F482712
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 832 | 395 | 826 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100604010|Ga0070665_1006040101 |
| Length | 310 |
| Sequence | LTITQTTPPQATSADKEASKSAFKRTLTRAYALLPEKMRRRTPVVAVLPLSGAIGAASRFGGGLSMSRLEKVIDSAFAVKGVKAVALVINSPGGSPAQSHLIMRRIRALSAEKKVPVFAFVEDVAASGGYMIACAADEIIADPASILGSIGVVSASFGFDKLIEKIGVERRVHTAGRSKTMLDPFSPEKPEDIERLATLQREIHDMFIALVKERREGKLKADDDTLFTGEFWLAPRAIELGLADGIGDIRSVMRQRFGEKVRFRTVSESRGFLSRRLGFGTGFSAADSEQLTEGILFALEGRAIRARFGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 3 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 4 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 5 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 6 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 7 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 8 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 10 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 12 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 13 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 134 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 220 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 236 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 239 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 241 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 254 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 256 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 275 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 390 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.08 |
| Nodule | 0.12 |
| Rhizoplane | 6.25 |
| Rhizosphere | 92.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745202 | 2209111006 | Bacteria | 16175 |
| 2 | ARcpr5oldR_c000031 | 3300000041 | Bacteria | 28603 |
| 3 | ARcpr5oldR_c006817 | 3300000041 | Bacteria | 973 |
| 4 | ARSoilYngRDRAFT_c00086 | 3300000042 | Bacteria | 15520 |
| 5 | ARcpr5yngRDRAFT_c000084 | 3300000043 | Bacteria | 15520 |
| 6 | ARSoilOldRDRAFT_c000050 | 3300000044 | Bacteria | 25074 |
| 7 | ARCol0oldRDRAFT_c00024 | 3300000045 | Bacteria | 11391 |
| 8 | ARCol0yngRDRAFT_1000023 | 3300000652 | Bacteria | 28722 |
| 9 | JGI24736J21556_1015770 | 3300001904 | Bacteria | 1208 |
| 10 | JGI24747J21853_1000375 | 3300001978 | Bacteria | 2649 |
| 11 | JGI24739J22299_10005003 | 3300001989 | Bacteria | 5045 |
| 12 | JGI24737J22298_10006384 | 3300001990 | Bacteria | 4028 |
| 13 | JGI24750J21931_1007838 | 3300002070 | Bacteria | 1349 |
| 14 | JGI24745J21846_1001867 | 3300002073 | Bacteria | 2090 |
| 15 | JGI24748J21848_1006144 | 3300002074 | Bacteria | 1398 |
| 16 | JGI24749J21850_1009858 | 3300002076 | Bacteria | 1335 |
| 17 | JGI24744J21845_10002596 | 3300002077 | Bacteria | 3689 |
| 18 | JGI24033J26618_1003037 | 3300002155 | Bacteria | 1751 |
| 19 | JGI24034J26672_10000829 | 3300002239 | Bacteria | 4013 |
| 20 | JGI24742J22300_10015325 | 3300002244 | Bacteria | 1289 |
| 21 | JGI25406J46586_10000594 | 3300003203 | Bacteria | 17054 |
| 22 | Ga0065712_10003536 | 3300005290 | Bacteria | 4967 |
| 23 | Ga0065715_10000519 | 3300005293 | Bacteria | 20489 |
| 24 | Ga0065715_10005464 | 3300005293 | Bacteria | 7340 |
| 25 | Ga0065707_10116342 | 3300005295 | Bacteria | 2240 |
| 26 | Ga0070658_10018141 | 3300005327 | Bacteria | 5631 |
| 27 | Ga0070658_10151721 | 3300005327 | Bacteria | 1940 |
| 28 | Ga0070676_10168784 | 3300005328 | Bacteria | 1414 |
| 29 | Ga0070683_100008697 | 3300005329 | Bacteria | 8634 |
| 30 | Ga0070690_100008145 | 3300005330 | Bacteria | 6024 |
| 31 | Ga0070690_100010289 | 3300005330 | Bacteria | 5440 |
| 32 | Ga0070690_100058971 | 3300005330 | Bacteria | 2467 |
| 33 | Ga0070690_100062482 | 3300005330 | Bacteria | 2401 |
| 34 | Ga0070670_100072895 | 3300005331 | Bacteria | 2949 |
| 35 | Ga0070677_10009111 | 3300005333 | Bacteria | 3361 |
| 36 | Ga0068869_100030072 | 3300005334 | Bacteria | 3809 |
| 37 | Ga0068869_100036646 | 3300005334 | Bacteria | 3483 |
| 38 | Ga0068869_100533468 | 3300005334 | Bacteria | 984 |
| 39 | Ga0070666_10006379 | 3300005335 | Bacteria | 7253 |
| 40 | Ga0070680_100003646 | 3300005336 | Bacteria | 11504 |
| 41 | Ga0070680_100010386 | 3300005336 | Bacteria | 7177 |
| 42 | Ga0070680_100058840 | 3300005336 | Bacteria | 3143 |
| 43 | Ga0070680_100131222 | 3300005336 | Bacteria | 2096 |
| 44 | Ga0070680_100162863 | 3300005336 | Bacteria | 1875 |
| 45 | Ga0070680_100481503 | 3300005336 | Bacteria | 1061 |
| 46 | Ga0070682_100006855 | 3300005337 | Bacteria | 6397 |
| 47 | Ga0070682_100014492 | 3300005337 | Bacteria | 4558 |
| 48 | Ga0070682_100104030 | 3300005337 | Unclassified | 1880 |
| 49 | Ga0068868_100001527 | 3300005338 | Bacteria | 15860 |
| 50 | Ga0068868_100134550 | 3300005338 | Unclassified | 2025 |
| 51 | Ga0068868_100215125 | 3300005338 | Bacteria | 1607 |
| 52 | Ga0070660_100007921 | 3300005339 | Bacteria | 7413 |
| 53 | Ga0070660_100044535 | 3300005339 | Bacteria | 3395 |
| 54 | Ga0070660_100102330 | 3300005339 | Bacteria | 2271 |
| 55 | Ga0070660_100224086 | 3300005339 | Bacteria | 1529 |
| 56 | Ga0070689_100000423 | 3300005340 | Bacteria | 24943 |
| 57 | Ga0070689_100030326 | 3300005340 | Bacteria | 4104 |
| 58 | Ga0070691_10030986 | 3300005341 | Bacteria | 2507 |
| 59 | Ga0070691_10131904 | 3300005341 | Bacteria | 1267 |
| 60 | Ga0070687_100010609 | 3300005343 | Bacteria | 3994 |
| 61 | Ga0070687_100020102 | 3300005343 | Bacteria | 3117 |
| 62 | Ga0070661_100001619 | 3300005344 | Bacteria | 15572 |
| 63 | Ga0070661_100027189 | 3300005344 | Bacteria | 4118 |
| 64 | Ga0070692_10007636 | 3300005345 | Bacteria | 4776 |
| 65 | Ga0070692_10018028 | 3300005345 | Bacteria | 3388 |
| 66 | Ga0070668_100042277 | 3300005347 | Bacteria | 3493 |
| 67 | Ga0070669_100001139 | 3300005353 | Bacteria | 19432 |
| 68 | Ga0070669_100033495 | 3300005353 | Bacteria | 3716 |
| 69 | Ga0070669_100244144 | 3300005353 | Bacteria | 1428 |
| 70 | Ga0070675_100043846 | 3300005354 | Bacteria | 3658 |
| 71 | Ga0070675_100169371 | 3300005354 | Bacteria | 1883 |
| 72 | Ga0070671_100000920 | 3300005355 | Bacteria | 21484 |
| 73 | Ga0070671_100020437 | 3300005355 | Bacteria | 5400 |
| 74 | Ga0070674_100013074 | 3300005356 | Bacteria | 5119 |
| 75 | Ga0070674_100083620 | 3300005356 | Bacteria | 2287 |
| 76 | Ga0070674_100215906 | 3300005356 | Unclassified | 1489 |
| 77 | Ga0070673_100023791 | 3300005364 | Bacteria | 4480 |
| 78 | Ga0070673_100047093 | 3300005364 | Bacteria | 3353 |
| 79 | Ga0070688_100014995 | 3300005365 | Bacteria | 4399 |
| 80 | Ga0070688_100042662 | 3300005365 | Bacteria | 2791 |
| 81 | Ga0070659_100015775 | 3300005366 | Bacteria | 5662 |
| 82 | Ga0070667_100014147 | 3300005367 | Bacteria | 6591 |
| 83 | Ga0070667_100158272 | 3300005367 | Unclassified | 1993 |
| 84 | Ga0070703_10028946 | 3300005406 | Bacteria | 1659 |
| 85 | Ga0070709_10032744 | 3300005434 | Bacteria | 3137 |
| 86 | Ga0070709_10065828 | 3300005434 | Unclassified | 2322 |
| 87 | Ga0070709_10089090 | 3300005434 | Bacteria | 2031 |
| 88 | Ga0070709_10178384 | 3300005434 | Bacteria | 1490 |
| 89 | Ga0070714_100018806 | 3300005435 | Bacteria | 5619 |
| 90 | Ga0070714_100144480 | 3300005435 | Bacteria | 2139 |
| 91 | Ga0070714_100147728 | 3300005435 | Bacteria | 2115 |
| 92 | Ga0070713_100001192 | 3300005436 | Bacteria | 16609 |
| 93 | Ga0070701_10000614 | 3300005438 | Bacteria | 12496 |
| 94 | Ga0070701_10031372 | 3300005438 | Bacteria | 2636 |
| 95 | Ga0070701_10210556 | 3300005438 | Bacteria | 1154 |
| 96 | Ga0070711_100006635 | 3300005439 | Bacteria | 6994 |
| 97 | Ga0070711_100064343 | 3300005439 | Bacteria | 2562 |
| 98 | Ga0070711_100071103 | 3300005439 | Bacteria | 2451 |
| 99 | Ga0070705_100028362 | 3300005440 | Bacteria | 3066 |
| 100 | Ga0070700_100027576 | 3300005441 | Bacteria | 3368 |
| 101 | Ga0070700_100259116 | 3300005441 | Bacteria | 1251 |
| 102 | Ga0070694_100003931 | 3300005444 | Bacteria | 8892 |
| 103 | Ga0070694_100069203 | 3300005444 | Bacteria | 2427 |
| 104 | Ga0070694_100189413 | 3300005444 | Bacteria | 1527 |
| 105 | Ga0070708_100018331 | 3300005445 | Bacteria | 5858 |
| 106 | Ga0070663_100317688 | 3300005455 | Bacteria | 1251 |
| 107 | Ga0070678_100002661 | 3300005456 | Bacteria | 9840 |
| 108 | Ga0070678_100069985 | 3300005456 | Bacteria | 2621 |
| 109 | Ga0070678_100651078 | 3300005456 | Bacteria | 945 |
| 110 | Ga0070662_100004411 | 3300005457 | Bacteria | 8892 |
| 111 | Ga0070681_10066963 | 3300005458 | Bacteria | 3560 |
| 112 | Ga0070681_10080212 | 3300005458 | Bacteria | 3219 |
| 113 | Ga0070681_10114978 | 3300005458 | Bacteria | 2629 |
| 114 | Ga0070681_10131744 | 3300005458 | Bacteria | 2432 |
| 115 | Ga0068867_100006480 | 3300005459 | Bacteria | 8270 |
| 116 | Ga0070679_100005088 | 3300005530 | Bacteria | 12151 |
| 117 | Ga0070679_100045910 | 3300005530 | Bacteria | 4353 |
| 118 | Ga0070679_100089271 | 3300005530 | Bacteria | 3069 |
| 119 | Ga0070679_100178184 | 3300005530 | Bacteria | 2098 |
| 120 | Ga0070684_100058016 | 3300005535 | Bacteria | 3382 |
| 121 | Ga0070684_100071061 | 3300005535 | Bacteria | 3063 |
| 122 | Ga0068853_100221054 | 3300005539 | Bacteria | 1730 |
| 123 | Ga0068853_100506722 | 3300005539 | Bacteria | 1140 |
| 124 | Ga0070672_100006170 | 3300005543 | Bacteria | 8023 |
| 125 | Ga0070672_100101542 | 3300005543 | Bacteria | 2333 |
| 126 | Ga0070686_100010831 | 3300005544 | Bacteria | 5157 |
| 127 | Ga0070686_100019639 | 3300005544 | Bacteria | 3985 |
| 128 | Ga0070686_100078329 | 3300005544 | Bacteria | 2182 |
| 129 | Ga0070695_100020774 | 3300005545 | Bacteria | 4011 |
| 130 | Ga0070695_100043885 | 3300005545 | Bacteria | 2844 |
| 131 | Ga0070696_100004009 | 3300005546 | Bacteria | 9815 |
| 132 | Ga0070696_100045991 | 3300005546 | Bacteria | 3026 |
| 133 | Ga0070696_100058424 | 3300005546 | Bacteria | 2693 |
| 134 | Ga0070696_100062587 | 3300005546 | Bacteria | 2605 |
| 135 | Ga0070693_100002242 | 3300005547 | Bacteria | 8873 |
| 136 | Ga0070665_100074891 | 3300005548 | Bacteria | 3391 |
| 137 | Ga0070665_100604010 | 3300005548 | Bacteria | 1110 |
| 138 | Ga0070704_100007752 | 3300005549 | Bacteria | 6399 |
| 139 | Ga0070704_100042538 | 3300005549 | Bacteria | 3143 |
| 140 | Ga0070704_100165906 | 3300005549 | Bacteria | 1751 |
| 141 | Ga0068855_100011293 | 3300005563 | Bacteria | 10783 |
| 142 | Ga0068855_100226656 | 3300005563 | Bacteria | 2094 |
| 143 | Ga0068855_100270715 | 3300005563 | Bacteria | 1889 |
| 144 | Ga0068855_100345202 | 3300005563 | Bacteria | 1640 |
| 145 | Ga0070664_100039417 | 3300005564 | Bacteria | 3981 |
| 146 | Ga0070664_100060752 | 3300005564 | Bacteria | 3219 |
| 147 | Ga0070664_100093883 | 3300005564 | Bacteria | 2601 |
| 148 | Ga0070664_100121615 | 3300005564 | Bacteria | 2287 |
| 149 | Ga0068857_100001682 | 3300005577 | Bacteria | 17775 |
| 150 | Ga0068857_100099307 | 3300005577 | Bacteria | 2611 |
| 151 | Ga0068857_100236670 | 3300005577 | Bacteria | 1671 |
| 152 | Ga0068854_100004886 | 3300005578 | Bacteria | 8457 |
| 153 | Ga0068854_100090331 | 3300005578 | Bacteria | 2277 |
| 154 | Ga0068854_100194218 | 3300005578 | Bacteria | 1592 |
| 155 | Ga0068856_100008165 | 3300005614 | Bacteria | 10207 |
| 156 | Ga0068856_100067227 | 3300005614 | Bacteria | 3542 |
| 157 | Ga0068856_100120855 | 3300005614 | Bacteria | 2621 |
| 158 | Ga0068856_100359461 | 3300005614 | Bacteria | 1475 |
| 159 | Ga0070702_100037932 | 3300005615 | Bacteria | 2679 |
| 160 | Ga0068852_100001494 | 3300005616 | Bacteria | 15815 |
| 161 | Ga0068859_100008349 | 3300005617 | Bacteria | 10494 |
| 162 | Ga0068859_100464819 | 3300005617 | Unclassified | 1361 |
| 163 | Ga0068864_100001074 | 3300005618 | Bacteria | 22938 |
| 164 | Ga0068864_100063921 | 3300005618 | Bacteria | 3190 |
| 165 | Ga0068864_100260015 | 3300005618 | Bacteria | 1614 |
| 166 | Ga0068866_10001816 | 3300005718 | Bacteria | 8977 |
| 167 | Ga0068866_10063618 | 3300005718 | Bacteria | 1924 |
| 168 | Ga0068861_100040271 | 3300005719 | Bacteria | 3493 |
| 169 | Ga0068861_100054273 | 3300005719 | Bacteria | 3052 |
| 170 | Ga0068851_10026105 | 3300005834 | Bacteria | 2868 |
| 171 | Ga0068870_10000051 | 3300005840 | Bacteria | 36782 |
| 172 | Ga0068863_100023028 | 3300005841 | Bacteria | 5953 |
| 173 | Ga0068858_100005723 | 3300005842 | Bacteria | 12147 |
| 174 | Ga0068858_100097241 | 3300005842 | Bacteria | 2744 |
| 175 | Ga0068860_100001825 | 3300005843 | Bacteria | 22684 |
| 176 | Ga0068860_100208852 | 3300005843 | Bacteria | 1894 |
| 177 | Ga0068862_100150419 | 3300005844 | Bacteria | 2072 |
| 178 | Ga0068862_100372080 | 3300005844 | Bacteria | 1330 |
| 179 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 180 | Ga0081455_10007188 | 3300005937 | Bacteria | 11768 |
| 181 | Ga0081455_10241404 | 3300005937 | Bacteria | 1327 |
| 182 | Ga0081539_10001482 | 3300005985 | Bacteria | 39787 |
| 183 | Ga0070717_10088976 | 3300006028 | Bacteria | 2604 |
| 184 | Ga0070717_10103396 | 3300006028 | Bacteria | 2421 |
| 185 | Ga0075432_10006659 | 3300006058 | Bacteria | 3933 |
| 186 | Ga0070715_10026308 | 3300006163 | Bacteria | 2314 |
| 187 | Ga0070716_100004877 | 3300006173 | Bacteria | 6452 |
| 188 | Ga0070716_100265469 | 3300006173 | Bacteria | 1177 |
| 189 | Ga0070712_100153422 | 3300006175 | Bacteria | 1771 |
| 190 | Ga0075367_10037100 | 3300006178 | Bacteria | 2830 |
| 191 | Ga0097621_100002133 | 3300006237 | Bacteria | 13532 |
| 192 | Ga0097621_100002924 | 3300006237 | Bacteria | 11739 |
| 193 | Ga0097621_100004972 | 3300006237 | Bacteria | 9322 |
| 194 | Ga0068871_100004127 | 3300006358 | Bacteria | 10046 |
| 195 | Ga0068871_100029472 | 3300006358 | Bacteria | 4311 |
| 196 | Ga0068871_100039055 | 3300006358 | Bacteria | 3796 |
| 197 | Ga0075428_100005056 | 3300006844 | Bacteria | 14667 |
| 198 | Ga0075428_100451942 | 3300006844 | Bacteria | 1376 |
| 199 | Ga0075430_100001054 | 3300006846 | Bacteria | 21797 |
| 200 | Ga0075431_100001076 | 3300006847 | Bacteria | 24422 |
| 201 | Ga0075433_10009722 | 3300006852 | Bacteria | 7703 |
| 202 | Ga0075433_10035548 | 3300006852 | Bacteria | 4285 |
| 203 | Ga0075433_10089970 | 3300006852 | Bacteria | 2713 |
| 204 | Ga0075434_100003201 | 3300006871 | Bacteria | 14596 |
| 205 | Ga0075434_100006467 | 3300006871 | Bacteria | 10738 |
| 206 | Ga0075434_100434955 | 3300006871 | Bacteria | 1333 |
| 207 | Ga0075429_100000098 | 3300006880 | Bacteria | 47888 |
| 208 | Ga0068865_100031407 | 3300006881 | Bacteria | 3542 |
| 209 | Ga0068865_100032338 | 3300006881 | Bacteria | 3493 |
| 210 | Ga0068865_100132391 | 3300006881 | Bacteria | 1870 |
| 211 | Ga0068865_100273006 | 3300006881 | Bacteria | 1343 |
| 212 | Ga0075436_100012725 | 3300006914 | Bacteria | 5767 |
| 213 | Ga0097620_100008349 | 3300006931 | Bacteria | 10494 |
| 214 | Ga0097620_100464822 | 3300006931 | Unclassified | 1361 |
| 215 | Ga0075435_100029590 | 3300007076 | Bacteria | 4299 |
| 216 | Ga0075435_100041124 | 3300007076 | Bacteria | 3694 |
| 217 | Ga0075435_100206909 | 3300007076 | Bacteria | 1663 |
| 218 | Ga0105251_10019521 | 3300009011 | Bacteria | 3578 |
| 219 | Ga0105240_10049462 | 3300009093 | Bacteria | 5305 |
| 220 | Ga0105240_10129854 | 3300009093 | Bacteria | 3023 |
| 221 | Ga0105240_10311400 | 3300009093 | Bacteria | 1798 |
| 222 | Ga0111539_10000757 | 3300009094 | Bacteria | 42016 |
| 223 | Ga0111539_10001671 | 3300009094 | Bacteria | 29561 |
| 224 | Ga0111539_10032539 | 3300009094 | Bacteria | 6332 |
| 225 | Ga0111539_10059301 | 3300009094 | Bacteria | 4539 |
| 226 | Ga0105245_10120387 | 3300009098 | Bacteria | 2451 |
| 227 | Ga0105247_10002735 | 3300009101 | Bacteria | 11818 |
| 228 | Ga0105247_10015124 | 3300009101 | Bacteria | 4628 |
| 229 | Ga0105247_10032592 | 3300009101 | Bacteria | 3166 |
| 230 | Ga0114129_10008949 | 3300009147 | Bacteria | 14268 |
| 231 | Ga0114129_10017470 | 3300009147 | Bacteria | 10214 |
| 232 | Ga0105243_10006997 | 3300009148 | Bacteria | 8685 |
| 233 | Ga0105243_10023377 | 3300009148 | Bacteria | 4707 |
| 234 | Ga0105243_10036757 | 3300009148 | Bacteria | 3803 |
| 235 | Ga0105243_10131072 | 3300009148 | Bacteria | 2126 |
| 236 | Ga0105241_10010830 | 3300009174 | Bacteria | 6690 |
| 237 | Ga0105241_10016796 | 3300009174 | Bacteria | 5372 |
| 238 | Ga0105241_10043867 | 3300009174 | Bacteria | 3387 |
| 239 | Ga0105242_10056130 | 3300009176 | Bacteria | 3222 |
| 240 | Ga0105242_10121283 | 3300009176 | Bacteria | 2244 |
| 241 | Ga0105248_10010592 | 3300009177 | Bacteria | 10164 |
| 242 | Ga0105248_10069576 | 3300009177 | Bacteria | 3951 |
| 243 | Ga0105248_10390089 | 3300009177 | Bacteria | 1568 |
| 244 | Ga0105237_10031006 | 3300009545 | Bacteria | 5423 |
| 245 | Ga0105237_10070292 | 3300009545 | Bacteria | 3496 |
| 246 | Ga0105237_10079628 | 3300009545 | Bacteria | 3266 |
| 247 | Ga0105238_10208106 | 3300009551 | Bacteria | 1932 |
| 248 | Ga0105238_10316663 | 3300009551 | Bacteria | 1546 |
| 249 | Ga0105238_10794447 | 3300009551 | Bacteria | 962 |
| 250 | Ga0105249_10001193 | 3300009553 | Bacteria | 22912 |
| 251 | Ga0105249_10018341 | 3300009553 | Bacteria | 6223 |
| 252 | Ga0105239_10494684 | 3300010375 | Bacteria | 1390 |
| 253 | Ga0105239_11064495 | 3300010375 | Bacteria | 931 |
| 254 | Ga0105246_10000255 | 3300011119 | Bacteria | 27531 |
| 255 | Ga0105246_10062593 | 3300011119 | Bacteria | 2593 |
| 256 | Ga0105246_10239870 | 3300011119 | Bacteria | 1432 |
| 257 | Ga0157339_1003789 | 3300012505 | Bacteria | 1110 |
| 258 | Ga0157373_10049682 | 3300013100 | Bacteria | 2988 |
| 259 | Ga0157373_10071545 | 3300013100 | Bacteria | 2449 |
| 260 | Ga0157373_10142614 | 3300013100 | Bacteria | 1685 |
| 261 | Ga0157371_10017533 | 3300013102 | Bacteria | 5318 |
| 262 | Ga0157370_10039505 | 3300013104 | Bacteria | 4560 |
| 263 | Ga0157370_10151546 | 3300013104 | Bacteria | 2157 |
| 264 | Ga0157369_10134356 | 3300013105 | Bacteria | 2620 |
| 265 | Ga0157369_10379008 | 3300013105 | Bacteria | 1468 |
| 266 | Ga0157374_10028071 | 3300013296 | Bacteria | 5083 |
| 267 | Ga0157374_10042269 | 3300013296 | Bacteria | 4204 |
| 268 | Ga0157374_10198445 | 3300013296 | Bacteria | 1964 |
| 269 | Ga0157374_10307472 | 3300013296 | Bacteria | 1569 |
| 270 | Ga0157378_10022902 | 3300013297 | Bacteria | 5498 |
| 271 | Ga0157378_10140503 | 3300013297 | Bacteria | 2242 |
| 272 | Ga0157378_10261221 | 3300013297 | Bacteria | 1661 |
| 273 | Ga0163162_10066273 | 3300013306 | Bacteria | 3660 |
| 274 | Ga0157372_10027692 | 3300013307 | Bacteria | 6176 |
| 275 | Ga0157372_10301657 | 3300013307 | Bacteria | 1863 |
| 276 | Ga0157372_10379577 | 3300013307 | Bacteria | 1647 |
| 277 | Ga0157375_10020563 | 3300013308 | Bacteria | 6032 |
| 278 | Ga0157375_10044607 | 3300013308 | Bacteria | 4309 |
| 279 | Ga0157375_10056005 | 3300013308 | Bacteria | 3890 |
| 280 | Ga0157375_10307533 | 3300013308 | Bacteria | 1749 |
| 281 | Ga0163163_10087213 | 3300014325 | Bacteria | 3131 |
| 282 | Ga0157380_10005310 | 3300014326 | Bacteria | 9001 |
| 283 | Ga0157380_10024000 | 3300014326 | Bacteria | 4609 |
| 284 | Ga0157380_10072062 | 3300014326 | Bacteria | 2797 |
| 285 | Ga0157377_10000164 | 3300014745 | Bacteria | 39592 |
| 286 | Ga0157379_10002095 | 3300014968 | Bacteria | 16559 |
| 287 | Ga0157379_10077215 | 3300014968 | Bacteria | 2982 |
| 288 | Ga0157376_10027757 | 3300014969 | Bacteria | 4491 |
| 289 | Ga0163161_10027479 | 3300017792 | Bacteria | 4037 |
| 290 | Ga0163161_10038484 | 3300017792 | Bacteria | 3430 |
| 291 | Ga0207666_1000051 | 3300025271 | Bacteria | 21813 |
| 292 | Ga0207666_1000825 | 3300025271 | Bacteria | 3721 |
| 293 | Ga0207673_1000758 | 3300025290 | Bacteria | 3479 |
| 294 | Ga0207697_10003536 | 3300025315 | Bacteria | 7704 |
| 295 | Ga0207653_10016506 | 3300025885 | Bacteria | 2319 |
| 296 | Ga0207653_10037868 | 3300025885 | Bacteria | 1574 |
| 297 | Ga0207682_10000072 | 3300025893 | Bacteria | 44659 |
| 298 | Ga0207692_10156767 | 3300025898 | Bacteria | 1309 |
| 299 | Ga0207642_10029170 | 3300025899 | Bacteria | 2281 |
| 300 | Ga0207710_10004456 | 3300025900 | Bacteria | 6110 |
| 301 | Ga0207710_10018655 | 3300025900 | Bacteria | 2953 |
| 302 | Ga0207688_10000229 | 3300025901 | Bacteria | 25389 |
| 303 | Ga0207680_10008261 | 3300025903 | Bacteria | 5103 |
| 304 | Ga0207680_10050338 | 3300025903 | Bacteria | 2485 |
| 305 | Ga0207680_10189720 | 3300025903 | Bacteria | 1394 |
| 306 | Ga0207680_10232782 | 3300025903 | Bacteria | 1267 |
| 307 | Ga0207647_10002000 | 3300025904 | Bacteria | 15594 |
| 308 | Ga0207647_10022872 | 3300025904 | Bacteria | 4146 |
| 309 | Ga0207685_10037720 | 3300025905 | Bacteria | 1782 |
| 310 | Ga0207699_10003384 | 3300025906 | Bacteria | 7603 |
| 311 | Ga0207699_10028904 | 3300025906 | Bacteria | 3086 |
| 312 | Ga0207645_10000966 | 3300025907 | Bacteria | 23780 |
| 313 | Ga0207645_10037371 | 3300025907 | Bacteria | 3115 |
| 314 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 315 | Ga0207705_10004623 | 3300025909 | Bacteria | 10387 |
| 316 | Ga0207654_10153464 | 3300025911 | Bacteria | 1481 |
| 317 | Ga0207654_10233533 | 3300025911 | Bacteria | 1226 |
| 318 | Ga0207707_10008300 | 3300025912 | Bacteria | 9012 |
| 319 | Ga0207707_10060858 | 3300025912 | Bacteria | 3284 |
| 320 | Ga0207707_10131577 | 3300025912 | Bacteria | 2188 |
| 321 | Ga0207707_10141147 | 3300025912 | Bacteria | 2106 |
| 322 | Ga0207671_10118354 | 3300025914 | Bacteria | 2023 |
| 323 | Ga0207671_10189574 | 3300025914 | Bacteria | 1603 |
| 324 | Ga0207693_10035873 | 3300025915 | Bacteria | 3908 |
| 325 | Ga0207693_10117308 | 3300025915 | Bacteria | 2090 |
| 326 | Ga0207693_10271129 | 3300025915 | Bacteria | 1330 |
| 327 | Ga0207663_10021824 | 3300025916 | Bacteria | 3651 |
| 328 | Ga0207663_10047876 | 3300025916 | Unclassified | 2642 |
| 329 | Ga0207663_10074049 | 3300025916 | Unclassified | 2206 |
| 330 | Ga0207663_10127052 | 3300025916 | Bacteria | 1756 |
| 331 | Ga0207660_10004454 | 3300025917 | Bacteria | 9129 |
| 332 | Ga0207662_10000317 | 3300025918 | Bacteria | 21877 |
| 333 | Ga0207657_10002047 | 3300025919 | Bacteria | 21819 |
| 334 | Ga0207657_10052705 | 3300025919 | Bacteria | 3529 |
| 335 | Ga0207657_10057638 | 3300025919 | Bacteria | 3347 |
| 336 | Ga0207657_10060705 | 3300025919 | Bacteria | 3244 |
| 337 | Ga0207649_10000262 | 3300025920 | Bacteria | 41689 |
| 338 | Ga0207649_10055749 | 3300025920 | Bacteria | 2465 |
| 339 | Ga0207652_10000911 | 3300025921 | Bacteria | 27891 |
| 340 | Ga0207652_10027424 | 3300025921 | Bacteria | 4747 |
| 341 | Ga0207681_10038404 | 3300025923 | Bacteria | 3172 |
| 342 | Ga0207694_10249115 | 3300025924 | Bacteria | 1453 |
| 343 | Ga0207650_10197358 | 3300025925 | Bacteria | 1610 |
| 344 | Ga0207659_10001285 | 3300025926 | Bacteria | 15002 |
| 345 | Ga0207659_10038335 | 3300025926 | Bacteria | 3333 |
| 346 | Ga0207659_10125257 | 3300025926 | Bacteria | 1975 |
| 347 | Ga0207659_10178888 | 3300025926 | Bacteria | 1679 |
| 348 | Ga0207687_10132991 | 3300025927 | Bacteria | 1878 |
| 349 | Ga0207700_10047638 | 3300025928 | Bacteria | 3178 |
| 350 | Ga0207700_10184941 | 3300025928 | Bacteria | 1747 |
| 351 | Ga0207664_10018712 | 3300025929 | Bacteria | 5107 |
| 352 | Ga0207664_10053132 | 3300025929 | Bacteria | 3206 |
| 353 | Ga0207664_10190714 | 3300025929 | Bacteria | 1764 |
| 354 | Ga0207664_10261411 | 3300025929 | Bacteria | 1514 |
| 355 | Ga0207644_10004727 | 3300025931 | Bacteria | 8849 |
| 356 | Ga0207644_10017581 | 3300025931 | Bacteria | 4833 |
| 357 | Ga0207690_10001058 | 3300025932 | Bacteria | 17643 |
| 358 | Ga0207690_10465128 | 3300025932 | Unclassified | 1018 |
| 359 | Ga0207706_10001679 | 3300025933 | Bacteria | 21866 |
| 360 | Ga0207706_10016549 | 3300025933 | Bacteria | 6658 |
| 361 | Ga0207706_10035958 | 3300025933 | Bacteria | 4401 |
| 362 | Ga0207686_10005614 | 3300025934 | Bacteria | 6726 |
| 363 | Ga0207686_10230052 | 3300025934 | Bacteria | 1343 |
| 364 | Ga0207709_10009302 | 3300025935 | Bacteria | 5410 |
| 365 | Ga0207709_10069409 | 3300025935 | Bacteria | 2231 |
| 366 | Ga0207709_10141922 | 3300025935 | Bacteria | 1652 |
| 367 | Ga0207670_10000377 | 3300025936 | Bacteria | 25697 |
| 368 | Ga0207670_10026617 | 3300025936 | Bacteria | 3647 |
| 369 | Ga0207670_10068553 | 3300025936 | Bacteria | 2444 |
| 370 | Ga0207669_10014544 | 3300025937 | Bacteria | 3947 |
| 371 | Ga0207704_10006515 | 3300025938 | Bacteria | 5451 |
| 372 | Ga0207665_10008284 | 3300025939 | Bacteria | 6863 |
| 373 | Ga0207665_10043156 | 3300025939 | Bacteria | 3015 |
| 374 | Ga0207691_10026103 | 3300025940 | Bacteria | 5483 |
| 375 | Ga0207691_10034812 | 3300025940 | Bacteria | 4680 |
| 376 | Ga0207691_10102469 | 3300025940 | Bacteria | 2553 |
| 377 | Ga0207711_10006200 | 3300025941 | Bacteria | 10106 |
| 378 | Ga0207711_10016950 | 3300025941 | Bacteria | 6051 |
| 379 | Ga0207711_10158113 | 3300025941 | Bacteria | 2049 |
| 380 | Ga0207689_10000203 | 3300025942 | Bacteria | 52425 |
| 381 | Ga0207689_10029484 | 3300025942 | Bacteria | 4581 |
| 382 | Ga0207689_10115522 | 3300025942 | Bacteria | 2206 |
| 383 | Ga0207661_10002165 | 3300025944 | Bacteria | 13530 |
| 384 | Ga0207661_10081279 | 3300025944 | Bacteria | 2676 |
| 385 | Ga0207661_10321539 | 3300025944 | Bacteria | 1391 |
| 386 | Ga0207679_10000157 | 3300025945 | Bacteria | 56166 |
| 387 | Ga0207679_10026481 | 3300025945 | Bacteria | 3998 |
| 388 | Ga0207667_10684738 | 3300025949 | Bacteria | 1029 |
| 389 | Ga0207651_10000367 | 3300025960 | Bacteria | 19162 |
| 390 | Ga0207712_10015168 | 3300025961 | Bacteria | 4966 |
| 391 | Ga0207668_10070419 | 3300025972 | Bacteria | 2494 |
| 392 | Ga0207668_10075414 | 3300025972 | Bacteria | 2424 |
| 393 | Ga0207640_10051155 | 3300025981 | Bacteria | 2684 |
| 394 | Ga0207640_10063139 | 3300025981 | Bacteria | 2460 |
| 395 | Ga0207658_10004781 | 3300025986 | Bacteria | 9370 |
| 396 | Ga0207658_10261344 | 3300025986 | Bacteria | 1475 |
| 397 | Ga0207658_10509926 | 3300025986 | Bacteria | 1072 |
| 398 | Ga0207677_10003050 | 3300026023 | Bacteria | 8858 |
| 399 | Ga0207677_10161592 | 3300026023 | Bacteria | 1741 |
| 400 | Ga0207677_10190552 | 3300026023 | Bacteria | 1621 |
| 401 | Ga0207703_10001346 | 3300026035 | Bacteria | 22503 |
| 402 | Ga0207703_10001852 | 3300026035 | Bacteria | 18819 |
| 403 | Ga0207703_10088084 | 3300026035 | Bacteria | 2604 |
| 404 | Ga0207703_10352273 | 3300026035 | Bacteria | 1356 |
| 405 | Ga0207639_10078753 | 3300026041 | Bacteria | 2602 |
| 406 | Ga0207639_10252239 | 3300026041 | Bacteria | 1539 |
| 407 | Ga0207678_10010941 | 3300026067 | Bacteria | 7972 |
| 408 | Ga0207678_10036309 | 3300026067 | Bacteria | 4290 |
| 409 | Ga0207708_10037666 | 3300026075 | Bacteria | 3683 |
| 410 | Ga0207702_10204245 | 3300026078 | Bacteria | 1833 |
| 411 | Ga0207702_10279623 | 3300026078 | Bacteria | 1577 |
| 412 | Ga0207641_10094986 | 3300026088 | Bacteria | 2615 |
| 413 | Ga0207641_10224085 | 3300026088 | Bacteria | 1745 |
| 414 | Ga0207648_10002073 | 3300026089 | Bacteria | 21861 |
| 415 | Ga0207648_10128032 | 3300026089 | Bacteria | 2234 |
| 416 | Ga0207648_10141470 | 3300026089 | Bacteria | 2120 |
| 417 | Ga0207676_10010349 | 3300026095 | Bacteria | 6640 |
| 418 | Ga0207674_10000897 | 3300026116 | Bacteria | 38907 |
| 419 | Ga0207674_10203297 | 3300026116 | Bacteria | 1930 |
| 420 | Ga0207674_10570885 | 3300026116 | Bacteria | 1093 |
| 421 | Ga0207675_100001726 | 3300026118 | Bacteria | 21899 |
| 422 | Ga0207675_100115286 | 3300026118 | Bacteria | 2539 |
| 423 | Ga0207675_100119875 | 3300026118 | Bacteria | 2489 |
| 424 | Ga0207675_100255987 | 3300026118 | Bacteria | 1696 |
| 425 | Ga0207683_10001176 | 3300026121 | Bacteria | 23694 |
| 426 | Ga0207698_10039789 | 3300026142 | Bacteria | 3486 |
| 427 | Ga0207698_10088166 | 3300026142 | Bacteria | 2530 |
| 428 | Ga0209983_1027703 | 3300027665 | Bacteria | 1200 |
| 429 | Ga0209966_1001285 | 3300027695 | Bacteria | 4454 |
| 430 | Ga0209966_1009770 | 3300027695 | Bacteria | 1719 |
| 431 | Ga0209998_10000255 | 3300027717 | Bacteria | 17497 |
| 432 | Ga0209998_10024295 | 3300027717 | Bacteria | 1314 |
| 433 | Ga0209974_10002830 | 3300027876 | Bacteria | 6301 |
| 434 | Ga0209974_10099082 | 3300027876 | Bacteria | 1017 |
| 435 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 436 | Ga0207428_10000165 | 3300027907 | Bacteria | 91701 |
| 437 | Ga0207428_10000792 | 3300027907 | Bacteria | 35769 |
| 438 | Ga0268266_10018077 | 3300028379 | Bacteria | 6008 |
| 439 | Ga0268266_10109108 | 3300028379 | Bacteria | 2450 |
| 440 | Ga0268265_10066454 | 3300028380 | Bacteria | 2787 |
| 441 | Ga0268265_10137636 | 3300028380 | Bacteria | 2039 |
| 442 | Ga0268264_10001616 | 3300028381 | Bacteria | 20825 |
| 443 | Ga0265325_10000264 | 3300031241 | Bacteria | 37210 |
| 444 | Ga0265325_10037662 | 3300031241 | Bacteria | 2556 |
| 445 | Ga0265340_10013138 | 3300031247 | Bacteria | 4358 |
| 446 | Ga0265340_10079733 | 3300031247 | Bacteria | 1543 |
| 447 | Ga0265331_10090758 | 3300031250 | Bacteria | 1412 |
| 448 | Ga0265316_10117357 | 3300031344 | Bacteria | 2012 |
| 449 | Ga0265316_10135948 | 3300031344 | Bacteria | 1849 |
| 450 | Ga0307509_10376187 | 3300031507 | Bacteria | 1135 |
| 451 | Ga0265313_10069516 | 3300031595 | Unclassified | 1624 |
| 452 | Ga0316575_10035231 | 3300031665 | Bacteria | 1967 |
| 453 | Ga0265314_10001726 | 3300031711 | Bacteria | 23697 |
| 454 | Ga0265314_10009303 | 3300031711 | Bacteria | 8315 |
| 455 | Ga0265314_10060754 | 3300031711 | Bacteria | 2578 |
| 456 | Ga0316583_10002826 | 3300032133 | Bacteria | 6078 |
| 457 | Ga0307510_10133597 | 3300033180 | Bacteria | 2146 |
| 458 | Ga0373930_0000452 | 3300034816 | Bacteria | 5500 |
| 459 | Ga0373930_0004658 | 3300034816 | Bacteria | 2245 |
| 460 | Ga0373930_0013677 | 3300034816 | Bacteria | 1500 |
| 461 | Ga0373948_0000822 | 3300034817 | Bacteria | 4099 |
| 462 | Ga0373948_0013582 | 3300034817 | Bacteria | 1472 |
| 463 | Ga0373948_0047176 | 3300034817 | Unclassified | 917 |
| 464 | Ga0373958_0000721 | 3300034819 | Bacteria | 4197 |
| 465 | Ga0373959_0001671 | 3300034820 | Bacteria | 3527 |
| 466 | Ga0373959_0015498 | 3300034820 | Bacteria | 1400 |
| 467 | Ga0373938_0008796 | 3300034957 | Bacteria | 1812 |
| 468 | Ga0373938_0016684 | 3300034957 | Bacteria | 1438 |
| 469 | Ga0373926_0002855 | 3300035083 | Bacteria | 5532 |
| 470 | Ga0373928_0000449 | 3300035084 | Bacteria | 8127 |
| 471 | Ga0373929_0000206 | 3300035085 | Bacteria | 10608 |
| 472 | Ga0373934_0002288 | 3300035086 | Bacteria | 7052 |
| 473 | Ga0373934_0018396 | 3300035086 | Bacteria | 2673 |
| 474 | Ga0373934_0026660 | 3300035086 | Bacteria | 2242 |
| 475 | Ga0373934_0099366 | 3300035086 | Unclassified | 1176 |
| 476 | Ga0373940_0000275 | 3300035088 | Bacteria | 7415 |
| 477 | Ga0373944_0001376 | 3300035089 | Bacteria | 6132 |
| 478 | Ga0373944_0023050 | 3300035089 | Bacteria | 1813 |
| 479 | Ga0373949_0001134 | 3300035090 | Bacteria | 8033 |
| 480 | Ga0373949_0006003 | 3300035090 | Bacteria | 2693 |
| 481 | Ga0373951_0000423 | 3300035091 | Bacteria | 12422 |
| 482 | Ga0373951_0001767 | 3300035091 | Bacteria | 5622 |
| 483 | Ga0373952_0000038 | 3300035092 | Bacteria | 15588 |
| 484 | Ga0373952_0003171 | 3300035092 | Bacteria | 2961 |
| 485 | Ga0373923_0003371 | 3300035111 | Bacteria | 5112 |
| 486 | Ga0373932_0000572 | 3300035112 | Bacteria | 11295 |
| 487 | Ga0373936_0006584 | 3300035113 | Bacteria | 4375 |
| 488 | Ga0373939_0000257 | 3300035114 | Bacteria | 14265 |
| 489 | Ga0373939_0001047 | 3300035114 | Bacteria | 6813 |
| 490 | Ga0373939_0001338 | 3300035114 | Bacteria | 5981 |
| 491 | Ga0373939_0003044 | 3300035114 | Bacteria | 3937 |
| 492 | Ga0373941_0001225 | 3300035115 | Bacteria | 5387 |
| 493 | Ga0373941_0003694 | 3300035115 | Bacteria | 3484 |
| 494 | Ga0373945_0004740 | 3300035116 | Bacteria | 4330 |
| 495 | Ga0373953_0016152 | 3300035117 | Bacteria | 2721 |
| 496 | Ga0373954_0008462 | 3300035118 | Bacteria | 4516 |
| 497 | Ga0373956_0011299 | 3300035119 | Bacteria | 3678 |
| 498 | Ga0373956_0055402 | 3300035119 | Unclassified | 1788 |
| 499 | Ga0373957_0001356 | 3300035120 | Bacteria | 6580 |
| 500 | Ga0373957_0052537 | 3300035120 | Unclassified | 1561 |
| 501 | Ga0373960_0003182 | 3300035121 | Bacteria | 3710 |
| 502 | Ga0373960_0006465 | 3300035121 | Bacteria | 2751 |
| 503 | Ga0373960_0014057 | 3300035121 | Bacteria | 2020 |
| 504 | Ga0373943_0013498 | 3300035170 | Bacteria | 3690 |
| 505 | Ga0373943_0016485 | 3300035170 | Bacteria | 3370 |
| 506 | Ga0373943_0051142 | 3300035170 | Bacteria | 2033 |
| 507 | Ga0373943_0082021 | 3300035170 | Unclassified | 1655 |
| 508 | Ga0373946_0008671 | 3300035171 | Bacteria | 3733 |
| 509 | Ga0373955_0002078 | 3300035172 | Bacteria | 8632 |
| 510 | Ga0373955_0002733 | 3300035172 | Bacteria | 7732 |
| 511 | Ga0373955_0005429 | 3300035172 | Bacteria | 5729 |
| 512 | Ga0373955_0157500 | 3300035172 | Bacteria | 1338 |
| 513 | Ga0373955_0242916 | 3300035172 | Bacteria | 1079 |
| 514 | Ga0373942_0000089 | 3300035207 | Bacteria | 19884 |
| 515 | Ga0373942_0014182 | 3300035207 | Bacteria | 1925 |
| 516 | Ga0373942_0030018 | 3300035207 | Bacteria | 1430 |
| 517 | Ga0373961_0002484 | 3300035241 | Bacteria | 4767 |
| 518 | Ga0373961_0038548 | 3300035241 | Bacteria | 1369 |
| 519 | Ga0373962_0001788 | 3300035242 | Bacteria | 5119 |
| 520 | Ga0373962_0006580 | 3300035242 | Bacteria | 2816 |
| 521 | Ga0373924_0075788 | 3300035410 | Bacteria | 1424 |
| 522 | Ga0373924_0170489 | 3300035410 | Unclassified | 956 |
| 523 | Ga0373931_0001147 | 3300035691 | Bacteria | 11271 |
| 524 | Ga0373931_0002088 | 3300035691 | Bacteria | 8796 |
| 525 | Ga0373931_0016624 | 3300035691 | Bacteria | 3624 |
| 526 | Ga0373931_0200950 | 3300035691 | Bacteria | 1191 |
| 527 | Ga0373935_0006737 | 3300035692 | Bacteria | 6862 |
| 528 | Ga0373935_0035049 | 3300035692 | Bacteria | 3131 |
| 529 | Ga0373935_0093329 | 3300035692 | Unclassified | 1973 |
| 530 | Ga0373927_0017667 | 3300035695 | Bacteria | 4692 |
| 531 | Ga0373927_0179748 | 3300035695 | Bacteria | 1388 |
| 532 | Ga0373933_0011372 | 3300035724 | Bacteria | 4902 |
| 533 | Ga0373933_0016229 | 3300035724 | Bacteria | 4161 |
| 534 | Ga0373933_0025867 | 3300035724 | Bacteria | 3367 |
| 535 | Ga0373933_0254782 | 3300035724 | Bacteria | 1131 |
| 536 | Ga0373947_0000424 | 3300035725 | Bacteria | 23999 |
| 537 | Ga0373947_0071765 | 3300035725 | Bacteria | 2124 |
| 538 | Ga0373937_0014261 | 3300036401 | Bacteria | 7013 |
| 539 | Ga0373937_0018346 | 3300036401 | Bacteria | 6248 |
| 540 | Ga0373937_0047021 | 3300036401 | Bacteria | 3947 |
| 541 | Ga0373937_0054598 | 3300036401 | Bacteria | 3667 |
| 542 | Ga0373937_0376761 | 3300036401 | Bacteria | 1346 |
| 543 | Ga0316582_0188954 | 3300036647 | Bacteria | 1403 |
| 544 | Ga0373925_0049481 | 3300037068 | Unclassified | 3133 |
| 545 | Ga0373925_0050867 | 3300037068 | Bacteria | 3091 |
| 546 | Ga0395905_0281473 | 3300037471 | Bacteria | 1549 |
| 547 | Ga0242420_006378 | 3300038996 | Bacteria | 1861 |
| 548 | Ga0453684_0291155 | 3300044712 | Bacteria | 1859 |
| 549 | Ga0451576_0047830 | 3300045051 | Bacteria | 4496 |
| 550 | Ga0451576_0396498 | 3300045051 | Bacteria | 1447 |
| 551 | Ga0495592_0025647 | 3300046454 | Bacteria | 4473 |
| 552 | Ga0495592_0041594 | 3300046454 | Bacteria | 3444 |
| 553 | Ga0495592_0096163 | 3300046454 | Bacteria | 2117 |
| 554 | Ga0495603_0038640 | 3300046455 | Bacteria | 2862 |
| 555 | Ga0495591_032418 | 3300046458 | Bacteria | 1555 |
| 556 | Ga0495629_0000447 | 3300046459 | Bacteria | 34326 |
| 557 | Ga0495629_0112296 | 3300046459 | Bacteria | 1899 |
| 558 | Ga0495629_0310677 | 3300046459 | Unclassified | 1078 |
| 559 | Ga0495641_0055025 | 3300046461 | Unclassified | 1807 |
| 560 | Ga0495651_0015323 | 3300046462 | Bacteria | 5927 |
| 561 | Ga0495651_0020710 | 3300046462 | Bacteria | 5106 |
| 562 | Ga0495651_0030858 | 3300046462 | Bacteria | 4179 |
| 563 | Ga0495651_0115960 | 3300046462 | Bacteria | 1974 |
| 564 | Ga0495653_0013922 | 3300046463 | Bacteria | 6558 |
| 565 | Ga0495653_0080036 | 3300046463 | Bacteria | 2418 |
| 566 | Ga0495580_0019007 | 3300046472 | Bacteria | 5109 |
| 567 | Ga0495580_0095263 | 3300046472 | Bacteria | 2070 |
| 568 | Ga0495582_0006745 | 3300046473 | Bacteria | 6388 |
| 569 | Ga0495662_0016654 | 3300046476 | Bacteria | 3561 |
| 570 | Ga0495664_0044002 | 3300046477 | Bacteria | 2645 |
| 571 | Ga0495664_0086099 | 3300046477 | Unclassified | 1887 |
| 572 | Ga0495584_0006761 | 3300046491 | Bacteria | 5992 |
| 573 | Ga0495584_0102450 | 3300046491 | Bacteria | 1447 |
| 574 | Ga0495585_0003617 | 3300046492 | Bacteria | 10355 |
| 575 | Ga0495594_0021714 | 3300046499 | Bacteria | 3428 |
| 576 | Ga0495594_0129357 | 3300046499 | Bacteria | 1429 |
| 577 | Ga0495594_0224445 | 3300046499 | Unclassified | 1071 |
| 578 | Ga0495607_0007932 | 3300046501 | Bacteria | 7299 |
| 579 | Ga0495608_0003528 | 3300046511 | Bacteria | 11206 |
| 580 | Ga0495618_0025853 | 3300046514 | Bacteria | 3646 |
| 581 | Ga0495628_0006361 | 3300046516 | Bacteria | 10324 |
| 582 | Ga0495628_0011889 | 3300046516 | Bacteria | 7341 |
| 583 | Ga0495628_0025333 | 3300046516 | Bacteria | 4846 |
| 584 | Ga0495630_0057991 | 3300046517 | Bacteria | 2902 |
| 585 | Ga0495630_0072935 | 3300046517 | Bacteria | 2584 |
| 586 | Ga0495644_0000748 | 3300046523 | Bacteria | 13392 |
| 587 | Ga0495666_0042043 | 3300046526 | Bacteria | 2211 |
| 588 | Ga0495652_0011053 | 3300046529 | Bacteria | 8182 |
| 589 | Ga0495652_0050380 | 3300046529 | Bacteria | 3560 |
| 590 | Ga0495652_0072716 | 3300046529 | Bacteria | 2865 |
| 591 | Ga0495652_0105769 | 3300046529 | Bacteria | 2273 |
| 592 | Ga0495640_0007483 | 3300046533 | Bacteria | 8580 |
| 593 | Ga0495640_0074036 | 3300046533 | Bacteria | 2278 |
| 594 | Ga0495586_0007081 | 3300046535 | Bacteria | 5978 |
| 595 | Ga0495586_0056351 | 3300046535 | Bacteria | 2131 |
| 596 | Ga0495587_0009207 | 3300046536 | Bacteria | 6335 |
| 597 | Ga0495587_0025703 | 3300046536 | Bacteria | 3597 |
| 598 | Ga0495598_0019699 | 3300046537 | Bacteria | 1773 |
| 599 | Ga0495645_0003160 | 3300046543 | Bacteria | 11163 |
| 600 | Ga0495645_0051861 | 3300046543 | Bacteria | 2985 |
| 601 | Ga0495622_0012435 | 3300046557 | Bacteria | 3940 |
| 602 | Ga0495633_0007380 | 3300046558 | Bacteria | 6332 |
| 603 | Ga0495667_0004191 | 3300046559 | Bacteria | 9712 |
| 604 | Ga0495667_0004817 | 3300046559 | Bacteria | 9124 |
| 605 | Ga0495667_0027013 | 3300046559 | Bacteria | 3868 |
| 606 | Ga0495667_0034869 | 3300046559 | Bacteria | 3365 |
| 607 | Ga0495656_0013672 | 3300046615 | Bacteria | 3025 |
| 608 | Ga0495634_0088252 | 3300046642 | Unclassified | 2017 |
| 609 | Ga0495634_0161494 | 3300046642 | Bacteria | 1412 |
| 610 | Ga0495611_0003367 | 3300046648 | Bacteria | 7056 |
| 611 | Ga0495635_0002274 | 3300046663 | Bacteria | 13065 |
| 612 | Ga0495635_0021903 | 3300046663 | Bacteria | 4454 |
| 613 | Ga0495635_0061311 | 3300046663 | Bacteria | 2584 |
| 614 | Ga0495635_0061844 | 3300046663 | Unclassified | 2571 |
| 615 | Ga0495635_0071034 | 3300046663 | Bacteria | 2386 |
| 616 | Ga0495588_0006148 | 3300046674 | Bacteria | 5392 |
| 617 | Ga0495657_0032249 | 3300046675 | Bacteria | 3658 |
| 618 | Ga0495657_0052882 | 3300046675 | Bacteria | 2720 |
| 619 | Ga0495657_0167146 | 3300046675 | Bacteria | 1357 |
| 620 | Ga0495599_0006608 | 3300046678 | Bacteria | 6995 |
| 621 | Ga0495599_0031607 | 3300046678 | Bacteria | 3322 |
| 622 | Ga0495599_0049221 | 3300046678 | Bacteria | 2641 |
| 623 | Ga0495623_0012776 | 3300046679 | Bacteria | 5436 |
| 624 | Ga0495623_0035467 | 3300046679 | Bacteria | 3197 |
| 625 | Ga0495646_0042876 | 3300046680 | Bacteria | 2774 |
| 626 | Ga0495646_0044732 | 3300046680 | Bacteria | 2706 |
| 627 | Ga0495647_0091051 | 3300046681 | Bacteria | 1250 |
| 628 | Ga0495658_0003413 | 3300046683 | Bacteria | 7863 |
| 629 | Ga0495658_0033330 | 3300046683 | Bacteria | 2819 |
| 630 | Ga0495658_0166172 | 3300046683 | Bacteria | 1363 |
| 631 | Ga0495613_0022722 | 3300046689 | Bacteria | 4673 |
| 632 | Ga0495613_0049327 | 3300046689 | Bacteria | 3107 |
| 633 | Ga0495613_0110478 | 3300046689 | Bacteria | 1981 |
| 634 | Ga0495624_0021150 | 3300046690 | Bacteria | 4318 |
| 635 | Ga0495624_0079297 | 3300046690 | Bacteria | 2036 |
| 636 | Ga0495670_0001290 | 3300046691 | Bacteria | 12211 |
| 637 | Ga0495671_0084329 | 3300046692 | Unclassified | 1557 |
| 638 | Ga0495600_0004224 | 3300046809 | Bacteria | 8577 |
| 639 | Ga0495600_0068784 | 3300046809 | Bacteria | 2314 |
| 640 | Ga0495581_0009308 | 3300047315 | Bacteria | 5684 |
| 641 | Ga0495581_0011457 | 3300047315 | Bacteria | 5133 |
| 642 | Ga0495581_0024160 | 3300047315 | Bacteria | 3522 |
| 643 | Ga0495604_0013941 | 3300047317 | Bacteria | 6412 |
| 644 | Ga0495604_0036706 | 3300047317 | Bacteria | 3863 |
| 645 | Ga0495604_0038875 | 3300047317 | Bacteria | 3743 |
| 646 | Ga0495604_0064299 | 3300047317 | Bacteria | 2796 |
| 647 | Ga0495604_0066726 | 3300047317 | Bacteria | 2736 |
| 648 | Ga0495674_0029272 | 3300047319 | Bacteria | 5018 |
| 649 | Ga0495674_0038342 | 3300047319 | Bacteria | 4301 |
| 650 | Ga0495674_0093302 | 3300047319 | Unclassified | 2569 |
| 651 | Ga0495676_0035281 | 3300047321 | Bacteria | 4185 |
| 652 | Ga0495680_0002870 | 3300047322 | Bacteria | 17316 |
| 653 | Ga0495680_0009896 | 3300047322 | Bacteria | 8548 |
| 654 | Ga0495680_0030095 | 3300047322 | Bacteria | 4437 |
| 655 | Ga0495680_0048923 | 3300047322 | Bacteria | 3316 |
| 656 | Ga0495680_0081031 | 3300047322 | Bacteria | 2451 |
| 657 | Ga0495675_0005619 | 3300047444 | Bacteria | 7656 |
| 658 | Ga0495675_0036408 | 3300047444 | Bacteria | 3139 |
| 659 | Ga0495679_029627 | 3300047446 | Bacteria | 1784 |
| 660 | Ga0495684_0315276 | 3300047471 | Bacteria | 1119 |
| 661 | Ga0495684_0386547 | 3300047471 | Bacteria | 986 |
| 662 | Ga0495593_0007133 | 3300047673 | Bacteria | 6552 |
| 663 | Ga0495593_0031295 | 3300047673 | Bacteria | 2908 |
| 664 | Ga0495593_0074802 | 3300047673 | Bacteria | 1756 |
| 665 | Ga0495602_0000776 | 3300048088 | Bacteria | 30394 |
| 666 | Ga0495602_0006877 | 3300048088 | Bacteria | 11953 |
| 667 | Ga0495602_0107826 | 3300048088 | Bacteria | 2269 |
| 668 | Ga0495602_0168941 | 3300048088 | Bacteria | 1699 |
| 669 | Ga0495602_0208515 | 3300048088 | Bacteria | 1485 |
| 670 | Ga0495614_0038605 | 3300048089 | Bacteria | 2049 |
| 671 | Ga0496100_0002767 | 3300048903 | Bacteria | 8965 |
| 672 | Ga0496100_0015150 | 3300048903 | Bacteria | 4497 |
| 673 | Ga0496100_0138431 | 3300048903 | Bacteria | 1722 |
| 674 | Ga0496101_0044420 | 3300048904 | Bacteria | 3180 |
| 675 | Ga0496101_0081575 | 3300048904 | Bacteria | 2392 |
| 676 | Ga0496101_0599084 | 3300048904 | Bacteria | 871 |
| 677 | Ga0496102_0005624 | 3300048905 | Bacteria | 10639 |
| 678 | Ga0496102_0090459 | 3300048905 | Bacteria | 2832 |
| 679 | Ga0496102_0127882 | 3300048905 | Bacteria | 2376 |
| 680 | Ga0496102_0255950 | 3300048905 | Bacteria | 1650 |
| 681 | Ga0496102_0271239 | 3300048905 | Bacteria | 1600 |
| 682 | Ga0496103_0030884 | 3300048906 | Bacteria | 3261 |
| 683 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 684 | Ga0496104_0041796 | 3300048907 | Bacteria | 4299 |
| 685 | Ga0496104_0175177 | 3300048907 | Bacteria | 2055 |
| 686 | Ga0496104_0532743 | 3300048907 | Bacteria | 1085 |
| 687 | Ga0496105_0003752 | 3300048908 | Bacteria | 11320 |
| 688 | Ga0496105_0006025 | 3300048908 | Bacteria | 9268 |
| 689 | Ga0496105_0113109 | 3300048908 | Bacteria | 2240 |
| 690 | Ga0496105_0116807 | 3300048908 | Bacteria | 2201 |
| 691 | Ga0496105_0244408 | 3300048908 | Bacteria | 1455 |
| 692 | Ga0496106_0002308 | 3300048909 | Bacteria | 14232 |
| 693 | Ga0496106_0040080 | 3300048909 | Bacteria | 3507 |
| 694 | Ga0496106_0084416 | 3300048909 | Bacteria | 2443 |
| 695 | Ga0496106_0105407 | 3300048909 | Bacteria | 2190 |
| 696 | Ga0496107_0035169 | 3300048910 | Bacteria | 3591 |
| 697 | Ga0496107_0272976 | 3300048910 | Bacteria | 1258 |
| 698 | Ga0496108_0008222 | 3300048911 | Bacteria | 8468 |
| 699 | Ga0496108_0015654 | 3300048911 | Bacteria | 6186 |
| 700 | Ga0496108_0034918 | 3300048911 | Bacteria | 4178 |
| 701 | Ga0496109_0002084 | 3300048912 | Bacteria | 16616 |
| 702 | Ga0496109_0013436 | 3300048912 | Bacteria | 7102 |
| 703 | Ga0496109_0266679 | 3300048912 | Bacteria | 1613 |
| 704 | Ga0496110_0021235 | 3300048913 | Bacteria | 5493 |
| 705 | Ga0496110_0063281 | 3300048913 | Bacteria | 3268 |
| 706 | Ga0496110_0239521 | 3300048913 | Bacteria | 1651 |
| 707 | Ga0496111_0208362 | 3300048914 | Unclassified | 1452 |
| 708 | Ga0496111_0313430 | 3300048914 | Bacteria | 1162 |
| 709 | Ga0496112_0079495 | 3300048915 | Bacteria | 3243 |
| 710 | Ga0496112_0090817 | 3300048915 | Bacteria | 3023 |
| 711 | Ga0496112_0230526 | 3300048915 | Bacteria | 1806 |
| 712 | Ga0496112_0392614 | 3300048915 | Bacteria | 1328 |
| 713 | Ga0496113_0005585 | 3300048916 | Bacteria | 7861 |
| 714 | Ga0496113_0009576 | 3300048916 | Bacteria | 6357 |
| 715 | Ga0496113_0113591 | 3300048916 | Bacteria | 2111 |
| 716 | Ga0496114_0058116 | 3300048917 | Bacteria | 3229 |
| 717 | Ga0496114_0065102 | 3300048917 | Bacteria | 3053 |
| 718 | Ga0496114_0150389 | 3300048917 | Bacteria | 2019 |
| 719 | Ga0496115_0043074 | 3300048918 | Bacteria | 3598 |
| 720 | Ga0496115_0056441 | 3300048918 | Bacteria | 3156 |
| 721 | Ga0496115_0062136 | 3300048918 | Bacteria | 3012 |
| 722 | Ga0496115_0081951 | 3300048918 | Bacteria | 2628 |
| 723 | Ga0501032_0219459 | 3300049569 | Bacteria | 1238 |
| 724 | Ga0501034_0140283 | 3300049571 | Bacteria | 2397 |
| 725 | Ga0501034_0182434 | 3300049571 | Bacteria | 2063 |
| 726 | Ga0501034_0281827 | 3300049571 | Bacteria | 1601 |
| 727 | Ga0501036_0158102 | 3300049572 | Bacteria | 1911 |
| 728 | Ga0501036_0193589 | 3300049572 | Bacteria | 1710 |
| 729 | Ga0501036_0331580 | 3300049572 | Bacteria | 1271 |
| 730 | Ga0501036_0437357 | 3300049572 | Bacteria | 1090 |
| 731 | Ga0501037_0058837 | 3300049573 | Bacteria | 2803 |
| 732 | Ga0501038_0014576 | 3300049574 | Bacteria | 7164 |
| 733 | Ga0501038_0026051 | 3300049574 | Bacteria | 5208 |
| 734 | Ga0501038_0123017 | 3300049574 | Bacteria | 2137 |
| 735 | Ga0501039_0028565 | 3300049575 | Bacteria | 4293 |
| 736 | Ga0501043_0013503 | 3300049579 | Bacteria | 6390 |
| 737 | Ga0501043_0135863 | 3300049579 | Bacteria | 1926 |
| 738 | Ga0501046_0089002 | 3300049580 | Bacteria | 2377 |
| 739 | Ga0501047_0064372 | 3300049581 | Bacteria | 3536 |
| 740 | Ga0501047_0151325 | 3300049581 | Bacteria | 2196 |
| 741 | Ga0501047_0213918 | 3300049581 | Bacteria | 1785 |
| 742 | Ga0501068_0027696 | 3300049584 | Bacteria | 3347 |
| 743 | Ga0501069_0074323 | 3300049585 | Bacteria | 1907 |
| 744 | Ga0501070_0037217 | 3300049586 | Bacteria | 4063 |
| 745 | Ga0501070_0088179 | 3300049586 | Bacteria | 2568 |
| 746 | Ga0501070_0119752 | 3300049586 | Bacteria | 2175 |
| 747 | Ga0501070_0313609 | 3300049586 | Bacteria | 1276 |
| 748 | Ga0501070_0435956 | 3300049586 | Bacteria | 1057 |
| 749 | Ga0501071_0255826 | 3300049587 | Bacteria | 1322 |
| 750 | Ga0501071_0486177 | 3300049587 | Bacteria | 946 |
| 751 | Ga0501072_0106653 | 3300049588 | Bacteria | 2228 |
| 752 | Ga0501073_0024957 | 3300049589 | Bacteria | 4289 |
| 753 | Ga0501073_0208197 | 3300049589 | Bacteria | 1351 |
| 754 | Ga0501073_0300587 | 3300049589 | Bacteria | 1107 |
| 755 | Ga0501075_0097106 | 3300049591 | Bacteria | 2236 |
| 756 | Ga0501075_0170621 | 3300049591 | Bacteria | 1660 |
| 757 | Ga0501076_0207590 | 3300049592 | Bacteria | 1600 |
| 758 | Ga0501079_0061605 | 3300049741 | Bacteria | 2894 |
| 759 | Ga0501079_0108547 | 3300049741 | Bacteria | 2155 |
| 760 | Ga0501080_0058855 | 3300049742 | Bacteria | 3576 |
| 761 | Ga0501080_0126999 | 3300049742 | Bacteria | 2362 |
| 762 | Ga0501080_0199615 | 3300049742 | Bacteria | 1837 |
| 763 | Ga0501080_0375490 | 3300049742 | Bacteria | 1281 |
| 764 | Ga0501081_0013022 | 3300049743 | Bacteria | 5471 |
| 765 | Ga0501081_0296281 | 3300049743 | Bacteria | 1186 |
| 766 | Ga0501083_0106665 | 3300049744 | Bacteria | 1844 |
| 767 | Ga0501083_0187620 | 3300049744 | Bacteria | 1350 |
| 768 | Ga0501035_0032190 | 3300049822 | Bacteria | 4772 |
| 769 | Ga0501035_0058217 | 3300049822 | Bacteria | 3444 |
| 770 | Ga0501035_0128538 | 3300049822 | Bacteria | 2210 |
| 771 | Ga0501035_0213467 | 3300049822 | Bacteria | 1650 |
| 772 | Ga0501044_0157300 | 3300049823 | Bacteria | 2251 |
| 773 | nmdc:mga06z11_158180_c1 | 3300050494 | Unclassified | 1293 |
| 774 | nmdc:mga06z11_45500_c1 | 3300050494 | Bacteria | 2219 |
| 775 | nmdc:mga05p37_114452_c1 | 3300050507 | Bacteria | 3316 |
| 776 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 777 | nmdc:mga09592_1702_c1 | 3300050508 | Bacteria | 17731 |
| 778 | nmdc:mga0qj67_50198_c1 | 3300050509 | Bacteria | 3299 |
| 779 | nmdc:mga06r32_2037_c1 | 3300050510 | Bacteria | 18072 |
| 780 | nmdc:mga08y16_12219_c1 | 3300050511 | Bacteria | 9024 |
| 781 | nmdc:mga08y16_1809_c1 | 3300050511 | Bacteria | 21689 |
| 782 | nmdc:mga08y16_199543_c1 | 3300050511 | Bacteria | 2073 |
| 783 | nmdc:mga08y16_212290_c1 | 3300050511 | Bacteria | 2005 |
| 784 | nmdc:mga0n895_120612_c1 | 3300050512 | Bacteria | 2643 |
| 785 | nmdc:mga0n895_184670_c1 | 3300050512 | Bacteria | 2116 |
| 786 | nmdc:mga0n895_326507_c1 | 3300050512 | Bacteria | 1555 |
| 787 | nmdc:mga0n895_37587_c1 | 3300050512 | Bacteria | 4685 |
| 788 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 789 | nmdc:mga0rr50_1204_c1 | 3300050513 | Bacteria | 14048 |
| 790 | nmdc:mga0rr50_206291_c1 | 3300050513 | Unclassified | 1617 |
| 791 | nmdc:mga0rr50_93838_c1 | 3300050513 | Bacteria | 2342 |
| 792 | nmdc:mga0a205_106498_c1 | 3300050515 | Bacteria | 2701 |
| 793 | nmdc:mga0a205_113332_c1 | 3300050515 | Bacteria | 2611 |
| 794 | nmdc:mga0a205_3268_c1 | 3300050515 | Bacteria | 14416 |
| 795 | nmdc:mga0a205_72068_c1 | 3300050515 | Bacteria | 3337 |
| 796 | Ga0495601_0000107 | 3300053077 | Bacteria | 45730 |
| 797 | Ga0495601_0001733 | 3300053077 | Bacteria | 12062 |
| 798 | Ga0495601_0019931 | 3300053077 | Bacteria | 4093 |
| 799 | Ga0495601_0028792 | 3300053077 | Bacteria | 3442 |
| 800 | Ga0495612_0000162 | 3300053078 | Bacteria | 27772 |
| 801 | Ga0495612_0007461 | 3300053078 | Bacteria | 4468 |
| 802 | Ga0495612_0009252 | 3300053078 | Bacteria | 3997 |
| 803 | Ga0495612_0167625 | 3300053078 | Bacteria | 961 |
| 804 | Ga0495612_0170299 | 3300053078 | Bacteria | 953 |
| 805 | Ga0495595_0001476 | 3300053084 | Bacteria | 9177 |
| 806 | Ga0495595_0075954 | 3300053084 | Bacteria | 1594 |
| 807 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 808 | Ga0495619_0000337 | 3300053085 | Bacteria | 32903 |
| 809 | Ga0495619_0002709 | 3300053085 | Bacteria | 11585 |
| 810 | Ga0495619_0020702 | 3300053085 | Bacteria | 4193 |
| 811 | Ga0495619_0029836 | 3300053085 | Bacteria | 3526 |
| 812 | Ga0495619_0170464 | 3300053085 | Bacteria | 1505 |
| 813 | Ga0495619_0390915 | 3300053085 | Bacteria | 961 |
| 814 | Ga0500643_021801 | 3300053087 | Bacteria | 2072 |
| 815 | Ga0500644_0001646 | 3300053088 | Bacteria | 5827 |
| 816 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 817 | Ga0500652_006268 | 3300053131 | Bacteria | 3817 |
| 818 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 819 | Ga0500645_000099 | 3300053730 | Bacteria | 68426 |
| 820 | Ga0501084_0098245 | 3300054114 | Bacteria | 2458 |
| 821 | Ga0501084_0150084 | 3300054114 | Bacteria | 1964 |
| 822 | Ga0501082_0042849 | 3300060353 | Bacteria | 3902 |
| 823 | Ga0501082_0194760 | 3300060353 | Bacteria | 1763 |
| 824 | Ga0466962_0067368 | 3300061719 | Bacteria | 1709 |
| 825 | Ga0530510_0078676 | 3300061734 | Bacteria | 2398 |
| 826 | Ga0530510_0391726 | 3300061734 | Bacteria | 1046 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049591 | Ga0501075_0097106 | Ga0501075_0097106_85_822 | 216 |
| 2 | 3300049586 | Ga0501070_0313609 | Ga0501070_0313609_29_805 | 239 |
| 3 | 3300003203 | JGI25406J46586_10000594 | JGI25406J46586_100005946 | 250 |
| 4 | 3300005985 | Ga0081539_10001482 | Ga0081539_1000148226 | 250 |
| 5 | 3300013296 | Ga0157374_10028071 | Ga0157374_100280716 | 254 |
| 6 | 3300049742 | Ga0501080_0199615 | Ga0501080_0199615_770_1633 | 257 |
| 7 | 3300049743 | Ga0501081_0013022 | Ga0501081_0013022_3321_4184 | 257 |
| 8 | 3300054114 | Ga0501084_0098245 | Ga0501084_0098245_209_1072 | 257 |
| 9 | 3300061734 | Ga0530510_0391726 | Ga0530510_0391726_100_963 | 257 |
| 10 | 3300053078 | Ga0495612_0167625 | Ga0495612_0167625_120_914 | 259 |
| 11 | 3300060353 | Ga0501082_0194760 | Ga0501082_0194760_559_1350 | 259 |
| 12 | 3300049572 | Ga0501036_0437357 | Ga0501036_0437357_65_955 | 262 |
| 13 | 3300049579 | Ga0501043_0135863 | Ga0501043_0135863_317_1207 | 262 |
| 14 | 3300049742 | Ga0501080_0126999 | Ga0501080_0126999_1158_2048 | 262 |
| 15 | 3300049822 | Ga0501035_0213467 | Ga0501035_0213467_17_907 | 262 |
| 16 | 3300025923 | Ga0207681_10038404 | Ga0207681_100384041 | 263 |
| 17 | 3300048904 | Ga0496101_0599084 | Ga0496101_0599084_24_818 | 264 |
| 18 | iso_pu_bacteria | 2894772417 | 2894773596 | 264 |
| 19 | 3300048088 | Ga0495602_0208515 | Ga0495602_0208515_636_1445 | 265 |
| 20 | 3300045051 | Ga0451576_0396498 | Ga0451576_0396498_593_1432 | 266 |
| 21 | 3300035121 | Ga0373960_0014057 | Ga0373960_0014057_16_819 | 267 |
| 22 | 3300035241 | Ga0373961_0038548 | Ga0373961_0038548_553_1356 | 267 |
| 23 | 3300036401 | Ga0373937_0054598 | Ga0373937_0054598_177_1082 | 268 |
| 24 | 3300046459 | Ga0495629_0112296 | Ga0495629_0112296_35_841 | 268 |
| 25 | 3300046516 | Ga0495628_0006361 | Ga0495628_0006361_10_816 | 268 |
| 26 | 3300046529 | Ga0495652_0072716 | Ga0495652_0072716_1744_2649 | 268 |
| 27 | 3300046559 | Ga0495667_0034869 | Ga0495667_0034869_965_1870 | 268 |
| 28 | 3300046663 | Ga0495635_0061311 | Ga0495635_0061311_1423_2328 | 268 |
| 29 | 3300047317 | Ga0495604_0064299 | Ga0495604_0064299_1723_2628 | 268 |
| 30 | 3300047319 | Ga0495674_0029272 | Ga0495674_0029272_971_1876 | 268 |
| 31 | 3300047322 | Ga0495680_0081031 | Ga0495680_0081031_92_997 | 268 |
| 32 | 3300047471 | Ga0495684_0386547 | Ga0495684_0386547_45_950 | 268 |
| 33 | 3300047673 | Ga0495593_0031295 | Ga0495593_0031295_969_1874 | 268 |
| 34 | 3300053077 | Ga0495601_0001733 | Ga0495601_0001733_6831_7736 | 268 |
| 35 | 3300053078 | Ga0495612_0170299 | Ga0495612_0170299_10_816 | 268 |
| 36 | 3300053085 | Ga0495619_0000045 | Ga0495619_0000045_78934_79839 | 268 |
| 37 | 3300013104 | Ga0157370_10151546 | Ga0157370_101515461 | 269 |
| 38 | 3300025921 | Ga0207652_10027424 | Ga0207652_100274245 | 269 |
| 39 | 3300005434 | Ga0070709_10032744 | Ga0070709_100327442 | 270 |
| 40 | 3300005436 | Ga0070713_100001192 | Ga0070713_10000119210 | 270 |
| 41 | 3300005439 | Ga0070711_100006635 | Ga0070711_1000066357 | 270 |
| 42 | 3300005439 | Ga0070711_100064343 | Ga0070711_1000643431 | 270 |
| 43 | 3300006028 | Ga0070717_10088976 | Ga0070717_100889762 | 270 |
| 44 | 3300006175 | Ga0070712_100153422 | Ga0070712_1001534222 | 270 |
| 45 | 3300025915 | Ga0207693_10271129 | Ga0207693_102711292 | 270 |
| 46 | 3300025916 | Ga0207663_10047876 | Ga0207663_100478763 | 270 |
| 47 | 3300025916 | Ga0207663_10127052 | Ga0207663_101270521 | 270 |
| 48 | 3300031241 | Ga0265325_10000264 | Ga0265325_1000026436 | 270 |
| 49 | 3300031595 | Ga0265313_10069516 | Ga0265313_100695161 | 270 |
| 50 | 3300035086 | Ga0373934_0099366 | Ga0373934_0099366_247_1152 | 270 |
| 51 | 3300035120 | Ga0373957_0052537 | Ga0373957_0052537_611_1516 | 270 |
| 52 | 3300035170 | Ga0373943_0082021 | Ga0373943_0082021_531_1436 | 270 |
| 53 | 3300035172 | Ga0373955_0002733 | Ga0373955_0002733_5145_6050 | 270 |
| 54 | 3300035410 | Ga0373924_0170489 | Ga0373924_0170489_13_873 | 270 |
| 55 | 3300036401 | Ga0373937_0014261 | Ga0373937_0014261_2714_3619 | 270 |
| 56 | 3300036401 | Ga0373937_0376761 | Ga0373937_0376761_410_1315 | 270 |
| 57 | 3300036647 | Ga0316582_0188954 | Ga0316582_0188954_300_1181 | 270 |
| 58 | 3300037068 | Ga0373925_0049481 | Ga0373925_0049481_605_1510 | 270 |
| 59 | 3300046462 | Ga0495651_0020710 | Ga0495651_0020710_807_1712 | 270 |
| 60 | 3300046516 | Ga0495628_0011889 | Ga0495628_0011889_5155_6060 | 270 |
| 61 | 3300046529 | Ga0495652_0011053 | Ga0495652_0011053_2162_3067 | 270 |
| 62 | 3300046536 | Ga0495587_0025703 | Ga0495587_0025703_1715_2620 | 270 |
| 63 | 3300046543 | Ga0495645_0003160 | Ga0495645_0003160_4855_5760 | 270 |
| 64 | 3300046663 | Ga0495635_0061844 | Ga0495635_0061844_1046_1951 | 270 |
| 65 | 3300046678 | Ga0495599_0006608 | Ga0495599_0006608_707_1612 | 270 |
| 66 | 3300046679 | Ga0495623_0035467 | Ga0495623_0035467_26_886 | 270 |
| 67 | 3300047317 | Ga0495604_0036706 | Ga0495604_0036706_1537_2442 | 270 |
| 68 | 3300047319 | Ga0495674_0093302 | Ga0495674_0093302_1346_2251 | 270 |
| 69 | 3300047444 | Ga0495675_0036408 | Ga0495675_0036408_191_1096 | 270 |
| 70 | 3300048088 | Ga0495602_0000776 | Ga0495602_0000776_13022_13927 | 270 |
| 71 | 3300048907 | Ga0496104_0000092 | Ga0496104_0000092_48054_48914 | 270 |
| 72 | 3300048908 | Ga0496105_0003752 | Ga0496105_0003752_923_1783 | 270 |
| 73 | 3300048918 | Ga0496115_0081951 | Ga0496115_0081951_511_1371 | 270 |
| 74 | 3300053077 | Ga0495601_0000107 | Ga0495601_0000107_18862_19767 | 270 |
| 75 | 3300053078 | Ga0495612_0000162 | Ga0495612_0000162_3608_4513 | 270 |
| 76 | 3300053084 | Ga0495595_0001476 | Ga0495595_0001476_1947_2852 | 270 |
| 77 | 3300053085 | Ga0495619_0002709 | Ga0495619_0002709_5301_6206 | 270 |
| 78 | 3300053085 | Ga0495619_0390915 | Ga0495619_0390915_40_900 | 270 |
| 79 | 3300009148 | Ga0105243_10131072 | Ga0105243_101310722 | 271 |
| 80 | 3300025935 | Ga0207709_10141922 | Ga0207709_101419222 | 271 |
| 81 | 3300049572 | Ga0501036_0158102 | Ga0501036_0158102_285_1112 | 271 |
| 82 | 3300049574 | Ga0501038_0026051 | Ga0501038_0026051_763_1590 | 271 |
| 83 | 3300049580 | Ga0501046_0089002 | Ga0501046_0089002_41_868 | 271 |
| 84 | 3300049581 | Ga0501047_0151325 | Ga0501047_0151325_908_1735 | 271 |
| 85 | 3300049589 | Ga0501073_0024957 | Ga0501073_0024957_3024_3851 | 271 |
| 86 | 3300049742 | Ga0501080_0058855 | Ga0501080_0058855_2225_3052 | 271 |
| 87 | 3300049823 | Ga0501044_0157300 | Ga0501044_0157300_819_1646 | 271 |
| 88 | 3300005445 | Ga0070708_100018331 | Ga0070708_1000183315 | 272 |
| 89 | 3300005617 | Ga0068859_100008349 | Ga0068859_1000083494 | 272 |
| 90 | 3300005718 | Ga0068866_10001816 | Ga0068866_100018166 | 272 |
| 91 | 3300005841 | Ga0068863_100023028 | Ga0068863_1000230281 | 272 |
| 92 | 3300005844 | Ga0068862_100150419 | Ga0068862_1001504193 | 272 |
| 93 | 3300005844 | Ga0068862_100372080 | Ga0068862_1003720801 | 272 |
| 94 | 3300006871 | Ga0075434_100006467 | Ga0075434_10000646711 | 272 |
| 95 | 3300006931 | Ga0097620_100008349 | Ga0097620_1000083494 | 272 |
| 96 | 3300009098 | Ga0105245_10120387 | Ga0105245_101203871 | 272 |
| 97 | 3300009545 | Ga0105237_10031006 | Ga0105237_100310067 | 272 |
| 98 | 3300013297 | Ga0157378_10261221 | Ga0157378_102612213 | 272 |
| 99 | 3300017792 | Ga0163161_10027479 | Ga0163161_100274796 | 272 |
| 100 | 3300025290 | Ga0207673_1000758 | Ga0207673_10007582 | 272 |
| 101 | 3300025901 | Ga0207688_10000229 | Ga0207688_100002297 | 272 |
| 102 | 3300025912 | Ga0207707_10131577 | Ga0207707_101315772 | 272 |
| 103 | 3300025926 | Ga0207659_10001285 | Ga0207659_100012851 | 272 |
| 104 | 3300025927 | Ga0207687_10132991 | Ga0207687_101329911 | 272 |
| 105 | 3300025937 | Ga0207669_10014544 | Ga0207669_100145441 | 272 |
| 106 | 3300026088 | Ga0207641_10094986 | Ga0207641_100949862 | 272 |
| 107 | 3300027695 | Ga0209966_1009770 | Ga0209966_10097702 | 272 |
| 108 | 3300027876 | Ga0209974_10002830 | Ga0209974_100028303 | 272 |
| 109 | 3300027907 | Ga0207428_10000165 | Ga0207428_100001657 | 272 |
| 110 | 3300028380 | Ga0268265_10066454 | Ga0268265_100664541 | 272 |
| 111 | 3300031507 | Ga0307509_10376187 | Ga0307509_103761872 | 272 |
| 112 | 3300034816 | Ga0373930_0013677 | Ga0373930_0013677_310_1170 | 272 |
| 113 | 3300034957 | Ga0373938_0016684 | Ga0373938_0016684_154_1014 | 272 |
| 114 | 3300035242 | Ga0373962_0006580 | Ga0373962_0006580_132_992 | 272 |
| 115 | 3300046491 | Ga0495584_0102450 | Ga0495584_0102450_377_1237 | 272 |
| 116 | 3300048906 | Ga0496103_0030884 | Ga0496103_0030884_54_914 | 272 |
| 117 | 3300048907 | Ga0496104_0532743 | Ga0496104_0532743_82_942 | 272 |
| 118 | 3300048911 | Ga0496108_0008222 | Ga0496108_0008222_1192_2052 | 272 |
| 119 | 3300050512 | nmdc:mga0n895_37587_c1 | nmdc:mga0n895_37587_c1_3610_4470 | 272 |
| 120 | 3300000041 | ARcpr5oldR_c006817 | ARcpr5oldR_0068171 | 273 |
| 121 | 3300001904 | JGI24736J21556_1015770 | JGI24736J21556_10157701 | 273 |
| 122 | 3300001978 | JGI24747J21853_1000375 | JGI24747J21853_10003751 | 273 |
| 123 | 3300001989 | JGI24739J22299_10005003 | JGI24739J22299_100050031 | 273 |
| 124 | 3300001990 | JGI24737J22298_10006384 | JGI24737J22298_100063842 | 273 |
| 125 | 3300002070 | JGI24750J21931_1007838 | JGI24750J21931_10078382 | 273 |
| 126 | 3300002073 | JGI24745J21846_1001867 | JGI24745J21846_10018671 | 273 |
| 127 | 3300002074 | JGI24748J21848_1006144 | JGI24748J21848_10061442 | 273 |
| 128 | 3300002076 | JGI24749J21850_1009858 | JGI24749J21850_10098581 | 273 |
| 129 | 3300002077 | JGI24744J21845_10002596 | JGI24744J21845_100025961 | 273 |
| 130 | 3300002155 | JGI24033J26618_1003037 | JGI24033J26618_10030371 | 273 |
| 131 | 3300002239 | JGI24034J26672_10000829 | JGI24034J26672_100008296 | 273 |
| 132 | 3300002244 | JGI24742J22300_10015325 | JGI24742J22300_100153252 | 273 |
| 133 | 3300005293 | Ga0065715_10000519 | Ga0065715_1000051915 | 273 |
| 134 | 3300005329 | Ga0070683_100008697 | Ga0070683_1000086971 | 273 |
| 135 | 3300005330 | Ga0070690_100010289 | Ga0070690_1000102893 | 273 |
| 136 | 3300005330 | Ga0070690_100062482 | Ga0070690_1000624821 | 273 |
| 137 | 3300005331 | Ga0070670_100072895 | Ga0070670_1000728953 | 273 |
| 138 | 3300005333 | Ga0070677_10009111 | Ga0070677_100091111 | 273 |
| 139 | 3300005334 | Ga0068869_100030072 | Ga0068869_1000300723 | 273 |
| 140 | 3300005334 | Ga0068869_100036646 | Ga0068869_1000366464 | 273 |
| 141 | 3300005335 | Ga0070666_10006379 | Ga0070666_100063795 | 273 |
| 142 | 3300005336 | Ga0070680_100003646 | Ga0070680_10000364611 | 273 |
| 143 | 3300005337 | Ga0070682_100006855 | Ga0070682_1000068552 | 273 |
| 144 | 3300005337 | Ga0070682_100014492 | Ga0070682_1000144923 | 273 |
| 145 | 3300005338 | Ga0068868_100001527 | Ga0068868_1000015275 | 273 |
| 146 | 3300005338 | Ga0068868_100215125 | Ga0068868_1002151252 | 273 |
| 147 | 3300005339 | Ga0070660_100007921 | Ga0070660_1000079212 | 273 |
| 148 | 3300005339 | Ga0070660_100224086 | Ga0070660_1002240863 | 273 |
| 149 | 3300005340 | Ga0070689_100000423 | Ga0070689_10000042326 | 273 |
| 150 | 3300005340 | Ga0070689_100030326 | Ga0070689_1000303264 | 273 |
| 151 | 3300005341 | Ga0070691_10030986 | Ga0070691_100309863 | 273 |
| 152 | 3300005343 | Ga0070687_100010609 | Ga0070687_1000106092 | 273 |
| 153 | 3300005343 | Ga0070687_100020102 | Ga0070687_1000201023 | 273 |
| 154 | 3300005344 | Ga0070661_100001619 | Ga0070661_10000161914 | 273 |
| 155 | 3300005344 | Ga0070661_100027189 | Ga0070661_1000271892 | 273 |
| 156 | 3300005345 | Ga0070692_10007636 | Ga0070692_100076361 | 273 |
| 157 | 3300005347 | Ga0070668_100042277 | Ga0070668_1000422774 | 273 |
| 158 | 3300005353 | Ga0070669_100001139 | Ga0070669_10000113918 | 273 |
| 159 | 3300005354 | Ga0070675_100043846 | Ga0070675_1000438464 | 273 |
| 160 | 3300005355 | Ga0070671_100000920 | Ga0070671_10000092018 | 273 |
| 161 | 3300005364 | Ga0070673_100023791 | Ga0070673_1000237913 | 273 |
| 162 | 3300005364 | Ga0070673_100047093 | Ga0070673_1000470933 | 273 |
| 163 | 3300005365 | Ga0070688_100014995 | Ga0070688_1000149953 | 273 |
| 164 | 3300005366 | Ga0070659_100015775 | Ga0070659_1000157751 | 273 |
| 165 | 3300005367 | Ga0070667_100014147 | Ga0070667_1000141476 | 273 |
| 166 | 3300005434 | Ga0070709_10089090 | Ga0070709_100890901 | 273 |
| 167 | 3300005435 | Ga0070714_100018806 | Ga0070714_1000188065 | 273 |
| 168 | 3300005438 | Ga0070701_10000614 | Ga0070701_100006148 | 273 |
| 169 | 3300005439 | Ga0070711_100071103 | Ga0070711_1000711032 | 273 |
| 170 | 3300005441 | Ga0070700_100259116 | Ga0070700_1002591161 | 273 |
| 171 | 3300005444 | Ga0070694_100003931 | Ga0070694_1000039311 | 273 |
| 172 | 3300005444 | Ga0070694_100189413 | Ga0070694_1001894132 | 273 |
| 173 | 3300005455 | Ga0070663_100317688 | Ga0070663_1003176881 | 273 |
| 174 | 3300005456 | Ga0070678_100002661 | Ga0070678_1000026612 | 273 |
| 175 | 3300005457 | Ga0070662_100004411 | Ga0070662_1000044111 | 273 |
| 176 | 3300005458 | Ga0070681_10080212 | Ga0070681_100802124 | 273 |
| 177 | 3300005458 | Ga0070681_10114978 | Ga0070681_101149782 | 273 |
| 178 | 3300005459 | Ga0068867_100006480 | Ga0068867_1000064806 | 273 |
| 179 | 3300005530 | Ga0070679_100005088 | Ga0070679_10000508811 | 273 |
| 180 | 3300005543 | Ga0070672_100006170 | Ga0070672_1000061702 | 273 |
| 181 | 3300005544 | Ga0070686_100010831 | Ga0070686_1000108315 | 273 |
| 182 | 3300005544 | Ga0070686_100019639 | Ga0070686_1000196394 | 273 |
| 183 | 3300005545 | Ga0070695_100043885 | Ga0070695_1000438853 | 273 |
| 184 | 3300005546 | Ga0070696_100004009 | Ga0070696_1000040092 | 273 |
| 185 | 3300005547 | Ga0070693_100002242 | Ga0070693_10000224210 | 273 |
| 186 | 3300005548 | Ga0070665_100074891 | Ga0070665_1000748912 | 273 |
| 187 | 3300005549 | Ga0070704_100007752 | Ga0070704_1000077523 | 273 |
| 188 | 3300005563 | Ga0068855_100011293 | Ga0068855_10001129311 | 273 |
| 189 | 3300005564 | Ga0070664_100039417 | Ga0070664_1000394175 | 273 |
| 190 | 3300005564 | Ga0070664_100060752 | Ga0070664_1000607525 | 273 |
| 191 | 3300005577 | Ga0068857_100001682 | Ga0068857_10000168212 | 273 |
| 192 | 3300005578 | Ga0068854_100004886 | Ga0068854_1000048861 | 273 |
| 193 | 3300005614 | Ga0068856_100008165 | Ga0068856_1000081654 | 273 |
| 194 | 3300005614 | Ga0068856_100067227 | Ga0068856_1000672274 | 273 |
| 195 | 3300005615 | Ga0070702_100037932 | Ga0070702_1000379323 | 273 |
| 196 | 3300005616 | Ga0068852_100001494 | Ga0068852_10000149413 | 273 |
| 197 | 3300005618 | Ga0068864_100001074 | Ga0068864_10000107423 | 273 |
| 198 | 3300005618 | Ga0068864_100063921 | Ga0068864_1000639213 | 273 |
| 199 | 3300005719 | Ga0068861_100040271 | Ga0068861_1000402711 | 273 |
| 200 | 3300005834 | Ga0068851_10026105 | Ga0068851_100261054 | 273 |
| 201 | 3300005840 | Ga0068870_10000051 | Ga0068870_100000518 | 273 |
| 202 | 3300005842 | Ga0068858_100005723 | Ga0068858_1000057236 | 273 |
| 203 | 3300005843 | Ga0068860_100001825 | Ga0068860_1000018255 | 273 |
| 204 | 3300005937 | Ga0081455_10000081 | Ga0081455_100000818 | 273 |
| 205 | 3300006028 | Ga0070717_10103396 | Ga0070717_101033964 | 273 |
| 206 | 3300006173 | Ga0070716_100004877 | Ga0070716_1000048773 | 273 |
| 207 | 3300006178 | Ga0075367_10037100 | Ga0075367_100371002 | 273 |
| 208 | 3300006237 | Ga0097621_100002133 | Ga0097621_1000021339 | 273 |
| 209 | 3300006237 | Ga0097621_100002924 | Ga0097621_10000292411 | 273 |
| 210 | 3300006358 | Ga0068871_100029472 | Ga0068871_1000294726 | 273 |
| 211 | 3300006358 | Ga0068871_100039055 | Ga0068871_1000390555 | 273 |
| 212 | 3300006852 | Ga0075433_10035548 | Ga0075433_100355481 | 273 |
| 213 | 3300006881 | Ga0068865_100031407 | Ga0068865_1000314075 | 273 |
| 214 | 3300006881 | Ga0068865_100032338 | Ga0068865_1000323385 | 273 |
| 215 | 3300006914 | Ga0075436_100012725 | Ga0075436_1000127255 | 273 |
| 216 | 3300007076 | Ga0075435_100041124 | Ga0075435_1000411244 | 273 |
| 217 | 3300009011 | Ga0105251_10019521 | Ga0105251_100195214 | 273 |
| 218 | 3300009093 | Ga0105240_10049462 | Ga0105240_100494624 | 273 |
| 219 | 3300009094 | Ga0111539_10032539 | Ga0111539_100325395 | 273 |
| 220 | 3300009094 | Ga0111539_10059301 | Ga0111539_100593017 | 273 |
| 221 | 3300009101 | Ga0105247_10002735 | Ga0105247_100027359 | 273 |
| 222 | 3300009148 | Ga0105243_10023377 | Ga0105243_100233773 | 273 |
| 223 | 3300009148 | Ga0105243_10036757 | Ga0105243_100367576 | 273 |
| 224 | 3300009174 | Ga0105241_10010830 | Ga0105241_100108307 | 273 |
| 225 | 3300009174 | Ga0105241_10016796 | Ga0105241_100167968 | 273 |
| 226 | 3300009176 | Ga0105242_10056130 | Ga0105242_100561301 | 273 |
| 227 | 3300009177 | Ga0105248_10010592 | Ga0105248_100105927 | 273 |
| 228 | 3300009551 | Ga0105238_10208106 | Ga0105238_102081061 | 273 |
| 229 | 3300009553 | Ga0105249_10001193 | Ga0105249_1000119322 | 273 |
| 230 | 3300011119 | Ga0105246_10000255 | Ga0105246_1000025511 | 273 |
| 231 | 3300011119 | Ga0105246_10239870 | Ga0105246_102398701 | 273 |
| 232 | 3300013100 | Ga0157373_10049682 | Ga0157373_100496822 | 273 |
| 233 | 3300013100 | Ga0157373_10071545 | Ga0157373_100715453 | 273 |
| 234 | 3300013102 | Ga0157371_10017533 | Ga0157371_100175333 | 273 |
| 235 | 3300013296 | Ga0157374_10042269 | Ga0157374_100422692 | 273 |
| 236 | 3300013296 | Ga0157374_10198445 | Ga0157374_101984452 | 273 |
| 237 | 3300013297 | Ga0157378_10140503 | Ga0157378_101405033 | 273 |
| 238 | 3300013307 | Ga0157372_10027692 | Ga0157372_100276922 | 273 |
| 239 | 3300013308 | Ga0157375_10020563 | Ga0157375_100205635 | 273 |
| 240 | 3300013308 | Ga0157375_10307533 | Ga0157375_103075331 | 273 |
| 241 | 3300014325 | Ga0163163_10087213 | Ga0163163_100872132 | 273 |
| 242 | 3300014326 | Ga0157380_10005310 | Ga0157380_1000531010 | 273 |
| 243 | 3300014745 | Ga0157377_10000164 | Ga0157377_1000016441 | 273 |
| 244 | 3300014968 | Ga0157379_10002095 | Ga0157379_100020959 | 273 |
| 245 | 3300025271 | Ga0207666_1000051 | Ga0207666_10000512 | 273 |
| 246 | 3300025885 | Ga0207653_10016506 | Ga0207653_100165061 | 273 |
| 247 | 3300025893 | Ga0207682_10000072 | Ga0207682_100000727 | 273 |
| 248 | 3300025900 | Ga0207710_10004456 | Ga0207710_100044566 | 273 |
| 249 | 3300025900 | Ga0207710_10018655 | Ga0207710_100186553 | 273 |
| 250 | 3300025903 | Ga0207680_10008261 | Ga0207680_100082612 | 273 |
| 251 | 3300025903 | Ga0207680_10189720 | Ga0207680_101897201 | 273 |
| 252 | 3300025904 | Ga0207647_10002000 | Ga0207647_100020008 | 273 |
| 253 | 3300025905 | Ga0207685_10037720 | Ga0207685_100377203 | 273 |
| 254 | 3300025906 | Ga0207699_10003384 | Ga0207699_100033847 | 273 |
| 255 | 3300025907 | Ga0207645_10000966 | Ga0207645_100009666 | 273 |
| 256 | 3300025908 | Ga0207643_10000004 | Ga0207643_1000000432 | 273 |
| 257 | 3300025911 | Ga0207654_10153464 | Ga0207654_101534642 | 273 |
| 258 | 3300025914 | Ga0207671_10118354 | Ga0207671_101183544 | 273 |
| 259 | 3300025916 | Ga0207663_10021824 | Ga0207663_100218241 | 273 |
| 260 | 3300025916 | Ga0207663_10074049 | Ga0207663_100740492 | 273 |
| 261 | 3300025917 | Ga0207660_10004454 | Ga0207660_100044548 | 273 |
| 262 | 3300025918 | Ga0207662_10000317 | Ga0207662_100003172 | 273 |
| 263 | 3300025919 | Ga0207657_10002047 | Ga0207657_100020472 | 273 |
| 264 | 3300025920 | Ga0207649_10000262 | Ga0207649_100002627 | 273 |
| 265 | 3300025920 | Ga0207649_10055749 | Ga0207649_100557492 | 273 |
| 266 | 3300025921 | Ga0207652_10000911 | Ga0207652_1000091115 | 273 |
| 267 | 3300025924 | Ga0207694_10249115 | Ga0207694_102491151 | 273 |
| 268 | 3300025925 | Ga0207650_10197358 | Ga0207650_101973582 | 273 |
| 269 | 3300025926 | Ga0207659_10178888 | Ga0207659_101788882 | 273 |
| 270 | 3300025928 | Ga0207700_10047638 | Ga0207700_100476382 | 273 |
| 271 | 3300025929 | Ga0207664_10018712 | Ga0207664_100187126 | 273 |
| 272 | 3300025931 | Ga0207644_10004727 | Ga0207644_100047276 | 273 |
| 273 | 3300025931 | Ga0207644_10017581 | Ga0207644_100175816 | 273 |
| 274 | 3300025932 | Ga0207690_10001058 | Ga0207690_100010586 | 273 |
| 275 | 3300025933 | Ga0207706_10001679 | Ga0207706_1000167922 | 273 |
| 276 | 3300025934 | Ga0207686_10005614 | Ga0207686_100056145 | 273 |
| 277 | 3300025935 | Ga0207709_10009302 | Ga0207709_100093027 | 273 |
| 278 | 3300025936 | Ga0207670_10000377 | Ga0207670_1000037715 | 273 |
| 279 | 3300025936 | Ga0207670_10026617 | Ga0207670_100266175 | 273 |
| 280 | 3300025938 | Ga0207704_10006515 | Ga0207704_100065152 | 273 |
| 281 | 3300025939 | Ga0207665_10008284 | Ga0207665_100082845 | 273 |
| 282 | 3300025940 | Ga0207691_10026103 | Ga0207691_100261032 | 273 |
| 283 | 3300025941 | Ga0207711_10006200 | Ga0207711_100062008 | 273 |
| 284 | 3300025941 | Ga0207711_10016950 | Ga0207711_100169507 | 273 |
| 285 | 3300025942 | Ga0207689_10000203 | Ga0207689_1000020340 | 273 |
| 286 | 3300025942 | Ga0207689_10029484 | Ga0207689_100294845 | 273 |
| 287 | 3300025944 | Ga0207661_10002165 | Ga0207661_1000216514 | 273 |
| 288 | 3300025944 | Ga0207661_10081279 | Ga0207661_100812793 | 273 |
| 289 | 3300025945 | Ga0207679_10000157 | Ga0207679_1000015716 | 273 |
| 290 | 3300025960 | Ga0207651_10000367 | Ga0207651_100003678 | 273 |
| 291 | 3300025961 | Ga0207712_10015168 | Ga0207712_100151682 | 273 |
| 292 | 3300025972 | Ga0207668_10070419 | Ga0207668_100704193 | 273 |
| 293 | 3300025972 | Ga0207668_10075414 | Ga0207668_100754142 | 273 |
| 294 | 3300025981 | Ga0207640_10063139 | Ga0207640_100631393 | 273 |
| 295 | 3300025986 | Ga0207658_10004781 | Ga0207658_1000478110 | 273 |
| 296 | 3300025986 | Ga0207658_10261344 | Ga0207658_102613443 | 273 |
| 297 | 3300026023 | Ga0207677_10003050 | Ga0207677_1000305010 | 273 |
| 298 | 3300026023 | Ga0207677_10190552 | Ga0207677_101905522 | 273 |
| 299 | 3300026035 | Ga0207703_10001346 | Ga0207703_1000134622 | 273 |
| 300 | 3300026035 | Ga0207703_10001852 | Ga0207703_100018523 | 273 |
| 301 | 3300026041 | Ga0207639_10078753 | Ga0207639_100787533 | 273 |
| 302 | 3300026067 | Ga0207678_10036309 | Ga0207678_100363096 | 273 |
| 303 | 3300026078 | Ga0207702_10204245 | Ga0207702_102042453 | 273 |
| 304 | 3300026089 | Ga0207648_10002073 | Ga0207648_1000207322 | 273 |
| 305 | 3300026089 | Ga0207648_10141470 | Ga0207648_101414701 | 273 |
| 306 | 3300026095 | Ga0207676_10010349 | Ga0207676_100103492 | 273 |
| 307 | 3300026116 | Ga0207674_10000897 | Ga0207674_1000089722 | 273 |
| 308 | 3300026116 | Ga0207674_10570885 | Ga0207674_105708851 | 273 |
| 309 | 3300026118 | Ga0207675_100001726 | Ga0207675_1000017262 | 273 |
| 310 | 3300026118 | Ga0207675_100119875 | Ga0207675_1001198753 | 273 |
| 311 | 3300026121 | Ga0207683_10001176 | Ga0207683_1000117625 | 273 |
| 312 | 3300026142 | Ga0207698_10088166 | Ga0207698_100881663 | 273 |
| 313 | 3300028379 | Ga0268266_10018077 | Ga0268266_100180776 | 273 |
| 314 | 3300028379 | Ga0268266_10109108 | Ga0268266_101091081 | 273 |
| 315 | 3300028381 | Ga0268264_10001616 | Ga0268264_100016163 | 273 |
| 316 | 3300034816 | Ga0373930_0004658 | Ga0373930_0004658_317_1225 | 273 |
| 317 | 3300034817 | Ga0373948_0013582 | Ga0373948_0013582_297_1157 | 273 |
| 318 | 3300034820 | Ga0373959_0015498 | Ga0373959_0015498_432_1292 | 273 |
| 319 | 3300034957 | Ga0373938_0008796 | Ga0373938_0008796_831_1739 | 273 |
| 320 | 3300035090 | Ga0373949_0006003 | Ga0373949_0006003_242_1150 | 273 |
| 321 | 3300035091 | Ga0373951_0001767 | Ga0373951_0001767_4667_5527 | 273 |
| 322 | 3300035092 | Ga0373952_0003171 | Ga0373952_0003171_138_1046 | 273 |
| 323 | 3300035114 | Ga0373939_0001338 | Ga0373939_0001338_3212_4120 | 273 |
| 324 | 3300035114 | Ga0373939_0003044 | Ga0373939_0003044_491_1351 | 273 |
| 325 | 3300035121 | Ga0373960_0006465 | Ga0373960_0006465_1186_2094 | 273 |
| 326 | 3300035170 | Ga0373943_0051142 | Ga0373943_0051142_418_1326 | 273 |
| 327 | 3300035207 | Ga0373942_0014182 | Ga0373942_0014182_309_1169 | 273 |
| 328 | 3300035207 | Ga0373942_0030018 | Ga0373942_0030018_425_1333 | 273 |
| 329 | 3300035241 | Ga0373961_0002484 | Ga0373961_0002484_1944_2852 | 273 |
| 330 | 3300035691 | Ga0373931_0001147 | Ga0373931_0001147_1167_2075 | 273 |
| 331 | 3300035691 | Ga0373931_0016624 | Ga0373931_0016624_833_1693 | 273 |
| 332 | 3300035692 | Ga0373935_0035049 | Ga0373935_0035049_1464_2372 | 273 |
| 333 | 3300035695 | Ga0373927_0017667 | Ga0373927_0017667_12_920 | 273 |
| 334 | 3300035725 | Ga0373947_0000424 | Ga0373947_0000424_8144_9052 | 273 |
| 335 | 3300046455 | Ga0495603_0038640 | Ga0495603_0038640_689_1597 | 273 |
| 336 | 3300046459 | Ga0495629_0000447 | Ga0495629_0000447_4372_5280 | 273 |
| 337 | 3300046473 | Ga0495582_0006745 | Ga0495582_0006745_5288_6196 | 273 |
| 338 | 3300046499 | Ga0495594_0129357 | Ga0495594_0129357_105_1013 | 273 |
| 339 | 3300046526 | Ga0495666_0042043 | Ga0495666_0042043_761_1669 | 273 |
| 340 | 3300046683 | Ga0495658_0003413 | Ga0495658_0003413_6195_7103 | 273 |
| 341 | 3300046689 | Ga0495613_0110478 | Ga0495613_0110478_515_1423 | 273 |
| 342 | 3300047315 | Ga0495581_0011457 | Ga0495581_0011457_3729_4637 | 273 |
| 343 | 3300047321 | Ga0495676_0035281 | Ga0495676_0035281_1362_2270 | 273 |
| 344 | 3300047322 | Ga0495680_0002870 | Ga0495680_0002870_8212_9120 | 273 |
| 345 | 3300047673 | Ga0495593_0074802 | Ga0495593_0074802_224_1132 | 273 |
| 346 | 3300048089 | Ga0495614_0038605 | Ga0495614_0038605_336_1244 | 273 |
| 347 | 3300048903 | Ga0496100_0002767 | Ga0496100_0002767_93_953 | 273 |
| 348 | 3300048903 | Ga0496100_0138431 | Ga0496100_0138431_668_1576 | 273 |
| 349 | 3300048904 | Ga0496101_0081575 | Ga0496101_0081575_825_1685 | 273 |
| 350 | 3300048905 | Ga0496102_0090459 | Ga0496102_0090459_350_1258 | 273 |
| 351 | 3300048905 | Ga0496102_0255950 | Ga0496102_0255950_624_1532 | 273 |
| 352 | 3300048908 | Ga0496105_0113109 | Ga0496105_0113109_1289_2197 | 273 |
| 353 | 3300048908 | Ga0496105_0116807 | Ga0496105_0116807_53_913 | 273 |
| 354 | 3300048908 | Ga0496105_0244408 | Ga0496105_0244408_38_946 | 273 |
| 355 | 3300048909 | Ga0496106_0002308 | Ga0496106_0002308_6199_7059 | 273 |
| 356 | 3300048909 | Ga0496106_0040080 | Ga0496106_0040080_979_1887 | 273 |
| 357 | 3300048910 | Ga0496107_0272976 | Ga0496107_0272976_300_1160 | 273 |
| 358 | 3300048912 | Ga0496109_0002084 | Ga0496109_0002084_37_897 | 273 |
| 359 | 3300048913 | Ga0496110_0063281 | Ga0496110_0063281_1266_2174 | 273 |
| 360 | 3300048914 | Ga0496111_0313430 | Ga0496111_0313430_228_1088 | 273 |
| 361 | 3300048915 | Ga0496112_0079495 | Ga0496112_0079495_2301_3209 | 273 |
| 362 | 3300048915 | Ga0496112_0090817 | Ga0496112_0090817_800_1660 | 273 |
| 363 | 3300048915 | Ga0496112_0230526 | Ga0496112_0230526_753_1661 | 273 |
| 364 | 3300048916 | Ga0496113_0005585 | Ga0496113_0005585_2712_3572 | 273 |
| 365 | 3300048917 | Ga0496114_0058116 | Ga0496114_0058116_106_966 | 273 |
| 366 | 3300048917 | Ga0496114_0150389 | Ga0496114_0150389_209_1117 | 273 |
| 367 | 3300048918 | Ga0496115_0043074 | Ga0496115_0043074_813_1721 | 273 |
| 368 | 3300048918 | Ga0496115_0062136 | Ga0496115_0062136_63_923 | 273 |
| 369 | 3300049587 | Ga0501071_0486177 | Ga0501071_0486177_10_876 | 273 |
| 370 | 3300049589 | Ga0501073_0300587 | Ga0501073_0300587_115_981 | 273 |
| 371 | 3300049592 | Ga0501076_0207590 | Ga0501076_0207590_28_894 | 273 |
| 372 | 3300049741 | Ga0501079_0108547 | Ga0501079_0108547_1123_1983 | 273 |
| 373 | 3300050494 | nmdc:mga06z11_45500_c1 | nmdc:mga06z11_45500_c1_380_1240 | 273 |
| 374 | 3300050511 | nmdc:mga08y16_199543_c1 | nmdc:mga08y16_199543_c1_476_1408 | 273 |
| 375 | 3300050511 | nmdc:mga08y16_212290_c1 | nmdc:mga08y16_212290_c1_321_1181 | 273 |
| 376 | 3300050512 | nmdc:mga0n895_326507_c1 | nmdc:mga0n895_326507_c1_105_1013 | 273 |
| 377 | 3300050515 | nmdc:mga0a205_72068_c1 | nmdc:mga0a205_72068_c1_2031_2891 | 273 |
| 378 | 3300053085 | Ga0495619_0000337 | Ga0495619_0000337_31791_32699 | 273 |
| 379 | 3300054114 | Ga0501084_0150084 | Ga0501084_0150084_384_1250 | 273 |
| 380 | 3300060353 | Ga0501082_0042849 | Ga0501082_0042849_2621_3487 | 273 |
| 381 | iso_pu_bacteria | 2829745981 | 2829747329 | 273 |
| 382 | iso_pu_bacteria | 3003665799 | 3003670958 | 273 |
| 383 | 3300005295 | Ga0065707_10116342 | Ga0065707_101163423 | 274 |
| 384 | 3300005937 | Ga0081455_10007188 | Ga0081455_100071889 | 274 |
| 385 | 3300005937 | Ga0081455_10241404 | Ga0081455_102414041 | 274 |
| 386 | 3300006058 | Ga0075432_10006659 | Ga0075432_100066595 | 274 |
| 387 | 3300006844 | Ga0075428_100005056 | Ga0075428_1000050567 | 274 |
| 388 | 3300006844 | Ga0075428_100451942 | Ga0075428_1004519421 | 274 |
| 389 | 3300006846 | Ga0075430_100001054 | Ga0075430_10000105416 | 274 |
| 390 | 3300006847 | Ga0075431_100001076 | Ga0075431_10000107613 | 274 |
| 391 | 3300006852 | Ga0075433_10009722 | Ga0075433_100097227 | 274 |
| 392 | 3300006871 | Ga0075434_100003201 | Ga0075434_10000320113 | 274 |
| 393 | 3300006880 | Ga0075429_100000098 | Ga0075429_10000009817 | 274 |
| 394 | 3300007076 | Ga0075435_100029590 | Ga0075435_1000295905 | 274 |
| 395 | 3300007076 | Ga0075435_100206909 | Ga0075435_1002069092 | 274 |
| 396 | 3300009094 | Ga0111539_10001671 | Ga0111539_1000167117 | 274 |
| 397 | 3300009147 | Ga0114129_10008949 | Ga0114129_1000894912 | 274 |
| 398 | 3300009147 | Ga0114129_10017470 | Ga0114129_100174702 | 274 |
| 399 | 3300013296 | Ga0157374_10307472 | Ga0157374_103074721 | 274 |
| 400 | 3300027907 | Ga0207428_10000137 | Ga0207428_1000013722 | 274 |
| 401 | 3300035083 | Ga0373926_0002855 | Ga0373926_0002855_2809_3714 | 274 |
| 402 | 3300035086 | Ga0373934_0018396 | Ga0373934_0018396_468_1373 | 274 |
| 403 | 3300035089 | Ga0373944_0001376 | Ga0373944_0001376_3340_4245 | 274 |
| 404 | 3300035111 | Ga0373923_0003371 | Ga0373923_0003371_3664_4569 | 274 |
| 405 | 3300035113 | Ga0373936_0006584 | Ga0373936_0006584_1978_2883 | 274 |
| 406 | 3300035116 | Ga0373945_0004740 | Ga0373945_0004740_1576_2481 | 274 |
| 407 | 3300035117 | Ga0373953_0016152 | Ga0373953_0016152_1260_2165 | 274 |
| 408 | 3300035119 | Ga0373956_0055402 | Ga0373956_0055402_251_1156 | 274 |
| 409 | 3300035170 | Ga0373943_0013498 | Ga0373943_0013498_1006_1911 | 274 |
| 410 | 3300035171 | Ga0373946_0008671 | Ga0373946_0008671_309_1214 | 274 |
| 411 | 3300035172 | Ga0373955_0002078 | Ga0373955_0002078_5008_5913 | 274 |
| 412 | 3300035410 | Ga0373924_0075788 | Ga0373924_0075788_530_1390 | 274 |
| 413 | 3300035692 | Ga0373935_0006737 | Ga0373935_0006737_2399_3304 | 274 |
| 414 | 3300035724 | Ga0373933_0016229 | Ga0373933_0016229_2971_3876 | 274 |
| 415 | 3300036401 | Ga0373937_0047021 | Ga0373937_0047021_1693_2598 | 274 |
| 416 | 3300037068 | Ga0373925_0050867 | Ga0373925_0050867_1619_2524 | 274 |
| 417 | 3300037471 | Ga0395905_0281473 | Ga0395905_0281473_613_1458 | 274 |
| 418 | 3300046454 | Ga0495592_0041594 | Ga0495592_0041594_1867_2772 | 274 |
| 419 | 3300046458 | Ga0495591_032418 | Ga0495591_032418_623_1534 | 274 |
| 420 | 3300046462 | Ga0495651_0030858 | Ga0495651_0030858_1798_2703 | 274 |
| 421 | 3300046463 | Ga0495653_0013922 | Ga0495653_0013922_3280_4185 | 274 |
| 422 | 3300046472 | Ga0495580_0019007 | Ga0495580_0019007_2511_3416 | 274 |
| 423 | 3300046476 | Ga0495662_0016654 | Ga0495662_0016654_2176_3081 | 274 |
| 424 | 3300046477 | Ga0495664_0086099 | Ga0495664_0086099_478_1383 | 274 |
| 425 | 3300046491 | Ga0495584_0006761 | Ga0495584_0006761_1304_2209 | 274 |
| 426 | 3300046492 | Ga0495585_0003617 | Ga0495585_0003617_5229_6134 | 274 |
| 427 | 3300046499 | Ga0495594_0021714 | Ga0495594_0021714_704_1609 | 274 |
| 428 | 3300046501 | Ga0495607_0007932 | Ga0495607_0007932_1225_2130 | 274 |
| 429 | 3300046516 | Ga0495628_0025333 | Ga0495628_0025333_2809_3714 | 274 |
| 430 | 3300046517 | Ga0495630_0072935 | Ga0495630_0072935_673_1578 | 274 |
| 431 | 3300046523 | Ga0495644_0000748 | Ga0495644_0000748_2706_3611 | 274 |
| 432 | 3300046535 | Ga0495586_0007081 | Ga0495586_0007081_810_1715 | 274 |
| 433 | 3300046536 | Ga0495587_0009207 | Ga0495587_0009207_1133_2038 | 274 |
| 434 | 3300046537 | Ga0495598_0019699 | Ga0495598_0019699_129_1034 | 274 |
| 435 | 3300046543 | Ga0495645_0051861 | Ga0495645_0051861_2041_2946 | 274 |
| 436 | 3300046557 | Ga0495622_0012435 | Ga0495622_0012435_835_1740 | 274 |
| 437 | 3300046558 | Ga0495633_0007380 | Ga0495633_0007380_356_1267 | 274 |
| 438 | 3300046559 | Ga0495667_0004817 | Ga0495667_0004817_4840_5745 | 274 |
| 439 | 3300046615 | Ga0495656_0013672 | Ga0495656_0013672_1536_2441 | 274 |
| 440 | 3300046642 | Ga0495634_0161494 | Ga0495634_0161494_492_1397 | 274 |
| 441 | 3300046648 | Ga0495611_0003367 | Ga0495611_0003367_4493_5398 | 274 |
| 442 | 3300046663 | Ga0495635_0021903 | Ga0495635_0021903_2074_2979 | 274 |
| 443 | 3300046674 | Ga0495588_0006148 | Ga0495588_0006148_2035_2940 | 274 |
| 444 | 3300046675 | Ga0495657_0167146 | Ga0495657_0167146_51_956 | 274 |
| 445 | 3300046678 | Ga0495599_0031607 | Ga0495599_0031607_810_1715 | 274 |
| 446 | 3300046680 | Ga0495646_0044732 | Ga0495646_0044732_1786_2691 | 274 |
| 447 | 3300046683 | Ga0495658_0033330 | Ga0495658_0033330_98_1003 | 274 |
| 448 | 3300046689 | Ga0495613_0022722 | Ga0495613_0022722_1930_2835 | 274 |
| 449 | 3300046690 | Ga0495624_0021150 | Ga0495624_0021150_1350_2255 | 274 |
| 450 | 3300046691 | Ga0495670_0001290 | Ga0495670_0001290_8934_9839 | 274 |
| 451 | 3300046692 | Ga0495671_0084329 | Ga0495671_0084329_459_1364 | 274 |
| 452 | 3300046809 | Ga0495600_0004224 | Ga0495600_0004224_3675_4580 | 274 |
| 453 | 3300047315 | Ga0495581_0009308 | Ga0495581_0009308_2489_3394 | 274 |
| 454 | 3300047317 | Ga0495604_0038875 | Ga0495604_0038875_1557_2462 | 274 |
| 455 | 3300047322 | Ga0495680_0048923 | Ga0495680_0048923_663_1568 | 274 |
| 456 | 3300047446 | Ga0495679_029627 | Ga0495679_029627_241_1146 | 274 |
| 457 | 3300047673 | Ga0495593_0007133 | Ga0495593_0007133_2407_3312 | 274 |
| 458 | 3300048088 | Ga0495602_0107826 | Ga0495602_0107826_698_1603 | 274 |
| 459 | 3300050507 | nmdc:mga05p37_114452_c1 | nmdc:mga05p37_114452_c1_1325_2230 | 274 |
| 460 | 3300050507 | nmdc:mga05p37_66_c1 | nmdc:mga05p37_66_c1_15401_16306 | 274 |
| 461 | 3300050508 | nmdc:mga09592_1702_c1 | nmdc:mga09592_1702_c1_7566_8471 | 274 |
| 462 | 3300050509 | nmdc:mga0qj67_50198_c1 | nmdc:mga0qj67_50198_c1_101_1006 | 274 |
| 463 | 3300050510 | nmdc:mga06r32_2037_c1 | nmdc:mga06r32_2037_c1_14746_15651 | 274 |
| 464 | 3300050511 | nmdc:mga08y16_1809_c1 | nmdc:mga08y16_1809_c1_9637_10542 | 274 |
| 465 | 3300050512 | nmdc:mga0n895_43_c1 | nmdc:mga0n895_43_c1_58081_58986 | 274 |
| 466 | 3300050513 | nmdc:mga0rr50_1204_c1 | nmdc:mga0rr50_1204_c1_4534_5439 | 274 |
| 467 | 3300050513 | nmdc:mga0rr50_93838_c1 | nmdc:mga0rr50_93838_c1_908_1813 | 274 |
| 468 | 3300050515 | nmdc:mga0a205_3268_c1 | nmdc:mga0a205_3268_c1_877_1782 | 274 |
| 469 | 3300053077 | Ga0495601_0019931 | Ga0495601_0019931_2183_3088 | 274 |
| 470 | 3300053078 | Ga0495612_0007461 | Ga0495612_0007461_2397_3302 | 274 |
| 471 | iso_pu_bacteria | 2842698319 | 2842698615 | 275 |
| 472 | 3300031250 | Ga0265331_10090758 | Ga0265331_100907581 | 276 |
| 473 | 3300031711 | Ga0265314_10060754 | Ga0265314_100607543 | 276 |
| 474 | 3300035691 | Ga0373931_0200950 | Ga0373931_0200950_148_1032 | 277 |
| 475 | 3300035115 | Ga0373941_0003694 | Ga0373941_0003694_238_1107 | 279 |
| 476 | 3300049571 | Ga0501034_0182434 | Ga0501034_0182434_962_1831 | 279 |
| 477 | 3300049573 | Ga0501037_0058837 | Ga0501037_0058837_1098_1967 | 279 |
| 478 | 3300049574 | Ga0501038_0123017 | Ga0501038_0123017_969_1838 | 279 |
| 479 | 3300049575 | Ga0501039_0028565 | Ga0501039_0028565_604_1473 | 279 |
| 480 | 3300049579 | Ga0501043_0013503 | Ga0501043_0013503_5092_5961 | 279 |
| 481 | 3300049584 | Ga0501068_0027696 | Ga0501068_0027696_695_1564 | 279 |
| 482 | 3300049585 | Ga0501069_0074323 | Ga0501069_0074323_984_1853 | 279 |
| 483 | 3300049586 | Ga0501070_0119752 | Ga0501070_0119752_604_1473 | 279 |
| 484 | 3300049588 | Ga0501072_0106653 | Ga0501072_0106653_50_919 | 279 |
| 485 | 3300049589 | Ga0501073_0208197 | Ga0501073_0208197_205_1074 | 279 |
| 486 | 3300049741 | Ga0501079_0061605 | Ga0501079_0061605_204_1073 | 279 |
| 487 | 3300049742 | Ga0501080_0375490 | Ga0501080_0375490_208_1077 | 279 |
| 488 | 3300049822 | Ga0501035_0032190 | Ga0501035_0032190_2192_3061 | 279 |
| 489 | 3300005548 | Ga0070665_100604010 | Ga0070665_1006040101 | 280 |
| 490 | 3300009093 | Ga0105240_10311400 | Ga0105240_103114003 | 280 |
| 491 | 3300033180 | Ga0307510_10133597 | Ga0307510_101335972 | 280 |
| 492 | 3300035695 | Ga0373927_0179748 | Ga0373927_0179748_298_1179 | 280 |
| 493 | 3300049586 | Ga0501070_0037217 | Ga0501070_0037217_1031_1903 | 280 |
| 494 | 3300049744 | Ga0501083_0106665 | Ga0501083_0106665_318_1190 | 280 |
| 495 | iso_pu_bacteria | 2909042592 | 2909045065 | 280 |
| 496 | 3300005327 | Ga0070658_10018141 | Ga0070658_100181414 | 281 |
| 497 | 3300005327 | Ga0070658_10151721 | Ga0070658_101517212 | 281 |
| 498 | 3300005336 | Ga0070680_100010386 | Ga0070680_1000103864 | 281 |
| 499 | 3300005336 | Ga0070680_100058840 | Ga0070680_1000588401 | 281 |
| 500 | 3300005339 | Ga0070660_100102330 | Ga0070660_1001023302 | 281 |
| 501 | 3300005530 | Ga0070679_100045910 | Ga0070679_1000459105 | 281 |
| 502 | 3300005539 | Ga0068853_100506722 | Ga0068853_1005067222 | 281 |
| 503 | 3300005563 | Ga0068855_100226656 | Ga0068855_1002266563 | 281 |
| 504 | 3300005563 | Ga0068855_100345202 | Ga0068855_1003452023 | 281 |
| 505 | 3300005578 | Ga0068854_100090331 | Ga0068854_1000903313 | 281 |
| 506 | 3300005614 | Ga0068856_100359461 | Ga0068856_1003594611 | 281 |
| 507 | 3300009093 | Ga0105240_10129854 | Ga0105240_101298543 | 281 |
| 508 | 3300013104 | Ga0157370_10039505 | Ga0157370_100395055 | 281 |
| 509 | 3300013105 | Ga0157369_10379008 | Ga0157369_103790082 | 281 |
| 510 | 3300013307 | Ga0157372_10379577 | Ga0157372_103795773 | 281 |
| 511 | 3300025909 | Ga0207705_10004623 | Ga0207705_100046233 | 281 |
| 512 | 3300025912 | Ga0207707_10141147 | Ga0207707_101411472 | 281 |
| 513 | 3300025919 | Ga0207657_10060705 | Ga0207657_100607053 | 281 |
| 514 | 3300025981 | Ga0207640_10051155 | Ga0207640_100511554 | 281 |
| 515 | 3300026041 | Ga0207639_10252239 | Ga0207639_102522392 | 281 |
| 516 | 3300026142 | Ga0207698_10039789 | Ga0207698_100397895 | 281 |
| 517 | 3300046559 | Ga0495667_0004191 | Ga0495667_0004191_4265_5248 | 281 |
| 518 | 3300049581 | Ga0501047_0064372 | Ga0501047_0064372_2102_2992 | 281 |
| 519 | 3300005353 | Ga0070669_100244144 | Ga0070669_1002441442 | 282 |
| 520 | 3300005618 | Ga0068864_100260015 | Ga0068864_1002600151 | 282 |
| 521 | 3300009177 | Ga0105248_10390089 | Ga0105248_103900891 | 282 |
| 522 | 3300035724 | Ga0373933_0254782 | Ga0373933_0254782_77_973 | 282 |
| 523 | 3300049822 | Ga0501035_0058217 | Ga0501035_0058217_799_1689 | 282 |
| 524 | 3300053085 | Ga0495619_0029836 | Ga0495619_0029836_1357_2253 | 282 |
| 525 | 3300053087 | Ga0500643_021801 | Ga0500643_021801_703_1596 | 282 |
| 526 | 3300053088 | Ga0500644_0001646 | Ga0500644_0001646_3216_4085 | 282 |
| 527 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_925714_926583 | 282 |
| 528 | 3300053131 | Ga0500652_006268 | Ga0500652_006268_1390_2259 | 282 |
| 529 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1030058_1030927 | 282 |
| 530 | 3300053730 | Ga0500645_000099 | Ga0500645_000099_26934_27803 | 282 |
| 531 | iso_pu_bacteria | 2939669807 | 2939669898 | 283 |
| 532 | 3300005438 | Ga0070701_10210556 | Ga0070701_102105561 | 284 |
| 533 | 3300005354 | Ga0070675_100169371 | Ga0070675_1001693713 | 285 |
| 534 | 3300005356 | Ga0070674_100013074 | Ga0070674_1000130744 | 285 |
| 535 | 3300005456 | Ga0070678_100069985 | Ga0070678_1000699852 | 285 |
| 536 | 3300005543 | Ga0070672_100101542 | Ga0070672_1001015422 | 285 |
| 537 | 3300014326 | Ga0157380_10072062 | Ga0157380_100720623 | 285 |
| 538 | 3300025926 | Ga0207659_10125257 | Ga0207659_101252572 | 285 |
| 539 | 3300025940 | Ga0207691_10034812 | Ga0207691_100348123 | 285 |
| 540 | 3300026023 | Ga0207677_10161592 | Ga0207677_101615921 | 285 |
| 541 | 3300026118 | Ga0207675_100115286 | Ga0207675_1001152861 | 285 |
| 542 | 3300031711 | Ga0265314_10001726 | Ga0265314_1000172623 | 285 |
| 543 | 3300031711 | Ga0265314_10009303 | Ga0265314_100093036 | 285 |
| 544 | 3300049572 | Ga0501036_0193589 | Ga0501036_0193589_197_1096 | 285 |
| 545 | 3300049574 | Ga0501038_0014576 | Ga0501038_0014576_3442_4341 | 285 |
| 546 | 3300049586 | Ga0501070_0088179 | Ga0501070_0088179_1127_2026 | 285 |
| 547 | 2209111006 | 2214745202 | 2213754648 | 286 |
| 548 | 3300000041 | ARcpr5oldR_c000031 | ARcpr5oldR_00003122 | 286 |
| 549 | 3300000042 | ARSoilYngRDRAFT_c00086 | ARSoilYngRDRAFT_0008619 | 286 |
| 550 | 3300000043 | ARcpr5yngRDRAFT_c000084 | ARcpr5yngRDRAFT_0000842 | 286 |
| 551 | 3300000044 | ARSoilOldRDRAFT_c000050 | ARSoilOldRDRAFT_00005010 | 286 |
| 552 | 3300000045 | ARCol0oldRDRAFT_c00024 | ARCol0oldRDRAFT_000249 | 286 |
| 553 | 3300000652 | ARCol0yngRDRAFT_1000023 | ARCol0yngRDRAFT_100002310 | 286 |
| 554 | 3300005290 | Ga0065712_10003536 | Ga0065712_100035366 | 286 |
| 555 | 3300005293 | Ga0065715_10005464 | Ga0065715_100054642 | 286 |
| 556 | 3300005328 | Ga0070676_10168784 | Ga0070676_101687841 | 286 |
| 557 | 3300005330 | Ga0070690_100008145 | Ga0070690_1000081456 | 286 |
| 558 | 3300005330 | Ga0070690_100058971 | Ga0070690_1000589713 | 286 |
| 559 | 3300005334 | Ga0068869_100533468 | Ga0068869_1005334681 | 286 |
| 560 | 3300005336 | Ga0070680_100131222 | Ga0070680_1001312221 | 286 |
| 561 | 3300005336 | Ga0070680_100162863 | Ga0070680_1001628633 | 286 |
| 562 | 3300005336 | Ga0070680_100481503 | Ga0070680_1004815031 | 286 |
| 563 | 3300005337 | Ga0070682_100104030 | Ga0070682_1001040301 | 286 |
| 564 | 3300005338 | Ga0068868_100134550 | Ga0068868_1001345502 | 286 |
| 565 | 3300005339 | Ga0070660_100044535 | Ga0070660_1000445352 | 286 |
| 566 | 3300005341 | Ga0070691_10131904 | Ga0070691_101319041 | 286 |
| 567 | 3300005345 | Ga0070692_10018028 | Ga0070692_100180285 | 286 |
| 568 | 3300005353 | Ga0070669_100033495 | Ga0070669_1000334954 | 286 |
| 569 | 3300005355 | Ga0070671_100020437 | Ga0070671_1000204375 | 286 |
| 570 | 3300005356 | Ga0070674_100083620 | Ga0070674_1000836202 | 286 |
| 571 | 3300005356 | Ga0070674_100215906 | Ga0070674_1002159063 | 286 |
| 572 | 3300005365 | Ga0070688_100042662 | Ga0070688_1000426624 | 286 |
| 573 | 3300005367 | Ga0070667_100158272 | Ga0070667_1001582723 | 286 |
| 574 | 3300005406 | Ga0070703_10028946 | Ga0070703_100289461 | 286 |
| 575 | 3300005434 | Ga0070709_10065828 | Ga0070709_100658283 | 286 |
| 576 | 3300005434 | Ga0070709_10178384 | Ga0070709_101783841 | 286 |
| 577 | 3300005435 | Ga0070714_100144480 | Ga0070714_1001444802 | 286 |
| 578 | 3300005435 | Ga0070714_100147728 | Ga0070714_1001477283 | 286 |
| 579 | 3300005438 | Ga0070701_10031372 | Ga0070701_100313722 | 286 |
| 580 | 3300005440 | Ga0070705_100028362 | Ga0070705_1000283624 | 286 |
| 581 | 3300005441 | Ga0070700_100027576 | Ga0070700_1000275763 | 286 |
| 582 | 3300005444 | Ga0070694_100069203 | Ga0070694_1000692032 | 286 |
| 583 | 3300005456 | Ga0070678_100651078 | Ga0070678_1006510781 | 286 |
| 584 | 3300005458 | Ga0070681_10066963 | Ga0070681_100669633 | 286 |
| 585 | 3300005458 | Ga0070681_10131744 | Ga0070681_101317443 | 286 |
| 586 | 3300005530 | Ga0070679_100089271 | Ga0070679_1000892715 | 286 |
| 587 | 3300005530 | Ga0070679_100178184 | Ga0070679_1001781841 | 286 |
| 588 | 3300005535 | Ga0070684_100058016 | Ga0070684_1000580162 | 286 |
| 589 | 3300005535 | Ga0070684_100071061 | Ga0070684_1000710611 | 286 |
| 590 | 3300005539 | Ga0068853_100221054 | Ga0068853_1002210542 | 286 |
| 591 | 3300005544 | Ga0070686_100078329 | Ga0070686_1000783293 | 286 |
| 592 | 3300005545 | Ga0070695_100020774 | Ga0070695_1000207742 | 286 |
| 593 | 3300005546 | Ga0070696_100045991 | Ga0070696_1000459914 | 286 |
| 594 | 3300005546 | Ga0070696_100058424 | Ga0070696_1000584243 | 286 |
| 595 | 3300005546 | Ga0070696_100062587 | Ga0070696_1000625872 | 286 |
| 596 | 3300005549 | Ga0070704_100042538 | Ga0070704_1000425382 | 286 |
| 597 | 3300005549 | Ga0070704_100165906 | Ga0070704_1001659062 | 286 |
| 598 | 3300005563 | Ga0068855_100270715 | Ga0068855_1002707153 | 286 |
| 599 | 3300005564 | Ga0070664_100093883 | Ga0070664_1000938833 | 286 |
| 600 | 3300005564 | Ga0070664_100121615 | Ga0070664_1001216152 | 286 |
| 601 | 3300005577 | Ga0068857_100099307 | Ga0068857_1000993072 | 286 |
| 602 | 3300005577 | Ga0068857_100236670 | Ga0068857_1002366702 | 286 |
| 603 | 3300005578 | Ga0068854_100194218 | Ga0068854_1001942184 | 286 |
| 604 | 3300005614 | Ga0068856_100120855 | Ga0068856_1001208552 | 286 |
| 605 | 3300005617 | Ga0068859_100464819 | Ga0068859_1004648192 | 286 |
| 606 | 3300005718 | Ga0068866_10063618 | Ga0068866_100636182 | 286 |
| 607 | 3300005719 | Ga0068861_100054273 | Ga0068861_1000542734 | 286 |
| 608 | 3300005842 | Ga0068858_100097241 | Ga0068858_1000972411 | 286 |
| 609 | 3300005843 | Ga0068860_100208852 | Ga0068860_1002088522 | 286 |
| 610 | 3300006163 | Ga0070715_10026308 | Ga0070715_100263082 | 286 |
| 611 | 3300006173 | Ga0070716_100265469 | Ga0070716_1002654692 | 286 |
| 612 | 3300006237 | Ga0097621_100004972 | Ga0097621_1000049726 | 286 |
| 613 | 3300006358 | Ga0068871_100004127 | Ga0068871_1000041279 | 286 |
| 614 | 3300006852 | Ga0075433_10089970 | Ga0075433_100899704 | 286 |
| 615 | 3300006871 | Ga0075434_100434955 | Ga0075434_1004349553 | 286 |
| 616 | 3300006881 | Ga0068865_100132391 | Ga0068865_1001323912 | 286 |
| 617 | 3300006881 | Ga0068865_100273006 | Ga0068865_1002730063 | 286 |
| 618 | 3300006931 | Ga0097620_100464822 | Ga0097620_1004648222 | 286 |
| 619 | 3300009094 | Ga0111539_10000757 | Ga0111539_1000075745 | 286 |
| 620 | 3300009101 | Ga0105247_10015124 | Ga0105247_100151242 | 286 |
| 621 | 3300009101 | Ga0105247_10032592 | Ga0105247_100325923 | 286 |
| 622 | 3300009148 | Ga0105243_10006997 | Ga0105243_100069978 | 286 |
| 623 | 3300009174 | Ga0105241_10043867 | Ga0105241_100438673 | 286 |
| 624 | 3300009176 | Ga0105242_10121283 | Ga0105242_101212832 | 286 |
| 625 | 3300009177 | Ga0105248_10069576 | Ga0105248_100695765 | 286 |
| 626 | 3300009545 | Ga0105237_10070292 | Ga0105237_100702926 | 286 |
| 627 | 3300009545 | Ga0105237_10079628 | Ga0105237_100796281 | 286 |
| 628 | 3300009551 | Ga0105238_10316663 | Ga0105238_103166631 | 286 |
| 629 | 3300009551 | Ga0105238_10794447 | Ga0105238_107944471 | 286 |
| 630 | 3300009553 | Ga0105249_10018341 | Ga0105249_100183417 | 286 |
| 631 | 3300010375 | Ga0105239_10494684 | Ga0105239_104946842 | 286 |
| 632 | 3300010375 | Ga0105239_11064495 | Ga0105239_110644951 | 286 |
| 633 | 3300011119 | Ga0105246_10062593 | Ga0105246_100625932 | 286 |
| 634 | 3300012505 | Ga0157339_1003789 | Ga0157339_10037892 | 286 |
| 635 | 3300013100 | Ga0157373_10142614 | Ga0157373_101426141 | 286 |
| 636 | 3300013105 | Ga0157369_10134356 | Ga0157369_101343561 | 286 |
| 637 | 3300013297 | Ga0157378_10022902 | Ga0157378_100229025 | 286 |
| 638 | 3300013306 | Ga0163162_10066273 | Ga0163162_100662736 | 286 |
| 639 | 3300013307 | Ga0157372_10301657 | Ga0157372_103016572 | 286 |
| 640 | 3300013308 | Ga0157375_10044607 | Ga0157375_100446074 | 286 |
| 641 | 3300013308 | Ga0157375_10056005 | Ga0157375_100560055 | 286 |
| 642 | 3300014326 | Ga0157380_10024000 | Ga0157380_100240006 | 286 |
| 643 | 3300014968 | Ga0157379_10077215 | Ga0157379_100772153 | 286 |
| 644 | 3300014969 | Ga0157376_10027757 | Ga0157376_100277574 | 286 |
| 645 | 3300017792 | Ga0163161_10038484 | Ga0163161_100384844 | 286 |
| 646 | 3300025271 | Ga0207666_1000825 | Ga0207666_10008255 | 286 |
| 647 | 3300025315 | Ga0207697_10003536 | Ga0207697_100035367 | 286 |
| 648 | 3300025885 | Ga0207653_10037868 | Ga0207653_100378682 | 286 |
| 649 | 3300025898 | Ga0207692_10156767 | Ga0207692_101567671 | 286 |
| 650 | 3300025899 | Ga0207642_10029170 | Ga0207642_100291702 | 286 |
| 651 | 3300025903 | Ga0207680_10050338 | Ga0207680_100503382 | 286 |
| 652 | 3300025903 | Ga0207680_10232782 | Ga0207680_102327822 | 286 |
| 653 | 3300025904 | Ga0207647_10022872 | Ga0207647_100228726 | 286 |
| 654 | 3300025906 | Ga0207699_10028904 | Ga0207699_100289042 | 286 |
| 655 | 3300025907 | Ga0207645_10037371 | Ga0207645_100373714 | 286 |
| 656 | 3300025911 | Ga0207654_10233533 | Ga0207654_102335332 | 286 |
| 657 | 3300025912 | Ga0207707_10008300 | Ga0207707_100083002 | 286 |
| 658 | 3300025912 | Ga0207707_10060858 | Ga0207707_100608583 | 286 |
| 659 | 3300025914 | Ga0207671_10189574 | Ga0207671_101895742 | 286 |
| 660 | 3300025915 | Ga0207693_10035873 | Ga0207693_100358732 | 286 |
| 661 | 3300025915 | Ga0207693_10117308 | Ga0207693_101173082 | 286 |
| 662 | 3300025919 | Ga0207657_10052705 | Ga0207657_100527052 | 286 |
| 663 | 3300025919 | Ga0207657_10057638 | Ga0207657_100576383 | 286 |
| 664 | 3300025926 | Ga0207659_10038335 | Ga0207659_100383355 | 286 |
| 665 | 3300025928 | Ga0207700_10184941 | Ga0207700_101849411 | 286 |
| 666 | 3300025929 | Ga0207664_10053132 | Ga0207664_100531322 | 286 |
| 667 | 3300025929 | Ga0207664_10190714 | Ga0207664_101907143 | 286 |
| 668 | 3300025929 | Ga0207664_10261411 | Ga0207664_102614112 | 286 |
| 669 | 3300025932 | Ga0207690_10465128 | Ga0207690_104651281 | 286 |
| 670 | 3300025933 | Ga0207706_10016549 | Ga0207706_100165495 | 286 |
| 671 | 3300025933 | Ga0207706_10035958 | Ga0207706_100359583 | 286 |
| 672 | 3300025934 | Ga0207686_10230052 | Ga0207686_102300522 | 286 |
| 673 | 3300025935 | Ga0207709_10069409 | Ga0207709_100694093 | 286 |
| 674 | 3300025936 | Ga0207670_10068553 | Ga0207670_100685531 | 286 |
| 675 | 3300025939 | Ga0207665_10043156 | Ga0207665_100431561 | 286 |
| 676 | 3300025940 | Ga0207691_10102469 | Ga0207691_101024693 | 286 |
| 677 | 3300025941 | Ga0207711_10158113 | Ga0207711_101581132 | 286 |
| 678 | 3300025942 | Ga0207689_10115522 | Ga0207689_101155222 | 286 |
| 679 | 3300025944 | Ga0207661_10321539 | Ga0207661_103215392 | 286 |
| 680 | 3300025945 | Ga0207679_10026481 | Ga0207679_100264814 | 286 |
| 681 | 3300025949 | Ga0207667_10684738 | Ga0207667_106847382 | 286 |
| 682 | 3300025986 | Ga0207658_10509926 | Ga0207658_105099262 | 286 |
| 683 | 3300026035 | Ga0207703_10088084 | Ga0207703_100880842 | 286 |
| 684 | 3300026035 | Ga0207703_10352273 | Ga0207703_103522733 | 286 |
| 685 | 3300026067 | Ga0207678_10010941 | Ga0207678_100109412 | 286 |
| 686 | 3300026075 | Ga0207708_10037666 | Ga0207708_100376665 | 286 |
| 687 | 3300026078 | Ga0207702_10279623 | Ga0207702_102796232 | 286 |
| 688 | 3300026088 | Ga0207641_10224085 | Ga0207641_102240854 | 286 |
| 689 | 3300026089 | Ga0207648_10128032 | Ga0207648_101280322 | 286 |
| 690 | 3300026116 | Ga0207674_10203297 | Ga0207674_102032973 | 286 |
| 691 | 3300026118 | Ga0207675_100255987 | Ga0207675_1002559873 | 286 |
| 692 | 3300027665 | Ga0209983_1027703 | Ga0209983_10277031 | 286 |
| 693 | 3300027695 | Ga0209966_1001285 | Ga0209966_10012852 | 286 |
| 694 | 3300027717 | Ga0209998_10000255 | Ga0209998_1000025519 | 286 |
| 695 | 3300027717 | Ga0209998_10024295 | Ga0209998_100242951 | 286 |
| 696 | 3300027876 | Ga0209974_10099082 | Ga0209974_100990822 | 286 |
| 697 | 3300027907 | Ga0207428_10000792 | Ga0207428_1000079210 | 286 |
| 698 | 3300028380 | Ga0268265_10137636 | Ga0268265_101376362 | 286 |
| 699 | 3300031241 | Ga0265325_10037662 | Ga0265325_100376624 | 286 |
| 700 | 3300031247 | Ga0265340_10013138 | Ga0265340_100131382 | 286 |
| 701 | 3300031247 | Ga0265340_10079733 | Ga0265340_100797332 | 286 |
| 702 | 3300031344 | Ga0265316_10117357 | Ga0265316_101173571 | 286 |
| 703 | 3300031344 | Ga0265316_10135948 | Ga0265316_101359482 | 286 |
| 704 | 3300031665 | Ga0316575_10035231 | Ga0316575_100352312 | 286 |
| 705 | 3300032133 | Ga0316583_10002826 | Ga0316583_100028262 | 286 |
| 706 | 3300034816 | Ga0373930_0000452 | Ga0373930_0000452_3373_4233 | 286 |
| 707 | 3300034817 | Ga0373948_0000822 | Ga0373948_0000822_2433_3293 | 286 |
| 708 | 3300034817 | Ga0373948_0047176 | Ga0373948_0047176_25_885 | 286 |
| 709 | 3300034819 | Ga0373958_0000721 | Ga0373958_0000721_3291_4151 | 286 |
| 710 | 3300034820 | Ga0373959_0001671 | Ga0373959_0001671_1921_2781 | 286 |
| 711 | 3300035084 | Ga0373928_0000449 | Ga0373928_0000449_1804_2664 | 286 |
| 712 | 3300035085 | Ga0373929_0000206 | Ga0373929_0000206_520_1380 | 286 |
| 713 | 3300035086 | Ga0373934_0002288 | Ga0373934_0002288_307_1212 | 286 |
| 714 | 3300035086 | Ga0373934_0026660 | Ga0373934_0026660_20_901 | 286 |
| 715 | 3300035088 | Ga0373940_0000275 | Ga0373940_0000275_2614_3474 | 286 |
| 716 | 3300035089 | Ga0373944_0023050 | Ga0373944_0023050_28_888 | 286 |
| 717 | 3300035090 | Ga0373949_0001134 | Ga0373949_0001134_702_1562 | 286 |
| 718 | 3300035091 | Ga0373951_0000423 | Ga0373951_0000423_1624_2484 | 286 |
| 719 | 3300035092 | Ga0373952_0000038 | Ga0373952_0000038_2865_3725 | 286 |
| 720 | 3300035112 | Ga0373932_0000572 | Ga0373932_0000572_2622_3482 | 286 |
| 721 | 3300035114 | Ga0373939_0000257 | Ga0373939_0000257_5431_6291 | 286 |
| 722 | 3300035114 | Ga0373939_0001047 | Ga0373939_0001047_3789_4670 | 286 |
| 723 | 3300035115 | Ga0373941_0001225 | Ga0373941_0001225_747_1607 | 286 |
| 724 | 3300035118 | Ga0373954_0008462 | Ga0373954_0008462_3563_4465 | 286 |
| 725 | 3300035119 | Ga0373956_0011299 | Ga0373956_0011299_384_1289 | 286 |
| 726 | 3300035120 | Ga0373957_0001356 | Ga0373957_0001356_1891_2796 | 286 |
| 727 | 3300035121 | Ga0373960_0003182 | Ga0373960_0003182_2104_2964 | 286 |
| 728 | 3300035170 | Ga0373943_0016485 | Ga0373943_0016485_2494_3354 | 286 |
| 729 | 3300035172 | Ga0373955_0005429 | Ga0373955_0005429_1601_2503 | 286 |
| 730 | 3300035172 | Ga0373955_0157500 | Ga0373955_0157500_38_943 | 286 |
| 731 | 3300035172 | Ga0373955_0242916 | Ga0373955_0242916_10_915 | 286 |
| 732 | 3300035207 | Ga0373942_0000089 | Ga0373942_0000089_2570_3430 | 286 |
| 733 | 3300035242 | Ga0373962_0001788 | Ga0373962_0001788_4244_5104 | 286 |
| 734 | 3300035691 | Ga0373931_0002088 | Ga0373931_0002088_1913_2773 | 286 |
| 735 | 3300035692 | Ga0373935_0093329 | Ga0373935_0093329_485_1345 | 286 |
| 736 | 3300035724 | Ga0373933_0011372 | Ga0373933_0011372_3098_4000 | 286 |
| 737 | 3300035724 | Ga0373933_0025867 | Ga0373933_0025867_1923_2783 | 286 |
| 738 | 3300035725 | Ga0373947_0071765 | Ga0373947_0071765_1253_2113 | 286 |
| 739 | 3300036401 | Ga0373937_0018346 | Ga0373937_0018346_4769_5674 | 286 |
| 740 | 3300038996 | Ga0242420_006378 | Ga0242420_006378_630_1490 | 286 |
| 741 | 3300044712 | Ga0453684_0291155 | Ga0453684_0291155_269_1129 | 286 |
| 742 | 3300045051 | Ga0451576_0047830 | Ga0451576_0047830_2035_2895 | 286 |
| 743 | 3300046454 | Ga0495592_0025647 | Ga0495592_0025647_645_1550 | 286 |
| 744 | 3300046454 | Ga0495592_0096163 | Ga0495592_0096163_343_1245 | 286 |
| 745 | 3300046459 | Ga0495629_0310677 | Ga0495629_0310677_202_1062 | 286 |
| 746 | 3300046461 | Ga0495641_0055025 | Ga0495641_0055025_909_1769 | 286 |
| 747 | 3300046462 | Ga0495651_0015323 | Ga0495651_0015323_2285_3145 | 286 |
| 748 | 3300046462 | Ga0495651_0115960 | Ga0495651_0115960_817_1698 | 286 |
| 749 | 3300046463 | Ga0495653_0080036 | Ga0495653_0080036_869_1729 | 286 |
| 750 | 3300046472 | Ga0495580_0095263 | Ga0495580_0095263_177_1082 | 286 |
| 751 | 3300046477 | Ga0495664_0044002 | Ga0495664_0044002_1730_2635 | 286 |
| 752 | 3300046499 | Ga0495594_0224445 | Ga0495594_0224445_103_1008 | 286 |
| 753 | 3300046511 | Ga0495608_0003528 | Ga0495608_0003528_10276_11136 | 286 |
| 754 | 3300046514 | Ga0495618_0025853 | Ga0495618_0025853_1177_2037 | 286 |
| 755 | 3300046517 | Ga0495630_0057991 | Ga0495630_0057991_1336_2196 | 286 |
| 756 | 3300046529 | Ga0495652_0050380 | Ga0495652_0050380_426_1331 | 286 |
| 757 | 3300046529 | Ga0495652_0105769 | Ga0495652_0105769_192_1097 | 286 |
| 758 | 3300046533 | Ga0495640_0007483 | Ga0495640_0007483_11_871 | 286 |
| 759 | 3300046533 | Ga0495640_0074036 | Ga0495640_0074036_944_1849 | 286 |
| 760 | 3300046535 | Ga0495586_0056351 | Ga0495586_0056351_601_1461 | 286 |
| 761 | 3300046559 | Ga0495667_0027013 | Ga0495667_0027013_2598_3458 | 286 |
| 762 | 3300046642 | Ga0495634_0088252 | Ga0495634_0088252_457_1317 | 286 |
| 763 | 3300046663 | Ga0495635_0002274 | Ga0495635_0002274_2653_3558 | 286 |
| 764 | 3300046663 | Ga0495635_0071034 | Ga0495635_0071034_1175_2080 | 286 |
| 765 | 3300046675 | Ga0495657_0032249 | Ga0495657_0032249_958_1860 | 286 |
| 766 | 3300046675 | Ga0495657_0052882 | Ga0495657_0052882_381_1241 | 286 |
| 767 | 3300046678 | Ga0495599_0049221 | Ga0495599_0049221_1156_2061 | 286 |
| 768 | 3300046679 | Ga0495623_0012776 | Ga0495623_0012776_3992_4852 | 286 |
| 769 | 3300046680 | Ga0495646_0042876 | Ga0495646_0042876_534_1439 | 286 |
| 770 | 3300046681 | Ga0495647_0091051 | Ga0495647_0091051_63_968 | 286 |
| 771 | 3300046683 | Ga0495658_0166172 | Ga0495658_0166172_471_1331 | 286 |
| 772 | 3300046689 | Ga0495613_0049327 | Ga0495613_0049327_357_1262 | 286 |
| 773 | 3300046690 | Ga0495624_0079297 | Ga0495624_0079297_327_1232 | 286 |
| 774 | 3300046809 | Ga0495600_0068784 | Ga0495600_0068784_12_917 | 286 |
| 775 | 3300047315 | Ga0495581_0024160 | Ga0495581_0024160_2100_3005 | 286 |
| 776 | 3300047317 | Ga0495604_0013941 | Ga0495604_0013941_2220_3125 | 286 |
| 777 | 3300047317 | Ga0495604_0066726 | Ga0495604_0066726_693_1595 | 286 |
| 778 | 3300047319 | Ga0495674_0038342 | Ga0495674_0038342_2698_3603 | 286 |
| 779 | 3300047322 | Ga0495680_0009896 | Ga0495680_0009896_5650_6510 | 286 |
| 780 | 3300047322 | Ga0495680_0030095 | Ga0495680_0030095_3121_4023 | 286 |
| 781 | 3300047444 | Ga0495675_0005619 | Ga0495675_0005619_2789_3649 | 286 |
| 782 | 3300047471 | Ga0495684_0315276 | Ga0495684_0315276_53_958 | 286 |
| 783 | 3300048088 | Ga0495602_0006877 | Ga0495602_0006877_773_1678 | 286 |
| 784 | 3300048088 | Ga0495602_0168941 | Ga0495602_0168941_570_1472 | 286 |
| 785 | 3300048903 | Ga0496100_0015150 | Ga0496100_0015150_47_973 | 286 |
| 786 | 3300048904 | Ga0496101_0044420 | Ga0496101_0044420_1128_1988 | 286 |
| 787 | 3300048905 | Ga0496102_0005624 | Ga0496102_0005624_8772_9677 | 286 |
| 788 | 3300048905 | Ga0496102_0127882 | Ga0496102_0127882_61_921 | 286 |
| 789 | 3300048905 | Ga0496102_0271239 | Ga0496102_0271239_394_1317 | 286 |
| 790 | 3300048907 | Ga0496104_0041796 | Ga0496104_0041796_1895_2821 | 286 |
| 791 | 3300048907 | Ga0496104_0175177 | Ga0496104_0175177_51_911 | 286 |
| 792 | 3300048908 | Ga0496105_0006025 | Ga0496105_0006025_3518_4444 | 286 |
| 793 | 3300048909 | Ga0496106_0084416 | Ga0496106_0084416_283_1143 | 286 |
| 794 | 3300048909 | Ga0496106_0105407 | Ga0496106_0105407_480_1406 | 286 |
| 795 | 3300048910 | Ga0496107_0035169 | Ga0496107_0035169_1035_1895 | 286 |
| 796 | 3300048911 | Ga0496108_0015654 | Ga0496108_0015654_3954_4814 | 286 |
| 797 | 3300048911 | Ga0496108_0034918 | Ga0496108_0034918_2238_3098 | 286 |
| 798 | 3300048912 | Ga0496109_0013436 | Ga0496109_0013436_2752_3612 | 286 |
| 799 | 3300048912 | Ga0496109_0266679 | Ga0496109_0266679_472_1398 | 286 |
| 800 | 3300048913 | Ga0496110_0021235 | Ga0496110_0021235_2719_3579 | 286 |
| 801 | 3300048913 | Ga0496110_0239521 | Ga0496110_0239521_381_1241 | 286 |
| 802 | 3300048914 | Ga0496111_0208362 | Ga0496111_0208362_263_1123 | 286 |
| 803 | 3300048915 | Ga0496112_0392614 | Ga0496112_0392614_327_1253 | 286 |
| 804 | 3300048916 | Ga0496113_0009576 | Ga0496113_0009576_3342_4202 | 286 |
| 805 | 3300048916 | Ga0496113_0113591 | Ga0496113_0113591_623_1483 | 286 |
| 806 | 3300048917 | Ga0496114_0065102 | Ga0496114_0065102_1393_2253 | 286 |
| 807 | 3300048918 | Ga0496115_0056441 | Ga0496115_0056441_1254_2159 | 286 |
| 808 | 3300049569 | Ga0501032_0219459 | Ga0501032_0219459_268_1149 | 286 |
| 809 | 3300049571 | Ga0501034_0140283 | Ga0501034_0140283_658_1539 | 286 |
| 810 | 3300049571 | Ga0501034_0281827 | Ga0501034_0281827_501_1382 | 286 |
| 811 | 3300049572 | Ga0501036_0331580 | Ga0501036_0331580_117_1025 | 286 |
| 812 | 3300049581 | Ga0501047_0213918 | Ga0501047_0213918_261_1142 | 286 |
| 813 | 3300049586 | Ga0501070_0435956 | Ga0501070_0435956_116_997 | 286 |
| 814 | 3300049587 | Ga0501071_0255826 | Ga0501071_0255826_344_1225 | 286 |
| 815 | 3300049591 | Ga0501075_0170621 | Ga0501075_0170621_253_1161 | 286 |
| 816 | 3300049743 | Ga0501081_0296281 | Ga0501081_0296281_29_922 | 286 |
| 817 | 3300049744 | Ga0501083_0187620 | Ga0501083_0187620_91_996 | 286 |
| 818 | 3300049822 | Ga0501035_0128538 | Ga0501035_0128538_774_1655 | 286 |
| 819 | 3300050494 | nmdc:mga06z11_158180_c1 | nmdc:mga06z11_158180_c1_377_1237 | 286 |
| 820 | 3300050511 | nmdc:mga08y16_12219_c1 | nmdc:mga08y16_12219_c1_5995_6855 | 286 |
| 821 | 3300050512 | nmdc:mga0n895_120612_c1 | nmdc:mga0n895_120612_c1_1654_2514 | 286 |
| 822 | 3300050512 | nmdc:mga0n895_184670_c1 | nmdc:mga0n895_184670_c1_111_1010 | 286 |
| 823 | 3300050513 | nmdc:mga0rr50_206291_c1 | nmdc:mga0rr50_206291_c1_415_1275 | 286 |
| 824 | 3300050515 | nmdc:mga0a205_106498_c1 | nmdc:mga0a205_106498_c1_556_1461 | 286 |
| 825 | 3300050515 | nmdc:mga0a205_113332_c1 | nmdc:mga0a205_113332_c1_935_1795 | 286 |
| 826 | 3300053077 | Ga0495601_0028792 | Ga0495601_0028792_2462_3364 | 286 |
| 827 | 3300053078 | Ga0495612_0009252 | Ga0495612_0009252_2627_3529 | 286 |
| 828 | 3300053084 | Ga0495595_0075954 | Ga0495595_0075954_309_1190 | 286 |
| 829 | 3300053085 | Ga0495619_0020702 | Ga0495619_0020702_2923_3783 | 286 |
| 830 | 3300053085 | Ga0495619_0170464 | Ga0495619_0170464_508_1413 | 286 |
| 831 | 3300061719 | Ga0466962_0067368 | Ga0466962_0067368_524_1396 | 286 |
| 832 | 3300061734 | Ga0530510_0078676 | Ga0530510_0078676_511_1419 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rst-assembly1.cif.gz_A | crystal structure of bacillus subtilis signal peptide peptidase a | 0.8921 | 18 | 230 |
| 4kwb-assembly1.cif.gz_D | structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation | 0.8869 | 20 | 230 |
| 4kwb-assembly1.cif.gz_C | structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation | 0.886 | 17 | 230 |
| 4kwb-assembly1.cif.gz_H | structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation | 0.882 | 18 | 230 |
| 3rst-assembly1.cif.gz_B | crystal structure of bacillus subtilis signal peptide peptidase a | 0.8365 | 17 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kwbC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8726 | 17 | 230 | 3.90.226.10 |
| af_Q9C9C0_371_523_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8706 | 20 | 164 | 3.90.226.10 |
| af_P95072_325_478_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8665 | 18 | 159 | 3.90.226.10 |
| 3rstA02 | Special;Other non-globular;peptide peptidase (sppa) fold; | 0.8659 | 126 | 191 | 6.20.330.10 |
| 3rstA02 | Special;Other non-globular;peptide peptidase (sppa) fold; | 0.8432 | 126 | 191 | 6.20.330.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401TV86-F1-model_v4 | Peptidase S49 domain-containing protein | 0.9648 | 13 | 240 |
GO:0006508
GO:0008236 |
| AF-A0A401TV86-F1-model_v4 | Peptidase S49 domain-containing protein | 0.9607 | 13 | 240 |
GO:0006508
GO:0008236 |
| AF-X1KBM2-F1-model_v4 | Peptidase S49 domain-containing protein | 0.9488 | 2 | 236 |
GO:0006508
GO:0008236 |
| AF-A0A383EXC7-F1-model_v4 | Peptidase S49 domain-containing protein | 0.9458 | 13 | 129 |
GO:0006508
GO:0008233 |
| AF-A0A527ZKB2-F1-model_v4 | S49 family peptidase | 0.9453 | 27 | 236 |
GO:0006508
GO:0008236 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar