075362_10521090 3300006177 Bacteria 609
163 Ga0075366_10482154 3300006195 Bacteria 766
164 Ga0097621_100051940 3300006237 Bacteria 3337
165 Ga0097621_100094989 3300006237 Bacteria 2500
166 Ga0068871_101095445 3300006358 Unclassified 745
167 Ga0075428_100094169 3300006844 Bacteria 3266
168 Ga0075428_100168066 3300006844 Bacteria 2379
169 Ga0075428_100178024 3300006844 Bacteria 2303
170 Ga0075428_100289922 3300006844 Bacteria 1760
171 Ga0075428_101010683 3300006844 Unclassified 880
172 Ga0075428_102054257 3300006844 Bacteria 592
173 Ga0075430_100031870 3300006846 Bacteria 4474
174 Ga0075430_100667622 3300006846 Unclassified 857
175 Ga0075431_100053442 3300006847 Bacteria 4165
176 Ga0075431_100268002 3300006847 Bacteria 1732
177 Ga0075431_100269032 3300006847 Unclassified 1728
178 Ga0075433_10230811 3300006852 Bacteria 1644
179 Ga0075433_10919858 3300006852 Unclassified 763
180 Ga0075434_100040273 3300006871 Bacteria 4627
181 Ga0075429_100254854 3300006880 Unclassified 1536
182 Ga0075429_100424157 3300006880 Bacteria 1165
183 Ga0075429_100628377 3300006880 Unclassified 941
184 Ga0068865_100322438 3300006881 Bacteria 1243
185 Ga0068865_100331929 3300006881 Bacteria 1226
186 Ga0068865_100895085 3300006881 Bacteria 771
187 Ga0075436_100017742 3300006914 Bacteria 4872
188 Ga0075436_100619313 3300006914 Bacteria 798
189 Ga0097620_100498714 3300006931 Bacteria 1313
190 Ga0075435_100572691 3300007076 Bacteria 979
191 Ga0099794_10048661 3300007265 Bacteria 2035
192 Ga0099795_10015498 3300007788 Bacteria 2389
193 Ga0099795_10288849 3300007788 Bacteria 718
194 Ga0099795_10445570 3300007788 Bacteria 595
195 Ga0105240_10003482 3300009093 Bacteria 24419
196 Ga0105240_10029418 3300009093 Bacteria 7157
197 Ga0105240_10185602 3300009093 Bacteria 2450
198 Ga0105240_10643314 3300009093 Bacteria 1163
199 Ga0105240_11097916 3300009093 Bacteria 847
200 Ga0111539_10018297 3300009094 Bacteria 8679
201 Ga0111539_10041142 3300009094 Bacteria 5558
202 Ga0111539_10473801 3300009094 Bacteria 1458
203 Ga0111539_10824096 3300009094 Bacteria 1080
204 Ga0111539_11470483 3300009094 Bacteria 790
205 Ga0111539_12542096 3300009094 Bacteria 594
206 Ga0105245_10007194 3300009098 Bacteria 9752
207 Ga0105245_10245251 3300009098 Bacteria 1738
208 Ga0105247_10316839 3300009101 Bacteria 1087
209 Ga0114129_10014687 3300009147 Bacteria 11158
210 Ga0114129_10483879 3300009147 Bacteria 1619
211 Ga0114129_11729769 3300009147 Bacteria 762
212 Ga0105243_10938370 3300009148 Unclassified 863
213 Ga0105243_10994120 3300009148 Unclassified 841
214 Ga0105243_11448815 3300009148 Bacteria 709
215 Ga0105241_10412811 3300009174 Bacteria 1186
216 Ga0105241_10523306 3300009174 Bacteria 1061
217 Ga0105242_11677675 3300009176 Unclassified 671
218 Ga0105248_10027688 3300009177 Bacteria 6312
219 Ga0105248_10218075 3300009177 Bacteria 2148
220 Ga0105248_11668763 3300009177 Unclassified 722
221 Ga0105237_10828155 3300009545 Bacteria 932
222 Ga0105238_10011409 3300009551 Bacteria 8948
223 Ga0105238_10132631 3300009551 Bacteria 2469
224 Ga0105238_10637521 3300009551 Bacteria 1075
225 Ga0105249_10538486 3300009553 Unclassified 1217
226 Ga0099796_10017549 3300010159 Bacteria 2133
227 Ga0105239_11376848 3300010375 Unclassified 814
228 Ga0105239_12666317 3300010375 Unclassified 583
229 Ga0105246_10453684 3300011119 Bacteria 1078
230 Ga0157347_1016424 3300012502 Bacteria 833
231 Ga0157373_10068119 3300013100 Bacteria 2516
232 Ga0157373_10072811 3300013100 Bacteria 2425
233 Ga0157373_10075187 3300013100 Bacteria 2383
234 Ga0157371_10162056 3300013102 Bacteria 1597
235 Ga0157371_10164667 3300013102 Bacteria 1584
236 Ga0157370_10002489 3300013104 Bacteria 22197
237 Ga0157370_10045586 3300013104 Bacteria 4205
238 Ga0157370_10103934 3300013104 Bacteria 2659
239 Ga0157370_10937366 3300013104 Bacteria 785
240 Ga0157369_10364362 3300013105 Bacteria 1500
241 Ga0157369_10511848 3300013105 Bacteria 1242
242 Ga0157369_11472327 3300013105 Unclassified 693
243 Ga0157374_10106839 3300013296 Unclassified 2689
244 Ga0157374_10592351 3300013296 Bacteria 1118
245 Ga0157378_10200316 3300013297 Bacteria 1888
246 Ga0157378_10822153 3300013297 Bacteria 956
247 Ga0157378_11387785 3300013297 Bacteria 745
248 Ga0163162_10077112 3300013306 Bacteria 3396
249 Ga0163162_10088372 3300013306 Bacteria 3178
250 Ga0163162_10968260 3300013306 Bacteria 961
251 Ga0163162_11246561 3300013306 Unclassified 844
252 Ga0157372_10082809 3300013307 Bacteria 3633
253 Ga0157372_10371677 3300013307 Bacteria 1666
254 Ga0157372_10941723 3300013307 Bacteria 1001
255 Ga0157372_11539135 3300013307 Bacteria 766
256 Ga0157375_10063653 3300013308 Bacteria 3670
257 Ga0157375_11822674 3300013308 Unclassified 721
258 Ga0163163_10113546 3300014325 Bacteria 2739
259 Ga0163163_10437559 3300014325 Bacteria 1367
260 Ga0157380_11292428 3300014326 Bacteria 776
261 Ga0182008_10581622 3300014497 Bacteria 626
262 Ga0157377_10208472 3300014745 Bacteria 1245
263 Ga0157379_10650681 3300014968 Bacteria 987
264 Ga0157379_10720888 3300014968 Bacteria 937
265 Ga0157379_10889064 3300014968 Unclassified 844
266 Ga0157376_10029373 3300014969 Bacteria 4378
267 Ga0157376_10662024 3300014969 Bacteria 1046
268 Ga0157376_11651397 3300014969 Bacteria 675
269 Ga0163161_10761170 3300017792 Bacteria 811
270 Ga0163161_11026704 3300017792 Bacteria 705
271 Ga0163161_11513349 3300017792 Unclassified 589
272 Ga0213876_10051631 3300021384 Bacteria 2173
273 Ga0213876_10190909 3300021384 Bacteria 1089
274 Ga0213876_10240472 3300021384 Bacteria 962
275 Ga0207656_10056127 3300025321 Bacteria 1716
276 Ga0207692_10123246 3300025898 Bacteria 1454
277 Ga0207692_10348740 3300025898 Bacteria 912
278 Ga0207692_10352079 3300025898 Bacteria 908
279 Ga0207692_10490495 3300025898 Unclassified 778
280 Ga0207642_10017305 3300025899 Bacteria 2738
281 Ga0207642_10091233 3300025899 Bacteria 1505
282 Ga0207710_10227364 3300025900 Unclassified 928
283 Ga0207710_10382594 3300025900 Bacteria 720
284 Ga0207688_10114003 3300025901 Bacteria 1572
285 Ga0207680_10338459 3300025903 Bacteria 1055
286 Ga0207699_10383479 3300025906 Bacteria 998
287 Ga0207699_10813606 3300025906 Bacteria 687
288 Ga0207645_10079675 3300025907 Bacteria 2099
289 Ga0207645_10691055 3300025907 Bacteria 693
290 Ga0207705_10023664 3300025909 Bacteria 4382
291 Ga0207705_10033896 3300025909 Bacteria 3648
292 Ga0207705_10165287 3300025909 Bacteria 1664
293 Ga0207705_10532328 3300025909 Bacteria 913
294 Ga0207684_10794851 3300025910 Bacteria 800
295 Ga0207707_10012084 3300025912 Bacteria 7508
296 Ga0207707_10015854 3300025912 Bacteria 6572
297 Ga0207707_10024122 3300025912 Bacteria 5320
298 Ga0207707_10041100 3300025912 Bacteria 4038
299 Ga0207695_10120980 3300025913 Bacteria 2586
300 Ga0207695_10906826 3300025913 Bacteria 761
301 Ga0207693_10010728 3300025915 Bacteria 7437
302 Ga0207693_10100071 3300025915 Unclassified 2273
303 Ga0207693_10180388 3300025915 Bacteria 1661
304 Ga0207693_10183157 3300025915 Unclassified 1649
305 Ga0207693_10276185 3300025915 Bacteria 1316
306 Ga0207663_10037278 3300025916 Bacteria 2930
307 Ga0207663_10355080 3300025916 Bacteria 1111
308 Ga0207663_10460575 3300025916 Bacteria 982
309 Ga0207663_10623122 3300025916 Bacteria 849
310 Ga0207663_10780830 3300025916 Bacteria 760
311 Ga0207660_10003904 3300025917 Bacteria 9716
312 Ga0207660_10036831 3300025917 Bacteria 3403
313 Ga0207660_10431128 3300025917 Unclassified 1064
314 Ga0207660_10755667 3300025917 Bacteria 793
315 Ga0207662_10008714 3300025918 Bacteria 5564
316 Ga0207662_10055613 3300025918 Bacteria 2362
317 Ga0207657_10028544 3300025919 Bacteria 5089
318 Ga0207657_10618087 3300025919 Bacteria 845
319 Ga0207652_10006133 3300025921 Bacteria 9720
320 Ga0207652_10018723 3300025921 Bacteria 5683
321 Ga0207652_10083338 3300025921 Bacteria 2800
322 Ga0207652_10370980 3300025921 Bacteria 1292
323 Ga0207652_10392550 3300025921 Bacteria 1252
324 Ga0207652_11040336 3300025921 Bacteria 718
325 Ga0207652_11271331 3300025921 Bacteria 638
326 Ga0207681_11199316 3300025923 Unclassified 638
327 Ga0207694_10089709 3300025924 Bacteria 2425
328 Ga0207694_10315496 3300025924 Bacteria 1289
329 Ga0207694_10454387 3300025924 Bacteria 1069
330 Ga0207650_10026548 3300025925 Bacteria 4133
331 Ga0207659_10393114 3300025926 Bacteria 1158
332 Ga0207687_10050158 3300025927 Bacteria 2904
333 Ga0207687_10100493 3300025927 Bacteria 2128
334 Ga0207700_11219003 3300025928 Unclassified 671
335 Ga0207700_11243491 3300025928 Unclassified 664
336 Ga0207664_10129974 3300025929 Bacteria 2119
337 Ga0207690_10065141 3300025932 Bacteria 2491
338 Ga0207706_10012271 3300025933 Bacteria 7808
339 Ga0207706_10869276 3300025933 Bacteria 763
340 Ga0207709_10020359 3300025935 Bacteria 3741
341 Ga0207670_10038888 3300025936 Bacteria 3110
342 Ga0207669_10171999 3300025937 Bacteria 1543
343 Ga0207669_10390901 3300025937 Unclassified 1086
344 Ga0207669_10529717 3300025937 Bacteria 947
345 Ga0207704_10670083 3300025938 Bacteria 856
346 Ga0207704_11317725 3300025938 Bacteria 618
347 Ga0207665_11384929 3300025939 Bacteria 560
348 Ga0207691_10043196 3300025940 Bacteria 4155
349 Ga0207691_10536759 3300025940 Bacteria 992
350 Ga0207711_10256644 3300025941 Bacteria 1606
351 Ga0207689_10009474 3300025942 Bacteria 8408
352 Ga0207689_10635508 3300025942 Bacteria 899
353 Ga0207689_10647442 3300025942 Unclassified 890
354 Ga0207689_11363723 3300025942 Bacteria 595
355 Ga0207661_10490055 3300025944 Bacteria 1123
356 Ga0207667_10297011 3300025949 Bacteria 1650
357 Ga0207667_10318718 3300025949 Bacteria 1588
358 Ga0207651_10168920 3300025960 Bacteria 1723
359 Ga0207651_10504497 3300025960 Bacteria 1046
360 Ga0207651_10868824 3300025960 Unclassified 802
361 Ga0207712_10250670 3300025961 Bacteria 1431
362 Ga0207668_10133548 3300025972 Bacteria 1899
363 Ga0207640_10296798 3300025981 Bacteria 1276
364 Ga0207677_10021380 3300026023 Bacteria 3952
365 Ga0207677_10115874 3300026023 Bacteria 2005
366 Ga0207677_10198682 3300026023 Bacteria 1592
367 Ga0207703_10019096 3300026035 Bacteria 5355
368 Ga0207703_10638620 3300026035 Bacteria 1009
369 Ga0207639_10085909 3300026041 Bacteria 2504
370 Ga0207639_10416622 3300026041 Bacteria 1213
371 Ga0207639_10680914 3300026041 Bacteria 953
372 Ga0207678_10078006 3300026067 Bacteria 2837
373 Ga0207678_10190387 3300026067 Bacteria 1753
374 Ga0207708_10021260 3300026075 Bacteria 4892
375 Ga0207708_10351050 3300026075 Bacteria 1210
376 Ga0207702_10064258 3300026078 Bacteria 3140
377 Ga0207702_10077085 3300026078 Bacteria 2882
378 Ga0207702_10180680 3300026078 Bacteria 1943
379 Ga0207702_11103310 3300026078 Bacteria 787
380 Ga0207641_10377318 3300026088 Unclassified 1357
381 Ga0207648_10373803 3300026089 Bacteria 1288
382 Ga0207648_10555775 3300026089 Bacteria 1055
383 Ga0207676_10016006 3300026095 Bacteria 5427
384 Ga0207676_10178089 3300026095 Bacteria 1859
385 Ga0207676_10434509 3300026095 Bacteria 1234
386 Ga0207674_10067339 3300026116 Bacteria 3605
387 Ga0207674_10095871 3300026116 Bacteria 2952
388 Ga0207674_10754095 3300026116 Bacteria 939
389 Ga0207674_11711839 3300026116 Bacteria 597
390 Ga0207675_100605076 3300026118 Bacteria 1099
391 Ga0207683_10045559 3300026121 Bacteria 3836
392 Ga0207683_10348475 3300026121 Bacteria 1359
393 Ga0207683_12101514 3300026121 Unclassified 513
394 Ga0207698_10040697 3300026142 Bacteria 3457
395 Ga0207698_10166548 3300026142 Bacteria 1935
396 Ga0207698_10360751 3300026142 Bacteria 1376
397 Ga0207698_11649120 3300026142 Bacteria 657
398 Ga0207428_10176070 3300027907 Unclassified 1618
399 Ga0268266_10492635 3300028379 Unclassified 1169
400 Ga0268266_10885560 3300028379 Bacteria 863
401 Ga0268265_10285823 3300028380 Bacteria 1478
402 Ga0268265_10919325 3300028380 Bacteria 860
403 Ga0268264_10519945 3300028381 Bacteria 1163
404 Ga0265338_10044761 3300028800 Bacteria 4080
405 Ga0265338_10178817 3300028800 Bacteria 1620
406 Ga0265338_10367886 3300028800 Bacteria 1030
407 Ga0265332_10002624 3300031238 Bacteria 9065
408 Ga0265332_10184891 3300031238 Bacteria 868
409 Ga0265328_10276597 3300031239 Bacteria 646
410 Ga0265325_10000093 3300031241 Bacteria 63498
411 Ga0265325_10011946 3300031241 Bacteria 4976
412 Ga0265325_10040411 3300031241 Bacteria 2450
413 Ga0265325_10052422 3300031241 Bacteria 2095
414 Ga0265325_10082024 3300031241 Bacteria 1601
415 Ga0265340_10001806 3300031247 Bacteria 12218
416 Ga0265340_10046308 3300031247 Bacteria 2122
417 Ga0265339_10037937 3300031249 Bacteria 2690
418 Ga0265331_10015974 3300031250 Bacteria 3950
419 Ga0265316_10342677 3300031344 Bacteria 1083
420 Ga0307513_10341113 3300031456 Bacteria 1249
421 Ga0307513_10451896 3300031456 Bacteria 1009
422 Ga0265313_10004184 3300031595 Bacteria 11198
423 Ga0265313_10004593 3300031595 Bacteria 10500
424 Ga0265313_10017649 3300031595 Bacteria 4042
425 Ga0265313_10062905 3300031595 Unclassified 1732
426 Ga0265313_10289248 3300031595 Bacteria 661
427 Ga0265313_10331107 3300031595 Unclassified 607
428 Ga0316575_10138170 3300031665 Bacteria 1002
429 Ga0265314_10009933 3300031711 Bacteria 7979
430 Ga0265314_10204412 3300031711 Bacteria 1165
431 Ga0265314_10321225 3300031711 Unclassified 861
432 Ga0265342_10000011 3300031712 Bacteria 208435
433 Ga0265342_10004077 3300031712 Bacteria 11650
434 Ga0265342_10005903 3300031712 Bacteria 9230
435 Ga0307405_10772364 3300031731 Bacteria 802
436 Ga0307405_11662638 3300031731 Bacteria 565
437 Ga0307407_10154549 3300031903 Bacteria 1495
438 Ga0307412_10535371 3300031911 Bacteria 981
439 Ga0307409_100037395 3300031995 Bacteria 3579
440 Ga0307416_102849148 3300032002 Bacteria 578
441 Ga0307414_11591800 3300032004 Unclassified 609
442 Ga0316583_10006570 3300032133 Bacteria 4179
443 Ga0316583_10051647 3300032133 Bacteria 1447
444 Ga0373930_0008949 3300034816 Bacteria 1762
445 Ga0373930_0120618 3300034816 Bacteria 638
446 Ga0373926_0061157 3300035083 Bacteria 1373
447 Ga0373929_0008642 3300035085 Bacteria 1879
448 Ga0373929_0033797 3300035085 Unclassified 1107
449 Ga0373934_0015879 3300035086 Bacteria 2861
450 Ga0373944_0013671 3300035089 Bacteria 2256
451 Ga0373949_0156178 3300035090 Unclassified 663
452 Ga0373923_0126914 3300035111 Bacteria 1144
453 Ga0373936_0053390 3300035113 Bacteria 1639
454 Ga0373936_0106597 3300035113 Unclassified 1187
455 Ga0373939_0271639 3300035114 Bacteria 667
456 Ga0373941_0123492 3300035115 Bacteria 925
457 Ga0373945_0009911 3300035116 Bacteria 3127
458 Ga0373945_0043030 3300035116 Bacteria 1638
459 Ga0373953_0048401 3300035117 Bacteria 1713
460 Ga0373953_0075832 3300035117 Bacteria 1393
461 Ga0373954_0017797 3300035118 Bacteria 3195
462 Ga0373956_0313432 3300035119 Bacteria 747
463 Ga0373957_0231902 3300035120 Unclassified 774
464 Ga0373960_0054927 3300035121 Bacteria 1192
465 Ga0373943_0069495 3300035170 Bacteria 1780
466 Ga0373943_0147143 3300035170 Bacteria 1273
467 Ga0373943_0196088 3300035170 Bacteria 1116
468 Ga0373946_0025694 3300035171 Bacteria 2317
469 Ga0373955_0005085 3300035172 Bacteria 5877
470 Ga0373942_0003214 3300035207 Bacteria 3864
471 Ga0373961_0094364 3300035241 Bacteria 960
472 Ga0373924_0102896 3300035410 Unclassified 1229
473 Ga0373935_0076414 3300035692 Bacteria 2168
474 Ga0373935_0097912 3300035692 Bacteria 1930
475 Ga0373935_0392411 3300035692 Bacteria 995
476 Ga0373927_0008790 3300035695 Bacteria 6789
477 Ga0373927_0129613 3300035695 Bacteria 1647
478 Ga0373927_0148091 3300035695 Unclassified 1537
479 Ga0373933_0005755 3300035724 Bacteria 6741
480 Ga0373933_0062054 3300035724 Bacteria 2256
481 Ga0373947_0058919 3300035725 Bacteria 2327
482 Ga0373947_0130567 3300035725 Bacteria 1603
483 Ga0373947_0479990 3300035725 Bacteria 843
484 Ga0373937_0009762 3300036401 Bacteria 8368
485 Ga0373937_0012997 3300036401 Bacteria 7332
486 Ga0373937_0029122 3300036401 Bacteria 5000
487 Ga0373937_0603033 3300036401 Unclassified 1042
488 Ga0373937_1891769 3300036401 Unclassified 543
489 Ga0373925_0098549 3300037068 Bacteria 2243
490 Ga0373925_0228222 3300037068 Bacteria 1488
491 Ga0373925_1445184 3300037068 Bacteria 563
492 Ga0395900_0003409 3300037418 Bacteria 17178
493 Ga0395900_0031012 3300037418 Bacteria 5491
494 Ga0395900_0084690 3300037418 Bacteria 3258
495 Ga0395898_0004890 3300037466 Bacteria 14548
496 Ga0395898_0043106 3300037466 Bacteria 4447
497 Ga0395898_0089749 3300037466 Bacteria 2958
498 Ga0395898_0455564 3300037466 Bacteria 1218
499 Ga0436364_0135547 3300037853 Bacteria 922
500 Ga0436364_1278643 3300037853 Bacteria 3800
501 Ga0395901_0066218 3300038443 Bacteria 3763
502 Ga0395901_0083425 3300038443 Bacteria 3340
503 Ga0395901_0355132 3300038443 Bacteria 1512
504 Ga0395901_0612153 3300038443 Bacteria 1097
505 Ga0436365_0080885 3300039437 Bacteria 2175
506 Ga0436365_0228691 3300039437 Bacteria 6281
507 Ga0436365_0258563 3300039437 Bacteria 1174
508 Ga0436365_0364923 3300039437 Bacteria 799
509 Ga0436365_0420225 3300039437 Bacteria 7863
510 Ga0436365_1935734 3300039437 Bacteria 2060
511 Ga0436360_0029211 3300039438 Bacteria 971
512 Ga0436360_0286970 3300039438 Bacteria 2439
513 Ga0436360_0395899 3300039438 Bacteria 1558
514 Ga0436360_0524608 3300039438 Bacteria 1246
515 Ga0436360_0807994 3300039438 Bacteria 3083
516 Ga0436360_0817002 3300039438 Unclassified 547
517 Ga0436360_1056072 3300039438 Bacteria 1028
518 Ga0436360_1083614 3300039438 Bacteria 4290
519 Ga0436360_1174518 3300039438 Bacteria 3461
520 Ga0436361_1033080 3300039447 Unclassified 647
521 Ga0436361_1127209 3300039447 Bacteria 1308
522 Ga0436363_0232716 3300039450 Unclassified 657
523 Ga0436363_0843885 3300039450 Unclassified 1099
524 Ga0439441_074850 3300042001 Bacteria 730
525 Ga0466961_0296685 3300044693 Bacteria 988
526 Ga0466963_0054091 3300044694 Unclassified 2667
527 Ga0466971_0242908 3300044719 Bacteria 857
528 Ga0466970_0654927 3300044765 Bacteria 611
529 Ga0466957_0264843 3300044842 Bacteria 1146
530 Ga0466957_0365656 3300044842 Bacteria 981
531 Ga0466957_0626902 3300044842 Bacteria 754
532 Ga0466957_0877865 3300044842 Bacteria 640
533 Ga0466959_0974282 3300045049 Unclassified 565
534 Ga0466958_0217546 3300045836 Bacteria 1218
535 Ga0466958_0447679 3300045836 Bacteria 836
536 Ga0466967_0183152 3300045976 Bacteria 1976
537 Ga0466967_1122116 3300045976 Bacteria 784
538 Ga0495592_0105995 3300046454 Bacteria 1996
539 Ga0495592_0107693 3300046454 Bacteria 1977
540 Ga0495592_0814260 3300046454 Bacteria 554
541 Ga0495603_0247896 3300046455 Bacteria 1025
542 Ga0495590_0031250 3300046457 Bacteria 1865
543 Ga0495629_0229183 3300046459 Bacteria 1281
544 Ga0495629_0428416 3300046459 Bacteria 897
545 Ga0495641_0075635 3300046461 Bacteria 1510
546 Ga0495651_0080248 3300046462 Bacteria 2465
547 Ga0495651_0543680 3300046462 Unclassified 739
548 Ga0495580_0002052 3300046472 Bacteria 17682
549 Ga0495580_0088606 3300046472 Bacteria 2155
550 Ga0495580_0170521 3300046472 Bacteria 1505
551 Ga0495580_0198559 3300046472 Bacteria 1383
552 Ga0495580_0251880 3300046472 Unclassified 1209
553 Ga0495580_0617517 3300046472 Bacteria 715
554 Ga0495582_0063249 3300046473 Bacteria 2044
555 Ga0495605_0109056 3300046474 Bacteria 1265
556 Ga0495639_0018096 3300046475 Bacteria 3064
557 Ga0495662_0120502 3300046476 Bacteria 1288
558 Ga0495662_0306238 3300046476 Bacteria 781
559 Ga0495664_0338073 3300046477 Bacteria 907
560 Ga0495607_0546456 3300046501 Bacteria 509
561 Ga0495616_0055684 3300046513 Bacteria 1957
562 Ga0495618_0164167 3300046514 Bacteria 1415
563 Ga0495628_0013920 3300046516 Bacteria 6755
564 Ga0495628_0257822 3300046516 Bacteria 1300
565 Ga0495628_0260740 3300046516 Bacteria 1292
566 Ga0495630_0455814 3300046517 Bacteria 980
567 Ga0495630_0993111 3300046517 Bacteria 638
568 Ga0495631_0055914 3300046518 Bacteria 1719
569 Ga0495663_0030132 3300046525 Bacteria 1606
570 Ga0495666_0095955 3300046526 Bacteria 1398
571 Ga0495666_0385872 3300046526 Bacteria 630
572 Ga0495642_0069433 3300046528 Bacteria 1472
573 Ga0495652_0024293 3300046529 Bacteria 5366
574 Ga0495652_0095258 3300046529 Bacteria 2426
575 Ga0495652_0353649 3300046529 Bacteria 1052
576 Ga0495652_0368303 3300046529 Bacteria 1025
577 Ga0495665_0151730 3300046531 Bacteria 1209
578 Ga0495640_0028513 3300046533 Bacteria 4019
579 Ga0495640_0250719 3300046533 Bacteria 1109
580 Ga0495640_0458136 3300046533 Bacteria 778
581 Ga0495587_0093933 3300046536 Unclassified 1732
582 Ga0495587_0537436 3300046536 Archaea 645
583 Ga0495598_0005428 3300046537 Bacteria 2824
584 Ga0495645_0014092 3300046543 Bacteria 5665
585 Ga0495645_0224988 3300046543 Bacteria 1260
586 Ga0495645_0264898 3300046543 Bacteria 1136
587 Ga0495622_0081231 3300046557 Bacteria 1491
588 Ga0495622_0128223 3300046557 Bacteria 1156
589 Ga0495667_0176170 3300046559 Bacteria 1373
590 Ga0495656_0086454 3300046615 Bacteria 1426
591 Ga0495656_0219427 3300046615 Bacteria 950
592 Ga0495634_0161902 3300046642 Unclassified 1410
593 Ga0495634_0305443 3300046642 Bacteria 961
594 Ga0495661_0055265 3300046665 Bacteria 2380
595 Ga0495657_0187588 3300046675 Bacteria 1265
596 Ga0495599_0018786 3300046678 Bacteria 4309
597 Ga0495599_0181294 3300046678 Unclassified 1298
598 Ga0495599_0608386 3300046678 Unclassified 636
599 Ga0495623_0014531 3300046679 Bacteria 5094
600 Ga0495646_0142463 3300046680 Bacteria 1339
601 Ga0495658_0460051 3300046683 Bacteria 813
602 Ga0495613_0130213 3300046689 Bacteria 1802
603 Ga0495624_0024582 3300046690 Bacteria 3962
604 Ga0495670_0009666 3300046691 Bacteria 4740
605 Ga0495589_0166784 3300046794 Bacteria 1048
606 Ga0495600_0031905 3300046809 Bacteria 3415
607 Ga0495581_0727573 3300047315 Bacteria 572
608 Ga0495604_0097542 3300047317 Bacteria 2167
609 Ga0495604_0469178 3300047317 Unclassified 820
610 Ga0495636_0238230 3300047318 Bacteria 839
611 Ga0495674_0112575 3300047319 Bacteria 2306
612 Ga0495676_0030885 3300047321 Bacteria 4538
613 Ga0495676_0069725 3300047321 Bacteria 2711
614 Ga0495680_0136860 3300047322 Bacteria 1795
615 Ga0495675_0346195 3300047444 Bacteria 875
616 Ga0495684_0214979 3300047471 Bacteria 1412
617 Ga0495684_0355385 3300047471 Bacteria 1039
618 Ga0495602_0022774 3300048088 Bacteria 6124
619 Ga0495602_0078864 3300048088 Bacteria 2780
620 Ga0495602_0570332 3300048088 Bacteria 782
621 Ga0495602_0580665 3300048088 Bacteria 773
622 Ga0495614_0234874 3300048089 Bacteria 836
623 Ga0495626_0195197 3300048091 Bacteria 833
624 Ga0495626_0202287 3300048091 Unclassified 814
625 Ga0496100_0058018 3300048903 Bacteria 2538
626 Ga0496100_0121832 3300048903 Bacteria 1825
627 Ga0496101_0040026 3300048904 Bacteria 3337
628 Ga0496101_0817180 3300048904 Unclassified 735
629 Ga0496102_0107728 3300048905 Unclassified 2595
630 Ga0496102_0154698 3300048905 Bacteria 2155
631 Ga0496102_0165540 3300048905 Bacteria 2080
632 Ga0496102_0318350 3300048905 Bacteria 1465
633 Ga0496103_0024104 3300048906 Bacteria 3670
634 Ga0496104_0002917 3300048907 Bacteria 14731
635 Ga0496104_0003793 3300048907 Bacteria 13077
636 Ga0496104_0182634 3300048907 Unclassified 2008
637 Ga0496104_0273892 3300048907 Bacteria 1600
638 Ga0496104_0655619 3300048907 Bacteria 958
639 Ga0496104_0888082 3300048907 Unclassified 796
640 Ga0496105_0000307 3300048908 Bacteria 32178
641 Ga0496105_0000442 3300048908 Bacteria 27287
642 Ga0496105_0025142 3300048908 Bacteria 4844
643 Ga0496105_0093240 3300048908 Bacteria 2486
644 Ga0496105_0225748 3300048908 Bacteria 1523
645 Ga0496105_0622772 3300048908 Bacteria 835
646 Ga0496105_0768748 3300048908 Unclassified 734
647 Ga0496106_0024744 3300048909 Bacteria 4464
648 Ga0496106_0058240 3300048909 Bacteria 2924
649 Ga0496106_0130881 3300048909 Bacteria 1967
650 Ga0496106_0319362 3300048909 Bacteria 1246
651 Ga0496106_0679505 3300048909 Unclassified 821
652 Ga0496107_0185615 3300048910 Bacteria 1544
653 Ga0496107_0446140 3300048910 Unclassified 961
654 Ga0496108_0004617 3300048911 Bacteria 11096
655 Ga0496108_0132920 3300048911 Bacteria 2139
656 Ga0496108_0219069 3300048911 Bacteria 1653
657 Ga0496108_0271821 3300048911 Bacteria 1475
658 Ga0496108_0585117 3300048911 Unclassified 973
659 Ga0496108_0655205 3300048911 Bacteria 912
660 Ga0496108_0670545 3300048911 Unclassified 900
661 Ga0496109_0001446 3300048912 Bacteria 19677
662 Ga0496109_0179658 3300048912 Bacteria 1987
663 Ga0496109_0208069 3300048912 Unclassified 1840
664 Ga0496109_0822456 3300048912 Bacteria 867
665 Ga0496109_1427953 3300048912 Bacteria 627
666 Ga0496110_0039351 3300048913 Bacteria 4116
667 Ga0496110_0078831 3300048913 Bacteria 2932
668 Ga0496110_0289759 3300048913 Bacteria 1491
669 Ga0496110_0501053 3300048913 Bacteria 1105
670 Ga0496111_0062707 3300048914 Bacteria 2695
671 Ga0496111_0096031 3300048914 Bacteria 2175
672 Ga0496111_0703115 3300048914 Archaea 735
673 Ga0496112_0067724 3300048915 Bacteria 3524
674 Ga0496112_0079771 3300048915 Bacteria 3237
675 Ga0496112_0181360 3300048915 Bacteria 2069
676 Ga0496112_0184245 3300048915 Bacteria 2051
677 Ga0496112_0198553 3300048915 Unclassified 1966
678 Ga0496112_0265622 3300048915 Unclassified 1665
679 Ga0496112_0356957 3300048915 Bacteria 1404
680 Ga0496112_0431644 3300048915 Unclassified 1256
681 Ga0496112_0535694 3300048915 Bacteria 1105
682 Ga0496112_0755304 3300048915 Unclassified 898
683 Ga0496112_0930999 3300048915 Unclassified 790
684 Ga0496112_1081388 3300048915 Bacteria 720
685 Ga0496113_0002540 3300048916 Bacteria 10641
686 Ga0496113_0081568 3300048916 Bacteria 2479
687 Ga0496113_0466533 3300048916 Bacteria 1015
688 Ga0496113_0557903 3300048916 Unclassified 918
689 Ga0496114_0143543 3300048917 Bacteria 2068
690 Ga0496114_0650587 3300048917 Unclassified 927
691 Ga0496114_0818496 3300048917 Unclassified 810
692 Ga0496115_0073476 3300048918 Bacteria 2776
693 Ga0496115_0116080 3300048918 Bacteria 2201
694 Ga0496115_0197017 3300048918 Bacteria 1664
695 Ga0496115_0317768 3300048918 Bacteria 1274
696 Ga0496115_0320591 3300048918 Unclassified 1267
697 Ga0501032_0045249 3300049569 Bacteria 2977
698 Ga0501032_0144370 3300049569 Bacteria 1567
699 Ga0501032_0684432 3300049569 Bacteria 650
700 Ga0501033_0093201 3300049570 Bacteria 2202
701 Ga0501033_0216723 3300049570 Unclassified 1364
702 Ga0501033_0239058 3300049570 Bacteria 1289
703 Ga0501034_0010927 3300049571 Bacteria 9434
704 Ga0501034_0020219 3300049571 Bacteria 6798
705 Ga0501034_0023518 3300049571 Bacteria 6278
706 Ga0501034_0330033 3300049571 Bacteria 1457
707 Ga0501036_0062714 3300049572 Bacteria 3148
708 Ga0501036_0071626 3300049572 Bacteria 2930
709 Ga0501037_0026512 3300049573 Bacteria 4284
710 Ga0501037_0173483 3300049573 Bacteria 1532
711 Ga0501037_0174170 3300049573 Bacteria 1529
712 Ga0501037_0414913 3300049573 Bacteria 922
713 Ga0501038_0030603 3300049574 Bacteria 4760
714 Ga0501038_0110450 3300049574 Bacteria 2278
715 Ga0501038_0748504 3300049574 Bacteria 729
716 Ga0501039_0043435 3300049575 Bacteria 3472
717 Ga0501039_0289423 3300049575 Unclassified 1288
718 Ga0501039_0669656 3300049575 Bacteria 812
719 Ga0501040_0352693 3300049576 Bacteria 1054
720 Ga0501041_0130310 3300049577 Bacteria 1567
721 Ga0501043_0103366 3300049579 Bacteria 2239
722 Ga0501047_0033645 3300049581 Bacteria 4947
723 Ga0501047_0153604 3300049581 Bacteria 2176
724 Ga0501047_0154886 3300049581 Bacteria 2166
725 Ga0501047_0224194 3300049581 Bacteria 1735
726 Ga0501048_0772571 3300049582 Bacteria 690
727 Ga0501069_0287542 3300049585 Bacteria 963
728 Ga0501069_0758402 3300049585 Bacteria 587
729 Ga0501070_0027648 3300049586 Bacteria 4758
730 Ga0501070_0035656 3300049586 Bacteria 4155
731 Ga0501070_0216997 3300049586 Unclassified 1569
732 Ga0501070_0229734 3300049586 Bacteria 1520
733 Ga0501070_0490989 3300049586 Bacteria 987
734 Ga0501071_0020074 3300049587 Bacteria 4643
735 Ga0501071_0100679 3300049587 Bacteria 2130
736 Ga0501071_1074199 3300049587 Bacteria 622
737 Ga0501072_0669156 3300049588 Bacteria 817
738 Ga0501072_0689403 3300049588 Bacteria 803
739 Ga0501072_1197779 3300049588 Bacteria 590
740 Ga0501072_1608839 3300049588 Unclassified 501
741 Ga0501073_0068822 3300049589 Bacteria 2467
742 Ga0501075_0012425 3300049591 Bacteria 6052
743 Ga0501075_0176758 3300049591 Bacteria 1629
744 Ga0501075_0297182 3300049591 Bacteria 1230
745 Ga0501077_0046931 3300049593 Bacteria 2744
746 Ga0501077_0063279 3300049593 Bacteria 2347
747 Ga0501077_0311352 3300049593 Bacteria 1003
748 Ga0501077_0340402 3300049593 Bacteria 957
749 Ga0501079_0032746 3300049741 Bacteria 3997
750 Ga0501079_0684904 3300049741 Unclassified 807
751 Ga0501080_0065875 3300049742 Bacteria 3369
752 Ga0501080_0087739 3300049742 Bacteria 2890
753 Ga0501080_0562616 3300049742 Bacteria 1015
754 Ga0501081_0007046 3300049743 Bacteria 7310
755 Ga0501081_0672099 3300049743 Bacteria 777
756 Ga0501083_0023402 3300049744 Bacteria 4285
757 Ga0501083_0754277 3300049744 Bacteria 633
758 Ga0501035_0062179 3300049822 Bacteria 3322
759 Ga0501035_0163950 3300049822 Bacteria 1923
760 Ga0501035_0466592 3300049822 Bacteria 1043
761 Ga0501035_0641369 3300049822 Bacteria 862
762 Ga0501044_0000674 3300049823 Bacteria 41281
763 Ga0501044_0087153 3300049823 Bacteria 3153
764 Ga0501044_0115448 3300049823 Bacteria 2690
765 Ga0501044_0168198 3300049823 Bacteria 2165
766 Ga0501044_0183276 3300049823 Bacteria 2060
767 Ga0501044_0326455 3300049823 Bacteria 1458
768 Ga0501044_0673135 3300049823 Bacteria 922
769 nmdc:mga0yw44_21378_c1 3300050492 Bacteria 3608
770 nmdc:mga0yw44_62794_c1 3300050492 Bacteria 2282
771 nmdc:mga0yw44_773624_c1 3300050492 Bacteria 652
772 nmdc:mga0yw44_79317_c1 3300050492 Bacteria 2054
773 nmdc:mga06z11_190124_c1 3300050494 Bacteria 1188
774 nmdc:mga06z11_66690_c1 3300050494 Bacteria 1893
775 nmdc:mga06z11_739500_c1 3300050494 Bacteria 599
776 nmdc:mga04h51_32786_c1 3300050495 Bacteria 1649
777 nmdc:mga05p37_188592_c1 3300050507 Bacteria 2505
778 nmdc:mga05p37_647825_c1 3300050507 Bacteria 1183
779 nmdc:mga05p37_652336_c1 3300050507 Bacteria 1178
780 nmdc:mga09592_150370_c1 3300050508 Bacteria 2008
781 nmdc:mga09592_217499_c1 3300050508 Bacteria 1655
782 nmdc:mga09592_456676_c1 3300050508 Bacteria 1102
783 nmdc:mga0qj67_1198069_c1 3300050509 Bacteria 591
784 nmdc:mga06r32_1084294_c1 3300050510 Unclassified 750
785 nmdc:mga06r32_1326057_c1 3300050510 Unclassified 663
786 nmdc:mga06r32_199621_c1 3300050510 Bacteria 1988
787 nmdc:mga06r32_444104_c1 3300050510 Bacteria 1277
788 nmdc:mga08y16_193475_c1 3300050511 Bacteria 2109
789 nmdc:mga08y16_37367_c1 3300050511 Bacteria 5100
790 nmdc:mga08y16_80669_c1 3300050511 Bacteria 3392
791 nmdc:mga0n895_138188_c1 3300050512 Bacteria 2464
792 nmdc:mga0n895_246115_c1 3300050512 Bacteria 1815
793 nmdc:mga0n895_412322_c1 3300050512 Unclassified 1366
794 nmdc:mga0rr50_40351_c1 3300050513 Bacteria 3393
795 nmdc:mga08x19_259862_c1 3300050514 Bacteria 1200
796 nmdc:mga08x19_799657_c1 3300050514 Bacteria 670
797 nmdc:mga0a205_174724_c1 3300050515 Bacteria 2044
798 nmdc:mga0a205_658790_c1 3300050515 Unclassified 898
799 Ga0495601_0015050 3300053077 Bacteria 4671
800 Ga0495601_0053986 3300053077 Bacteria 2541
801 Ga0495601_0127203 3300053077 Unclassified 1658
802 Ga0495601_0729289 3300053077 Bacteria 631
803 Ga0495612_0040979 3300053078 Bacteria 1888
804 Ga0495612_0158383 3300053078 Unclassified 988
805 Ga0495612_0159712 3300053078 Unclassified 984
806 Ga0495655_0125121 3300053083 Unclassified 786
807 Ga0495595_0028759 3300053084 Bacteria 2484
808 Ga0495595_0028867 3300053084 Bacteria 2479
809 Ga0495595_0041543 3300053084 Bacteria 2104
810 Ga0495595_0105952 3300053084 Bacteria 1360
811 Ga0495595_0287743 3300053084 Unclassified 826
812 Ga0495595_0312585 3300053084 Bacteria 791
813 Ga0495619_0006374 3300053085 Bacteria 7476
814 Ga0495619_0018585 3300053085 Bacteria 4410
815 Ga0495619_0020300 3300053085 Unclassified 4230
816 Ga0495619_0026083 3300053085 Bacteria 3758
817 Ga0495619_0039105 3300053085 Bacteria 3096
818 Ga0495619_0100887 3300053085 Bacteria 1964
819 Ga0495619_0119810 3300053085 Bacteria 1804
820 Ga0495619_0245279 3300053085 Bacteria 1241
821 Ga0500646_0100896 3300053090 Bacteria 906
822 Ga0500595_037983 3300053119 Bacteria 1567
823 Ga0500614_047453 3300053123 Bacteria 1116
824 Ga0500636_0230338 3300053177 Bacteria 959
825 Ga0501084_0054919 3300054114 Unclassified 3332
826 Ga0501084_0147484 3300054114 Bacteria 1982
827 Ga0501084_0856466 3300054114 Unclassified 765
828 Ga0501082_0029742 3300060353 Bacteria 4706
829 Ga0501082_0049287 3300060353 Bacteria 3632
830 Ga0501082_0055210 3300060353 Bacteria 3422
831 Ga0501082_0263834 3300060353 Bacteria 1498
832 Ga0530510_0307797 3300061734 Unclassified 1186
833 Ga0530510_1042790 3300061734 Bacteria 626
834 Ga0395899_0021282
835 JGI24742J22300_10095685
836 rootH1_10061561
837 JGI25404J52841_10003048
838 Ga0070658_10100128
839 Ga0070658_10377474
840 Ga0070658_10536026
841 Ga0070670_100014533
842 Ga0070670_100168559
843 Ga0070670_101776014
844 Ga0068869_100588517
845 Ga0068869_101491642
846 Ga0070666_10266697
847 Ga0070680_100000532
848 Ga0070680_100014359
849 Ga0070680_100017152
850 Ga0070680_100020767
851 Ga0070680_100160707
852 Ga0070680_100242614
853 Ga0070680_100872646
854 Ga0070682_101450804
855 Ga0068868_100091031
856 Ga0068868_100285186
857 Ga0070660_100706299
858 Ga0070689_100110227
859 Ga0070691_10002110
860 Ga0070691_10062538
861 Ga0070691_10397687
862 Ga0070661_100563738
863 Ga0070669_100665495
864 Ga0070669_100968731
865 Ga0070669_100993732
866 Ga0070675_100029273
867 Ga0070675_100045254
868 Ga0070671_100198986
869 Ga0070671_100850983
870 Ga0070671_100997742
871 Ga0070674_100226208
872 Ga0070674_100538772
873 Ga0070674_100587061
874 Ga0070673_100286294
875 Ga0070673_100719972
876 Ga0070688_100208329
877 Ga0070667_100957747
878 Ga0070703_10183005
879 Ga0070709_10121933
880 Ga0070709_10187558
881 Ga0070709_10468587
882 Ga0070709_11032296
883 Ga0070714_100228591
884 Ga0070714_100676094
885 Ga0070713_100007857
886 Ga0070713_100228786
887 Ga0070713_100678838
888 Ga0070713_100870209
889 Ga0070713_101703045
890 Ga0070710_10015505
891 Ga0070710_10122263
892 Ga0070710_10476080
893 Ga0070710_10825724
894 Ga0070701_10124105
895 Ga0070711_100089546
896 Ga0070711_100439584
897 Ga0070700_100233024
898 Ga0070700_100244875
899 Ga0070700_101194406
900 Ga0070694_100876857
901 Ga0070708_100205704
902 Ga0070663_100156117
903 Ga0070663_100882224
904 Ga0070678_100011639
905 Ga0070678_100854028
906 Ga0070662_101182524
907 Ga0070681_10001471
908 Ga0070681_10001868
909 Ga0070681_10039836
910 Ga0070681_10128482
911 Ga0070681_10175776
912 Ga0070681_10244293
913 Ga0070681_11244242
914 Ga0070685_10030546
915 Ga0070698_100189732
916 Ga0070698_100687673
917 Ga0070699_100004042
918 Ga0070699_100197651
919 Ga0070679_100005709
920 Ga0070679_100022471
921 Ga0070679_100060758
922 Ga0070679_100062165
923 Ga0070679_100116665
924 Ga0070679_100163240
925 Ga0070679_100573260
926 Ga0070679_101314173
927 Ga0070679_101578407
928 Ga0070684_100218023
929 Ga0070684_100493541
930 Ga0070684_100517396
931 Ga0070697_100086086
932 Ga0070696_100683759
933 Ga0070693_100037524
934 Ga0070693_100058118
935 Ga0070665_100643538
936 Ga0068855_100031168
937 Ga0068855_100425065
938 Ga0068855_100617644
939 Ga0070664_100253593
940 Ga0070664_100912970
941 Ga0068857_100214533
942 Ga0068857_100493149
943 Ga0068854_100397257
944 Ga0068854_100885233
945 Ga0068856_100064801
946 Ga0068856_100442108
947 Ga0070702_100246058
948 Ga0070702_100276003
949 Ga0068852_100039541
950 Ga0068852_100133712
951 Ga0068859_100498756
952 Ga0068864_100062130
953 Ga0068866_10355943
954 Ga0068861_100781231
955 Ga0068861_100944605
956 Ga0068861_100987504
957 Ga0068851_10177725
958 Ga0068851_10248012
959 Ga0068863_100064913
960 Ga0068858_100485880
961 Ga0068858_100768551
962 Ga0068860_100315563
963 Ga0068860_100686055
964 Ga0068862_100530381
965 Ga0068862_100577174
966 Ga0068862_101450777
967 Ga0081455_10004063
968 Ga0081455_10006691
969 Ga0081455_10188604
970 Ga0081455_10699478
971 Ga0081538_10013890
972 Ga0081538_10104212
973 Ga0081538_10216687
974 Ga0081540_1000068
975 Ga0081540_1007636
976 Ga0081540_1049542
977 Ga0081540_1092555
978 Ga0070717_10226629
979 Ga0070717_10286756
980 Ga0070717_10572477
981 Ga0070717_10859629
982 Ga0075365_10015218
983 Ga0075365_10018821
984 Ga0075365_10302639
985 Ga0075363_100048975
986 Ga0075363_100117284
987 Ga0075364_10413454
988 Ga0070715_10102597
989 Ga0070715_10177680
990 Ga0070716_101794603
991 Ga0070712_100174383
992 Ga0070712_100238937
993 Ga0070712_100820646
994 Ga0070712_101354732
995 Ga0075362_10521090
996 Ga0075366_10482154
997 Ga0097621_100051940
998 Ga0097621_100094989
999 Ga0068871_101095445
1000 Ga0075428_100094169
1001 Ga0075428_100168066
1002 Ga0075428_100178024
1003 Ga0075428_100289922
1004 Ga0075428_101010683
1005 Ga0075428_102054257
1006 Ga0075430_100031870
1007 Ga0075430_100667622
1008 Ga0075431_100053442
1009 Ga0075431_100268002
1010 Ga0075431_100269032
1011 Ga0075433_10230811
1012 Ga0075433_10919858
1013 Ga0075434_100040273
1014 Ga0075429_100254854
1015 Ga0075429_100424157
1016 Ga0075429_100628377
1017 Ga0068865_100322438
1018 Ga0068865_100331929
1019 Ga0068865_100895085
1020 Ga0075436_100017742
1021 Ga0075436_100619313
1022 Ga0097620_100498714
1023 Ga0075435_100572691
1024 Ga0099794_10048661
1025 Ga0099795_10015498
1026 Ga0099795_10288849
1027 Ga0099795_10445570
1028 Ga0105240_10003482
1029 Ga0105240_10029418
1030 Ga0105240_10185602
1031 Ga0105240_10643314
1032 Ga0105240_11097916
1033 Ga0111539_10018297
1034 Ga0111539_10041142
1035 Ga0111539_10473801
1036 Ga0111539_10824096
1037 Ga0111539_11470483
1038 Ga0111539_12542096
1039 Ga0105245_10007194
1040 Ga0105245_10245251
1041 Ga0105247_10316839
1042 Ga0114129_10014687
1043 Ga0114129_10483879
1044 Ga0114129_11729769
1045 Ga0105243_10938370
1046 Ga0105243_10994120
1047 Ga0105243_11448815
1048 Ga0105241_10412811
1049 Ga0105241_10523306
1050 Ga0105242_11677675
1051 Ga0105248_10027688
1052 Ga0105248_10218075
1053 Ga0105248_11668763
1054 Ga0105237_10828155
1055 Ga0105238_10011409
1056 Ga0105238_10132631
1057 Ga0105238_10637521
1058 Ga0105249_10538486
1059 Ga0099796_10017549
1060 Ga0105239_11376848
1061 Ga0105239_12666317
1062 Ga0105246_10453684
1063 Ga0157347_1016424
1064 Ga0157373_10068119
1065 Ga0157373_10072811
1066 Ga0157373_10075187
1067 Ga0157371_10162056
1068 Ga0157371_10164667
1069 Ga0157370_10002489
1070 Ga0157370_10045586
1071 Ga0157370_10103934
1072 Ga0157370_10937366
1073 Ga0157369_10364362
1074 Ga0157369_10511848
1075 Ga0157369_11472327
1076 Ga0157374_10106839
1077 Ga0157374_10592351
1078 Ga0157378_10200316
1079 Ga0157378_10822153
1080 Ga0157378_11387785
1081 Ga0163162_10077112
1082 Ga0163162_10088372
1083 Ga0163162_10968260
1084 Ga0163162_11246561
1085 Ga0157372_10082809
1086 Ga0157372_10371677
1087 Ga0157372_10941723
1088 Ga0157372_11539135
1089 Ga0157375_10063653
1090 Ga0157375_11822674
1091 Ga0163163_10113546
1092 Ga0163163_10437559
1093 Ga0157380_11292428
1094 Ga0182008_10581622
1095 Ga0157377_10208472
1096 Ga0157379_10650681
1097 Ga0157379_10720888
1098 Ga0157379_10889064
1099 Ga0157376_10029373
1100 Ga0157376_10662024
1101 Ga0157376_11651397
1102 Ga0163161_10761170
1103 Ga0163161_11026704
1104 Ga0163161_11513349
1105 Ga0213876_10051631
1106 Ga0213876_10190909
1107 Ga0213876_10240472
1108 Ga0207656_10056127
1109 Ga0207692_10123246
1110 Ga0207692_10348740
1111 Ga0207692_10352079
1112 Ga0207692_10490495
1113 Ga0207642_10017305
1114 Ga0207642_10091233
1115 Ga0207710_10227364
1116 Ga0207710_10382594
1117 Ga0207688_10114003
1118 Ga0207680_10338459
1119 Ga0207699_10383479
1120 Ga0207699_10813606
1121 Ga0207645_10079675
1122 Ga0207645_10691055
1123 Ga0207705_10023664
1124 Ga0207705_10033896
1125 Ga0207705_10165287
1126 Ga0207705_10532328
1127 Ga0207684_10794851
1128 Ga0207707_10012084
1129 Ga0207707_10015854
1130 Ga0207707_10024122
1131 Ga0207707_10041100
1132 Ga0207695_10120980
1133 Ga0207695_10906826
1134 Ga0207693_10010728
1135 Ga0207693_10100071
1136 Ga0207693_10180388
1137 Ga0207693_10183157
1138 Ga0207693_10276185
1139 Ga0207663_10037278
1140 Ga0207663_10355080
1141 Ga0207663_10460575
1142 Ga0207663_10623122
1143 Ga0207663_10780830
1144 Ga0207660_10003904
1145 Ga0207660_10036831
1146 Ga0207660_10431128
1147 Ga0207660_10755667
1148 Ga0207662_10008714
1149 Ga0207662_10055613
1150 Ga0207657_10028544
1151 Ga0207657_10618087
1152 Ga0207652_10006133
1153 Ga0207652_10018723
1154 Ga0207652_10083338
1155 Ga0207652_10370980
1156 Ga0207652_10392550
1157 Ga0207652_11040336
1158 Ga0207652_11271331
1159 Ga0207681_11199316
1160 Ga0207694_10089709
1161 Ga0207694_10315496
1162 Ga0207694_10454387
1163 Ga0207650_10026548
1164 Ga0207659_10393114
1165 Ga0207687_10050158
1166 Ga0207687_10100493
1167 Ga0207700_11219003
1168 Ga0207700_11243491
1169 Ga0207664_10129974
1170 Ga0207690_10065141
1171 Ga0207706_10012271
1172 Ga0207706_10869276
1173 Ga0207709_10020359
1174 Ga0207670_10038888
1175 Ga0207669_10171999
1176 Ga0207669_10390901
1177 Ga0207669_10529717
1178 Ga0207704_10670083
1179 Ga0207704_11317725
1180 Ga0207665_11384929
1181 Ga0207691_10043196
1182 Ga0207691_10536759
1183 Ga0207711_10256644
1184 Ga0207689_10009474
1185 Ga0207689_10635508
1186 Ga0207689_10647442
1187 Ga0207689_11363723
1188 Ga0207661_10490055
1189 Ga0207667_10297011
1190 Ga0207667_10318718
1191 Ga0207651_10168920
1192 Ga0207651_10504497
1193 Ga0207651_10868824
1194 Ga0207712_10250670
1195 Ga0207668_10133548
1196 Ga0207640_10296798
1197 Ga0207677_10021380
1198 Ga0207677_10115874
1199 Ga0207677_10198682
1200 Ga0207703_10019096
1201 Ga0207703_10638620
1202 Ga0207639_10085909
1203 Ga0207639_10416622
1204 Ga0207639_10680914
1205 Ga0207678_10078006
1206 Ga0207678_10190387
1207 Ga0207708_10021260
1208 Ga0207708_10351050
1209 Ga0207702_10064258
1210 Ga0207702_10077085
1211 Ga0207702_10180680
1212 Ga0207702_11103310
1213 Ga0207641_10377318
1214 Ga0207648_10373803
1215 Ga0207648_10555775
1216 Ga0207676_10016006
1217 Ga0207676_10178089
1218 Ga0207676_10434509
1219 Ga0207674_10067339
1220 Ga0207674_10095871
1221 Ga0207674_10754095
1222 Ga0207674_11711839
1223 Ga0207675_100605076
1224 Ga0207683_10045559
1225 Ga0207683_10348475
1226 Ga0207683_12101514
1227 Ga0207698_10040697
1228 Ga0207698_10166548
1229 Ga0207698_10360751
1230 Ga0207698_11649120
1231 Ga0207428_10176070
1232 Ga0268266_10492635
1233 Ga0268266_10885560
1234 Ga0268265_10285823
1235 Ga0268265_10919325
1236 Ga0268264_10519945
1237 Ga0265338_10044761
1238 Ga0265338_10178817
1239 Ga0265338_10367886
1240 Ga0265332_10002624
1241 Ga0265332_10184891
1242 Ga0265328_10276597
1243 Ga0265325_10000093
1244 Ga0265325_10011946
1245 Ga0265325_10040411
1246 Ga0265325_10052422
1247 Ga0265325_10082024
1248 Ga0265340_10001806
1249 Ga0265340_10046308
1250 Ga0265339_10037937
1251 Ga0265331_10015974
1252 Ga0265316_10342677
1253 Ga0307513_10341113
1254 Ga0307513_10451896
1255 Ga0265313_10004184
1256 Ga0265313_10004593
1257 Ga0265313_10017649
1258 Ga0265313_10062905
1259 Ga0265313_10289248
1260 Ga0265313_10331107
1261 Ga0316575_10138170
1262 Ga0265314_10009933
1263 Ga0265314_10204412
1264 Ga0265314_10321225
1265 Ga0265342_10000011
1266 Ga0265342_10004077
1267 Ga0265342_10005903
1268 Ga0307405_10772364
1269 Ga0307405_11662638
1270 Ga0307407_10154549
1271 Ga0307412_10535371
1272 Ga0307409_100037395
1273 Ga0307416_102849148
1274 Ga0307414_11591800
1275 Ga0316583_10006570
1276 Ga0316583_10051647
1277 Ga0373930_0008949
1278 Ga0373930_0120618
1279 Ga0373926_0061157
1280 Ga0373929_0008642
1281 Ga0373929_0033797
1282 Ga0373934_0015879
1283 Ga0373944_0013671
1284 Ga0373949_0156178
1285 Ga0373923_0126914
1286 Ga0373936_0053390
1287 Ga0373936_0106597
1288 Ga0373939_0271639
1289 Ga0373941_0123492
1290 Ga0373945_0009911
1291 Ga0373945_0043030
1292 Ga0373953_0048401
1293 Ga0373953_0075832
1294 Ga0373954_0017797
1295 Ga0373956_0313432
1296 Ga0373957_0231902
1297 Ga0373960_0054927
1298 Ga0373943_0069495
1299 Ga0373943_0147143
1300 Ga0373943_0196088
1301 Ga0373946_0025694
1302 Ga0373955_0005085
1303 Ga0373942_0003214
1304 Ga0373961_0094364
1305 Ga0373924_0102896
1306 Ga0373935_0076414
1307 Ga0373935_0097912
1308 Ga0373935_0392411
1309 Ga0373927_0008790
1310 Ga0373927_0129613
1311 Ga0373927_0148091
1312 Ga0373933_0005755
1313 Ga0373933_0062054
1314 Ga0373947_0058919
1315 Ga0373947_0130567
1316 Ga0373947_0479990
1317 Ga0373937_0009762
1318 Ga0373937_0012997
1319 Ga0373937_0029122
1320 Ga0373937_0603033
1321 Ga0373937_1891769
1322 Ga0373925_0098549
1323 Ga0373925_0228222
1324 Ga0373925_1445184
1325 Ga0395900_0003409
1326 Ga0395900_0031012
1327 Ga0395900_0084690
1328 Ga0395898_0004890
1329 Ga0395898_0043106
1330 Ga0395898_0089749
1331 Ga0395898_0455564
1332 Ga0436364_0135547
1333 Ga0436364_1278643
1334 Ga0395901_0066218
1335 Ga0395901_0083425
1336 Ga0395901_0355132
1337 Ga0395901_0612153
1338 Ga0436365_0080885
1339 Ga0436365_0228691
1340 Ga0436365_0258563
1341 Ga0436365_0364923
1342 Ga0436365_0420225
1343 Ga0436365_1935734
1344 Ga0436360_0029211
1345 Ga0436360_0286970
1346 Ga0436360_0395899
1347 Ga0436360_0524608
1348 Ga0436360_0807994
1349 Ga0436360_0817002
1350 Ga0436360_1056072
1351 Ga0436360_1083614
1352 Ga0436360_1174518
1353 Ga0436361_1033080
1354 Ga0436361_1127209
1355 Ga0436363_0232716
1356 Ga0436363_0843885
1357 Ga0439441_074850
1358 Ga0466961_0296685
1359 Ga0466963_0054091
1360 Ga0466971_0242908
1361 Ga0466970_0654927
1362 Ga0466957_0264843
1363 Ga0466957_0365656
1364 Ga0466957_0626902
1365 Ga0466957_0877865
1366 Ga0466959_0974282
1367 Ga0466958_0217546
1368 Ga0466958_0447679
1369 Ga0466967_0183152
1370 Ga0466967_1122116
1371 Ga0495592_0105995
1372 Ga0495592_0107693
1373 Ga0495592_0814260
1374 Ga0495603_0247896
1375 Ga0495590_0031250
1376 Ga0495629_0229183
1377 Ga0495629_0428416
1378 Ga0495641_0075635
1379 Ga0495651_0080248
1380 Ga0495651_0543680
1381 Ga0495580_0002052
1382 Ga0495580_0088606
1383 Ga0495580_0170521
1384 Ga0495580_0198559
1385 Ga0495580_0251880
1386 Ga0495580_0617517
1387 Ga0495582_0063249
1388 Ga0495605_0109056
1389 Ga0495639_0018096
1390 Ga0495662_0120502
1391 Ga0495662_0306238
1392 Ga0495664_0338073
1393 Ga0495607_0546456
1394 Ga0495616_0055684
1395 Ga0495618_0164167
1396 Ga0495628_0013920
1397 Ga0495628_0257822
1398 Ga0495628_0260740
1399 Ga0495630_0455814
1400 Ga0495630_0993111
1401 Ga0495631_0055914
1402 Ga0495663_0030132
1403 Ga0495666_0095955
1404 Ga0495666_0385872
1405 Ga0495642_0069433
1406 Ga0495652_0024293
1407 Ga0495652_0095258
1408 Ga0495652_0353649
1409 Ga0495652_0368303
1410 Ga0495665_0151730
1411 Ga0495640_0028513
1412 Ga0495640_0250719
1413 Ga0495640_0458136
1414 Ga0495587_0093933
1415 Ga0495587_0537436
1416 Ga0495598_0005428
1417 Ga0495645_0014092
1418 Ga0495645_0224988
1419 Ga0495645_0264898
1420 Ga0495622_0081231
1421 Ga0495622_0128223
1422 Ga0495667_0176170
1423 Ga0495656_0086454
1424 Ga0495656_0219427
1425 Ga0495634_0161902
1426 Ga0495634_0305443
1427 Ga0495661_0055265
1428 Ga0495657_0187588
1429 Ga0495599_0018786
1430 Ga0495599_0181294
1431 Ga0495599_0608386
1432 Ga0495623_0014531
1433 Ga0495646_0142463
1434 Ga0495658_0460051
1435 Ga0495613_0130213
1436 Ga0495624_0024582
1437 Ga0495670_0009666
1438 Ga0495589_0166784
1439 Ga0495600_0031905
1440 Ga0495581_0727573
1441 Ga0495604_0097542
1442 Ga0495604_0469178
1443 Ga0495636_0238230
1444 Ga0495674_0112575
1445 Ga0495676_0030885
1446 Ga0495676_0069725
1447 Ga0495680_0136860
1448 Ga0495675_0346195
1449 Ga0495684_0214979
1450 Ga0495684_0355385
1451 Ga0495602_0022774
1452 Ga0495602_0078864
1453 Ga0495602_0570332
1454 Ga0495602_0580665
1455 Ga0495614_0234874
1456 Ga0495626_0195197
1457 Ga0495626_0202287
1458 Ga0496100_0058018
1459 Ga0496100_0121832
1460 Ga0496101_0040026
1461 Ga0496101_0817180
1462 Ga0496102_0107728
1463 Ga0496102_0154698
1464 Ga0496102_0165540
1465 Ga0496102_0318350
1466 Ga0496103_0024104
1467 Ga0496104_0002917
1468 Ga0496104_0003793
1469 Ga0496104_0182634
1470 Ga0496104_0273892
1471 Ga0496104_0655619
1472 Ga0496104_0888082
1473 Ga0496105_0000307
1474 Ga0496105_0000442
1475 Ga0496105_0025142
1476 Ga0496105_0093240
1477 Ga0496105_0225748
1478 Ga0496105_0622772
1479 Ga0496105_0768748
1480 Ga0496106_0024744
1481 Ga0496106_0058240
1482 Ga0496106_0130881
1483 Ga0496106_0319362
1484 Ga0496106_0679505
1485 Ga0496107_0185615
1486 Ga0496107_0446140
1487 Ga0496108_0004617
1488 Ga0496108_0132920
1489 Ga0496108_0219069
1490 Ga0496108_0271821
1491 Ga0496108_0585117
1492 Ga0496108_0655205
1493 Ga0496108_0670545
1494 Ga0496109_0001446
1495 Ga0496109_0179658
1496 Ga0496109_0208069
1497 Ga0496109_0822456
1498 Ga0496109_1427953
1499 Ga0496110_0039351
1500 Ga0496110_0078831
1501 Ga0496110_0289759
1502 Ga0496110_0501053
1503 Ga0496111_0062707
1504 Ga0496111_0096031
1505 Ga0496111_0703115
1506 Ga0496112_0067724
1507 Ga0496112_0079771
1508 Ga0496112_0181360
1509 Ga0496112_0184245
1510 Ga0496112_0198553
1511 Ga0496112_0265622
1512 Ga0496112_0356957
1513 Ga0496112_0431644
1514 Ga0496112_0535694
1515 Ga0496112_0755304
1516 Ga0496112_0930999
1517 Ga0496112_1081388
1518 Ga0496113_0002540
1519 Ga0496113_0081568
1520 Ga0496113_0466533
1521 Ga0496113_0557903
1522 Ga0496114_0143543
1523 Ga0496114_0650587
1524 Ga0496114_0818496
1525 Ga0496115_0073476
1526 Ga0496115_0116080
1527 Ga0496115_0197017
1528 Ga0496115_0317768
1529 Ga0496115_0320591
1530 Ga0501032_0045249
1531 Ga0501032_0144370
1532 Ga0501032_0684432
1533 Ga0501033_0093201
1534 Ga0501033_0216723
1535 Ga0501033_0239058
1536 Ga0501034_0010927
1537 Ga0501034_0020219
1538 Ga0501034_0023518
1539 Ga0501034_0330033
1540 Ga0501036_0062714
1541 Ga0501036_0071626
1542 Ga0501037_0026512
1543 Ga0501037_0173483
1544 Ga0501037_0174170
1545 Ga0501037_0414913
1546 Ga0501038_0030603
1547 Ga0501038_0110450
1548 Ga0501038_0748504
1549 Ga0501039_0043435
1550 Ga0501039_0289423
1551 Ga0501039_0669656
1552 Ga0501040_0352693
1553 Ga0501041_0130310
1554 Ga0501043_0103366
1555 Ga0501047_0033645
1556 Ga0501047_0153604
1557 Ga0501047_0154886
1558 Ga0501047_0224194
1559 Ga0501048_0772571
1560 Ga0501069_0287542
1561 Ga0501069_0758402
1562 Ga0501070_0027648
1563 Ga0501070_0035656
1564 Ga0501070_0216997
1565 Ga0501070_0229734
1566 Ga0501070_0490989
1567 Ga0501071_0020074
1568 Ga0501071_0100679
1569 Ga0501071_1074199
1570 Ga0501072_0669156
1571 Ga0501072_0689403
1572 Ga0501072_1197779
1573 Ga0501072_1608839
1574 Ga0501073_0068822
1575 Ga0501075_0012425
1576 Ga0501075_0176758
1577 Ga0501075_0297182
1578 Ga0501077_0046931
1579 Ga0501077_0063279
1580 Ga0501077_0311352
1581 Ga0501077_0340402
1582 Ga0501079_0032746
1583 Ga0501079_0684904
1584 Ga0501080_0065875
1585 Ga0501080_0087739
1586 Ga0501080_0562616
1587 Ga0501081_0007046
1588 Ga0501081_0672099
1589 Ga0501083_0023402
1590 Ga0501083_0754277
1591 Ga0501035_0062179
1592 Ga0501035_0163950
1593 Ga0501035_0466592
1594 Ga0501035_0641369
1595 Ga0501044_0000674
1596 Ga0501044_0087153
1597 Ga0501044_0115448
1598 Ga0501044_0168198
1599 Ga0501044_0183276
1600 Ga0501044_0326455
1601 Ga0501044_0673135
1602 nmdc:mga0yw44_21378_c1
1603 nmdc:mga0yw44_62794_c1
1604 nmdc:mga0yw44_773624_c1
1605 nmdc:mga0yw44_79317_c1
1606 nmdc:mga06z11_190124_c1
1607 nmdc:mga06z11_66690_c1
1608 nmdc:mga06z11_739500_c1
1609 nmdc:mga04h51_32786_c1
1610 nmdc:mga05p37_188592_c1
1611 nmdc:mga05p37_647825_c1
1612 nmdc:mga05p37_652336_c1
1613 nmdc:mga09592_150370_c1
1614 nmdc:mga09592_217499_c1
1615 nmdc:mga09592_456676_c1
1616 nmdc:mga0qj67_1198069_c1
1617 nmdc:mga06r32_1084294_c1
1618 nmdc:mga06r32_1326057_c1
1619 nmdc:mga06r32_199621_c1
1620 nmdc:mga06r32_444104_c1
1621 nmdc:mga08y16_193475_c1
1622 nmdc:mga08y16_37367_c1
1623 nmdc:mga08y16_80669_c1
1624 nmdc:mga0n895_138188_c1
1625 nmdc:mga0n895_246115_c1
1626 nmdc:mga0n895_412322_c1
1627 nmdc:mga0rr50_40351_c1
1628 nmdc:mga08x19_259862_c1
1629 nmdc:mga08x19_799657_c1
1630 nmdc:mga0a205_174724_c1
1631 nmdc:mga0a205_658790_c1
1632 Ga0495601_0015050
1633 Ga0495601_0053986
1634 Ga0495601_0127203
1635 Ga0495601_0729289
1636 Ga0495612_0040979
1637 Ga0495612_0158383
1638 Ga0495612_0159712
1639 Ga0495655_0125121
1640 Ga0495595_0028759
1641 Ga0495595_0028867
1642 Ga0495595_0041543
1643 Ga0495595_0105952
1644 Ga0495595_0287743
1645 Ga0495595_0312585
1646 Ga0495619_0006374
1647 Ga0495619_0018585
1648 Ga0495619_0020300
1649 Ga0495619_0026083
1650 Ga0495619_0039105
1651 Ga0495619_0100887
1652 Ga0495619_0119810
1653 Ga0495619_0245279
1654 Ga0500646_0100896
1655 Ga0500595_037983
1656 Ga0500614_047453
1657 Ga0500636_0230338
1658 Ga0501084_0054919
1659 Ga0501084_0147484
1660 Ga0501084_0856466
1661 Ga0501082_0029742
1662 Ga0501082_0049287
1663 Ga0501082_0055210
1664 Ga0501082_0263834
1665 Ga0530510_0307797
1666 Ga0530510_1042790

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

100

169

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3es1-assembly1.cif.gz_A-2 crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution 0.8944 4 156
7zvy-assembly4.cif.gz_H thermococcus kadokarensis phosphomannose isomerase 0.864 28 143
2d40-assembly1.cif.gz_A crystal structure of z3393 from escherichia coli o157:h7 0.8596 70 143
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.8585 70 145
3es1-assembly1.cif.gz_A-2 crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution 0.8575 4 156
ID Description Score Start End Superfamily
3es1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8989 34 156 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8728 70 143 2.60.120.10
3es1A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8718 34 156 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8713 70 143 2.60.120.10
4e4hC01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8551 70 143 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A2V8DA14-F1-model_v4 Cupin domain-containing protein 0.9853 3 159
AF-A0A345ZQL0-F1-model_v4 Cupin domain-containing protein 0.984 4 159
AF-A0A2V8DA14-F1-model_v4 Cupin domain-containing protein 0.9792 3 159
AF-A0A2V6XK96-F1-model_v4 Cupin domain-containing protein 0.9744 1 128
AF-A0A2V6TWW3-F1-model_v4 Cupin domain-containing protein 0.9742 22 159

Map