F482712

General Info

Members Datasets Scaffolds Average Seq Length
832 395 826 285

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100604010|Ga0070665_1006040101
Length 310
Sequence LTITQTTPPQATSADKEASKSAFKRTLTRAYALLPEKMRRRTPVVAVLPLSGAIGAASRFGGGLSMSRLEKVIDSAFAVKGVKAVALVINSPGGSPAQSHLIMRRIRALSAEKKVPVFAFVEDVAASGGYMIACAADEIIADPASILGSIGVVSASFGFDKLIEKIGVERRVHTAGRSKTMLDPFSPEKPEDIERLATLQREIHDMFIALVKERREGKLKADDDTLFTGEFWLAPRAIELGLADGIGDIRSVMRQRFGEKVRFRTVSESRGFLSRRLGFGTGFSAADSEQLTEGILFALEGRAIRARFGL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
3 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
4 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
5 2909042592 Labrys sp. LIt4 Isolate Nodule
6 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
7 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
8 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
9 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
10 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
11 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
12 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
13 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
234 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
235 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
236 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
237 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
238 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
239 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
240 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
241 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
253 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
254 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
255 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
256 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
257 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
258 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
259 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
323 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
324 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
387 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
388 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
389 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0.12
Rhizoplane 6.25
Rhizosphere 92.07
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214745202 2209111006 Bacteria 16175
2 ARcpr5oldR_c000031 3300000041 Bacteria 28603
3 ARcpr5oldR_c006817 3300000041 Bacteria 973
4 ARSoilYngRDRAFT_c00086 3300000042 Bacteria 15520
5 ARcpr5yngRDRAFT_c000084 3300000043 Bacteria 15520
6 ARSoilOldRDRAFT_c000050 3300000044 Bacteria 25074
7 ARCol0oldRDRAFT_c00024 3300000045 Bacteria 11391
8 ARCol0yngRDRAFT_1000023 3300000652 Bacteria 28722
9 JGI24736J21556_1015770 3300001904 Bacteria 1208
10 JGI24747J21853_1000375 3300001978 Bacteria 2649
11 JGI24739J22299_10005003 3300001989 Bacteria 5045
12 JGI24737J22298_10006384 3300001990 Bacteria 4028
13 JGI24750J21931_1007838 3300002070 Bacteria 1349
14 JGI24745J21846_1001867 3300002073 Bacteria 2090
15 JGI24748J21848_1006144 3300002074 Bacteria 1398
16 JGI24749J21850_1009858 3300002076 Bacteria 1335
17 JGI24744J21845_10002596 3300002077 Bacteria 3689
18 JGI24033J26618_1003037 3300002155 Bacteria 1751
19 JGI24034J26672_10000829 3300002239 Bacteria 4013
20 JGI24742J22300_10015325 3300002244 Bacteria 1289
21 JGI25406J46586_10000594 3300003203 Bacteria 17054
22 Ga0065712_10003536 3300005290 Bacteria 4967
23 Ga0065715_10000519 3300005293 Bacteria 20489
24 Ga0065715_10005464 3300005293 Bacteria 7340
25 Ga0065707_10116342 3300005295 Bacteria 2240
26 Ga0070658_10018141 3300005327 Bacteria 5631
27 Ga0070658_10151721 3300005327 Bacteria 1940
28 Ga0070676_10168784 3300005328 Bacteria 1414
29 Ga0070683_100008697 3300005329 Bacteria 8634
30 Ga0070690_100008145 3300005330 Bacteria 6024
31 Ga0070690_100010289 3300005330 Bacteria 5440
32 Ga0070690_100058971 3300005330 Bacteria 2467
33 Ga0070690_100062482 3300005330 Bacteria 2401
34 Ga0070670_100072895 3300005331 Bacteria 2949
35 Ga0070677_10009111 3300005333 Bacteria 3361
36 Ga0068869_100030072 3300005334 Bacteria 3809
37 Ga0068869_100036646 3300005334 Bacteria 3483
38 Ga0068869_100533468 3300005334 Bacteria 984
39 Ga0070666_10006379 3300005335 Bacteria 7253
40 Ga0070680_100003646 3300005336 Bacteria 11504
41 Ga0070680_100010386 3300005336 Bacteria 7177
42 Ga0070680_100058840 3300005336 Bacteria 3143
43 Ga0070680_100131222 3300005336 Bacteria 2096
44 Ga0070680_100162863 3300005336 Bacteria 1875
45 Ga0070680_100481503 3300005336 Bacteria 1061
46 Ga0070682_100006855 3300005337 Bacteria 6397
47 Ga0070682_100014492 3300005337 Bacteria 4558
48 Ga0070682_100104030 3300005337 Unclassified 1880
49 Ga0068868_100001527 3300005338 Bacteria 15860
50 Ga0068868_100134550 3300005338 Unclassified 2025
51 Ga0068868_100215125 3300005338 Bacteria 1607
52 Ga0070660_100007921 3300005339 Bacteria 7413
53 Ga0070660_100044535 3300005339 Bacteria 3395
54 Ga0070660_100102330 3300005339 Bacteria 2271
55 Ga0070660_100224086 3300005339 Bacteria 1529
56 Ga0070689_100000423 3300005340 Bacteria 24943
57 Ga0070689_100030326 3300005340 Bacteria 4104
58 Ga0070691_10030986 3300005341 Bacteria 2507
59 Ga0070691_10131904 3300005341 Bacteria 1267
60 Ga0070687_100010609 3300005343 Bacteria 3994
61 Ga0070687_100020102 3300005343 Bacteria 3117
62 Ga0070661_100001619 3300005344 Bacteria 15572
63 Ga0070661_100027189 3300005344 Bacteria 4118
64 Ga0070692_10007636 3300005345 Bacteria 4776
65 Ga0070692_10018028 3300005345 Bacteria 3388
66 Ga0070668_100042277 3300005347 Bacteria 3493
67 Ga0070669_100001139 3300005353 Bacteria 19432
68 Ga0070669_100033495 3300005353 Bacteria 3716
69 Ga0070669_100244144 3300005353 Bacteria 1428
70 Ga0070675_100043846 3300005354 Bacteria 3658
71 Ga0070675_100169371 3300005354 Bacteria 1883
72 Ga0070671_100000920 3300005355 Bacteria 21484
73 Ga0070671_100020437 3300005355 Bacteria 5400
74 Ga0070674_100013074 3300005356 Bacteria 5119
75 Ga0070674_100083620 3300005356 Bacteria 2287
76 Ga0070674_100215906 3300005356 Unclassified 1489
77 Ga0070673_100023791 3300005364 Bacteria 4480
78 Ga0070673_100047093 3300005364 Bacteria 3353
79 Ga0070688_100014995 3300005365 Bacteria 4399
80 Ga0070688_100042662 3300005365 Bacteria 2791
81 Ga0070659_100015775 3300005366 Bacteria 5662
82 Ga0070667_100014147 3300005367 Bacteria 6591
83 Ga0070667_100158272 3300005367 Unclassified 1993
84 Ga0070703_10028946 3300005406 Bacteria 1659
85 Ga0070709_10032744 3300005434 Bacteria 3137
86 Ga0070709_10065828 3300005434 Unclassified 2322
87 Ga0070709_10089090 3300005434 Bacteria 2031
88 Ga0070709_10178384 3300005434 Bacteria 1490
89 Ga0070714_100018806 3300005435 Bacteria 5619
90 Ga0070714_100144480 3300005435 Bacteria 2139
91 Ga0070714_100147728 3300005435 Bacteria 2115
92 Ga0070713_100001192 3300005436 Bacteria 16609
93 Ga0070701_10000614 3300005438 Bacteria 12496
94 Ga0070701_10031372 3300005438 Bacteria 2636
95 Ga0070701_10210556 3300005438 Bacteria 1154
96 Ga0070711_100006635 3300005439 Bacteria 6994
97 Ga0070711_100064343 3300005439 Bacteria 2562
98 Ga0070711_100071103 3300005439 Bacteria 2451
99 Ga0070705_100028362 3300005440 Bacteria 3066
100 Ga0070700_100027576 3300005441 Bacteria 3368
101 Ga0070700_100259116 3300005441 Bacteria 1251
102 Ga0070694_100003931 3300005444 Bacteria 8892
103 Ga0070694_100069203 3300005444 Bacteria 2427
104 Ga0070694_100189413 3300005444 Bacteria 1527
105 Ga0070708_100018331 3300005445 Bacteria 5858
106 Ga0070663_100317688 3300005455 Bacteria 1251
107 Ga0070678_100002661 3300005456 Bacteria 9840
108 Ga0070678_100069985 3300005456 Bacteria 2621
109 Ga0070678_100651078 3300005456 Bacteria 945
110 Ga0070662_100004411 3300005457 Bacteria 8892
111 Ga0070681_10066963 3300005458 Bacteria 3560
112 Ga0070681_10080212 3300005458 Bacteria 3219
113 Ga0070681_10114978 3300005458 Bacteria 2629
114 Ga0070681_10131744 3300005458 Bacteria 2432
115 Ga0068867_100006480 3300005459 Bacteria 8270
116 Ga0070679_100005088 3300005530 Bacteria 12151
117 Ga0070679_100045910 3300005530 Bacteria 4353
118 Ga0070679_100089271 3300005530 Bacteria 3069
119 Ga0070679_100178184 3300005530 Bacteria 2098
120 Ga0070684_100058016 3300005535 Bacteria 3382
121 Ga0070684_100071061 3300005535 Bacteria 3063
122 Ga0068853_100221054 3300005539 Bacteria 1730
123 Ga0068853_100506722 3300005539 Bacteria 1140
124 Ga0070672_100006170 3300005543 Bacteria 8023
125 Ga0070672_100101542 3300005543 Bacteria 2333
126 Ga0070686_100010831 3300005544 Bacteria 5157
127 Ga0070686_100019639 3300005544 Bacteria 3985
128 Ga0070686_100078329 3300005544 Bacteria 2182
129 Ga0070695_100020774 3300005545 Bacteria 4011
130 Ga0070695_100043885 3300005545 Bacteria 2844
131 Ga0070696_100004009 3300005546 Bacteria 9815
132 Ga0070696_100045991 3300005546 Bacteria 3026
133 Ga0070696_100058424 3300005546 Bacteria 2693
134 Ga0070696_100062587 3300005546 Bacteria 2605
135 Ga0070693_100002242 3300005547 Bacteria 8873
136 Ga0070665_100074891 3300005548 Bacteria 3391
137 Ga0070665_100604010 3300005548 Bacteria 1110
138 Ga0070704_100007752 3300005549 Bacteria 6399
139 Ga0070704_100042538 3300005549 Bacteria 3143
140 Ga0070704_100165906 3300005549 Bacteria 1751
141 Ga0068855_100011293 3300005563 Bacteria 10783
142 Ga0068855_100226656 3300005563 Bacteria 2094
143 Ga0068855_100270715 3300005563 Bacteria 1889
144 Ga0068855_100345202 3300005563 Bacteria 1640
145 Ga0070664_100039417 3300005564 Bacteria 3981
146 Ga0070664_100060752 3300005564 Bacteria 3219
147 Ga0070664_100093883 3300005564 Bacteria 2601
148 Ga0070664_100121615 3300005564 Bacteria 2287
149 Ga0068857_100001682 3300005577 Bacteria 17775
150 Ga0068857_100099307 3300005577 Bacteria 2611
151 Ga0068857_100236670 3300005577 Bacteria 1671
152 Ga0068854_100004886 3300005578 Bacteria 8457
153 Ga0068854_100090331 3300005578 Bacteria 2277
154 Ga0068854_100194218 3300005578 Bacteria 1592
155 Ga0068856_100008165 3300005614 Bacteria 10207
156 Ga0068856_100067227 3300005614 Bacteria 3542
157 Ga0068856_100120855 3300005614 Bacteria 2621
158 Ga0068856_100359461 3300005614 Bacteria 1475
159 Ga0070702_100037932 3300005615 Bacteria 2679
160 Ga0068852_100001494 3300005616 Bacteria 15815
161 Ga0068859_100008349 3300005617 Bacteria 10494
162 Ga0068859_100464819 3300005617 Unclassified 1361
163 Ga0068864_100001074 3300005618 Bacteria 22938
164 Ga0068864_100063921 3300005618 Bacteria 3190
165 Ga0068864_100260015 3300005618 Bacteria 1614
166 Ga0068866_10001816 3300005718 Bacteria 8977
167 Ga0068866_10063618 3300005718 Bacteria 1924
168 Ga0068861_100040271 3300005719 Bacteria 3493
169 Ga0068861_100054273 3300005719 Bacteria 3052
170 Ga0068851_10026105 3300005834 Bacteria 2868
171 Ga0068870_10000051 3300005840 Bacteria 36782
172 Ga0068863_100023028 3300005841 Bacteria 5953
173 Ga0068858_100005723 3300005842 Bacteria 12147
174 Ga0068858_100097241 3300005842 Bacteria 2744
175 Ga0068860_100001825 3300005843 Bacteria 22684
176 Ga0068860_100208852 3300005843 Bacteria 1894
177 Ga0068862_100150419 3300005844 Bacteria 2072
178 Ga0068862_100372080 3300005844 Bacteria 1330
179 Ga0081455_10000081 3300005937 Bacteria 103752
180 Ga0081455_10007188 3300005937 Bacteria 11768
181 Ga0081455_10241404 3300005937 Bacteria 1327
182 Ga0081539_10001482 3300005985 Bacteria 39787
183 Ga0070717_10088976 3300006028 Bacteria 2604
184 Ga0070717_10103396 3300006028 Bacteria 2421
185 Ga0075432_10006659 3300006058 Bacteria 3933
186 Ga0070715_10026308 3300006163 Bacteria 2314
187 Ga0070716_100004877 3300006173 Bacteria 6452
188 Ga0070716_100265469 3300006173 Bacteria 1177
189 Ga0070712_100153422 3300006175 Bacteria 1771
190 Ga0075367_10037100 3300006178 Bacteria 2830
191 Ga0097621_100002133 3300006237 Bacteria 13532
192 Ga0097621_100002924 3300006237 Bacteria 11739
193 Ga0097621_100004972 3300006237 Bacteria 9322
194 Ga0068871_100004127 3300006358 Bacteria 10046
195 Ga0068871_100029472 3300006358 Bacteria 4311
196 Ga0068871_100039055 3300006358 Bacteria 3796
197 Ga0075428_100005056 3300006844 Bacteria 14667
198 Ga0075428_100451942 3300006844 Bacteria 1376
199 Ga0075430_100001054 3300006846 Bacteria 21797
200 Ga0075431_100001076 3300006847 Bacteria 24422
201 Ga0075433_10009722 3300006852 Bacteria 7703
202 Ga0075433_10035548 3300006852 Bacteria 4285
203 Ga0075433_10089970 3300006852 Bacteria 2713
204 Ga0075434_100003201 3300006871 Bacteria 14596
205 Ga0075434_100006467 3300006871 Bacteria 10738
206 Ga0075434_100434955 3300006871 Bacteria 1333
207 Ga0075429_100000098 3300006880 Bacteria 47888
208 Ga0068865_100031407 3300006881 Bacteria 3542
209 Ga0068865_100032338 3300006881 Bacteria 3493
210 Ga0068865_100132391 3300006881 Bacteria 1870
211 Ga0068865_100273006 3300006881 Bacteria 1343
212 Ga0075436_100012725 3300006914 Bacteria 5767
213 Ga0097620_100008349 3300006931 Bacteria 10494
214 Ga0097620_100464822 3300006931 Unclassified 1361
215 Ga0075435_100029590 3300007076 Bacteria 4299
216 Ga0075435_100041124 3300007076 Bacteria 3694
217 Ga0075435_100206909 3300007076 Bacteria 1663
218 Ga0105251_10019521 3300009011 Bacteria 3578
219 Ga0105240_10049462 3300009093 Bacteria 5305
220 Ga0105240_10129854 3300009093 Bacteria 3023
221 Ga0105240_10311400 3300009093 Bacteria 1798
222 Ga0111539_10000757 3300009094 Bacteria 42016
223 Ga0111539_10001671 3300009094 Bacteria 29561
224 Ga0111539_10032539 3300009094 Bacteria 6332
225 Ga0111539_10059301 3300009094 Bacteria 4539
226 Ga0105245_10120387 3300009098 Bacteria 2451
227 Ga0105247_10002735 3300009101 Bacteria 11818
228 Ga0105247_10015124 3300009101 Bacteria 4628
229 Ga0105247_10032592 3300009101 Bacteria 3166
230 Ga0114129_10008949 3300009147 Bacteria 14268
231 Ga0114129_10017470 3300009147 Bacteria 10214
232 Ga0105243_10006997 3300009148 Bacteria 8685
233 Ga0105243_10023377 3300009148 Bacteria 4707
234 Ga0105243_10036757 3300009148 Bacteria 3803
235 Ga0105243_10131072 3300009148 Bacteria 2126
236 Ga0105241_10010830 3300009174 Bacteria 6690
237 Ga0105241_10016796 3300009174 Bacteria 5372
238 Ga0105241_10043867 3300009174 Bacteria 3387
239 Ga0105242_10056130 3300009176 Bacteria 3222
240 Ga0105242_10121283 3300009176 Bacteria 2244
241 Ga0105248_10010592 3300009177 Bacteria 10164
242 Ga0105248_10069576 3300009177 Bacteria 3951
243 Ga0105248_10390089 3300009177 Bacteria 1568
244 Ga0105237_10031006 3300009545 Bacteria 5423
245 Ga0105237_10070292 3300009545 Bacteria 3496
246 Ga0105237_10079628 3300009545 Bacteria 3266
247 Ga0105238_10208106 3300009551 Bacteria 1932
248 Ga0105238_10316663 3300009551 Bacteria 1546
249 Ga0105238_10794447 3300009551 Bacteria 962
250 Ga0105249_10001193 3300009553 Bacteria 22912
251 Ga0105249_10018341 3300009553 Bacteria 6223
252 Ga0105239_10494684 3300010375 Bacteria 1390
253 Ga0105239_11064495 3300010375 Bacteria 931
254 Ga0105246_10000255 3300011119 Bacteria 27531
255 Ga0105246_10062593 3300011119 Bacteria 2593
256 Ga0105246_10239870 3300011119 Bacteria 1432
257 Ga0157339_1003789 3300012505 Bacteria 1110
258 Ga0157373_10049682 3300013100 Bacteria 2988
259 Ga0157373_10071545 3300013100 Bacteria 2449
260 Ga0157373_10142614 3300013100 Bacteria 1685
261 Ga0157371_10017533 3300013102 Bacteria 5318
262 Ga0157370_10039505 3300013104 Bacteria 4560
263 Ga0157370_10151546 3300013104 Bacteria 2157
264 Ga0157369_10134356 3300013105 Bacteria 2620
265 Ga0157369_10379008 3300013105 Bacteria 1468
266 Ga0157374_10028071 3300013296 Bacteria 5083
267 Ga0157374_10042269 3300013296 Bacteria 4204
268 Ga0157374_10198445 3300013296 Bacteria 1964
269 Ga0157374_10307472 3300013296 Bacteria 1569
270 Ga0157378_10022902 3300013297 Bacteria 5498
271 Ga0157378_10140503 3300013297 Bacteria 2242
272 Ga0157378_10261221 3300013297 Bacteria 1661
273 Ga0163162_10066273 3300013306 Bacteria 3660
274 Ga0157372_10027692 3300013307 Bacteria 6176
275 Ga0157372_10301657 3300013307 Bacteria 1863
276 Ga0157372_10379577 3300013307 Bacteria 1647
277 Ga0157375_10020563 3300013308 Bacteria 6032
278 Ga0157375_10044607 3300013308 Bacteria 4309
279 Ga0157375_10056005 3300013308 Bacteria 3890
280 Ga0157375_10307533 3300013308 Bacteria 1749
281 Ga0163163_10087213 3300014325 Bacteria 3131
282 Ga0157380_10005310 3300014326 Bacteria 9001
283 Ga0157380_10024000 3300014326 Bacteria 4609
284 Ga0157380_10072062 3300014326 Bacteria 2797
285 Ga0157377_10000164 3300014745 Bacteria 39592
286 Ga0157379_10002095 3300014968 Bacteria 16559
287 Ga0157379_10077215 3300014968 Bacteria 2982
288 Ga0157376_10027757 3300014969 Bacteria 4491
289 Ga0163161_10027479 3300017792 Bacteria 4037
290 Ga0163161_10038484 3300017792 Bacteria 3430
291 Ga0207666_1000051 3300025271 Bacteria 21813
292 Ga0207666_1000825 3300025271 Bacteria 3721
293 Ga0207673_1000758 3300025290 Bacteria 3479
294 Ga0207697_10003536 3300025315 Bacteria 7704
295 Ga0207653_10016506 3300025885 Bacteria 2319
296 Ga0207653_10037868 3300025885 Bacteria 1574
297 Ga0207682_10000072 3300025893 Bacteria 44659
298 Ga0207692_10156767 3300025898 Bacteria 1309
299 Ga0207642_10029170 3300025899 Bacteria 2281
300 Ga0207710_10004456 3300025900 Bacteria 6110
301 Ga0207710_10018655 3300025900 Bacteria 2953
302 Ga0207688_10000229 3300025901 Bacteria 25389
303 Ga0207680_10008261 3300025903 Bacteria 5103
304 Ga0207680_10050338 3300025903 Bacteria 2485
305 Ga0207680_10189720 3300025903 Bacteria 1394
306 Ga0207680_10232782 3300025903 Bacteria 1267
307 Ga0207647_10002000 3300025904 Bacteria 15594
308 Ga0207647_10022872 3300025904 Bacteria 4146
309 Ga0207685_10037720 3300025905 Bacteria 1782
310 Ga0207699_10003384 3300025906 Bacteria 7603
311 Ga0207699_10028904 3300025906 Bacteria 3086
312 Ga0207645_10000966 3300025907 Bacteria 23780
313 Ga0207645_10037371 3300025907 Bacteria 3115
314 Ga0207643_10000004 3300025908 Bacteria 187006
315 Ga0207705_10004623 3300025909 Bacteria 10387
316 Ga0207654_10153464 3300025911 Bacteria 1481
317 Ga0207654_10233533 3300025911 Bacteria 1226
318 Ga0207707_10008300 3300025912 Bacteria 9012
319 Ga0207707_10060858 3300025912 Bacteria 3284
320 Ga0207707_10131577 3300025912 Bacteria 2188
321 Ga0207707_10141147 3300025912 Bacteria 2106
322 Ga0207671_10118354 3300025914 Bacteria 2023
323 Ga0207671_10189574 3300025914 Bacteria 1603
324 Ga0207693_10035873 3300025915 Bacteria 3908
325 Ga0207693_10117308 3300025915 Bacteria 2090
326 Ga0207693_10271129 3300025915 Bacteria 1330
327 Ga0207663_10021824 3300025916 Bacteria 3651
328 Ga0207663_10047876 3300025916 Unclassified 2642
329 Ga0207663_10074049 3300025916 Unclassified 2206
330 Ga0207663_10127052 3300025916 Bacteria 1756
331 Ga0207660_10004454 3300025917 Bacteria 9129
332 Ga0207662_10000317 3300025918 Bacteria 21877
333 Ga0207657_10002047 3300025919 Bacteria 21819
334 Ga0207657_10052705 3300025919 Bacteria 3529
335 Ga0207657_10057638 3300025919 Bacteria 3347
336 Ga0207657_10060705 3300025919 Bacteria 3244
337 Ga0207649_10000262 3300025920 Bacteria 41689
338 Ga0207649_10055749 3300025920 Bacteria 2465
339 Ga0207652_10000911 3300025921 Bacteria 27891
340 Ga0207652_10027424 3300025921 Bacteria 4747
341 Ga0207681_10038404 3300025923 Bacteria 3172
342 Ga0207694_10249115 3300025924 Bacteria 1453
343 Ga0207650_10197358 3300025925 Bacteria 1610
344 Ga0207659_10001285 3300025926 Bacteria 15002
345 Ga0207659_10038335 3300025926 Bacteria 3333
346 Ga0207659_10125257 3300025926 Bacteria 1975
347 Ga0207659_10178888 3300025926 Bacteria 1679
348 Ga0207687_10132991 3300025927 Bacteria 1878
349 Ga0207700_10047638 3300025928 Bacteria 3178
350 Ga0207700_10184941 3300025928 Bacteria 1747
351 Ga0207664_10018712 3300025929 Bacteria 5107
352 Ga0207664_10053132 3300025929 Bacteria 3206
353 Ga0207664_10190714 3300025929 Bacteria 1764
354 Ga0207664_10261411 3300025929 Bacteria 1514
355 Ga0207644_10004727 3300025931 Bacteria 8849
356 Ga0207644_10017581 3300025931 Bacteria 4833
357 Ga0207690_10001058 3300025932 Bacteria 17643
358 Ga0207690_10465128 3300025932 Unclassified 1018
359 Ga0207706_10001679 3300025933 Bacteria 21866
360 Ga0207706_10016549 3300025933 Bacteria 6658
361 Ga0207706_10035958 3300025933 Bacteria 4401
362 Ga0207686_10005614 3300025934 Bacteria 6726
363 Ga0207686_10230052 3300025934 Bacteria 1343
364 Ga0207709_10009302 3300025935 Bacteria 5410
365 Ga0207709_10069409 3300025935 Bacteria 2231
366 Ga0207709_10141922 3300025935 Bacteria 1652
367 Ga0207670_10000377 3300025936 Bacteria 25697
368 Ga0207670_10026617 3300025936 Bacteria 3647
369 Ga0207670_10068553 3300025936 Bacteria 2444
370 Ga0207669_10014544 3300025937 Bacteria 3947
371 Ga0207704_10006515 3300025938 Bacteria 5451
372 Ga0207665_10008284 3300025939 Bacteria 6863
373 Ga0207665_10043156 3300025939 Bacteria 3015
374 Ga0207691_10026103 3300025940 Bacteria 5483
375 Ga0207691_10034812 3300025940 Bacteria 4680
376 Ga0207691_10102469 3300025940 Bacteria 2553
377 Ga0207711_10006200 3300025941 Bacteria 10106
378 Ga0207711_10016950 3300025941 Bacteria 6051
379 Ga0207711_10158113 3300025941 Bacteria 2049
380 Ga0207689_10000203 3300025942 Bacteria 52425
381 Ga0207689_10029484 3300025942 Bacteria 4581
382 Ga0207689_10115522 3300025942 Bacteria 2206
383 Ga0207661_10002165 3300025944 Bacteria 13530
384 Ga0207661_10081279 3300025944 Bacteria 2676
385 Ga0207661_10321539 3300025944 Bacteria 1391
386 Ga0207679_10000157 3300025945 Bacteria 56166
387 Ga0207679_10026481 3300025945 Bacteria 3998
388 Ga0207667_10684738 3300025949 Bacteria 1029
389 Ga0207651_10000367 3300025960 Bacteria 19162
390 Ga0207712_10015168 3300025961 Bacteria 4966
391 Ga0207668_10070419 3300025972 Bacteria 2494
392 Ga0207668_10075414 3300025972 Bacteria 2424
393 Ga0207640_10051155 3300025981 Bacteria 2684
394 Ga0207640_10063139 3300025981 Bacteria 2460
395 Ga0207658_10004781 3300025986 Bacteria 9370
396 Ga0207658_10261344 3300025986 Bacteria 1475
397 Ga0207658_10509926 3300025986 Bacteria 1072
398 Ga0207677_10003050 3300026023 Bacteria 8858
399 Ga0207677_10161592 3300026023 Bacteria 1741
400 Ga0207677_10190552 3300026023 Bacteria 1621
401 Ga0207703_10001346 3300026035 Bacteria 22503
402 Ga0207703_10001852 3300026035 Bacteria 18819
403 Ga0207703_10088084 3300026035 Bacteria 2604
404 Ga0207703_10352273 3300026035 Bacteria 1356
405 Ga0207639_10078753 3300026041 Bacteria 2602
406 Ga0207639_10252239 3300026041 Bacteria 1539
407 Ga0207678_10010941 3300026067 Bacteria 7972
408 Ga0207678_10036309 3300026067 Bacteria 4290
409 Ga0207708_10037666 3300026075 Bacteria 3683
410 Ga0207702_10204245 3300026078 Bacteria 1833
411 Ga0207702_10279623 3300026078 Bacteria 1577
412 Ga0207641_10094986 3300026088 Bacteria 2615
413 Ga0207641_10224085 3300026088 Bacteria 1745
414 Ga0207648_10002073 3300026089 Bacteria 21861
415 Ga0207648_10128032 3300026089 Bacteria 2234
416 Ga0207648_10141470 3300026089 Bacteria 2120
417 Ga0207676_10010349 3300026095 Bacteria 6640
418 Ga0207674_10000897 3300026116 Bacteria 38907
419 Ga0207674_10203297 3300026116 Bacteria 1930
420 Ga0207674_10570885 3300026116 Bacteria 1093
421 Ga0207675_100001726 3300026118 Bacteria 21899
422 Ga0207675_100115286 3300026118 Bacteria 2539
423 Ga0207675_100119875 3300026118 Bacteria 2489
424 Ga0207675_100255987 3300026118 Bacteria 1696
425 Ga0207683_10001176 3300026121 Bacteria 23694
426 Ga0207698_10039789 3300026142 Bacteria 3486
427 Ga0207698_10088166 3300026142 Bacteria 2530
428 Ga0209983_1027703 3300027665 Bacteria 1200
429 Ga0209966_1001285 3300027695 Bacteria 4454
430 Ga0209966_1009770 3300027695 Bacteria 1719
431 Ga0209998_10000255 3300027717 Bacteria 17497
432 Ga0209998_10024295 3300027717 Bacteria 1314
433 Ga0209974_10002830 3300027876 Bacteria 6301
434 Ga0209974_10099082 3300027876 Bacteria 1017
435 Ga0207428_10000137 3300027907 Bacteria 98535
436 Ga0207428_10000165 3300027907 Bacteria 91701
437 Ga0207428_10000792 3300027907 Bacteria 35769
438 Ga0268266_10018077 3300028379 Bacteria 6008
439 Ga0268266_10109108 3300028379 Bacteria 2450
440 Ga0268265_10066454 3300028380 Bacteria 2787
441 Ga0268265_10137636 3300028380 Bacteria 2039
442 Ga0268264_10001616 3300028381 Bacteria 20825
443 Ga0265325_10000264 3300031241 Bacteria 37210
444 Ga0265325_10037662 3300031241 Bacteria 2556
445 Ga0265340_10013138 3300031247 Bacteria 4358
446 Ga0265340_10079733 3300031247 Bacteria 1543
447 Ga0265331_10090758 3300031250 Bacteria 1412
448 Ga0265316_10117357 3300031344 Bacteria 2012
449 Ga0265316_10135948 3300031344 Bacteria 1849
450 Ga0307509_10376187 3300031507 Bacteria 1135
451 Ga0265313_10069516 3300031595 Unclassified 1624
452 Ga0316575_10035231 3300031665 Bacteria 1967
453 Ga0265314_10001726 3300031711 Bacteria 23697
454 Ga0265314_10009303 3300031711 Bacteria 8315
455 Ga0265314_10060754 3300031711 Bacteria 2578
456 Ga0316583_10002826 3300032133 Bacteria 6078
457 Ga0307510_10133597 3300033180 Bacteria 2146
458 Ga0373930_0000452 3300034816 Bacteria 5500
459 Ga0373930_0004658 3300034816 Bacteria 2245
460 Ga0373930_0013677 3300034816 Bacteria 1500
461 Ga0373948_0000822 3300034817 Bacteria 4099
462 Ga0373948_0013582 3300034817 Bacteria 1472
463 Ga0373948_0047176 3300034817 Unclassified 917
464 Ga0373958_0000721 3300034819 Bacteria 4197
465 Ga0373959_0001671 3300034820 Bacteria 3527
466 Ga0373959_0015498 3300034820 Bacteria 1400
467 Ga0373938_0008796 3300034957 Bacteria 1812
468 Ga0373938_0016684 3300034957 Bacteria 1438
469 Ga0373926_0002855 3300035083 Bacteria 5532
470 Ga0373928_0000449 3300035084 Bacteria 8127
471 Ga0373929_0000206 3300035085 Bacteria 10608
472 Ga0373934_0002288 3300035086 Bacteria 7052
473 Ga0373934_0018396 3300035086 Bacteria 2673
474 Ga0373934_0026660 3300035086 Bacteria 2242
475 Ga0373934_0099366 3300035086 Unclassified 1176
476 Ga0373940_0000275 3300035088 Bacteria 7415
477 Ga0373944_0001376 3300035089 Bacteria 6132
478 Ga0373944_0023050 3300035089 Bacteria 1813
479 Ga0373949_0001134 3300035090 Bacteria 8033
480 Ga0373949_0006003 3300035090 Bacteria 2693
481 Ga0373951_0000423 3300035091 Bacteria 12422
482 Ga0373951_0001767 3300035091 Bacteria 5622
483 Ga0373952_0000038 3300035092 Bacteria 15588
484 Ga0373952_0003171 3300035092 Bacteria 2961
485 Ga0373923_0003371 3300035111 Bacteria 5112
486 Ga0373932_0000572 3300035112 Bacteria 11295
487 Ga0373936_0006584 3300035113 Bacteria 4375
488 Ga0373939_0000257 3300035114 Bacteria 14265
489 Ga0373939_0001047 3300035114 Bacteria 6813
490 Ga0373939_0001338 3300035114 Bacteria 5981
491 Ga0373939_0003044 3300035114 Bacteria 3937
492 Ga0373941_0001225 3300035115 Bacteria 5387
493 Ga0373941_0003694 3300035115 Bacteria 3484
494 Ga0373945_0004740 3300035116 Bacteria 4330
495 Ga0373953_0016152 3300035117 Bacteria 2721
496 Ga0373954_0008462 3300035118 Bacteria 4516
497 Ga0373956_0011299 3300035119 Bacteria 3678
498 Ga0373956_0055402 3300035119 Unclassified 1788
499 Ga0373957_0001356 3300035120 Bacteria 6580
500 Ga0373957_0052537 3300035120 Unclassified 1561
501 Ga0373960_0003182 3300035121 Bacteria 3710
502 Ga0373960_0006465 3300035121 Bacteria 2751
503 Ga0373960_0014057 3300035121 Bacteria 2020
504 Ga0373943_0013498 3300035170 Bacteria 3690
505 Ga0373943_0016485 3300035170 Bacteria 3370
506 Ga0373943_0051142 3300035170 Bacteria 2033
507 Ga0373943_0082021 3300035170 Unclassified 1655
508 Ga0373946_0008671 3300035171 Bacteria 3733
509 Ga0373955_0002078 3300035172 Bacteria 8632
510 Ga0373955_0002733 3300035172 Bacteria 7732
511 Ga0373955_0005429 3300035172 Bacteria 5729
512 Ga0373955_0157500 3300035172 Bacteria 1338
513 Ga0373955_0242916 3300035172 Bacteria 1079
514 Ga0373942_0000089 3300035207 Bacteria 19884
515 Ga0373942_0014182 3300035207 Bacteria 1925
516 Ga0373942_0030018 3300035207 Bacteria 1430
517 Ga0373961_0002484 3300035241 Bacteria 4767
518 Ga0373961_0038548 3300035241 Bacteria 1369
519 Ga0373962_0001788 3300035242 Bacteria 5119
520 Ga0373962_0006580 3300035242 Bacteria 2816
521 Ga0373924_0075788 3300035410 Bacteria 1424
522 Ga0373924_0170489 3300035410 Unclassified 956
523 Ga0373931_0001147 3300035691 Bacteria 11271
524 Ga0373931_0002088 3300035691 Bacteria 8796
525 Ga0373931_0016624 3300035691 Bacteria 3624
526 Ga0373931_0200950 3300035691 Bacteria 1191
527 Ga0373935_0006737 3300035692 Bacteria 6862
528 Ga0373935_0035049 3300035692 Bacteria 3131
529 Ga0373935_0093329 3300035692 Unclassified 1973
530 Ga0373927_0017667 3300035695 Bacteria 4692
531 Ga0373927_0179748 3300035695 Bacteria 1388
532 Ga0373933_0011372 3300035724 Bacteria 4902
533 Ga0373933_0016229 3300035724 Bacteria 4161
534 Ga0373933_0025867 3300035724 Bacteria 3367
535 Ga0373933_0254782 3300035724 Bacteria 1131
536 Ga0373947_0000424 3300035725 Bacteria 23999
537 Ga0373947_0071765 3300035725 Bacteria 2124
538 Ga0373937_0014261 3300036401 Bacteria 7013
539 Ga0373937_0018346 3300036401 Bacteria 6248
540 Ga0373937_0047021 3300036401 Bacteria 3947
541 Ga0373937_0054598 3300036401 Bacteria 3667
542 Ga0373937_0376761 3300036401 Bacteria 1346
543 Ga0316582_0188954 3300036647 Bacteria 1403
544 Ga0373925_0049481 3300037068 Unclassified 3133
545 Ga0373925_0050867 3300037068 Bacteria 3091
546 Ga0395905_0281473 3300037471 Bacteria 1549
547 Ga0242420_006378 3300038996 Bacteria 1861
548 Ga0453684_0291155 3300044712 Bacteria 1859
549 Ga0451576_0047830 3300045051 Bacteria 4496
550 Ga0451576_0396498 3300045051 Bacteria 1447
551 Ga0495592_0025647 3300046454 Bacteria 4473
552 Ga0495592_0041594 3300046454 Bacteria 3444
553 Ga0495592_0096163 3300046454 Bacteria 2117
554 Ga0495603_0038640 3300046455 Bacteria 2862
555 Ga0495591_032418 3300046458 Bacteria 1555
556 Ga0495629_0000447 3300046459 Bacteria 34326
557 Ga0495629_0112296 3300046459 Bacteria 1899
558 Ga0495629_0310677 3300046459 Unclassified 1078
559 Ga0495641_0055025 3300046461 Unclassified 1807
560 Ga0495651_0015323 3300046462 Bacteria 5927
561 Ga0495651_0020710 3300046462 Bacteria 5106
562 Ga0495651_0030858 3300046462 Bacteria 4179
563 Ga0495651_0115960 3300046462 Bacteria 1974
564 Ga0495653_0013922 3300046463 Bacteria 6558
565 Ga0495653_0080036 3300046463 Bacteria 2418
566 Ga0495580_0019007 3300046472 Bacteria 5109
567 Ga0495580_0095263 3300046472 Bacteria 2070
568 Ga0495582_0006745 3300046473 Bacteria 6388
569 Ga0495662_0016654 3300046476 Bacteria 3561
570 Ga0495664_0044002 3300046477 Bacteria 2645
571 Ga0495664_0086099 3300046477 Unclassified 1887
572 Ga0495584_0006761 3300046491 Bacteria 5992
573 Ga0495584_0102450 3300046491 Bacteria 1447
574 Ga0495585_0003617 3300046492 Bacteria 10355
575 Ga0495594_0021714 3300046499 Bacteria 3428
576 Ga0495594_0129357 3300046499 Bacteria 1429
577 Ga0495594_0224445 3300046499 Unclassified 1071
578 Ga0495607_0007932 3300046501 Bacteria 7299
579 Ga0495608_0003528 3300046511 Bacteria 11206
580 Ga0495618_0025853 3300046514 Bacteria 3646
581 Ga0495628_0006361 3300046516 Bacteria 10324
582 Ga0495628_0011889 3300046516 Bacteria 7341
583 Ga0495628_0025333 3300046516 Bacteria 4846
584 Ga0495630_0057991 3300046517 Bacteria 2902
585 Ga0495630_0072935 3300046517 Bacteria 2584
586 Ga0495644_0000748 3300046523 Bacteria 13392
587 Ga0495666_0042043 3300046526 Bacteria 2211
588 Ga0495652_0011053 3300046529 Bacteria 8182
589 Ga0495652_0050380 3300046529 Bacteria 3560
590 Ga0495652_0072716 3300046529 Bacteria 2865
591 Ga0495652_0105769 3300046529 Bacteria 2273
592 Ga0495640_0007483 3300046533 Bacteria 8580
593 Ga0495640_0074036 3300046533 Bacteria 2278
594 Ga0495586_0007081 3300046535 Bacteria 5978
595 Ga0495586_0056351 3300046535 Bacteria 2131
596 Ga0495587_0009207 3300046536 Bacteria 6335
597 Ga0495587_0025703 3300046536 Bacteria 3597
598 Ga0495598_0019699 3300046537 Bacteria 1773
599 Ga0495645_0003160 3300046543 Bacteria 11163
600 Ga0495645_0051861 3300046543 Bacteria 2985
601 Ga0495622_0012435 3300046557 Bacteria 3940
602 Ga0495633_0007380 3300046558 Bacteria 6332
603 Ga0495667_0004191 3300046559 Bacteria 9712
604 Ga0495667_0004817 3300046559 Bacteria 9124
605 Ga0495667_0027013 3300046559 Bacteria 3868
606 Ga0495667_0034869 3300046559 Bacteria 3365
607 Ga0495656_0013672 3300046615 Bacteria 3025
608 Ga0495634_0088252 3300046642 Unclassified 2017
609 Ga0495634_0161494 3300046642 Bacteria 1412
610 Ga0495611_0003367 3300046648 Bacteria 7056
611 Ga0495635_0002274 3300046663 Bacteria 13065
612 Ga0495635_0021903 3300046663 Bacteria 4454
613 Ga0495635_0061311 3300046663 Bacteria 2584
614 Ga0495635_0061844 3300046663 Unclassified 2571
615 Ga0495635_0071034 3300046663 Bacteria 2386
616 Ga0495588_0006148 3300046674 Bacteria 5392
617 Ga0495657_0032249 3300046675 Bacteria 3658
618 Ga0495657_0052882 3300046675 Bacteria 2720
619 Ga0495657_0167146 3300046675 Bacteria 1357
620 Ga0495599_0006608 3300046678 Bacteria 6995
621 Ga0495599_0031607 3300046678 Bacteria 3322
622 Ga0495599_0049221 3300046678 Bacteria 2641
623 Ga0495623_0012776 3300046679 Bacteria 5436
624 Ga0495623_0035467 3300046679 Bacteria 3197
625 Ga0495646_0042876 3300046680 Bacteria 2774
626 Ga0495646_0044732 3300046680 Bacteria 2706
627 Ga0495647_0091051 3300046681 Bacteria 1250
628 Ga0495658_0003413 3300046683 Bacteria 7863
629 Ga0495658_0033330 3300046683 Bacteria 2819
630 Ga0495658_0166172 3300046683 Bacteria 1363
631 Ga0495613_0022722 3300046689 Bacteria 4673
632 Ga0495613_0049327 3300046689 Bacteria 3107
633 Ga0495613_0110478 3300046689 Bacteria 1981
634 Ga0495624_0021150 3300046690 Bacteria 4318
635 Ga0495624_0079297 3300046690 Bacteria 2036
636 Ga0495670_0001290 3300046691 Bacteria 12211
637 Ga0495671_0084329 3300046692 Unclassified 1557
638 Ga0495600_0004224 3300046809 Bacteria 8577
639 Ga0495600_0068784 3300046809 Bacteria 2314
640 Ga0495581_0009308 3300047315 Bacteria 5684
641 Ga0495581_0011457 3300047315 Bacteria 5133
642 Ga0495581_0024160 3300047315 Bacteria 3522
643 Ga0495604_0013941 3300047317 Bacteria 6412
644 Ga0495604_0036706 3300047317 Bacteria 3863
645 Ga0495604_0038875 3300047317 Bacteria 3743
646 Ga0495604_0064299 3300047317 Bacteria 2796
647 Ga0495604_0066726 3300047317 Bacteria 2736
648 Ga0495674_0029272 3300047319 Bacteria 5018
649 Ga0495674_0038342 3300047319 Bacteria 4301
650 Ga0495674_0093302 3300047319 Unclassified 2569
651 Ga0495676_0035281 3300047321 Bacteria 4185
652 Ga0495680_0002870 3300047322 Bacteria 17316
653 Ga0495680_0009896 3300047322 Bacteria 8548
654 Ga0495680_0030095 3300047322 Bacteria 4437
655 Ga0495680_0048923 3300047322 Bacteria 3316
656 Ga0495680_0081031 3300047322 Bacteria 2451
657 Ga0495675_0005619 3300047444 Bacteria 7656
658 Ga0495675_0036408 3300047444 Bacteria 3139
659 Ga0495679_029627 3300047446 Bacteria 1784
660 Ga0495684_0315276 3300047471 Bacteria 1119
661 Ga0495684_0386547 3300047471 Bacteria 986
662 Ga0495593_0007133 3300047673 Bacteria 6552
663 Ga0495593_0031295 3300047673 Bacteria 2908
664 Ga0495593_0074802 3300047673 Bacteria 1756
665 Ga0495602_0000776 3300048088 Bacteria 30394
666 Ga0495602_0006877 3300048088 Bacteria 11953
667 Ga0495602_0107826 3300048088 Bacteria 2269
668 Ga0495602_0168941 3300048088 Bacteria 1699
669 Ga0495602_0208515 3300048088 Bacteria 1485
670 Ga0495614_0038605 3300048089 Bacteria 2049
671 Ga0496100_0002767 3300048903 Bacteria 8965
672 Ga0496100_0015150 3300048903 Bacteria 4497
673 Ga0496100_0138431 3300048903 Bacteria 1722
674 Ga0496101_0044420 3300048904 Bacteria 3180
675 Ga0496101_0081575 3300048904 Bacteria 2392
676 Ga0496101_0599084 3300048904 Bacteria 871
677 Ga0496102_0005624 3300048905 Bacteria 10639
678 Ga0496102_0090459 3300048905 Bacteria 2832
679 Ga0496102_0127882 3300048905 Bacteria 2376
680 Ga0496102_0255950 3300048905 Bacteria 1650
681 Ga0496102_0271239 3300048905 Bacteria 1600
682 Ga0496103_0030884 3300048906 Bacteria 3261
683 Ga0496104_0000092 3300048907 Bacteria 87232
684 Ga0496104_0041796 3300048907 Bacteria 4299
685 Ga0496104_0175177 3300048907 Bacteria 2055
686 Ga0496104_0532743 3300048907 Bacteria 1085
687 Ga0496105_0003752 3300048908 Bacteria 11320
688 Ga0496105_0006025 3300048908 Bacteria 9268
689 Ga0496105_0113109 3300048908 Bacteria 2240
690 Ga0496105_0116807 3300048908 Bacteria 2201
691 Ga0496105_0244408 3300048908 Bacteria 1455
692 Ga0496106_0002308 3300048909 Bacteria 14232
693 Ga0496106_0040080 3300048909 Bacteria 3507
694 Ga0496106_0084416 3300048909 Bacteria 2443
695 Ga0496106_0105407 3300048909 Bacteria 2190
696 Ga0496107_0035169 3300048910 Bacteria 3591
697 Ga0496107_0272976 3300048910 Bacteria 1258
698 Ga0496108_0008222 3300048911 Bacteria 8468
699 Ga0496108_0015654 3300048911 Bacteria 6186
700 Ga0496108_0034918 3300048911 Bacteria 4178
701 Ga0496109_0002084 3300048912 Bacteria 16616
702 Ga0496109_0013436 3300048912 Bacteria 7102
703 Ga0496109_0266679 3300048912 Bacteria 1613
704 Ga0496110_0021235 3300048913 Bacteria 5493
705 Ga0496110_0063281 3300048913 Bacteria 3268
706 Ga0496110_0239521 3300048913 Bacteria 1651
707 Ga0496111_0208362 3300048914 Unclassified 1452
708 Ga0496111_0313430 3300048914 Bacteria 1162
709 Ga0496112_0079495 3300048915 Bacteria 3243
710 Ga0496112_0090817 3300048915 Bacteria 3023
711 Ga0496112_0230526 3300048915 Bacteria 1806
712 Ga0496112_0392614 3300048915 Bacteria 1328
713 Ga0496113_0005585 3300048916 Bacteria 7861
714 Ga0496113_0009576 3300048916 Bacteria 6357
715 Ga0496113_0113591 3300048916 Bacteria 2111
716 Ga0496114_0058116 3300048917 Bacteria 3229
717 Ga0496114_0065102 3300048917 Bacteria 3053
718 Ga0496114_0150389 3300048917 Bacteria 2019
719 Ga0496115_0043074 3300048918 Bacteria 3598
720 Ga0496115_0056441 3300048918 Bacteria 3156
721 Ga0496115_0062136 3300048918 Bacteria 3012
722 Ga0496115_0081951 3300048918 Bacteria 2628
723 Ga0501032_0219459 3300049569 Bacteria 1238
724 Ga0501034_0140283 3300049571 Bacteria 2397
725 Ga0501034_0182434 3300049571 Bacteria 2063
726 Ga0501034_0281827 3300049571 Bacteria 1601
727 Ga0501036_0158102 3300049572 Bacteria 1911
728 Ga0501036_0193589 3300049572 Bacteria 1710
729 Ga0501036_0331580 3300049572 Bacteria 1271
730 Ga0501036_0437357 3300049572 Bacteria 1090
731 Ga0501037_0058837 3300049573 Bacteria 2803
732 Ga0501038_0014576 3300049574 Bacteria 7164
733 Ga0501038_0026051 3300049574 Bacteria 5208
734 Ga0501038_0123017 3300049574 Bacteria 2137
735 Ga0501039_0028565 3300049575 Bacteria 4293
736 Ga0501043_0013503 3300049579 Bacteria 6390
737 Ga0501043_0135863 3300049579 Bacteria 1926
738 Ga0501046_0089002 3300049580 Bacteria 2377
739 Ga0501047_0064372 3300049581 Bacteria 3536
740 Ga0501047_0151325 3300049581 Bacteria 2196
741 Ga0501047_0213918 3300049581 Bacteria 1785
742 Ga0501068_0027696 3300049584 Bacteria 3347
743 Ga0501069_0074323 3300049585 Bacteria 1907
744 Ga0501070_0037217 3300049586 Bacteria 4063
745 Ga0501070_0088179 3300049586 Bacteria 2568
746 Ga0501070_0119752 3300049586 Bacteria 2175
747 Ga0501070_0313609 3300049586 Bacteria 1276
748 Ga0501070_0435956 3300049586 Bacteria 1057
749 Ga0501071_0255826 3300049587 Bacteria 1322
750 Ga0501071_0486177 3300049587 Bacteria 946
751 Ga0501072_0106653 3300049588 Bacteria 2228
752 Ga0501073_0024957 3300049589 Bacteria 4289
753 Ga0501073_0208197 3300049589 Bacteria 1351
754 Ga0501073_0300587 3300049589 Bacteria 1107
755 Ga0501075_0097106 3300049591 Bacteria 2236
756 Ga0501075_0170621 3300049591 Bacteria 1660
757 Ga0501076_0207590 3300049592 Bacteria 1600
758 Ga0501079_0061605 3300049741 Bacteria 2894
759 Ga0501079_0108547 3300049741 Bacteria 2155
760 Ga0501080_0058855 3300049742 Bacteria 3576
761 Ga0501080_0126999 3300049742 Bacteria 2362
762 Ga0501080_0199615 3300049742 Bacteria 1837
763 Ga0501080_0375490 3300049742 Bacteria 1281
764 Ga0501081_0013022 3300049743 Bacteria 5471
765 Ga0501081_0296281 3300049743 Bacteria 1186
766 Ga0501083_0106665 3300049744 Bacteria 1844
767 Ga0501083_0187620 3300049744 Bacteria 1350
768 Ga0501035_0032190 3300049822 Bacteria 4772
769 Ga0501035_0058217 3300049822 Bacteria 3444
770 Ga0501035_0128538 3300049822 Bacteria 2210
771 Ga0501035_0213467 3300049822 Bacteria 1650
772 Ga0501044_0157300 3300049823 Bacteria 2251
773 nmdc:mga06z11_158180_c1 3300050494 Unclassified 1293
774 nmdc:mga06z11_45500_c1 3300050494 Bacteria 2219
775 nmdc:mga05p37_114452_c1 3300050507 Bacteria 3316
776 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
777 nmdc:mga09592_1702_c1 3300050508 Bacteria 17731
778 nmdc:mga0qj67_50198_c1 3300050509 Bacteria 3299
779 nmdc:mga06r32_2037_c1 3300050510 Bacteria 18072
780 nmdc:mga08y16_12219_c1 3300050511 Bacteria 9024
781 nmdc:mga08y16_1809_c1 3300050511 Bacteria 21689
782 nmdc:mga08y16_199543_c1 3300050511 Bacteria 2073
783 nmdc:mga08y16_212290_c1 3300050511 Bacteria 2005
784 nmdc:mga0n895_120612_c1 3300050512 Bacteria 2643
785 nmdc:mga0n895_184670_c1 3300050512 Bacteria 2116
786 nmdc:mga0n895_326507_c1 3300050512 Bacteria 1555
787 nmdc:mga0n895_37587_c1 3300050512 Bacteria 4685
788 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
789 nmdc:mga0rr50_1204_c1 3300050513 Bacteria 14048
790 nmdc:mga0rr50_206291_c1 3300050513 Unclassified 1617
791 nmdc:mga0rr50_93838_c1 3300050513 Bacteria 2342
792 nmdc:mga0a205_106498_c1 3300050515 Bacteria 2701
793 nmdc:mga0a205_113332_c1 3300050515 Bacteria 2611
794 nmdc:mga0a205_3268_c1 3300050515 Bacteria 14416
795 nmdc:mga0a205_72068_c1 3300050515 Bacteria 3337
796 Ga0495601_0000107 3300053077 Bacteria 45730
797 Ga0495601_0001733 3300053077 Bacteria 12062
798 Ga0495601_0019931 3300053077 Bacteria 4093
799 Ga0495601_0028792 3300053077 Bacteria 3442
800 Ga0495612_0000162 3300053078 Bacteria 27772
801 Ga0495612_0007461 3300053078 Bacteria 4468
802 Ga0495612_0009252 3300053078 Bacteria 3997
803 Ga0495612_0167625 3300053078 Bacteria 961
804 Ga0495612_0170299 3300053078 Bacteria 953
805 Ga0495595_0001476 3300053084 Bacteria 9177
806 Ga0495595_0075954 3300053084 Bacteria 1594
807 Ga0495619_0000045 3300053085 Bacteria 108543
808 Ga0495619_0000337 3300053085 Bacteria 32903
809 Ga0495619_0002709 3300053085 Bacteria 11585
810 Ga0495619_0020702 3300053085 Bacteria 4193
811 Ga0495619_0029836 3300053085 Bacteria 3526
812 Ga0495619_0170464 3300053085 Bacteria 1505
813 Ga0495619_0390915 3300053085 Bacteria 961
814 Ga0500643_021801 3300053087 Bacteria 2072
815 Ga0500644_0001646 3300053088 Bacteria 5827
816 Ga0500595_000002 3300053119 Bacteria 1074388
817 Ga0500652_006268 3300053131 Bacteria 3817
818 Ga0500616_0000002 3300053153 Bacteria 1611257
819 Ga0500645_000099 3300053730 Bacteria 68426
820 Ga0501084_0098245 3300054114 Bacteria 2458
821 Ga0501084_0150084 3300054114 Bacteria 1964
822 Ga0501082_0042849 3300060353 Bacteria 3902
823 Ga0501082_0194760 3300060353 Bacteria 1763
824 Ga0466962_0067368 3300061719 Bacteria 1709
825 Ga0530510_0078676 3300061734 Bacteria 2398
826 Ga0530510_0391726 3300061734 Bacteria 1046

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0097106 Ga0501075_0097106_85_822 216
2 3300049586 Ga0501070_0313609 Ga0501070_0313609_29_805 239
3 3300003203 JGI25406J46586_10000594 JGI25406J46586_100005946 250
4 3300005985 Ga0081539_10001482 Ga0081539_1000148226 250
5 3300013296 Ga0157374_10028071 Ga0157374_100280716 254
6 3300049742 Ga0501080_0199615 Ga0501080_0199615_770_1633 257
7 3300049743 Ga0501081_0013022 Ga0501081_0013022_3321_4184 257
8 3300054114 Ga0501084_0098245 Ga0501084_0098245_209_1072 257
9 3300061734 Ga0530510_0391726 Ga0530510_0391726_100_963 257
10 3300053078 Ga0495612_0167625 Ga0495612_0167625_120_914 259
11 3300060353 Ga0501082_0194760 Ga0501082_0194760_559_1350 259
12 3300049572 Ga0501036_0437357 Ga0501036_0437357_65_955 262
13 3300049579 Ga0501043_0135863 Ga0501043_0135863_317_1207 262
14 3300049742 Ga0501080_0126999 Ga0501080_0126999_1158_2048 262
15 3300049822 Ga0501035_0213467 Ga0501035_0213467_17_907 262
16 3300025923 Ga0207681_10038404 Ga0207681_100384041 263
17 3300048904 Ga0496101_0599084 Ga0496101_0599084_24_818 264
18 iso_pu_bacteria 2894772417 2894773596 264
19 3300048088 Ga0495602_0208515 Ga0495602_0208515_636_1445 265
20 3300045051 Ga0451576_0396498 Ga0451576_0396498_593_1432 266
21 3300035121 Ga0373960_0014057 Ga0373960_0014057_16_819 267
22 3300035241 Ga0373961_0038548 Ga0373961_0038548_553_1356 267
23 3300036401 Ga0373937_0054598 Ga0373937_0054598_177_1082 268
24 3300046459 Ga0495629_0112296 Ga0495629_0112296_35_841 268
25 3300046516 Ga0495628_0006361 Ga0495628_0006361_10_816 268
26 3300046529 Ga0495652_0072716 Ga0495652_0072716_1744_2649 268
27 3300046559 Ga0495667_0034869 Ga0495667_0034869_965_1870 268
28 3300046663 Ga0495635_0061311 Ga0495635_0061311_1423_2328 268
29 3300047317 Ga0495604_0064299 Ga0495604_0064299_1723_2628 268
30 3300047319 Ga0495674_0029272 Ga0495674_0029272_971_1876 268
31 3300047322 Ga0495680_0081031 Ga0495680_0081031_92_997 268
32 3300047471 Ga0495684_0386547 Ga0495684_0386547_45_950 268
33 3300047673 Ga0495593_0031295 Ga0495593_0031295_969_1874 268
34 3300053077 Ga0495601_0001733 Ga0495601_0001733_6831_7736 268
35 3300053078 Ga0495612_0170299 Ga0495612_0170299_10_816 268
36 3300053085 Ga0495619_0000045 Ga0495619_0000045_78934_79839 268
37 3300013104 Ga0157370_10151546 Ga0157370_101515461 269
38 3300025921 Ga0207652_10027424 Ga0207652_100274245 269
39 3300005434 Ga0070709_10032744 Ga0070709_100327442 270
40 3300005436 Ga0070713_100001192 Ga0070713_10000119210 270
41 3300005439 Ga0070711_100006635 Ga0070711_1000066357 270
42 3300005439 Ga0070711_100064343 Ga0070711_1000643431 270
43 3300006028 Ga0070717_10088976 Ga0070717_100889762 270
44 3300006175 Ga0070712_100153422 Ga0070712_1001534222 270
45 3300025915 Ga0207693_10271129 Ga0207693_102711292 270
46 3300025916 Ga0207663_10047876 Ga0207663_100478763 270
47 3300025916 Ga0207663_10127052 Ga0207663_101270521 270
48 3300031241 Ga0265325_10000264 Ga0265325_1000026436 270
49 3300031595 Ga0265313_10069516 Ga0265313_100695161 270
50 3300035086 Ga0373934_0099366 Ga0373934_0099366_247_1152 270
51 3300035120 Ga0373957_0052537 Ga0373957_0052537_611_1516 270
52 3300035170 Ga0373943_0082021 Ga0373943_0082021_531_1436 270
53 3300035172 Ga0373955_0002733 Ga0373955_0002733_5145_6050 270
54 3300035410 Ga0373924_0170489 Ga0373924_0170489_13_873 270
55 3300036401 Ga0373937_0014261 Ga0373937_0014261_2714_3619 270
56 3300036401 Ga0373937_0376761 Ga0373937_0376761_410_1315 270
57 3300036647 Ga0316582_0188954 Ga0316582_0188954_300_1181 270
58 3300037068 Ga0373925_0049481 Ga0373925_0049481_605_1510 270
59 3300046462 Ga0495651_0020710 Ga0495651_0020710_807_1712 270
60 3300046516 Ga0495628_0011889 Ga0495628_0011889_5155_6060 270
61 3300046529 Ga0495652_0011053 Ga0495652_0011053_2162_3067 270
62 3300046536 Ga0495587_0025703 Ga0495587_0025703_1715_2620 270
63 3300046543 Ga0495645_0003160 Ga0495645_0003160_4855_5760 270
64 3300046663 Ga0495635_0061844 Ga0495635_0061844_1046_1951 270
65 3300046678 Ga0495599_0006608 Ga0495599_0006608_707_1612 270
66 3300046679 Ga0495623_0035467 Ga0495623_0035467_26_886 270
67 3300047317 Ga0495604_0036706 Ga0495604_0036706_1537_2442 270
68 3300047319 Ga0495674_0093302 Ga0495674_0093302_1346_2251 270
69 3300047444 Ga0495675_0036408 Ga0495675_0036408_191_1096 270
70 3300048088 Ga0495602_0000776 Ga0495602_0000776_13022_13927 270
71 3300048907 Ga0496104_0000092 Ga0496104_0000092_48054_48914 270
72 3300048908 Ga0496105_0003752 Ga0496105_0003752_923_1783 270
73 3300048918 Ga0496115_0081951 Ga0496115_0081951_511_1371 270
74 3300053077 Ga0495601_0000107 Ga0495601_0000107_18862_19767 270
75 3300053078 Ga0495612_0000162 Ga0495612_0000162_3608_4513 270
76 3300053084 Ga0495595_0001476 Ga0495595_0001476_1947_2852 270
77 3300053085 Ga0495619_0002709 Ga0495619_0002709_5301_6206 270
78 3300053085 Ga0495619_0390915 Ga0495619_0390915_40_900 270
79 3300009148 Ga0105243_10131072 Ga0105243_101310722 271
80 3300025935 Ga0207709_10141922 Ga0207709_101419222 271
81 3300049572 Ga0501036_0158102 Ga0501036_0158102_285_1112 271
82 3300049574 Ga0501038_0026051 Ga0501038_0026051_763_1590 271
83 3300049580 Ga0501046_0089002 Ga0501046_0089002_41_868 271
84 3300049581 Ga0501047_0151325 Ga0501047_0151325_908_1735 271
85 3300049589 Ga0501073_0024957 Ga0501073_0024957_3024_3851 271
86 3300049742 Ga0501080_0058855 Ga0501080_0058855_2225_3052 271
87 3300049823 Ga0501044_0157300 Ga0501044_0157300_819_1646 271
88 3300005445 Ga0070708_100018331 Ga0070708_1000183315 272
89 3300005617 Ga0068859_100008349 Ga0068859_1000083494 272
90 3300005718 Ga0068866_10001816 Ga0068866_100018166 272
91 3300005841 Ga0068863_100023028 Ga0068863_1000230281 272
92 3300005844 Ga0068862_100150419 Ga0068862_1001504193 272
93 3300005844 Ga0068862_100372080 Ga0068862_1003720801 272
94 3300006871 Ga0075434_100006467 Ga0075434_10000646711 272
95 3300006931 Ga0097620_100008349 Ga0097620_1000083494 272
96 3300009098 Ga0105245_10120387 Ga0105245_101203871 272
97 3300009545 Ga0105237_10031006 Ga0105237_100310067 272
98 3300013297 Ga0157378_10261221 Ga0157378_102612213 272
99 3300017792 Ga0163161_10027479 Ga0163161_100274796 272
100 3300025290 Ga0207673_1000758 Ga0207673_10007582 272
101 3300025901 Ga0207688_10000229 Ga0207688_100002297 272
102 3300025912 Ga0207707_10131577 Ga0207707_101315772 272
103 3300025926 Ga0207659_10001285 Ga0207659_100012851 272
104 3300025927 Ga0207687_10132991 Ga0207687_101329911 272
105 3300025937 Ga0207669_10014544 Ga0207669_100145441 272
106 3300026088 Ga0207641_10094986 Ga0207641_100949862 272
107 3300027695 Ga0209966_1009770 Ga0209966_10097702 272
108 3300027876 Ga0209974_10002830 Ga0209974_100028303 272
109 3300027907 Ga0207428_10000165 Ga0207428_100001657 272
110 3300028380 Ga0268265_10066454 Ga0268265_100664541 272
111 3300031507 Ga0307509_10376187 Ga0307509_103761872 272
112 3300034816 Ga0373930_0013677 Ga0373930_0013677_310_1170 272
113 3300034957 Ga0373938_0016684 Ga0373938_0016684_154_1014 272
114 3300035242 Ga0373962_0006580 Ga0373962_0006580_132_992 272
115 3300046491 Ga0495584_0102450 Ga0495584_0102450_377_1237 272
116 3300048906 Ga0496103_0030884 Ga0496103_0030884_54_914 272
117 3300048907 Ga0496104_0532743 Ga0496104_0532743_82_942 272
118 3300048911 Ga0496108_0008222 Ga0496108_0008222_1192_2052 272
119 3300050512 nmdc:mga0n895_37587_c1 nmdc:mga0n895_37587_c1_3610_4470 272
120 3300000041 ARcpr5oldR_c006817 ARcpr5oldR_0068171 273
121 3300001904 JGI24736J21556_1015770 JGI24736J21556_10157701 273
122 3300001978 JGI24747J21853_1000375 JGI24747J21853_10003751 273
123 3300001989 JGI24739J22299_10005003 JGI24739J22299_100050031 273
124 3300001990 JGI24737J22298_10006384 JGI24737J22298_100063842 273
125 3300002070 JGI24750J21931_1007838 JGI24750J21931_10078382 273
126 3300002073 JGI24745J21846_1001867 JGI24745J21846_10018671 273
127 3300002074 JGI24748J21848_1006144 JGI24748J21848_10061442 273
128 3300002076 JGI24749J21850_1009858 JGI24749J21850_10098581 273
129 3300002077 JGI24744J21845_10002596 JGI24744J21845_100025961 273
130 3300002155 JGI24033J26618_1003037 JGI24033J26618_10030371 273
131 3300002239 JGI24034J26672_10000829 JGI24034J26672_100008296 273
132 3300002244 JGI24742J22300_10015325 JGI24742J22300_100153252 273
133 3300005293 Ga0065715_10000519 Ga0065715_1000051915 273
134 3300005329 Ga0070683_100008697 Ga0070683_1000086971 273
135 3300005330 Ga0070690_100010289 Ga0070690_1000102893 273
136 3300005330 Ga0070690_100062482 Ga0070690_1000624821 273
137 3300005331 Ga0070670_100072895 Ga0070670_1000728953 273
138 3300005333 Ga0070677_10009111 Ga0070677_100091111 273
139 3300005334 Ga0068869_100030072 Ga0068869_1000300723 273
140 3300005334 Ga0068869_100036646 Ga0068869_1000366464 273
141 3300005335 Ga0070666_10006379 Ga0070666_100063795 273
142 3300005336 Ga0070680_100003646 Ga0070680_10000364611 273
143 3300005337 Ga0070682_100006855 Ga0070682_1000068552 273
144 3300005337 Ga0070682_100014492 Ga0070682_1000144923 273
145 3300005338 Ga0068868_100001527 Ga0068868_1000015275 273
146 3300005338 Ga0068868_100215125 Ga0068868_1002151252 273
147 3300005339 Ga0070660_100007921 Ga0070660_1000079212 273
148 3300005339 Ga0070660_100224086 Ga0070660_1002240863 273
149 3300005340 Ga0070689_100000423 Ga0070689_10000042326 273
150 3300005340 Ga0070689_100030326 Ga0070689_1000303264 273
151 3300005341 Ga0070691_10030986 Ga0070691_100309863 273
152 3300005343 Ga0070687_100010609 Ga0070687_1000106092 273
153 3300005343 Ga0070687_100020102 Ga0070687_1000201023 273
154 3300005344 Ga0070661_100001619 Ga0070661_10000161914 273
155 3300005344 Ga0070661_100027189 Ga0070661_1000271892 273
156 3300005345 Ga0070692_10007636 Ga0070692_100076361 273
157 3300005347 Ga0070668_100042277 Ga0070668_1000422774 273
158 3300005353 Ga0070669_100001139 Ga0070669_10000113918 273
159 3300005354 Ga0070675_100043846 Ga0070675_1000438464 273
160 3300005355 Ga0070671_100000920 Ga0070671_10000092018 273
161 3300005364 Ga0070673_100023791 Ga0070673_1000237913 273
162 3300005364 Ga0070673_100047093 Ga0070673_1000470933 273
163 3300005365 Ga0070688_100014995 Ga0070688_1000149953 273
164 3300005366 Ga0070659_100015775 Ga0070659_1000157751 273
165 3300005367 Ga0070667_100014147 Ga0070667_1000141476 273
166 3300005434 Ga0070709_10089090 Ga0070709_100890901 273
167 3300005435 Ga0070714_100018806 Ga0070714_1000188065 273
168 3300005438 Ga0070701_10000614 Ga0070701_100006148 273
169 3300005439 Ga0070711_100071103 Ga0070711_1000711032 273
170 3300005441 Ga0070700_100259116 Ga0070700_1002591161 273
171 3300005444 Ga0070694_100003931 Ga0070694_1000039311 273
172 3300005444 Ga0070694_100189413 Ga0070694_1001894132 273
173 3300005455 Ga0070663_100317688 Ga0070663_1003176881 273
174 3300005456 Ga0070678_100002661 Ga0070678_1000026612 273
175 3300005457 Ga0070662_100004411 Ga0070662_1000044111 273
176 3300005458 Ga0070681_10080212 Ga0070681_100802124 273
177 3300005458 Ga0070681_10114978 Ga0070681_101149782 273
178 3300005459 Ga0068867_100006480 Ga0068867_1000064806 273
179 3300005530 Ga0070679_100005088 Ga0070679_10000508811 273
180 3300005543 Ga0070672_100006170 Ga0070672_1000061702 273
181 3300005544 Ga0070686_100010831 Ga0070686_1000108315 273
182 3300005544 Ga0070686_100019639 Ga0070686_1000196394 273
183 3300005545 Ga0070695_100043885 Ga0070695_1000438853 273
184 3300005546 Ga0070696_100004009 Ga0070696_1000040092 273
185 3300005547 Ga0070693_100002242 Ga0070693_10000224210 273
186 3300005548 Ga0070665_100074891 Ga0070665_1000748912 273
187 3300005549 Ga0070704_100007752 Ga0070704_1000077523 273
188 3300005563 Ga0068855_100011293 Ga0068855_10001129311 273
189 3300005564 Ga0070664_100039417 Ga0070664_1000394175 273
190 3300005564 Ga0070664_100060752 Ga0070664_1000607525 273
191 3300005577 Ga0068857_100001682 Ga0068857_10000168212 273
192 3300005578 Ga0068854_100004886 Ga0068854_1000048861 273
193 3300005614 Ga0068856_100008165 Ga0068856_1000081654 273
194 3300005614 Ga0068856_100067227 Ga0068856_1000672274 273
195 3300005615 Ga0070702_100037932 Ga0070702_1000379323 273
196 3300005616 Ga0068852_100001494 Ga0068852_10000149413 273
197 3300005618 Ga0068864_100001074 Ga0068864_10000107423 273
198 3300005618 Ga0068864_100063921 Ga0068864_1000639213 273
199 3300005719 Ga0068861_100040271 Ga0068861_1000402711 273
200 3300005834 Ga0068851_10026105 Ga0068851_100261054 273
201 3300005840 Ga0068870_10000051 Ga0068870_100000518 273
202 3300005842 Ga0068858_100005723 Ga0068858_1000057236 273
203 3300005843 Ga0068860_100001825 Ga0068860_1000018255 273
204 3300005937 Ga0081455_10000081 Ga0081455_100000818 273
205 3300006028 Ga0070717_10103396 Ga0070717_101033964 273
206 3300006173 Ga0070716_100004877 Ga0070716_1000048773 273
207 3300006178 Ga0075367_10037100 Ga0075367_100371002 273
208 3300006237 Ga0097621_100002133 Ga0097621_1000021339 273
209 3300006237 Ga0097621_100002924 Ga0097621_10000292411 273
210 3300006358 Ga0068871_100029472 Ga0068871_1000294726 273
211 3300006358 Ga0068871_100039055 Ga0068871_1000390555 273
212 3300006852 Ga0075433_10035548 Ga0075433_100355481 273
213 3300006881 Ga0068865_100031407 Ga0068865_1000314075 273
214 3300006881 Ga0068865_100032338 Ga0068865_1000323385 273
215 3300006914 Ga0075436_100012725 Ga0075436_1000127255 273
216 3300007076 Ga0075435_100041124 Ga0075435_1000411244 273
217 3300009011 Ga0105251_10019521 Ga0105251_100195214 273
218 3300009093 Ga0105240_10049462 Ga0105240_100494624 273
219 3300009094 Ga0111539_10032539 Ga0111539_100325395 273
220 3300009094 Ga0111539_10059301 Ga0111539_100593017 273
221 3300009101 Ga0105247_10002735 Ga0105247_100027359 273
222 3300009148 Ga0105243_10023377 Ga0105243_100233773 273
223 3300009148 Ga0105243_10036757 Ga0105243_100367576 273
224 3300009174 Ga0105241_10010830 Ga0105241_100108307 273
225 3300009174 Ga0105241_10016796 Ga0105241_100167968 273
226 3300009176 Ga0105242_10056130 Ga0105242_100561301 273
227 3300009177 Ga0105248_10010592 Ga0105248_100105927 273
228 3300009551 Ga0105238_10208106 Ga0105238_102081061 273
229 3300009553 Ga0105249_10001193 Ga0105249_1000119322 273
230 3300011119 Ga0105246_10000255 Ga0105246_1000025511 273
231 3300011119 Ga0105246_10239870 Ga0105246_102398701 273
232 3300013100 Ga0157373_10049682 Ga0157373_100496822 273
233 3300013100 Ga0157373_10071545 Ga0157373_100715453 273
234 3300013102 Ga0157371_10017533 Ga0157371_100175333 273
235 3300013296 Ga0157374_10042269 Ga0157374_100422692 273
236 3300013296 Ga0157374_10198445 Ga0157374_101984452 273
237 3300013297 Ga0157378_10140503 Ga0157378_101405033 273
238 3300013307 Ga0157372_10027692 Ga0157372_100276922 273
239 3300013308 Ga0157375_10020563 Ga0157375_100205635 273
240 3300013308 Ga0157375_10307533 Ga0157375_103075331 273
241 3300014325 Ga0163163_10087213 Ga0163163_100872132 273
242 3300014326 Ga0157380_10005310 Ga0157380_1000531010 273
243 3300014745 Ga0157377_10000164 Ga0157377_1000016441 273
244 3300014968 Ga0157379_10002095 Ga0157379_100020959 273
245 3300025271 Ga0207666_1000051 Ga0207666_10000512 273
246 3300025885 Ga0207653_10016506 Ga0207653_100165061 273
247 3300025893 Ga0207682_10000072 Ga0207682_100000727 273
248 3300025900 Ga0207710_10004456 Ga0207710_100044566 273
249 3300025900 Ga0207710_10018655 Ga0207710_100186553 273
250 3300025903 Ga0207680_10008261 Ga0207680_100082612 273
251 3300025903 Ga0207680_10189720 Ga0207680_101897201 273
252 3300025904 Ga0207647_10002000 Ga0207647_100020008 273
253 3300025905 Ga0207685_10037720 Ga0207685_100377203 273
254 3300025906 Ga0207699_10003384 Ga0207699_100033847 273
255 3300025907 Ga0207645_10000966 Ga0207645_100009666 273
256 3300025908 Ga0207643_10000004 Ga0207643_1000000432 273
257 3300025911 Ga0207654_10153464 Ga0207654_101534642 273
258 3300025914 Ga0207671_10118354 Ga0207671_101183544 273
259 3300025916 Ga0207663_10021824 Ga0207663_100218241 273
260 3300025916 Ga0207663_10074049 Ga0207663_100740492 273
261 3300025917 Ga0207660_10004454 Ga0207660_100044548 273
262 3300025918 Ga0207662_10000317 Ga0207662_100003172 273
263 3300025919 Ga0207657_10002047 Ga0207657_100020472 273
264 3300025920 Ga0207649_10000262 Ga0207649_100002627 273
265 3300025920 Ga0207649_10055749 Ga0207649_100557492 273
266 3300025921 Ga0207652_10000911 Ga0207652_1000091115 273
267 3300025924 Ga0207694_10249115 Ga0207694_102491151 273
268 3300025925 Ga0207650_10197358 Ga0207650_101973582 273
269 3300025926 Ga0207659_10178888 Ga0207659_101788882 273
270 3300025928 Ga0207700_10047638 Ga0207700_100476382 273
271 3300025929 Ga0207664_10018712 Ga0207664_100187126 273
272 3300025931 Ga0207644_10004727 Ga0207644_100047276 273
273 3300025931 Ga0207644_10017581 Ga0207644_100175816 273
274 3300025932 Ga0207690_10001058 Ga0207690_100010586 273
275 3300025933 Ga0207706_10001679 Ga0207706_1000167922 273
276 3300025934 Ga0207686_10005614 Ga0207686_100056145 273
277 3300025935 Ga0207709_10009302 Ga0207709_100093027 273
278 3300025936 Ga0207670_10000377 Ga0207670_1000037715 273
279 3300025936 Ga0207670_10026617 Ga0207670_100266175 273
280 3300025938 Ga0207704_10006515 Ga0207704_100065152 273
281 3300025939 Ga0207665_10008284 Ga0207665_100082845 273
282 3300025940 Ga0207691_10026103 Ga0207691_100261032 273
283 3300025941 Ga0207711_10006200 Ga0207711_100062008 273
284 3300025941 Ga0207711_10016950 Ga0207711_100169507 273
285 3300025942 Ga0207689_10000203 Ga0207689_1000020340 273
286 3300025942 Ga0207689_10029484 Ga0207689_100294845 273
287 3300025944 Ga0207661_10002165 Ga0207661_1000216514 273
288 3300025944 Ga0207661_10081279 Ga0207661_100812793 273
289 3300025945 Ga0207679_10000157 Ga0207679_1000015716 273
290 3300025960 Ga0207651_10000367 Ga0207651_100003678 273
291 3300025961 Ga0207712_10015168 Ga0207712_100151682 273
292 3300025972 Ga0207668_10070419 Ga0207668_100704193 273
293 3300025972 Ga0207668_10075414 Ga0207668_100754142 273
294 3300025981 Ga0207640_10063139 Ga0207640_100631393 273
295 3300025986 Ga0207658_10004781 Ga0207658_1000478110 273
296 3300025986 Ga0207658_10261344 Ga0207658_102613443 273
297 3300026023 Ga0207677_10003050 Ga0207677_1000305010 273
298 3300026023 Ga0207677_10190552 Ga0207677_101905522 273
299 3300026035 Ga0207703_10001346 Ga0207703_1000134622 273
300 3300026035 Ga0207703_10001852 Ga0207703_100018523 273
301 3300026041 Ga0207639_10078753 Ga0207639_100787533 273
302 3300026067 Ga0207678_10036309 Ga0207678_100363096 273
303 3300026078 Ga0207702_10204245 Ga0207702_102042453 273
304 3300026089 Ga0207648_10002073 Ga0207648_1000207322 273
305 3300026089 Ga0207648_10141470 Ga0207648_101414701 273
306 3300026095 Ga0207676_10010349 Ga0207676_100103492 273
307 3300026116 Ga0207674_10000897 Ga0207674_1000089722 273
308 3300026116 Ga0207674_10570885 Ga0207674_105708851 273
309 3300026118 Ga0207675_100001726 Ga0207675_1000017262 273
310 3300026118 Ga0207675_100119875 Ga0207675_1001198753 273
311 3300026121 Ga0207683_10001176 Ga0207683_1000117625 273
312 3300026142 Ga0207698_10088166 Ga0207698_100881663 273
313 3300028379 Ga0268266_10018077 Ga0268266_100180776 273
314 3300028379 Ga0268266_10109108 Ga0268266_101091081 273
315 3300028381 Ga0268264_10001616 Ga0268264_100016163 273
316 3300034816 Ga0373930_0004658 Ga0373930_0004658_317_1225 273
317 3300034817 Ga0373948_0013582 Ga0373948_0013582_297_1157 273
318 3300034820 Ga0373959_0015498 Ga0373959_0015498_432_1292 273
319 3300034957 Ga0373938_0008796 Ga0373938_0008796_831_1739 273
320 3300035090 Ga0373949_0006003 Ga0373949_0006003_242_1150 273
321 3300035091 Ga0373951_0001767 Ga0373951_0001767_4667_5527 273
322 3300035092 Ga0373952_0003171 Ga0373952_0003171_138_1046 273
323 3300035114 Ga0373939_0001338 Ga0373939_0001338_3212_4120 273
324 3300035114 Ga0373939_0003044 Ga0373939_0003044_491_1351 273
325 3300035121 Ga0373960_0006465 Ga0373960_0006465_1186_2094 273
326 3300035170 Ga0373943_0051142 Ga0373943_0051142_418_1326 273
327 3300035207 Ga0373942_0014182 Ga0373942_0014182_309_1169 273
328 3300035207 Ga0373942_0030018 Ga0373942_0030018_425_1333 273
329 3300035241 Ga0373961_0002484 Ga0373961_0002484_1944_2852 273
330 3300035691 Ga0373931_0001147 Ga0373931_0001147_1167_2075 273
331 3300035691 Ga0373931_0016624 Ga0373931_0016624_833_1693 273
332 3300035692 Ga0373935_0035049 Ga0373935_0035049_1464_2372 273
333 3300035695 Ga0373927_0017667 Ga0373927_0017667_12_920 273
334 3300035725 Ga0373947_0000424 Ga0373947_0000424_8144_9052 273
335 3300046455 Ga0495603_0038640 Ga0495603_0038640_689_1597 273
336 3300046459 Ga0495629_0000447 Ga0495629_0000447_4372_5280 273
337 3300046473 Ga0495582_0006745 Ga0495582_0006745_5288_6196 273
338 3300046499 Ga0495594_0129357 Ga0495594_0129357_105_1013 273
339 3300046526 Ga0495666_0042043 Ga0495666_0042043_761_1669 273
340 3300046683 Ga0495658_0003413 Ga0495658_0003413_6195_7103 273
341 3300046689 Ga0495613_0110478 Ga0495613_0110478_515_1423 273
342 3300047315 Ga0495581_0011457 Ga0495581_0011457_3729_4637 273
343 3300047321 Ga0495676_0035281 Ga0495676_0035281_1362_2270 273
344 3300047322 Ga0495680_0002870 Ga0495680_0002870_8212_9120 273
345 3300047673 Ga0495593_0074802 Ga0495593_0074802_224_1132 273
346 3300048089 Ga0495614_0038605 Ga0495614_0038605_336_1244 273
347 3300048903 Ga0496100_0002767 Ga0496100_0002767_93_953 273
348 3300048903 Ga0496100_0138431 Ga0496100_0138431_668_1576 273
349 3300048904 Ga0496101_0081575 Ga0496101_0081575_825_1685 273
350 3300048905 Ga0496102_0090459 Ga0496102_0090459_350_1258 273
351 3300048905 Ga0496102_0255950 Ga0496102_0255950_624_1532 273
352 3300048908 Ga0496105_0113109 Ga0496105_0113109_1289_2197 273
353 3300048908 Ga0496105_0116807 Ga0496105_0116807_53_913 273
354 3300048908 Ga0496105_0244408 Ga0496105_0244408_38_946 273
355 3300048909 Ga0496106_0002308 Ga0496106_0002308_6199_7059 273
356 3300048909 Ga0496106_0040080 Ga0496106_0040080_979_1887 273
357 3300048910 Ga0496107_0272976 Ga0496107_0272976_300_1160 273
358 3300048912 Ga0496109_0002084 Ga0496109_0002084_37_897 273
359 3300048913 Ga0496110_0063281 Ga0496110_0063281_1266_2174 273
360 3300048914 Ga0496111_0313430 Ga0496111_0313430_228_1088 273
361 3300048915 Ga0496112_0079495 Ga0496112_0079495_2301_3209 273
362 3300048915 Ga0496112_0090817 Ga0496112_0090817_800_1660 273
363 3300048915 Ga0496112_0230526 Ga0496112_0230526_753_1661 273
364 3300048916 Ga0496113_0005585 Ga0496113_0005585_2712_3572 273
365 3300048917 Ga0496114_0058116 Ga0496114_0058116_106_966 273
366 3300048917 Ga0496114_0150389 Ga0496114_0150389_209_1117 273
367 3300048918 Ga0496115_0043074 Ga0496115_0043074_813_1721 273
368 3300048918 Ga0496115_0062136 Ga0496115_0062136_63_923 273
369 3300049587 Ga0501071_0486177 Ga0501071_0486177_10_876 273
370 3300049589 Ga0501073_0300587 Ga0501073_0300587_115_981 273
371 3300049592 Ga0501076_0207590 Ga0501076_0207590_28_894 273
372 3300049741 Ga0501079_0108547 Ga0501079_0108547_1123_1983 273
373 3300050494 nmdc:mga06z11_45500_c1 nmdc:mga06z11_45500_c1_380_1240 273
374 3300050511 nmdc:mga08y16_199543_c1 nmdc:mga08y16_199543_c1_476_1408 273
375 3300050511 nmdc:mga08y16_212290_c1 nmdc:mga08y16_212290_c1_321_1181 273
376 3300050512 nmdc:mga0n895_326507_c1 nmdc:mga0n895_326507_c1_105_1013 273
377 3300050515 nmdc:mga0a205_72068_c1 nmdc:mga0a205_72068_c1_2031_2891 273
378 3300053085 Ga0495619_0000337 Ga0495619_0000337_31791_32699 273
379 3300054114 Ga0501084_0150084 Ga0501084_0150084_384_1250 273
380 3300060353 Ga0501082_0042849 Ga0501082_0042849_2621_3487 273
381 iso_pu_bacteria 2829745981 2829747329 273
382 iso_pu_bacteria 3003665799 3003670958 273
383 3300005295 Ga0065707_10116342 Ga0065707_101163423 274
384 3300005937 Ga0081455_10007188 Ga0081455_100071889 274
385 3300005937 Ga0081455_10241404 Ga0081455_102414041 274
386 3300006058 Ga0075432_10006659 Ga0075432_100066595 274
387 3300006844 Ga0075428_100005056 Ga0075428_1000050567 274
388 3300006844 Ga0075428_100451942 Ga0075428_1004519421 274
389 3300006846 Ga0075430_100001054 Ga0075430_10000105416 274
390 3300006847 Ga0075431_100001076 Ga0075431_10000107613 274
391 3300006852 Ga0075433_10009722 Ga0075433_100097227 274
392 3300006871 Ga0075434_100003201 Ga0075434_10000320113 274
393 3300006880 Ga0075429_100000098 Ga0075429_10000009817 274
394 3300007076 Ga0075435_100029590 Ga0075435_1000295905 274
395 3300007076 Ga0075435_100206909 Ga0075435_1002069092 274
396 3300009094 Ga0111539_10001671 Ga0111539_1000167117 274
397 3300009147 Ga0114129_10008949 Ga0114129_1000894912 274
398 3300009147 Ga0114129_10017470 Ga0114129_100174702 274
399 3300013296 Ga0157374_10307472 Ga0157374_103074721 274
400 3300027907 Ga0207428_10000137 Ga0207428_1000013722 274
401 3300035083 Ga0373926_0002855 Ga0373926_0002855_2809_3714 274
402 3300035086 Ga0373934_0018396 Ga0373934_0018396_468_1373 274
403 3300035089 Ga0373944_0001376 Ga0373944_0001376_3340_4245 274
404 3300035111 Ga0373923_0003371 Ga0373923_0003371_3664_4569 274
405 3300035113 Ga0373936_0006584 Ga0373936_0006584_1978_2883 274
406 3300035116 Ga0373945_0004740 Ga0373945_0004740_1576_2481 274
407 3300035117 Ga0373953_0016152 Ga0373953_0016152_1260_2165 274
408 3300035119 Ga0373956_0055402 Ga0373956_0055402_251_1156 274
409 3300035170 Ga0373943_0013498 Ga0373943_0013498_1006_1911 274
410 3300035171 Ga0373946_0008671 Ga0373946_0008671_309_1214 274
411 3300035172 Ga0373955_0002078 Ga0373955_0002078_5008_5913 274
412 3300035410 Ga0373924_0075788 Ga0373924_0075788_530_1390 274
413 3300035692 Ga0373935_0006737 Ga0373935_0006737_2399_3304 274
414 3300035724 Ga0373933_0016229 Ga0373933_0016229_2971_3876 274
415 3300036401 Ga0373937_0047021 Ga0373937_0047021_1693_2598 274
416 3300037068 Ga0373925_0050867 Ga0373925_0050867_1619_2524 274
417 3300037471 Ga0395905_0281473 Ga0395905_0281473_613_1458 274
418 3300046454 Ga0495592_0041594 Ga0495592_0041594_1867_2772 274
419 3300046458 Ga0495591_032418 Ga0495591_032418_623_1534 274
420 3300046462 Ga0495651_0030858 Ga0495651_0030858_1798_2703 274
421 3300046463 Ga0495653_0013922 Ga0495653_0013922_3280_4185 274
422 3300046472 Ga0495580_0019007 Ga0495580_0019007_2511_3416 274
423 3300046476 Ga0495662_0016654 Ga0495662_0016654_2176_3081 274
424 3300046477 Ga0495664_0086099 Ga0495664_0086099_478_1383 274
425 3300046491 Ga0495584_0006761 Ga0495584_0006761_1304_2209 274
426 3300046492 Ga0495585_0003617 Ga0495585_0003617_5229_6134 274
427 3300046499 Ga0495594_0021714 Ga0495594_0021714_704_1609 274
428 3300046501 Ga0495607_0007932 Ga0495607_0007932_1225_2130 274
429 3300046516 Ga0495628_0025333 Ga0495628_0025333_2809_3714 274
430 3300046517 Ga0495630_0072935 Ga0495630_0072935_673_1578 274
431 3300046523 Ga0495644_0000748 Ga0495644_0000748_2706_3611 274
432 3300046535 Ga0495586_0007081 Ga0495586_0007081_810_1715 274
433 3300046536 Ga0495587_0009207 Ga0495587_0009207_1133_2038 274
434 3300046537 Ga0495598_0019699 Ga0495598_0019699_129_1034 274
435 3300046543 Ga0495645_0051861 Ga0495645_0051861_2041_2946 274
436 3300046557 Ga0495622_0012435 Ga0495622_0012435_835_1740 274
437 3300046558 Ga0495633_0007380 Ga0495633_0007380_356_1267 274
438 3300046559 Ga0495667_0004817 Ga0495667_0004817_4840_5745 274
439 3300046615 Ga0495656_0013672 Ga0495656_0013672_1536_2441 274
440 3300046642 Ga0495634_0161494 Ga0495634_0161494_492_1397 274
441 3300046648 Ga0495611_0003367 Ga0495611_0003367_4493_5398 274
442 3300046663 Ga0495635_0021903 Ga0495635_0021903_2074_2979 274
443 3300046674 Ga0495588_0006148 Ga0495588_0006148_2035_2940 274
444 3300046675 Ga0495657_0167146 Ga0495657_0167146_51_956 274
445 3300046678 Ga0495599_0031607 Ga0495599_0031607_810_1715 274
446 3300046680 Ga0495646_0044732 Ga0495646_0044732_1786_2691 274
447 3300046683 Ga0495658_0033330 Ga0495658_0033330_98_1003 274
448 3300046689 Ga0495613_0022722 Ga0495613_0022722_1930_2835 274
449 3300046690 Ga0495624_0021150 Ga0495624_0021150_1350_2255 274
450 3300046691 Ga0495670_0001290 Ga0495670_0001290_8934_9839 274
451 3300046692 Ga0495671_0084329 Ga0495671_0084329_459_1364 274
452 3300046809 Ga0495600_0004224 Ga0495600_0004224_3675_4580 274
453 3300047315 Ga0495581_0009308 Ga0495581_0009308_2489_3394 274
454 3300047317 Ga0495604_0038875 Ga0495604_0038875_1557_2462 274
455 3300047322 Ga0495680_0048923 Ga0495680_0048923_663_1568 274
456 3300047446 Ga0495679_029627 Ga0495679_029627_241_1146 274
457 3300047673 Ga0495593_0007133 Ga0495593_0007133_2407_3312 274
458 3300048088 Ga0495602_0107826 Ga0495602_0107826_698_1603 274
459 3300050507 nmdc:mga05p37_114452_c1 nmdc:mga05p37_114452_c1_1325_2230 274
460 3300050507 nmdc:mga05p37_66_c1 nmdc:mga05p37_66_c1_15401_16306 274
461 3300050508 nmdc:mga09592_1702_c1 nmdc:mga09592_1702_c1_7566_8471 274
462 3300050509 nmdc:mga0qj67_50198_c1 nmdc:mga0qj67_50198_c1_101_1006 274
463 3300050510 nmdc:mga06r32_2037_c1 nmdc:mga06r32_2037_c1_14746_15651 274
464 3300050511 nmdc:mga08y16_1809_c1 nmdc:mga08y16_1809_c1_9637_10542 274
465 3300050512 nmdc:mga0n895_43_c1 nmdc:mga0n895_43_c1_58081_58986 274
466 3300050513 nmdc:mga0rr50_1204_c1 nmdc:mga0rr50_1204_c1_4534_5439 274
467 3300050513 nmdc:mga0rr50_93838_c1 nmdc:mga0rr50_93838_c1_908_1813 274
468 3300050515 nmdc:mga0a205_3268_c1 nmdc:mga0a205_3268_c1_877_1782 274
469 3300053077 Ga0495601_0019931 Ga0495601_0019931_2183_3088 274
470 3300053078 Ga0495612_0007461 Ga0495612_0007461_2397_3302 274
471 iso_pu_bacteria 2842698319 2842698615 275
472 3300031250 Ga0265331_10090758 Ga0265331_100907581 276
473 3300031711 Ga0265314_10060754 Ga0265314_100607543 276
474 3300035691 Ga0373931_0200950 Ga0373931_0200950_148_1032 277
475 3300035115 Ga0373941_0003694 Ga0373941_0003694_238_1107 279
476 3300049571 Ga0501034_0182434 Ga0501034_0182434_962_1831 279
477 3300049573 Ga0501037_0058837 Ga0501037_0058837_1098_1967 279
478 3300049574 Ga0501038_0123017 Ga0501038_0123017_969_1838 279
479 3300049575 Ga0501039_0028565 Ga0501039_0028565_604_1473 279
480 3300049579 Ga0501043_0013503 Ga0501043_0013503_5092_5961 279
481 3300049584 Ga0501068_0027696 Ga0501068_0027696_695_1564 279
482 3300049585 Ga0501069_0074323 Ga0501069_0074323_984_1853 279
483 3300049586 Ga0501070_0119752 Ga0501070_0119752_604_1473 279
484 3300049588 Ga0501072_0106653 Ga0501072_0106653_50_919 279
485 3300049589 Ga0501073_0208197 Ga0501073_0208197_205_1074 279
486 3300049741 Ga0501079_0061605 Ga0501079_0061605_204_1073 279
487 3300049742 Ga0501080_0375490 Ga0501080_0375490_208_1077 279
488 3300049822 Ga0501035_0032190 Ga0501035_0032190_2192_3061 279
489 3300005548 Ga0070665_100604010 Ga0070665_1006040101 280
490 3300009093 Ga0105240_10311400 Ga0105240_103114003 280
491 3300033180 Ga0307510_10133597 Ga0307510_101335972 280
492 3300035695 Ga0373927_0179748 Ga0373927_0179748_298_1179 280
493 3300049586 Ga0501070_0037217 Ga0501070_0037217_1031_1903 280
494 3300049744 Ga0501083_0106665 Ga0501083_0106665_318_1190 280
495 iso_pu_bacteria 2909042592 2909045065 280
496 3300005327 Ga0070658_10018141 Ga0070658_100181414 281
497 3300005327 Ga0070658_10151721 Ga0070658_101517212 281
498 3300005336 Ga0070680_100010386 Ga0070680_1000103864 281
499 3300005336 Ga0070680_100058840 Ga0070680_1000588401 281
500 3300005339 Ga0070660_100102330 Ga0070660_1001023302 281
501 3300005530 Ga0070679_100045910 Ga0070679_1000459105 281
502 3300005539 Ga0068853_100506722 Ga0068853_1005067222 281
503 3300005563 Ga0068855_100226656 Ga0068855_1002266563 281
504 3300005563 Ga0068855_100345202 Ga0068855_1003452023 281
505 3300005578 Ga0068854_100090331 Ga0068854_1000903313 281
506 3300005614 Ga0068856_100359461 Ga0068856_1003594611 281
507 3300009093 Ga0105240_10129854 Ga0105240_101298543 281
508 3300013104 Ga0157370_10039505 Ga0157370_100395055 281
509 3300013105 Ga0157369_10379008 Ga0157369_103790082 281
510 3300013307 Ga0157372_10379577 Ga0157372_103795773 281
511 3300025909 Ga0207705_10004623 Ga0207705_100046233 281
512 3300025912 Ga0207707_10141147 Ga0207707_101411472 281
513 3300025919 Ga0207657_10060705 Ga0207657_100607053 281
514 3300025981 Ga0207640_10051155 Ga0207640_100511554 281
515 3300026041 Ga0207639_10252239 Ga0207639_102522392 281
516 3300026142 Ga0207698_10039789 Ga0207698_100397895 281
517 3300046559 Ga0495667_0004191 Ga0495667_0004191_4265_5248 281
518 3300049581 Ga0501047_0064372 Ga0501047_0064372_2102_2992 281
519 3300005353 Ga0070669_100244144 Ga0070669_1002441442 282
520 3300005618 Ga0068864_100260015 Ga0068864_1002600151 282
521 3300009177 Ga0105248_10390089 Ga0105248_103900891 282
522 3300035724 Ga0373933_0254782 Ga0373933_0254782_77_973 282
523 3300049822 Ga0501035_0058217 Ga0501035_0058217_799_1689 282
524 3300053085 Ga0495619_0029836 Ga0495619_0029836_1357_2253 282
525 3300053087 Ga0500643_021801 Ga0500643_021801_703_1596 282
526 3300053088 Ga0500644_0001646 Ga0500644_0001646_3216_4085 282
527 3300053119 Ga0500595_000002 Ga0500595_000002_925714_926583 282
528 3300053131 Ga0500652_006268 Ga0500652_006268_1390_2259 282
529 3300053153 Ga0500616_0000002 Ga0500616_0000002_1030058_1030927 282
530 3300053730 Ga0500645_000099 Ga0500645_000099_26934_27803 282
531 iso_pu_bacteria 2939669807 2939669898 283
532 3300005438 Ga0070701_10210556 Ga0070701_102105561 284
533 3300005354 Ga0070675_100169371 Ga0070675_1001693713 285
534 3300005356 Ga0070674_100013074 Ga0070674_1000130744 285
535 3300005456 Ga0070678_100069985 Ga0070678_1000699852 285
536 3300005543 Ga0070672_100101542 Ga0070672_1001015422 285
537 3300014326 Ga0157380_10072062 Ga0157380_100720623 285
538 3300025926 Ga0207659_10125257 Ga0207659_101252572 285
539 3300025940 Ga0207691_10034812 Ga0207691_100348123 285
540 3300026023 Ga0207677_10161592 Ga0207677_101615921 285
541 3300026118 Ga0207675_100115286 Ga0207675_1001152861 285
542 3300031711 Ga0265314_10001726 Ga0265314_1000172623 285
543 3300031711 Ga0265314_10009303 Ga0265314_100093036 285
544 3300049572 Ga0501036_0193589 Ga0501036_0193589_197_1096 285
545 3300049574 Ga0501038_0014576 Ga0501038_0014576_3442_4341 285
546 3300049586 Ga0501070_0088179 Ga0501070_0088179_1127_2026 285
547 2209111006 2214745202 2213754648 286
548 3300000041 ARcpr5oldR_c000031 ARcpr5oldR_00003122 286
549 3300000042 ARSoilYngRDRAFT_c00086 ARSoilYngRDRAFT_0008619 286
550 3300000043 ARcpr5yngRDRAFT_c000084 ARcpr5yngRDRAFT_0000842 286
551 3300000044 ARSoilOldRDRAFT_c000050 ARSoilOldRDRAFT_00005010 286
552 3300000045 ARCol0oldRDRAFT_c00024 ARCol0oldRDRAFT_000249 286
553 3300000652 ARCol0yngRDRAFT_1000023 ARCol0yngRDRAFT_100002310 286
554 3300005290 Ga0065712_10003536 Ga0065712_100035366 286
555 3300005293 Ga0065715_10005464 Ga0065715_100054642 286
556 3300005328 Ga0070676_10168784 Ga0070676_101687841 286
557 3300005330 Ga0070690_100008145 Ga0070690_1000081456 286
558 3300005330 Ga0070690_100058971 Ga0070690_1000589713 286
559 3300005334 Ga0068869_100533468 Ga0068869_1005334681 286
560 3300005336 Ga0070680_100131222 Ga0070680_1001312221 286
561 3300005336 Ga0070680_100162863 Ga0070680_1001628633 286
562 3300005336 Ga0070680_100481503 Ga0070680_1004815031 286
563 3300005337 Ga0070682_100104030 Ga0070682_1001040301 286
564 3300005338 Ga0068868_100134550 Ga0068868_1001345502 286
565 3300005339 Ga0070660_100044535 Ga0070660_1000445352 286
566 3300005341 Ga0070691_10131904 Ga0070691_101319041 286
567 3300005345 Ga0070692_10018028 Ga0070692_100180285 286
568 3300005353 Ga0070669_100033495 Ga0070669_1000334954 286
569 3300005355 Ga0070671_100020437 Ga0070671_1000204375 286
570 3300005356 Ga0070674_100083620 Ga0070674_1000836202 286
571 3300005356 Ga0070674_100215906 Ga0070674_1002159063 286
572 3300005365 Ga0070688_100042662 Ga0070688_1000426624 286
573 3300005367 Ga0070667_100158272 Ga0070667_1001582723 286
574 3300005406 Ga0070703_10028946 Ga0070703_100289461 286
575 3300005434 Ga0070709_10065828 Ga0070709_100658283 286
576 3300005434 Ga0070709_10178384 Ga0070709_101783841 286
577 3300005435 Ga0070714_100144480 Ga0070714_1001444802 286
578 3300005435 Ga0070714_100147728 Ga0070714_1001477283 286
579 3300005438 Ga0070701_10031372 Ga0070701_100313722 286
580 3300005440 Ga0070705_100028362 Ga0070705_1000283624 286
581 3300005441 Ga0070700_100027576 Ga0070700_1000275763 286
582 3300005444 Ga0070694_100069203 Ga0070694_1000692032 286
583 3300005456 Ga0070678_100651078 Ga0070678_1006510781 286
584 3300005458 Ga0070681_10066963 Ga0070681_100669633 286
585 3300005458 Ga0070681_10131744 Ga0070681_101317443 286
586 3300005530 Ga0070679_100089271 Ga0070679_1000892715 286
587 3300005530 Ga0070679_100178184 Ga0070679_1001781841 286
588 3300005535 Ga0070684_100058016 Ga0070684_1000580162 286
589 3300005535 Ga0070684_100071061 Ga0070684_1000710611 286
590 3300005539 Ga0068853_100221054 Ga0068853_1002210542 286
591 3300005544 Ga0070686_100078329 Ga0070686_1000783293 286
592 3300005545 Ga0070695_100020774 Ga0070695_1000207742 286
593 3300005546 Ga0070696_100045991 Ga0070696_1000459914 286
594 3300005546 Ga0070696_100058424 Ga0070696_1000584243 286
595 3300005546 Ga0070696_100062587 Ga0070696_1000625872 286
596 3300005549 Ga0070704_100042538 Ga0070704_1000425382 286
597 3300005549 Ga0070704_100165906 Ga0070704_1001659062 286
598 3300005563 Ga0068855_100270715 Ga0068855_1002707153 286
599 3300005564 Ga0070664_100093883 Ga0070664_1000938833 286
600 3300005564 Ga0070664_100121615 Ga0070664_1001216152 286
601 3300005577 Ga0068857_100099307 Ga0068857_1000993072 286
602 3300005577 Ga0068857_100236670 Ga0068857_1002366702 286
603 3300005578 Ga0068854_100194218 Ga0068854_1001942184 286
604 3300005614 Ga0068856_100120855 Ga0068856_1001208552 286
605 3300005617 Ga0068859_100464819 Ga0068859_1004648192 286
606 3300005718 Ga0068866_10063618 Ga0068866_100636182 286
607 3300005719 Ga0068861_100054273 Ga0068861_1000542734 286
608 3300005842 Ga0068858_100097241 Ga0068858_1000972411 286
609 3300005843 Ga0068860_100208852 Ga0068860_1002088522 286
610 3300006163 Ga0070715_10026308 Ga0070715_100263082 286
611 3300006173 Ga0070716_100265469 Ga0070716_1002654692 286
612 3300006237 Ga0097621_100004972 Ga0097621_1000049726 286
613 3300006358 Ga0068871_100004127 Ga0068871_1000041279 286
614 3300006852 Ga0075433_10089970 Ga0075433_100899704 286
615 3300006871 Ga0075434_100434955 Ga0075434_1004349553 286
616 3300006881 Ga0068865_100132391 Ga0068865_1001323912 286
617 3300006881 Ga0068865_100273006 Ga0068865_1002730063 286
618 3300006931 Ga0097620_100464822 Ga0097620_1004648222 286
619 3300009094 Ga0111539_10000757 Ga0111539_1000075745 286
620 3300009101 Ga0105247_10015124 Ga0105247_100151242 286
621 3300009101 Ga0105247_10032592 Ga0105247_100325923 286
622 3300009148 Ga0105243_10006997 Ga0105243_100069978 286
623 3300009174 Ga0105241_10043867 Ga0105241_100438673 286
624 3300009176 Ga0105242_10121283 Ga0105242_101212832 286
625 3300009177 Ga0105248_10069576 Ga0105248_100695765 286
626 3300009545 Ga0105237_10070292 Ga0105237_100702926 286
627 3300009545 Ga0105237_10079628 Ga0105237_100796281 286
628 3300009551 Ga0105238_10316663 Ga0105238_103166631 286
629 3300009551 Ga0105238_10794447 Ga0105238_107944471 286
630 3300009553 Ga0105249_10018341 Ga0105249_100183417 286
631 3300010375 Ga0105239_10494684 Ga0105239_104946842 286
632 3300010375 Ga0105239_11064495 Ga0105239_110644951 286
633 3300011119 Ga0105246_10062593 Ga0105246_100625932 286
634 3300012505 Ga0157339_1003789 Ga0157339_10037892 286
635 3300013100 Ga0157373_10142614 Ga0157373_101426141 286
636 3300013105 Ga0157369_10134356 Ga0157369_101343561 286
637 3300013297 Ga0157378_10022902 Ga0157378_100229025 286
638 3300013306 Ga0163162_10066273 Ga0163162_100662736 286
639 3300013307 Ga0157372_10301657 Ga0157372_103016572 286
640 3300013308 Ga0157375_10044607 Ga0157375_100446074 286
641 3300013308 Ga0157375_10056005 Ga0157375_100560055 286
642 3300014326 Ga0157380_10024000 Ga0157380_100240006 286
643 3300014968 Ga0157379_10077215 Ga0157379_100772153 286
644 3300014969 Ga0157376_10027757 Ga0157376_100277574 286
645 3300017792 Ga0163161_10038484 Ga0163161_100384844 286
646 3300025271 Ga0207666_1000825 Ga0207666_10008255 286
647 3300025315 Ga0207697_10003536 Ga0207697_100035367 286
648 3300025885 Ga0207653_10037868 Ga0207653_100378682 286
649 3300025898 Ga0207692_10156767 Ga0207692_101567671 286
650 3300025899 Ga0207642_10029170 Ga0207642_100291702 286
651 3300025903 Ga0207680_10050338 Ga0207680_100503382 286
652 3300025903 Ga0207680_10232782 Ga0207680_102327822 286
653 3300025904 Ga0207647_10022872 Ga0207647_100228726 286
654 3300025906 Ga0207699_10028904 Ga0207699_100289042 286
655 3300025907 Ga0207645_10037371 Ga0207645_100373714 286
656 3300025911 Ga0207654_10233533 Ga0207654_102335332 286
657 3300025912 Ga0207707_10008300 Ga0207707_100083002 286
658 3300025912 Ga0207707_10060858 Ga0207707_100608583 286
659 3300025914 Ga0207671_10189574 Ga0207671_101895742 286
660 3300025915 Ga0207693_10035873 Ga0207693_100358732 286
661 3300025915 Ga0207693_10117308 Ga0207693_101173082 286
662 3300025919 Ga0207657_10052705 Ga0207657_100527052 286
663 3300025919 Ga0207657_10057638 Ga0207657_100576383 286
664 3300025926 Ga0207659_10038335 Ga0207659_100383355 286
665 3300025928 Ga0207700_10184941 Ga0207700_101849411 286
666 3300025929 Ga0207664_10053132 Ga0207664_100531322 286
667 3300025929 Ga0207664_10190714 Ga0207664_101907143 286
668 3300025929 Ga0207664_10261411 Ga0207664_102614112 286
669 3300025932 Ga0207690_10465128 Ga0207690_104651281 286
670 3300025933 Ga0207706_10016549 Ga0207706_100165495 286
671 3300025933 Ga0207706_10035958 Ga0207706_100359583 286
672 3300025934 Ga0207686_10230052 Ga0207686_102300522 286
673 3300025935 Ga0207709_10069409 Ga0207709_100694093 286
674 3300025936 Ga0207670_10068553 Ga0207670_100685531 286
675 3300025939 Ga0207665_10043156 Ga0207665_100431561 286
676 3300025940 Ga0207691_10102469 Ga0207691_101024693 286
677 3300025941 Ga0207711_10158113 Ga0207711_101581132 286
678 3300025942 Ga0207689_10115522 Ga0207689_101155222 286
679 3300025944 Ga0207661_10321539 Ga0207661_103215392 286
680 3300025945 Ga0207679_10026481 Ga0207679_100264814 286
681 3300025949 Ga0207667_10684738 Ga0207667_106847382 286
682 3300025986 Ga0207658_10509926 Ga0207658_105099262 286
683 3300026035 Ga0207703_10088084 Ga0207703_100880842 286
684 3300026035 Ga0207703_10352273 Ga0207703_103522733 286
685 3300026067 Ga0207678_10010941 Ga0207678_100109412 286
686 3300026075 Ga0207708_10037666 Ga0207708_100376665 286
687 3300026078 Ga0207702_10279623 Ga0207702_102796232 286
688 3300026088 Ga0207641_10224085 Ga0207641_102240854 286
689 3300026089 Ga0207648_10128032 Ga0207648_101280322 286
690 3300026116 Ga0207674_10203297 Ga0207674_102032973 286
691 3300026118 Ga0207675_100255987 Ga0207675_1002559873 286
692 3300027665 Ga0209983_1027703 Ga0209983_10277031 286
693 3300027695 Ga0209966_1001285 Ga0209966_10012852 286
694 3300027717 Ga0209998_10000255 Ga0209998_1000025519 286
695 3300027717 Ga0209998_10024295 Ga0209998_100242951 286
696 3300027876 Ga0209974_10099082 Ga0209974_100990822 286
697 3300027907 Ga0207428_10000792 Ga0207428_1000079210 286
698 3300028380 Ga0268265_10137636 Ga0268265_101376362 286
699 3300031241 Ga0265325_10037662 Ga0265325_100376624 286
700 3300031247 Ga0265340_10013138 Ga0265340_100131382 286
701 3300031247 Ga0265340_10079733 Ga0265340_100797332 286
702 3300031344 Ga0265316_10117357 Ga0265316_101173571 286
703 3300031344 Ga0265316_10135948 Ga0265316_101359482 286
704 3300031665 Ga0316575_10035231 Ga0316575_100352312 286
705 3300032133 Ga0316583_10002826 Ga0316583_100028262 286
706 3300034816 Ga0373930_0000452 Ga0373930_0000452_3373_4233 286
707 3300034817 Ga0373948_0000822 Ga0373948_0000822_2433_3293 286
708 3300034817 Ga0373948_0047176 Ga0373948_0047176_25_885 286
709 3300034819 Ga0373958_0000721 Ga0373958_0000721_3291_4151 286
710 3300034820 Ga0373959_0001671 Ga0373959_0001671_1921_2781 286
711 3300035084 Ga0373928_0000449 Ga0373928_0000449_1804_2664 286
712 3300035085 Ga0373929_0000206 Ga0373929_0000206_520_1380 286
713 3300035086 Ga0373934_0002288 Ga0373934_0002288_307_1212 286
714 3300035086 Ga0373934_0026660 Ga0373934_0026660_20_901 286
715 3300035088 Ga0373940_0000275 Ga0373940_0000275_2614_3474 286
716 3300035089 Ga0373944_0023050 Ga0373944_0023050_28_888 286
717 3300035090 Ga0373949_0001134 Ga0373949_0001134_702_1562 286
718 3300035091 Ga0373951_0000423 Ga0373951_0000423_1624_2484 286
719 3300035092 Ga0373952_0000038 Ga0373952_0000038_2865_3725 286
720 3300035112 Ga0373932_0000572 Ga0373932_0000572_2622_3482 286
721 3300035114 Ga0373939_0000257 Ga0373939_0000257_5431_6291 286
722 3300035114 Ga0373939_0001047 Ga0373939_0001047_3789_4670 286
723 3300035115 Ga0373941_0001225 Ga0373941_0001225_747_1607 286
724 3300035118 Ga0373954_0008462 Ga0373954_0008462_3563_4465 286
725 3300035119 Ga0373956_0011299 Ga0373956_0011299_384_1289 286
726 3300035120 Ga0373957_0001356 Ga0373957_0001356_1891_2796 286
727 3300035121 Ga0373960_0003182 Ga0373960_0003182_2104_2964 286
728 3300035170 Ga0373943_0016485 Ga0373943_0016485_2494_3354 286
729 3300035172 Ga0373955_0005429 Ga0373955_0005429_1601_2503 286
730 3300035172 Ga0373955_0157500 Ga0373955_0157500_38_943 286
731 3300035172 Ga0373955_0242916 Ga0373955_0242916_10_915 286
732 3300035207 Ga0373942_0000089 Ga0373942_0000089_2570_3430 286
733 3300035242 Ga0373962_0001788 Ga0373962_0001788_4244_5104 286
734 3300035691 Ga0373931_0002088 Ga0373931_0002088_1913_2773 286
735 3300035692 Ga0373935_0093329 Ga0373935_0093329_485_1345 286
736 3300035724 Ga0373933_0011372 Ga0373933_0011372_3098_4000 286
737 3300035724 Ga0373933_0025867 Ga0373933_0025867_1923_2783 286
738 3300035725 Ga0373947_0071765 Ga0373947_0071765_1253_2113 286
739 3300036401 Ga0373937_0018346 Ga0373937_0018346_4769_5674 286
740 3300038996 Ga0242420_006378 Ga0242420_006378_630_1490 286
741 3300044712 Ga0453684_0291155 Ga0453684_0291155_269_1129 286
742 3300045051 Ga0451576_0047830 Ga0451576_0047830_2035_2895 286
743 3300046454 Ga0495592_0025647 Ga0495592_0025647_645_1550 286
744 3300046454 Ga0495592_0096163 Ga0495592_0096163_343_1245 286
745 3300046459 Ga0495629_0310677 Ga0495629_0310677_202_1062 286
746 3300046461 Ga0495641_0055025 Ga0495641_0055025_909_1769 286
747 3300046462 Ga0495651_0015323 Ga0495651_0015323_2285_3145 286
748 3300046462 Ga0495651_0115960 Ga0495651_0115960_817_1698 286
749 3300046463 Ga0495653_0080036 Ga0495653_0080036_869_1729 286
750 3300046472 Ga0495580_0095263 Ga0495580_0095263_177_1082 286
751 3300046477 Ga0495664_0044002 Ga0495664_0044002_1730_2635 286
752 3300046499 Ga0495594_0224445 Ga0495594_0224445_103_1008 286
753 3300046511 Ga0495608_0003528 Ga0495608_0003528_10276_11136 286
754 3300046514 Ga0495618_0025853 Ga0495618_0025853_1177_2037 286
755 3300046517 Ga0495630_0057991 Ga0495630_0057991_1336_2196 286
756 3300046529 Ga0495652_0050380 Ga0495652_0050380_426_1331 286
757 3300046529 Ga0495652_0105769 Ga0495652_0105769_192_1097 286
758 3300046533 Ga0495640_0007483 Ga0495640_0007483_11_871 286
759 3300046533 Ga0495640_0074036 Ga0495640_0074036_944_1849 286
760 3300046535 Ga0495586_0056351 Ga0495586_0056351_601_1461 286
761 3300046559 Ga0495667_0027013 Ga0495667_0027013_2598_3458 286
762 3300046642 Ga0495634_0088252 Ga0495634_0088252_457_1317 286
763 3300046663 Ga0495635_0002274 Ga0495635_0002274_2653_3558 286
764 3300046663 Ga0495635_0071034 Ga0495635_0071034_1175_2080 286
765 3300046675 Ga0495657_0032249 Ga0495657_0032249_958_1860 286
766 3300046675 Ga0495657_0052882 Ga0495657_0052882_381_1241 286
767 3300046678 Ga0495599_0049221 Ga0495599_0049221_1156_2061 286
768 3300046679 Ga0495623_0012776 Ga0495623_0012776_3992_4852 286
769 3300046680 Ga0495646_0042876 Ga0495646_0042876_534_1439 286
770 3300046681 Ga0495647_0091051 Ga0495647_0091051_63_968 286
771 3300046683 Ga0495658_0166172 Ga0495658_0166172_471_1331 286
772 3300046689 Ga0495613_0049327 Ga0495613_0049327_357_1262 286
773 3300046690 Ga0495624_0079297 Ga0495624_0079297_327_1232 286
774 3300046809 Ga0495600_0068784 Ga0495600_0068784_12_917 286
775 3300047315 Ga0495581_0024160 Ga0495581_0024160_2100_3005 286
776 3300047317 Ga0495604_0013941 Ga0495604_0013941_2220_3125 286
777 3300047317 Ga0495604_0066726 Ga0495604_0066726_693_1595 286
778 3300047319 Ga0495674_0038342 Ga0495674_0038342_2698_3603 286
779 3300047322 Ga0495680_0009896 Ga0495680_0009896_5650_6510 286
780 3300047322 Ga0495680_0030095 Ga0495680_0030095_3121_4023 286
781 3300047444 Ga0495675_0005619 Ga0495675_0005619_2789_3649 286
782 3300047471 Ga0495684_0315276 Ga0495684_0315276_53_958 286
783 3300048088 Ga0495602_0006877 Ga0495602_0006877_773_1678 286
784 3300048088 Ga0495602_0168941 Ga0495602_0168941_570_1472 286
785 3300048903 Ga0496100_0015150 Ga0496100_0015150_47_973 286
786 3300048904 Ga0496101_0044420 Ga0496101_0044420_1128_1988 286
787 3300048905 Ga0496102_0005624 Ga0496102_0005624_8772_9677 286
788 3300048905 Ga0496102_0127882 Ga0496102_0127882_61_921 286
789 3300048905 Ga0496102_0271239 Ga0496102_0271239_394_1317 286
790 3300048907 Ga0496104_0041796 Ga0496104_0041796_1895_2821 286
791 3300048907 Ga0496104_0175177 Ga0496104_0175177_51_911 286
792 3300048908 Ga0496105_0006025 Ga0496105_0006025_3518_4444 286
793 3300048909 Ga0496106_0084416 Ga0496106_0084416_283_1143 286
794 3300048909 Ga0496106_0105407 Ga0496106_0105407_480_1406 286
795 3300048910 Ga0496107_0035169 Ga0496107_0035169_1035_1895 286
796 3300048911 Ga0496108_0015654 Ga0496108_0015654_3954_4814 286
797 3300048911 Ga0496108_0034918 Ga0496108_0034918_2238_3098 286
798 3300048912 Ga0496109_0013436 Ga0496109_0013436_2752_3612 286
799 3300048912 Ga0496109_0266679 Ga0496109_0266679_472_1398 286
800 3300048913 Ga0496110_0021235 Ga0496110_0021235_2719_3579 286
801 3300048913 Ga0496110_0239521 Ga0496110_0239521_381_1241 286
802 3300048914 Ga0496111_0208362 Ga0496111_0208362_263_1123 286
803 3300048915 Ga0496112_0392614 Ga0496112_0392614_327_1253 286
804 3300048916 Ga0496113_0009576 Ga0496113_0009576_3342_4202 286
805 3300048916 Ga0496113_0113591 Ga0496113_0113591_623_1483 286
806 3300048917 Ga0496114_0065102 Ga0496114_0065102_1393_2253 286
807 3300048918 Ga0496115_0056441 Ga0496115_0056441_1254_2159 286
808 3300049569 Ga0501032_0219459 Ga0501032_0219459_268_1149 286
809 3300049571 Ga0501034_0140283 Ga0501034_0140283_658_1539 286
810 3300049571 Ga0501034_0281827 Ga0501034_0281827_501_1382 286
811 3300049572 Ga0501036_0331580 Ga0501036_0331580_117_1025 286
812 3300049581 Ga0501047_0213918 Ga0501047_0213918_261_1142 286
813 3300049586 Ga0501070_0435956 Ga0501070_0435956_116_997 286
814 3300049587 Ga0501071_0255826 Ga0501071_0255826_344_1225 286
815 3300049591 Ga0501075_0170621 Ga0501075_0170621_253_1161 286
816 3300049743 Ga0501081_0296281 Ga0501081_0296281_29_922 286
817 3300049744 Ga0501083_0187620 Ga0501083_0187620_91_996 286
818 3300049822 Ga0501035_0128538 Ga0501035_0128538_774_1655 286
819 3300050494 nmdc:mga06z11_158180_c1 nmdc:mga06z11_158180_c1_377_1237 286
820 3300050511 nmdc:mga08y16_12219_c1 nmdc:mga08y16_12219_c1_5995_6855 286
821 3300050512 nmdc:mga0n895_120612_c1 nmdc:mga0n895_120612_c1_1654_2514 286
822 3300050512 nmdc:mga0n895_184670_c1 nmdc:mga0n895_184670_c1_111_1010 286
823 3300050513 nmdc:mga0rr50_206291_c1 nmdc:mga0rr50_206291_c1_415_1275 286
824 3300050515 nmdc:mga0a205_106498_c1 nmdc:mga0a205_106498_c1_556_1461 286
825 3300050515 nmdc:mga0a205_113332_c1 nmdc:mga0a205_113332_c1_935_1795 286
826 3300053077 Ga0495601_0028792 Ga0495601_0028792_2462_3364 286
827 3300053078 Ga0495612_0009252 Ga0495612_0009252_2627_3529 286
828 3300053084 Ga0495595_0075954 Ga0495595_0075954_309_1190 286
829 3300053085 Ga0495619_0020702 Ga0495619_0020702_2923_3783 286
830 3300053085 Ga0495619_0170464 Ga0495619_0170464_508_1413 286
831 3300061719 Ga0466962_0067368 Ga0466962_0067368_524_1396 286
832 3300061734 Ga0530510_0078676 Ga0530510_0078676_511_1419 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01343

Peptidase_S49

Peptidase family S49

110

260

0.93

PF01972

SDH_sah

Serine dehydrogenase proteinase

24

166

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rst-assembly1.cif.gz_A crystal structure of bacillus subtilis signal peptide peptidase a 0.8921 18 230
4kwb-assembly1.cif.gz_D structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation 0.8869 20 230
4kwb-assembly1.cif.gz_C structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation 0.886 17 230
4kwb-assembly1.cif.gz_H structure of signal peptide peptidase a with c-termini bound in the active sites: insights into specificity, self-processing and regulation 0.882 18 230
3rst-assembly1.cif.gz_B crystal structure of bacillus subtilis signal peptide peptidase a 0.8365 17 238
ID Description Score Start End Superfamily
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8726 17 230 3.90.226.10
af_Q9C9C0_371_523_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8706 20 164 3.90.226.10
af_P95072_325_478_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8665 18 159 3.90.226.10
3rstA02 Special;Other non-globular;peptide peptidase (sppa) fold; 0.8659 126 191 6.20.330.10
3rstA02 Special;Other non-globular;peptide peptidase (sppa) fold; 0.8432 126 191 6.20.330.10
ID Description Score Start End GO Terms
AF-A0A401TV86-F1-model_v4 Peptidase S49 domain-containing protein 0.9648 13 240 GO:0006508
GO:0008236
AF-A0A401TV86-F1-model_v4 Peptidase S49 domain-containing protein 0.9607 13 240 GO:0006508
GO:0008236
AF-X1KBM2-F1-model_v4 Peptidase S49 domain-containing protein 0.9488 2 236 GO:0006508
GO:0008236
AF-A0A383EXC7-F1-model_v4 Peptidase S49 domain-containing protein 0.9458 13 129 GO:0006508
GO:0008233
AF-A0A527ZKB2-F1-model_v4 S49 family peptidase 0.9453 27 236 GO:0006508
GO:0008236

Feature Viewer

pLDDT pTM Quality
79.17 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map