F482634

General Info

Members Datasets Scaffolds Average Seq Length
830 462 751 216

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000022|JGI25155J39150_1000022128
Length 229
Sequence MAKPKTVAVVDYGMGNLHSVSQAVRHVAAGSGFEVFVTSKAEDVMNAERIVLPGQGAIADCMRELADSGMLESVLHAAAHKPLFGVCVGMQMLLSHSDEGQPGDGGAGTQGLNLIPGEVTKFELVGQTQPDGSRYKVPQMGWNQVYQNGAGTAGAHAIWAGVPDGAYFYFVHSFYAHPSDARHIAGEADYGGRFAAAIARDNIFATQFHPEKSADHGLALYRNFLHWNP

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
6 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
7 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
8 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
9 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
10 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
11 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
12 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
13 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
14 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
15 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
16 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
17 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
18 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
19 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
20 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
21 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
22 2643221672 Variovorax sp. Root434 Isolate Unclassified
23 2643221683 Variovorax sp. Root473 Isolate Unclassified
24 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
25 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
26 2738541277 Variovorax sp. GV051 Isolate Unclassified
27 2738541307 Variovorax sp. GV008 Isolate Unclassified
28 2738543013 Variovorax sp. BT01 Isolate Unclassified
29 2738543019 Variovorax sp. GV040 Isolate Unclassified
30 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
31 2818991446 Variovorax sp. 1180 Isolate Unclassified
32 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2842677519 Variovorax sp. R-72495 Isolate Unclassified
35 2842733646 Variovorax sp. R-72446 Isolate Unclassified
36 2842747753 Variovorax sp. R-72060 Isolate Unclassified
37 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
38 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
39 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
40 2857472729 Cohnella sp. R-74144 Isolate Unclassified
41 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
42 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
43 2885198086 Variovorax sp. 679 Isolate Unclassified
44 2885211737 Variovorax sp. 553 Isolate Unclassified
45 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
46 2899924645 Variovorax sp. 369 Isolate Unclassified
47 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
48 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
49 2904456579 Variovorax sp. 2002 Isolate Unclassified
50 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
51 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
52 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
53 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
54 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
55 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
56 2928037797 Variovorax sp. 1126 Isolate Unclassified
57 2928044640 Variovorax sp. 1128 Isolate Unclassified
58 2928051484 Variovorax sp. 1133 Isolate Unclassified
59 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
60 2928070936 Variovorax gossypii 1167 Isolate Unclassified
61 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
62 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
63 2929520902 Variovorax beijingensis 502 Isolate Unclassified
64 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
65 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
66 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
67 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
68 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
69 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
70 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
71 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
72 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
73 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
74 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
75 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
76 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
82 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
83 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
84 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
85 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
86 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
87 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
88 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
89 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
90 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
91 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
92 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
93 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
94 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
95 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
96 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
97 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
98 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
99 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
102 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
103 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
104 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
105 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
106 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
109 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
110 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
113 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
116 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
117 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
118 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
119 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
120 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
121 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
122 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
123 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
130 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
137 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
138 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
142 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
147 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
177 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
178 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
179 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
180 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
197 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
237 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
241 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
242 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
243 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
244 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
245 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
246 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
247 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
269 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
270 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
271 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
272 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
274 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
276 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
284 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
285 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
292 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
297 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
298 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
299 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
300 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
303 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
304 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
307 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
308 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
309 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
310 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
311 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
312 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
313 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
314 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
315 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
316 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
317 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
318 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
319 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
320 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
321 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
324 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
325 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
326 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
331 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
332 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
333 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
334 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
335 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
336 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
337 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
338 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
339 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
340 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
343 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
344 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
345 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
353 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
356 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
359 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
360 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
361 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
362 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
366 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
367 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
373 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
374 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
386 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
387 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
388 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
389 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
402 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
403 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
404 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
405 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
406 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
407 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
408 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
412 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
415 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
416 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
417 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
418 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
423 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
424 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
425 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
426 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
427 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
428 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
429 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
430 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
431 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
432 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
433 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
434 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
435 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
436 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
437 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
438 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
439 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
440 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
441 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
442 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
443 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
444 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
445 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
446 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
447 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
448 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
449 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
450 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
451 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
452 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
453 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
456 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
457 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
458 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
459 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
460 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
461 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
462 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.76
Metatranscriptomes 0.72
Isolates 9.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 32.05
Nodule 1.33
Rhizoplane 2.41
Rhizosphere 50.84
Stem 0
Stem Tuber 0
Unclassified 13.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003858 3300001979 Bacteria 6506
2 JGI24739J22299_10018303 3300001989 Bacteria 2519
3 JGI24739J22299_10063752 3300001989 Bacteria 1159
4 JGI25155J39150_1000022 3300002704 Bacteria 142950
5 JGI25156J39149_1000005 3300002705 Bacteria 263980
6 JGI25154J39366_1000017 3300002738 Bacteria 252448
7 JGI25158J39367_1002842 3300002739 Bacteria 2746
8 JGI25158J39367_1005105 3300002739 Bacteria 1939
9 JGI25157J39369_1000003 3300002741 Bacteria 274935
10 JGI25152J39213_1004641 3300002773 Bacteria 4263
11 JGI25152J39213_1020643 3300002773 Bacteria 1172
12 JGI25152J39213_1025480 3300002773 Bacteria 978
13 JGI25152J39213_1035849 3300002773 Bacteria 730
14 JGI25150J39212_1007128 3300002774 Bacteria 2264
15 JGI25150J39212_1009905 3300002774 Bacteria 1794
16 JGI25150J39212_1012415 3300002774 Bacteria 1510
17 JGI25150J39212_1018097 3300002774 Bacteria 1126
18 JGI25159J45721_1000561 3300002987 Bacteria 16704
19 JGI25159J45721_1001840 3300002987 Bacteria 8476
20 JGI25159J45721_1005446 3300002987 Bacteria 3995
21 JGI25159J45721_1018716 3300002987 Bacteria 1386
22 JGI25151J46595_10004741 3300003187 Bacteria 7139
23 JGI25151J46595_10004893 3300003187 Bacteria 6996
24 JGI25151J46595_10004998 3300003187 Bacteria 6911
25 JGI25151J46595_10007286 3300003187 Bacteria 5442
26 JGI25151J46595_10010356 3300003187 Bacteria 4345
27 JGI25151J46595_10020356 3300003187 Bacteria 2799
28 JGI25151J46595_10027780 3300003187 Bacteria 2262
29 JGI25151J46595_10076324 3300003187 Bacteria 990
30 JGI25151J46595_10076756 3300003187 Bacteria 985
31 JGI25153J46596_10010237 3300003215 Bacteria 4260
32 JGI25153J46596_10034417 3300003215 Bacteria 1656
33 JGI25153J46596_10040105 3300003215 Bacteria 1456
34 rootH1_10063531 3300003316 Bacteria 1225
35 rootH1_10010075 3300003323 Bacteria 1080
36 rootH1_10031907 3300003323 Bacteria 30043
37 JGI26128J50194_1002153 3300003347 Bacteria 1285
38 JGI25160J50197_1000691 3300003354 Bacteria 18646
39 JGI25160J50197_1008221 3300003354 Bacteria 3995
40 JGI25160J50197_1009957 3300003354 Bacteria 3479
41 JGI25161J50226_1000095 3300003374 Bacteria 72343
42 JGI25161J50226_1002715 3300003374 Bacteria 4382
43 JGI25161J50226_1003084 3300003374 Bacteria 3978
44 Ga0006562J51391_1040310 3300003578 Bacteria 2860
45 Ga0006562J51391_1149086 3300003578 Bacteria 2010
46 Ga0055532_1010496 3300003758 Bacteria 1106
47 Ga0055535_1000966 3300003761 Bacteria 18756
48 Ga0055542_1000080 3300003762 Bacteria 129634
49 Ga0055526_1016604 3300003771 Bacteria 2866
50 Ga0055526_1020873 3300003771 Bacteria 2306
51 Ga0055526_1023266 3300003771 Bacteria 2074
52 Ga0055526_1024718 3300003771 Bacteria 1953
53 Ga0055537_1000150 3300003773 Bacteria 52097
54 Ga0055537_1000205 3300003773 Bacteria 44266
55 Ga0055537_1001935 3300003773 Bacteria 7404
56 Ga0055537_1008735 3300003773 Bacteria 2306
57 Ga0055524_1000073 3300003775 Bacteria 123033
58 Ga0055524_1005814 3300003775 Bacteria 5447
59 Ga0055524_1005838 3300003775 Bacteria 5433
60 Ga0055536_1005910 3300003781 Bacteria 5858
61 Ga0055536_1010264 3300003781 Bacteria 3742
62 Ga0055536_1019004 3300003781 Bacteria 2177
63 Ga0055534_1000016 3300003784 Bacteria 144444
64 Ga0055534_1003549 3300003784 Bacteria 4858
65 Ga0055534_1005062 3300003784 Bacteria 3637
66 Ga0055534_1008144 3300003784 Bacteria 2408
67 Ga0055534_1013820 3300003784 Bacteria 1536
68 Ga0055528_1000894 3300003790 Bacteria 20125
69 Ga0055528_1002836 3300003790 Bacteria 9062
70 Ga0055528_1018968 3300003790 Bacteria 2306
71 Ga0055528_1022186 3300003790 Bacteria 1985
72 Ga0055530_10000848 3300003791 Bacteria 25191
73 Ga0055530_10005116 3300003791 Bacteria 6409
74 Ga0055530_10025185 3300003791 Bacteria 1667
75 Ga0055530_10029586 3300003791 Bacteria 1462
76 Ga0055540_1000037 3300003792 Bacteria 162957
77 Ga0055540_1004443 3300003792 Bacteria 6315
78 Ga0055540_1005600 3300003792 Bacteria 5227
79 Ga0055540_1005810 3300003792 Bacteria 5070
80 Ga0055540_1011326 3300003792 Bacteria 2884
81 Ga0055540_1029069 3300003792 Bacteria 1298
82 Ga0055531_10002177 3300003794 Bacteria 13374
83 Ga0055531_10006920 3300003794 Bacteria 6315
84 Ga0055531_10010770 3300003794 Bacteria 4502
85 Ga0055543_1001829 3300004625 Bacteria 7793
86 Ga0055543_1009482 3300004625 Bacteria 2088
87 Ga0065165_1006524 3300005262 Bacteria 6083
88 Ga0065165_1046483 3300005262 Bacteria 1259
89 Ga0065165_1066742 3300005262 Bacteria 967
90 Ga0065714_10201064 3300005288 Bacteria 879
91 Ga0065715_10219907 3300005293 Bacteria 1276
92 Ga0070683_100147324 3300005329 Bacteria 2231
93 Ga0070670_100000010 3300005331 Bacteria 277365
94 Ga0070666_10004810 3300005335 Bacteria 8259
95 Ga0070668_100250619 3300005347 Bacteria 1470
96 Ga0070669_100001528 3300005353 Bacteria 16739
97 Ga0070669_100034324 3300005353 Bacteria 3673
98 Ga0070671_100000060 3300005355 Bacteria 73698
99 Ga0070671_100715368 3300005355 Bacteria 869
100 Ga0070673_100648749 3300005364 Bacteria 966
101 Ga0070688_100006123 3300005365 Bacteria 6398
102 Ga0070659_100082251 3300005366 Bacteria 2573
103 Ga0070667_100000124 3300005367 Bacteria 98412
104 Ga0070667_100086398 3300005367 Bacteria 2691
105 Ga0070667_100303747 3300005367 Bacteria 1437
106 Ga0070678_100188811 3300005456 Bacteria 1693
107 Ga0070678_100426878 3300005456 Bacteria 1157
108 Ga0068867_100000063 3300005459 Bacteria 64286
109 Ga0070685_10000001 3300005466 Bacteria 349867
110 Ga0070684_100308855 3300005535 Unclassified 1452
111 Ga0068853_100009734 3300005539 Bacteria 7753
112 Ga0068853_100438824 3300005539 Bacteria 1227
113 Ga0070665_100093104 3300005548 Bacteria 3018
114 Ga0070664_100013607 3300005564 Bacteria 6630
115 Ga0068857_100137185 3300005577 Unclassified 2209
116 Ga0068854_100165835 3300005578 Bacteria 1715
117 Ga0068859_100007672 3300005617 Bacteria 10961
118 Ga0068859_100095948 3300005617 Bacteria 3018
119 Ga0068859_101517848 3300005617 Bacteria 740
120 Ga0068864_100000018 3300005618 Bacteria 277365
121 Ga0068851_10010947 3300005834 Bacteria 4243
122 Ga0068863_100124737 3300005841 Bacteria 2456
123 Ga0068863_100344398 3300005841 Bacteria 1450
124 Ga0068863_100411760 3300005841 Bacteria 1323
125 Ga0068858_100308203 3300005842 Bacteria 1511
126 Ga0068862_100017911 3300005844 Bacteria 5898
127 Ga0068862_100035210 3300005844 Bacteria 4238
128 Ga0075365_10069730 3300006038 Bacteria 2363
129 Ga0075363_100002569 3300006048 Bacteria 7462
130 Ga0075363_100038287 3300006048 Bacteria 2521
131 Ga0075363_100216359 3300006048 Bacteria 1097
132 Ga0075432_10003468 3300006058 Bacteria 5336
133 Ga0075362_10003058 3300006177 Bacteria 5756
134 Ga0075362_10021197 3300006177 Bacteria 2723
135 Ga0075367_10089860 3300006178 Bacteria 1867
136 Ga0075369_10139567 3300006186 Bacteria 1104
137 Ga0075369_10152865 3300006186 Bacteria 1056
138 Ga0075369_10174700 3300006186 Bacteria 987
139 Ga0075366_10018256 3300006195 Bacteria 4047
140 Ga0075366_10041111 3300006195 Bacteria 2736
141 Ga0075366_10368630 3300006195 Bacteria 882
142 Ga0075370_10000282 3300006353 Bacteria 18351
143 Ga0075370_10000304 3300006353 Bacteria 17728
144 Ga0075370_10002475 3300006353 Bacteria 8564
145 Ga0075370_10009367 3300006353 Bacteria 5082
146 Ga0075370_10181620 3300006353 Bacteria 1238
147 Ga0075370_10323069 3300006353 Bacteria 919
148 Ga0068871_100211717 3300006358 Bacteria 1677
149 Ga0068865_100022089 3300006881 Bacteria 4145
150 Ga0097620_100007672 3300006931 Bacteria 10961
151 Ga0097620_100095944 3300006931 Bacteria 3018
152 Ga0097620_101517874 3300006931 Bacteria 740
153 Ga0079104_1005095 3300006946 Bacteria 5352
154 Ga0079104_1009456 3300006946 Bacteria 3299
155 Ga0099826_10000101 3300006948 Bacteria 40408
156 Ga0099826_10066499 3300006948 Bacteria 2312
157 Ga0105251_10006725 3300009011 Bacteria 7257
158 Ga0105244_10038393 3300009036 Bacteria 2498
159 Ga0105240_10630627 3300009093 Bacteria 1177
160 Ga0105245_10212067 3300009098 Bacteria 1864
161 Ga0105247_10080772 3300009101 Bacteria 2049
162 Ga0114129_10025543 3300009147 Bacteria 8368
163 Ga0114129_11226688 3300009147 Unclassified 933
164 Ga0105243_10002786 3300009148 Bacteria 14519
165 Ga0105243_10262641 3300009148 Bacteria 1546
166 Ga0105248_10238124 3300009177 Bacteria 2049
167 Ga0105238_10097633 3300009551 Bacteria 2923
168 Ga0105238_10863482 3300009551 Bacteria 922
169 Ga0105249_10051700 3300009553 Bacteria 3749
170 Ga0105239_10191146 3300010375 Bacteria 2291
171 Ga0105246_10702987 3300011119 Bacteria 886
172 Ga0157322_1000857 3300012490 Bacteria 1328
173 Ga0157373_10043497 3300013100 Bacteria 3208
174 Ga0157373_10101206 3300013100 Bacteria 2027
175 Ga0157373_10470197 3300013100 Bacteria 906
176 Ga0157370_10033859 3300013104 Bacteria 4979
177 Ga0157370_10104976 3300013104 Bacteria 2645
178 Ga0157369_10003810 3300013105 Bacteria 17909
179 Ga0157369_10120724 3300013105 Bacteria 2781
180 Ga0157378_10033515 3300013297 Bacteria 4541
181 Ga0163162_10020264 3300013306 Bacteria 6530
182 Ga0163162_10187962 3300013306 Bacteria 2193
183 Ga0163162_10425225 3300013306 Bacteria 1460
184 Ga0163162_10682723 3300013306 Bacteria 1149
185 Ga0157372_10306878 3300013307 Bacteria 1847
186 Ga0157372_10979357 3300013307 Bacteria 980
187 Ga0157375_10011112 3300013308 Bacteria 7941
188 Ga0157375_10321531 3300013308 Bacteria 1712
189 Ga0163163_10000203 3300014325 Bacteria 61545
190 Ga0182008_10001633 3300014497 Bacteria 14849
191 Ga0182008_10001806 3300014497 Bacteria 13972
192 Ga0182008_10005156 3300014497 Bacteria 7495
193 Ga0182008_10038809 3300014497 Bacteria 2381
194 Ga0182008_10115321 3300014497 Bacteria 1332
195 Ga0157377_10000132 3300014745 Bacteria 47931
196 Ga0157379_10038359 3300014968 Bacteria 4275
197 Ga0157379_10140216 3300014968 Bacteria 2179
198 Ga0157376_10065464 3300014969 Bacteria 3069
199 Ga0182006_1069364 3300015261 Bacteria 1311
200 Ga0182006_1072523 3300015261 Bacteria 1273
201 Ga0182006_1100042 3300015261 Bacteria 1030
202 Ga0182007_10000853 3300015262 Bacteria 16919
203 Ga0182007_10003308 3300015262 Bacteria 7639
204 Ga0182005_1043524 3300015265 Bacteria 1220
205 Ga0183362_10003 3300015683 Bacteria 977584
206 Ga0163161_10001891 3300017792 Bacteria 15283
207 Ga0163161_10022442 3300017792 Bacteria 4445
208 Ga0163161_10066343 3300017792 Bacteria 2635
209 Ga0163161_10131696 3300017792 Bacteria 1887
210 Ga0163161_10209572 3300017792 Bacteria 1505
211 Ga0213872_10001257 3300021361 Bacteria 17069
212 Ga0213872_10004111 3300021361 Bacteria 7831
213 Ga0213872_10093803 3300021361 Bacteria 1341
214 Ga0209435_100002 3300025206 Bacteria 794178
215 Ga0209672_100378 3300025228 Bacteria 27209
216 Ga0209147_100696 3300025229 Bacteria 17227
217 Ga0209258_100093 3300025242 Bacteria 223559
218 Ga0207425_1001814 3300025245 Bacteria 8276
219 Ga0207425_1002888 3300025245 Bacteria 5767
220 Ga0207425_1014399 3300025245 Bacteria 1796
221 Ga0207425_1017383 3300025245 Bacteria 1580
222 Ga0209646_1000001 3300025246 Bacteria 3092932
223 Ga0209026_1000001 3300025250 Bacteria 1228671
224 Ga0209148_1000007 3300025254 Bacteria 1592273
225 Ga0209759_1000001 3300025256 Bacteria 2799452
226 Ga0209129_1000024 3300025258 Bacteria 417268
227 Ga0209129_1003815 3300025258 Bacteria 6302
228 Ga0209129_1004573 3300025258 Bacteria 5325
229 Ga0209129_1021504 3300025258 Bacteria 1181
230 Ga0209129_1022465 3300025258 Bacteria 1140
231 Ga0209565_1000098 3300025263 Bacteria 132021
232 Ga0209565_1000128 3300025263 Bacteria 108959
233 Ga0209565_1000574 3300025263 Bacteria 24961
234 Ga0209565_1000633 3300025263 Bacteria 22947
235 Ga0209565_1009387 3300025263 Bacteria 2486
236 Ga0209673_1000008 3300025273 Bacteria 626013
237 Ga0209673_1000058 3300025273 Bacteria 269028
238 Ga0209673_1002178 3300025273 Bacteria 14443
239 Ga0209673_1063161 3300025273 Bacteria 915
240 Ga0209130_1000072 3300025284 Bacteria 175726
241 Ga0209130_1000338 3300025284 Bacteria 53907
242 Ga0209130_1000654 3300025284 Bacteria 31825
243 Ga0209130_1001114 3300025284 Bacteria 19756
244 Ga0209675_1000010 3300025291 Bacteria 541927
245 Ga0209675_1000099 3300025291 Bacteria 128911
246 Ga0209675_1000151 3300025291 Bacteria 91172
247 Ga0209675_1000431 3300025291 Bacteria 33567
248 Ga0209675_1002776 3300025291 Bacteria 8744
249 Ga0209675_1010411 3300025291 Bacteria 3178
250 Ga0209675_1030195 3300025291 Bacteria 1296
251 Ga0209675_1048985 3300025291 Bacteria 881
252 Ga0209676_1000023 3300025292 Bacteria 589732
253 Ga0209676_1000028 3300025292 Bacteria 559745
254 Ga0209676_1002526 3300025292 Bacteria 12760
255 Ga0209676_1005235 3300025292 Bacteria 6871
256 Ga0209676_1005287 3300025292 Bacteria 6807
257 Ga0209676_1005294 3300025292 Bacteria 6800
258 Ga0209676_1051699 3300025292 Bacteria 1076
259 Ga0209676_1065223 3300025292 Bacteria 888
260 Ga0209676_1070787 3300025292 Bacteria 830
261 Ga0209025_1000685 3300025294 Bacteria 58093
262 Ga0209025_1001904 3300025294 Bacteria 24327
263 Ga0209025_1002647 3300025294 Bacteria 18311
264 Ga0209025_1005469 3300025294 Bacteria 10341
265 Ga0209025_1006074 3300025294 Bacteria 9549
266 Ga0209025_1006765 3300025294 Bacteria 8792
267 Ga0209025_1028371 3300025294 Bacteria 2745
268 Ga0209025_1039025 3300025294 Bacteria 2078
269 Ga0209025_1046707 3300025294 Bacteria 1777
270 Ga0209025_1080782 3300025294 Bacteria 1104
271 Ga0209564_1000209 3300025295 Bacteria 133651
272 Ga0209564_1002281 3300025295 Bacteria 15652
273 Ga0209564_1002522 3300025295 Bacteria 14144
274 Ga0209564_1003391 3300025295 Bacteria 10974
275 Ga0209758_1000049 3300025297 Bacteria 345104
276 Ga0209758_1005721 3300025297 Bacteria 9380
277 Ga0209758_1013703 3300025297 Bacteria 4392
278 Ga0209758_1034441 3300025297 Bacteria 2015
279 Ga0209050_1000022 3300025298 Bacteria 565239
280 Ga0209050_1000072 3300025298 Bacteria 293619
281 Ga0209050_1000721 3300025298 Bacteria 48376
282 Ga0209050_1000770 3300025298 Bacteria 46024
283 Ga0209050_1000927 3300025298 Bacteria 38487
284 Ga0209050_1006011 3300025298 Bacteria 7356
285 Ga0209050_1029036 3300025298 Bacteria 1779
286 Ga0209050_1036125 3300025298 Bacteria 1448
287 Ga0209050_1051191 3300025298 Bacteria 1043
288 Ga0209256_1000001 3300025299 Bacteria 2166974
289 Ga0209256_1000088 3300025299 Bacteria 217236
290 Ga0209256_1004126 3300025299 Bacteria 9396
291 Ga0209256_1019740 3300025299 Bacteria 2132
292 Ga0209256_1029604 3300025299 Bacteria 1523
293 Ga0207426_1000038 3300025302 Bacteria 441522
294 Ga0207426_1000053 3300025302 Bacteria 384818
295 Ga0207426_1000319 3300025302 Bacteria 92696
296 Ga0207426_1005271 3300025302 Bacteria 5953
297 Ga0209051_1000013 3300025303 Bacteria 565239
298 Ga0209051_1000015 3300025303 Bacteria 546798
299 Ga0209051_1000056 3300025303 Bacteria 271616
300 Ga0209051_1000424 3300025303 Bacteria 57966
301 Ga0209051_1000545 3300025303 Bacteria 46076
302 Ga0209051_1006138 3300025303 Bacteria 6826
303 Ga0209051_1011319 3300025303 Bacteria 4413
304 Ga0209051_1023463 3300025303 Bacteria 2564
305 Ga0209051_1053008 3300025303 Bacteria 1336
306 Ga0209051_1095202 3300025303 Bacteria 816
307 Ga0209257_1000042 3300025304 Bacteria 537149
308 Ga0209257_1003278 3300025304 Bacteria 14122
309 Ga0209257_1003691 3300025304 Bacteria 12748
310 Ga0209257_1011169 3300025304 Bacteria 4373
311 Ga0209257_1017545 3300025304 Bacteria 2811
312 Ga0207655_1013363 3300025728 Bacteria 4721
313 Ga0207655_1078064 3300025728 Bacteria 1205
314 Ga0207710_10016403 3300025900 Bacteria 3133
315 Ga0207647_10101997 3300025904 Unclassified 1702
316 Ga0207695_10820715 3300025913 Bacteria 810
317 Ga0207671_10085604 3300025914 Bacteria 2369
318 Ga0207681_10000850 3300025923 Bacteria 20074
319 Ga0207681_10007397 3300025923 Bacteria 6725
320 Ga0207650_10000003 3300025925 Bacteria 1123235
321 Ga0207659_10522801 3300025926 Bacteria 1006
322 Ga0207644_10000036 3300025931 Bacteria 128383
323 Ga0207644_10672711 3300025931 Bacteria 862
324 Ga0207706_10034754 3300025933 Bacteria 4484
325 Ga0207686_10167190 3300025934 Bacteria 1547
326 Ga0207709_10000958 3300025935 Bacteria 21596
327 Ga0207709_10001025 3300025935 Bacteria 20674
328 Ga0207709_10001786 3300025935 Bacteria 14415
329 Ga0207709_10002735 3300025935 Bacteria 10877
330 Ga0207669_10173859 3300025937 Bacteria 1536
331 Ga0207704_10019166 3300025938 Bacteria 3589
332 Ga0207691_10148675 3300025940 Bacteria 2061
333 Ga0207711_10011123 3300025941 Bacteria 7480
334 Ga0207661_10689385 3300025944 Bacteria 939
335 Ga0207679_10060887 3300025945 Bacteria 2807
336 Ga0207667_10301778 3300025949 Bacteria 1636
337 Ga0207651_10059515 3300025960 Bacteria 2647
338 Ga0207640_10508665 3300025981 Bacteria 1004
339 Ga0207658_10000007 3300025986 Bacteria 329651
340 Ga0207639_10047011 3300026041 Bacteria 3259
341 Ga0207639_10464946 3300026041 Bacteria 1151
342 Ga0207639_10665601 3300026041 Bacteria 964
343 Ga0207678_10223754 3300026067 Unclassified 1611
344 Ga0207678_10277557 3300026067 Bacteria 1438
345 Ga0207641_10018000 3300026088 Bacteria 5789
346 Ga0207641_10050928 3300026088 Bacteria 3505
347 Ga0207641_10081093 3300026088 Bacteria 2817
348 Ga0207641_10395133 3300026088 Bacteria 1326
349 Ga0207648_10000176 3300026089 Bacteria 66707
350 Ga0207648_10070177 3300026089 Bacteria 3054
351 Ga0207648_10200231 3300026089 Bacteria 1771
352 Ga0207676_10000003 3300026095 Bacteria 1123235
353 Ga0207674_10276512 3300026116 Unclassified 1627
354 Ga0207683_10140105 3300026121 Bacteria 2179
355 Ga0207683_10232501 3300026121 Bacteria 1681
356 Ga0207683_10363461 3300026121 Bacteria 1329
357 Ga0207698_10018899 3300026142 Bacteria 4706
358 Ga0209281_1007353 3300027111 Bacteria 2770
359 Ga0209282_1001024 3300027666 Bacteria 14706
360 Ga0209282_1102538 3300027666 Bacteria 1470
361 Ga0209813_10009313 3300027866 Bacteria 2508
362 Ga0209974_10125776 3300027876 Bacteria 911
363 Ga0207428_10265812 3300027907 Bacteria 1277
364 Ga0268266_10018918 3300028379 Bacteria 5868
365 Ga0268266_10024646 3300028379 Bacteria 5118
366 Ga0268266_10202406 3300028379 Bacteria 1817
367 Ga0268266_10537199 3300028379 Bacteria 1119
368 Ga0268265_10000387 3300028380 Bacteria 46961
369 Ga0268265_10020224 3300028380 Bacteria 4644
370 Ga0268264_10000009 3300028381 Bacteria 724972
371 Ga0268264_10807451 3300028381 Bacteria 938
372 Ga0307515_10000011 3300028794 Bacteria 633903
373 Ga0307515_10001854 3300028794 Bacteria 47116
374 Ga0307515_10017584 3300028794 Bacteria 13005
375 Ga0307515_10020861 3300028794 Bacteria 11649
376 Ga0307515_10041425 3300028794 Bacteria 7241
377 Ga0307515_10231820 3300028794 Bacteria 1637
378 Ga0307512_10046777 3300030522 Bacteria 3524
379 Ga0307512_10097717 3300030522 Bacteria 2007
380 Ga0307512_10131821 3300030522 Bacteria 1564
381 Ga0316177_1219794 3300030731 Bacteria 1063
382 Ga0316176_1008742 3300030732 Bacteria 1327
383 Ga0316183_1012351 3300030742 Bacteria 1705
384 Ga0316183_1181937 3300030742 Bacteria 5794
385 Ga0316181_1015975 3300030744 Bacteria 2330
386 Ga0316182_1239831 3300030745 Bacteria 1874
387 Ga0316182_1411386 3300030745 Bacteria 2062
388 Ga0265329_10052169 3300031242 Bacteria 1301
389 Ga0265331_10002484 3300031250 Bacteria 12461
390 Ga0265331_10014771 3300031250 Bacteria 4146
391 Ga0265331_10073850 3300031250 Bacteria 1592
392 Ga0265327_10000027 3300031251 Bacteria 364541
393 Ga0265327_10000742 3300031251 Bacteria 50671
394 Ga0265327_10000789 3300031251 Bacteria 48791
395 Ga0265327_10002682 3300031251 Bacteria 18266
396 Ga0265327_10008485 3300031251 Bacteria 7640
397 Ga0265327_10022404 3300031251 Bacteria 3778
398 Ga0265327_10078488 3300031251 Bacteria 1636
399 Ga0265316_10001311 3300031344 Bacteria 26774
400 Ga0307513_10000029 3300031456 Bacteria 191823
401 Ga0307513_10000038 3300031456 Bacteria 174780
402 Ga0307513_10239419 3300031456 Bacteria 1621
403 Ga0307513_10428596 3300031456 Bacteria 1051
404 Ga0307509_10000063 3300031507 Bacteria 143708
405 Ga0307408_100000005 3300031548 Bacteria 529098
406 Ga0307408_100000262 3300031548 Bacteria 53492
407 Ga0307408_100004302 3300031548 Bacteria 9664
408 Ga0307408_100011106 3300031548 Bacteria 5949
409 Ga0307408_100200325 3300031548 Bacteria 1615
410 Ga0307514_10004647 3300031649 Bacteria 12588
411 Ga0307514_10010207 3300031649 Bacteria 7861
412 Ga0316575_10009300 3300031665 Bacteria 3597
413 Ga0265314_10009072 3300031711 Bacteria 8449
414 Ga0316576_10062561 3300031727 Bacteria 2730
415 Ga0316576_10202702 3300031727 Bacteria 1494
416 Ga0316578_10035558 3300031728 Bacteria 2864
417 Ga0316578_10046304 3300031728 Bacteria 2535
418 Ga0307516_10005097 3300031730 Bacteria 15875
419 Ga0307516_10136191 3300031730 Bacteria 2230
420 Ga0307405_10203538 3300031731 Bacteria 1439
421 Ga0307405_10407120 3300031731 Bacteria 1066
422 Ga0316577_10031404 3300031733 Bacteria 2968
423 Ga0316577_10033920 3300031733 Bacteria 2852
424 Ga0316577_10123696 3300031733 Bacteria 1454
425 Ga0307413_10362740 3300031824 Bacteria 1122
426 Ga0307410_10155565 3300031852 Bacteria 1707
427 Ga0307406_10000030 3300031901 Bacteria 87564
428 Ga0307406_10012286 3300031901 Bacteria 4882
429 Ga0307406_10958401 3300031901 Bacteria 732
430 Ga0307412_10048788 3300031911 Bacteria 2786
431 Ga0307412_10081734 3300031911 Bacteria 2235
432 Ga0307412_10139740 3300031911 Bacteria 1772
433 Ga0307412_10471827 3300031911 Bacteria 1038
434 Ga0307409_100422127 3300031995 Bacteria 1280
435 Ga0307416_100033193 3300032002 Bacteria 3910
436 Ga0307416_100186040 3300032002 Bacteria 1952
437 Ga0307416_100551188 3300032002 Bacteria 1226
438 Ga0307414_10341241 3300032004 Bacteria 1282
439 Ga0307414_10534930 3300032004 Bacteria 1042
440 Ga0307411_10019929 3300032005 Bacteria 3887
441 Ga0307411_10105394 3300032005 Bacteria 2004
442 Ga0307411_10426992 3300032005 Bacteria 1102
443 Ga0307415_100201816 3300032126 Bacteria 1579
444 Ga0316580_10023039 3300032139 Bacteria 1923
445 Ga0316593_10004055 3300032168 Bacteria 3712
446 Ga0316593_10011174 3300032168 Bacteria 2601
447 Ga0316593_10025497 3300032168 Bacteria 1883
448 Ga0307510_10017213 3300033180 Bacteria 8527
449 Ga0316587_1038100 3300033529 Bacteria 864
450 Ga0373934_0000524 3300035086 Bacteria 13506
451 Ga0373936_0003119 3300035113 Bacteria 6206
452 Ga0373939_0101516 3300035114 Bacteria 988
453 Ga0373954_0006395 3300035118 Bacteria 5137
454 Ga0373956_0000135 3300035119 Bacteria 26321
455 Ga0373957_0007330 3300035120 Bacteria 3527
456 Ga0373955_0012069 3300035172 Bacteria 4143
457 Ga0373962_0039825 3300035242 Bacteria 1320
458 Ga0316574_0005184 3300035398 Bacteria 6932
459 Ga0316574_0081505 3300035398 Bacteria 2055
460 Ga0316574_0394069 3300035398 Bacteria 872
461 Ga0373931_0043621 3300035691 Bacteria 2363
462 Ga0373935_0411724 3300035692 Bacteria 972
463 Ga0373933_0008376 3300035724 Bacteria 5647
464 Ga0373933_0722555 3300035724 Bacteria 655
465 Ga0373937_0090127 3300036401 Bacteria 2840
466 Ga0373937_0355919 3300036401 Bacteria 1387
467 Ga0316582_0001520 3300036647 Bacteria 10257
468 Ga0316582_0096469 3300036647 Bacteria 1953
469 Ga0316582_0099818 3300036647 Bacteria 1921
470 Ga0316582_0471619 3300036647 Bacteria 865
471 Ga0316584_0062563 3300036712 Bacteria 2787
472 Ga0373925_0995375 3300037068 Bacteria 690
473 Ga0395899_0031345 3300037312 Bacteria 3995
474 Ga0395900_0098013 3300037418 Bacteria 3012
475 Ga0395905_0004208 3300037471 Bacteria 15056
476 Ga0395905_0103949 3300037471 Bacteria 2666
477 Ga0400483_018941 3300039062 Bacteria 3903
478 Ga0400483_028483 3300039062 Bacteria 154566
479 Ga0400483_151143 3300039062 Bacteria 268199
480 Ga0400483_170726 3300039062 Bacteria 3488
481 Ga0400483_281087 3300039062 Bacteria 7542
482 Ga0436365_1300655 3300039437 Bacteria 1328
483 Ga0436361_0293841 3300039447 Bacteria 85519
484 Ga0436361_0675274 3300039447 Bacteria 5014
485 Ga0436361_0921278 3300039447 Bacteria 22626
486 Ga0436361_1160515 3300039447 Bacteria 859
487 Ga0439436_0003328 3300041404 Bacteria 4875
488 Ga0439436_0035644 3300041404 Bacteria 1437
489 Ga0439439_0086280 3300041406 Bacteria 853
490 Ga0439447_016801 3300041407 Bacteria 2002
491 Ga0439466_0045545 3300041411 Bacteria 1450
492 Ga0439466_0065511 3300041411 Bacteria 1164
493 Ga0439465_0004991 3300041413 Bacteria 4262
494 Ga0451789_0802377 3300041443 Bacteria 1269
495 Ga0451791_1176561 3300041451 Bacteria 1268
496 Ga0451798_0222356 3300041458 Bacteria 1307
497 Ga0451843_1675037 3300041509 Bacteria 797
498 Ga0439431_0002005 3300041997 Bacteria 4508
499 Ga0439431_0025673 3300041997 Bacteria 1440
500 Ga0439433_0002498 3300041999 Bacteria 3903
501 Ga0439442_002272 3300042002 Bacteria 3775
502 Ga0439442_031416 3300042002 Bacteria 1109
503 Ga0439445_0000954 3300042004 Bacteria 6155
504 Ga0439445_0061969 3300042004 Bacteria 1024
505 Ga0439432_001040 3300042006 Bacteria 10528
506 Ga0439432_015392 3300042006 Bacteria 2582
507 Ga0439432_044439 3300042006 Bacteria 1399
508 Ga0439449_0004240 3300042007 Bacteria 5542
509 Ga0439449_0011935 3300042007 Bacteria 3265
510 Ga0439449_0051822 3300042007 Bacteria 1518
511 Ga0439449_0078829 3300042007 Bacteria 1214
512 Ga0439452_040743 3300042010 Bacteria 1095
513 Ga0439457_015663 3300042014 Bacteria 1692
514 Ga0439457_062022 3300042014 Bacteria 847
515 Ga0439462_0006257 3300042015 Bacteria 2954
516 Ga0439462_0008185 3300042015 Bacteria 2631
517 Ga0439462_0009279 3300042015 Bacteria 2488
518 Ga0450911_015639 3300042115 Bacteria 1004
519 Ga0450891_000371 3300042129 Bacteria 4708
520 Ga0450898_022768 3300042134 Bacteria 1111
521 Ga0450889_015211 3300042144 Bacteria 825
522 Ga0450910_013516 3300042147 Bacteria 1188
523 Ga0439446_0082320 3300042156 Bacteria 998
524 Ga0450908_004295 3300042184 Bacteria 2749
525 Ga0450908_034319 3300042184 Bacteria 879
526 Ga0439434_0007314 3300042435 Bacteria 3236
527 Ga0439434_0009318 3300042435 Bacteria 2884
528 Ga0439434_0018453 3300042435 Bacteria 2089
529 Ga0450918_002840 3300042531 Bacteria 3251
530 Ga0451577_0000096 3300042876 Bacteria 195129
531 Ga0451577_0130851 3300042876 Bacteria 2251
532 Ga0466969_0006652 3300044656 Bacteria 6141
533 Ga0466969_0011632 3300044656 Bacteria 4655
534 Ga0453683_0304766 3300044673 Unclassified 1019
535 Ga0466965_0001255 3300044683 Bacteria 10064
536 Ga0466965_0005697 3300044683 Bacteria 5618
537 Ga0466966_0011833 3300044684 Bacteria 5778
538 Ga0466966_0051807 3300044684 Bacteria 2609
539 Ga0466961_0001619 3300044693 Bacteria 13959
540 Ga0466961_0015034 3300044693 Bacteria 4970
541 Ga0453684_0003157 3300044712 Bacteria 37940
542 Ga0453684_0035801 3300044712 Bacteria 6854
543 Ga0453684_0041490 3300044712 Bacteria 6222
544 Ga0466968_0003548 3300044735 Bacteria 5773
545 Ga0466970_0355433 3300044765 Bacteria 832
546 Ga0466960_0001088 3300044901 Bacteria 9760
547 Ga0466959_0030495 3300045049 Bacteria 3992
548 Ga0451576_0022898 3300045051 Bacteria 6769
549 Ga0451576_0307668 3300045051 Bacteria 1658
550 Ga0451576_0310553 3300045051 Bacteria 1650
551 Ga0451576_0655865 3300045051 Bacteria 1103
552 Ga0495627_025534 3300046453 Bacteria 1915
553 Ga0495627_034041 3300046453 Bacteria 1594
554 Ga0495592_0006972 3300046454 Bacteria 8442
555 Ga0495592_0010390 3300046454 Bacteria 7022
556 Ga0495592_0423909 3300046454 Bacteria 838
557 Ga0495590_0016128 3300046457 Bacteria 2701
558 Ga0495638_0150545 3300046460 Bacteria 1350
559 Ga0495651_0000274 3300046462 Bacteria 40100
560 Ga0495639_0009801 3300046475 Bacteria 4112
561 Ga0495583_0126900 3300046506 Bacteria 1070
562 Ga0495610_0025793 3300046512 Bacteria 3148
563 Ga0495610_0252387 3300046512 Bacteria 698
564 Ga0495616_0008804 3300046513 Bacteria 5944
565 Ga0495620_0054020 3300046515 Bacteria 1699
566 Ga0495628_0009437 3300046516 Bacteria 8329
567 Ga0495628_0029940 3300046516 Bacteria 4410
568 Ga0495630_0235684 3300046517 Bacteria 1398
569 Ga0495630_0653360 3300046517 Bacteria 805
570 Ga0495630_0763021 3300046517 Bacteria 739
571 Ga0495631_0004715 3300046518 Bacteria 7206
572 Ga0495632_0005292 3300046519 Bacteria 8572
573 Ga0495632_0009066 3300046519 Bacteria 6026
574 Ga0495637_0036167 3300046520 Bacteria 2152
575 Ga0495637_0097975 3300046520 Bacteria 1149
576 Ga0495643_0052018 3300046522 Bacteria 2201
577 Ga0495643_0065254 3300046522 Bacteria 1922
578 Ga0495642_0072470 3300046528 Bacteria 1442
579 Ga0495652_0002976 3300046529 Bacteria 17031
580 Ga0495652_0105783 3300046529 Bacteria 2273
581 Ga0495587_0136318 3300046536 Bacteria 1402
582 Ga0495621_0039258 3300046539 Bacteria 1655
583 Ga0495621_0098877 3300046539 Bacteria 1108
584 Ga0495597_0173213 3300046542 Bacteria 875
585 Ga0495645_0000247 3300046543 Bacteria 39450
586 Ga0495633_0128256 3300046558 Bacteria 1174
587 Ga0495667_0043265 3300046559 Bacteria 2985
588 Ga0495656_0000646 3300046615 Bacteria 11165
589 Ga0495625_0000950 3300046660 Bacteria 38751
590 Ga0495625_0001672 3300046660 Bacteria 25960
591 Ga0495625_0180559 3300046660 Bacteria 1404
592 Ga0495659_0115977 3300046664 Bacteria 1050
593 Ga0495588_0020755 3300046674 Bacteria 3232
594 Ga0495599_0000345 3300046678 Bacteria 27538
595 Ga0495599_0003076 3300046678 Bacteria 9713
596 Ga0495599_0230269 3300046678 Bacteria 1131
597 Ga0495646_0080835 3300046680 Bacteria 1895
598 Ga0495658_0174951 3300046683 Bacteria 1330
599 Ga0495658_0288275 3300046683 Bacteria 1037
600 Ga0495670_0302483 3300046691 Bacteria 857
601 Ga0495671_0005567 3300046692 Bacteria 7360
602 Ga0495671_0136312 3300046692 Bacteria 1197
603 Ga0495660_0126290 3300046810 Bacteria 1288
604 Ga0495660_0128943 3300046810 Bacteria 1271
605 Ga0495676_0073681 3300047321 Bacteria 2617
606 Ga0495680_0702176 3300047322 Bacteria 668
607 Ga0495681_0065193 3300047470 Bacteria 1666
608 Ga0495686_0254562 3300047472 Bacteria 985
609 Ga0495593_0028693 3300047673 Bacteria 3055
610 Ga0495593_0087345 3300047673 Bacteria 1608
611 Ga0495614_0035030 3300048089 Bacteria 2157
612 Ga0496100_0141394 3300048903 Bacteria 1706
613 Ga0496101_0010666 3300048904 Bacteria 6071
614 Ga0496101_0082422 3300048904 Bacteria 2380
615 Ga0496101_0538268 3300048904 Bacteria 923
616 Ga0496101_0760937 3300048904 Bacteria 764
617 Ga0496102_0088537 3300048905 Bacteria 2862
618 Ga0496102_0187708 3300048905 Bacteria 1948
619 Ga0496104_0108684 3300048907 Bacteria 2658
620 Ga0496105_0004053 3300048908 Bacteria 10967
621 Ga0496106_0009081 3300048909 Bacteria 7347
622 Ga0496108_0448977 3300048911 Bacteria 1126
623 Ga0496111_0017568 3300048914 Bacteria 4945
624 Ga0496112_0331441 3300048915 Bacteria 1466
625 Ga0496114_0081997 3300048917 Bacteria 2725
626 Ga0496116_0012865 3300048919 Bacteria 6798
627 Ga0496116_0025714 3300048919 Bacteria 4322
628 Ga0496116_0045013 3300048919 Bacteria 2991
629 Ga0496116_0111479 3300048919 Bacteria 1607
630 Ga0496116_0146834 3300048919 Bacteria 1317
631 Ga0496116_0217993 3300048919 Bacteria 981
632 Ga0496116_0219521 3300048919 Bacteria 976
633 Ga0496117_0015225 3300048920 Bacteria 6575
634 Ga0496117_0149709 3300048920 Bacteria 1383
635 Ga0496117_0252043 3300048920 Bacteria 962
636 Ga0496118_0025618 3300048921 Bacteria 5049
637 Ga0496118_0082736 3300048921 Bacteria 2247
638 Ga0496119_0063738 3300048922 Bacteria 2191
639 Ga0496121_0211697 3300048924 Bacteria 1372
640 Ga0496121_0277381 3300048924 Bacteria 1149
641 Ga0496122_0000612 3300048925 Bacteria 73307
642 Ga0496122_0003234 3300048925 Bacteria 21644
643 Ga0496122_0191324 3300048925 Bacteria 1207
644 Ga0496123_0000274 3300048926 Bacteria 101783
645 Ga0496123_0070033 3300048926 Bacteria 2198
646 Ga0496123_0265468 3300048926 Bacteria 838
647 Ga0496124_0021958 3300048927 Bacteria 5869
648 Ga0496124_0058848 3300048927 Bacteria 3230
649 Ga0496124_0136280 3300048927 Bacteria 1943
650 Ga0496124_0241630 3300048927 Bacteria 1342
651 Ga0496124_0589494 3300048927 Bacteria 725
652 Ga0496125_0100067 3300048928 Bacteria 2138
653 Ga0496125_0189991 3300048928 Bacteria 1357
654 Ga0496126_0079885 3300048929 Bacteria 2895
655 Ga0496126_0148644 3300048929 Bacteria 2010
656 Ga0495682_0090024 3300049460 Bacteria 1102
657 Ga0501033_0466963 3300049570 Bacteria 875
658 Ga0501034_0250653 3300049571 Bacteria 1715
659 Ga0501047_0047097 3300049581 Bacteria 4166
660 Ga0501048_0093101 3300049582 Bacteria 2126
661 Ga0501198_019489 3300049649 Bacteria 1069
662 Ga0501208_002350 3300049655 Bacteria 1966
663 Ga0501216_031951 3300049660 Unclassified 976
664 Ga0501236_027983 3300049670 Bacteria 876
665 Ga0501249_005254 3300049679 Bacteria 2646
666 Ga0501225_0009291 3300049705 Bacteria 2802
667 Ga0501262_006502 3300049759 Bacteria 1399
668 Ga0501279_033202 3300049775 Bacteria 771
669 Ga0501035_0009715 3300049822 Bacteria 8949
670 Ga0501035_0033897 3300049822 Bacteria 4642
671 Ga0501044_0000086 3300049823 Bacteria 114287
672 Ga0501044_0769439 3300049823 Bacteria 844
673 nmdc:mga03683_3463_c1 3300050489 Bacteria 5097
674 nmdc:mga03683_3784_c1 3300050489 Bacteria 4935
675 nmdc:mga03683_92812_c1 3300050489 Bacteria 1318
676 nmdc:mga03n38_29675_c1 3300050490 Bacteria 2292
677 nmdc:mga03n38_74259_c1 3300050490 Bacteria 1581
678 nmdc:mga00v17_206043_c1 3300050491 Bacteria 1272
679 nmdc:mga00v17_566364_c1 3300050491 Bacteria 734
680 nmdc:mga00v17_8095_c2 3300050491 Bacteria 2510
681 nmdc:mga0yw44_25142_c1 3300050492 Bacteria 3381
682 nmdc:mga0k408_2586_c1 3300050493 Bacteria 9608
683 nmdc:mga0k408_2741_c1 3300050493 Bacteria 9364
684 nmdc:mga0k408_83317_c1 3300050493 Bacteria 1875
685 nmdc:mga06z11_240425_c1 3300050494 Bacteria 1063
686 nmdc:mga06z11_79587_c1 3300050494 Bacteria 1755
687 nmdc:mga07m45_121343_c1 3300050496 Bacteria 1510
688 nmdc:mga07m45_26799_c1 3300050496 Bacteria 3170
689 nmdc:mga07m45_3613_c1 3300050496 Bacteria 7473
690 nmdc:mga07m45_38151_c1 3300050496 Bacteria 2681
691 nmdc:mga07m45_4636_c1 3300050496 Bacteria 6743
692 nmdc:mga07m45_6363_c1 3300050496 Bacteria 4415
693 nmdc:mga09592_805051_c1 3300050508 Bacteria 794
694 nmdc:mga0sz30_111202_c1 3300050516 Bacteria 1201
695 nmdc:mga0sz30_37592_c1 3300050516 Bacteria 2026
696 Ga0495601_0003245 3300053077 Bacteria 9294
697 Ga0495601_0021328 3300053077 Bacteria 3967
698 Ga0500578_0000025 3300053086 Bacteria 151485
699 Ga0500643_025592 3300053087 Bacteria 1859
700 Ga0500644_0005645 3300053088 Bacteria 3163
701 Ga0500644_0046041 3300053088 Bacteria 1472
702 Ga0500646_0036683 3300053090 Bacteria 1366
703 Ga0500651_0000347 3300053093 Bacteria 26028
704 Ga0500651_0126864 3300053093 Bacteria 1545
705 Ga0500566_0099025 3300053094 Bacteria 1601
706 Ga0500650_0000375 3300053098 Bacteria 10900
707 Ga0500650_0047704 3300053098 Bacteria 1986
708 Ga0500650_0105629 3300053098 Bacteria 1316
709 Ga0500660_143127 3300053100 Bacteria 945
710 Ga0500555_042074 3300053103 Bacteria 1270
711 Ga0500555_110702 3300053103 Bacteria 691
712 Ga0500562_020379 3300053108 Bacteria 1721
713 Ga0500571_013161 3300053110 Bacteria 4605
714 Ga0500593_001062 3300053117 Bacteria 9919
715 Ga0500593_001145 3300053117 Bacteria 9554
716 Ga0500594_0022989 3300053118 Bacteria 1576
717 Ga0500594_0035126 3300053118 Bacteria 1342
718 Ga0500607_017870 3300053121 Bacteria 4035
719 Ga0500621_160234 3300053126 Bacteria 835
720 Ga0500623_151897 3300053127 Bacteria 950
721 Ga0500628_016326 3300053129 Bacteria 1433
722 Ga0500628_023032 3300053129 Bacteria 1280
723 Ga0500642_0115794 3300053130 Bacteria 1252
724 Ga0500652_000177 3300053131 Bacteria 24784
725 Ga0500655_006394 3300053133 Bacteria 2121
726 Ga0500658_0055414 3300053134 Bacteria 1632
727 Ga0500559_0000013 3300053136 Bacteria 163436
728 Ga0500559_0011545 3300053136 Bacteria 3772
729 Ga0500559_0134036 3300053136 Bacteria 1158
730 Ga0500564_004611 3300053138 Bacteria 5541
731 Ga0500568_0011721 3300053139 Bacteria 4052
732 Ga0500574_002285 3300053141 Bacteria 3119
733 Ga0500579_129897 3300053143 Bacteria 1183
734 Ga0500604_0071760 3300053151 Bacteria 1105
735 Ga0500622_0000087 3300053156 Bacteria 98385
736 Ga0500622_0003359 3300053156 Bacteria 10781
737 Ga0500622_0179192 3300053156 Bacteria 980
738 Ga0500622_0207171 3300053156 Bacteria 888
739 Ga0500627_0016227 3300053158 Bacteria 2900
740 Ga0500634_0024759 3300053161 Bacteria 3266
741 Ga0500638_095707 3300053162 Bacteria 1392
742 Ga0500636_0105326 3300053177 Bacteria 1599
743 Ga0500636_0207570 3300053177 Bacteria 1031
744 Ga0500570_042244 3300053724 Bacteria 2372
745 Ga0500645_001112 3300053730 Bacteria 14708
746 Ga0500645_005684 3300053730 Bacteria 4553
747 Ga0500645_019096 3300053730 Bacteria 2135
748 Ga0500565_005334 3300053734 Bacteria 1131
749 Ga0500587_003796 3300053739 Bacteria 2098
750 Ga0500661_053436 3300055283 Bacteria 723
751 Ga0590075_008347 3300059424 Bacteria 2473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0355433 Ga0466970_0355433_267_812 179
2 3300049775 Ga0501279_033202 Ga0501279_033202_10_570 181
3 3300035242 Ga0373962_0039825 Ga0373962_0039825_13_570 185
4 3300014968 Ga0157379_10038359 Ga0157379_100383595 192
5 3300046680 Ga0495646_0080835 Ga0495646_0080835_10_591 193
6 3300047472 Ga0495686_0254562 Ga0495686_0254562_26_607 193
7 3300055283 Ga0500661_053436 Ga0500661_053436_10_591 193
8 iso_pu_bacteria 2980182181 2980186542 193
9 3300031344 Ga0265316_10001311 Ga0265316_1000131126 194
10 3300031711 Ga0265314_10009072 Ga0265314_100090726 194
11 3300053103 Ga0500555_110702 Ga0500555_110702_20_604 194
12 iso_pu_bacteria 2512564039 2512729611 194
13 iso_pu_bacteria 2593339198 2595318736 194
14 iso_pu_bacteria 2857472729 2857478080 194
15 iso_pu_bacteria 2864997549 2865002324 194
16 iso_pu_bacteria 2925326138 2925333583 194
17 iso_pu_bacteria 8054795415 8054801933 194
18 iso_pu_bacteria 2563366752 2563929088 196
19 iso_pu_bacteria 2907202186 2907208264 196
20 3300025292 Ga0209676_1070787 Ga0209676_10707872 197
21 3300048919 Ga0496116_0012865 Ga0496116_0012865_5630_6253 197
22 3300048919 Ga0496116_0219521 Ga0496116_0219521_80_703 197
23 3300048927 Ga0496124_0136280 Ga0496124_0136280_206_829 197
24 iso_pu_bacteria 2971403814 2971410141 197
25 3300028381 Ga0268264_10807451 Ga0268264_108074512 198
26 3300037312 Ga0395899_0031345 Ga0395899_0031345_1461_2084 198
27 3300041406 Ga0439439_0086280 Ga0439439_0086280_99_719 198
28 3300042007 Ga0439449_0078829 Ga0439449_0078829_261_881 198
29 3300042015 Ga0439462_0009279 Ga0439462_0009279_586_1206 198
30 3300044656 Ga0466969_0011632 Ga0466969_0011632_3028_3654 198
31 3300044684 Ga0466966_0051807 Ga0466966_0051807_905_1531 198
32 3300044693 Ga0466961_0015034 Ga0466961_0015034_4155_4781 198
33 3300044735 Ga0466968_0003548 Ga0466968_0003548_2855_3481 198
34 3300045049 Ga0466959_0030495 Ga0466959_0030495_1237_1863 198
35 3300048919 Ga0496116_0111479 Ga0496116_0111479_583_1191 198
36 3300048919 Ga0496116_0146834 Ga0496116_0146834_164_772 198
37 3300048919 Ga0496116_0217993 Ga0496116_0217993_157_771 198
38 3300048925 Ga0496122_0003234 Ga0496122_0003234_8850_9455 198
39 3300049655 Ga0501208_002350 Ga0501208_002350_122_736 198
40 3300005293 Ga0065715_10219907 Ga0065715_102199071 200
41 3300009147 Ga0114129_10025543 Ga0114129_100255435 200
42 3300044712 Ga0453684_0035801 Ga0453684_0035801_2969_3595 200
43 3300049660 Ga0501216_031951 Ga0501216_031951_169_795 200
44 3300042144 Ga0450889_015211 Ga0450889_015211_99_728 201
45 3300046457 Ga0495590_0016128 Ga0495590_0016128_245_868 201
46 3300046542 Ga0495597_0173213 Ga0495597_0173213_66_689 201
47 3300046810 Ga0495660_0128943 Ga0495660_0128943_600_1223 201
48 3300047470 Ga0495681_0065193 Ga0495681_0065193_907_1530 201
49 3300048924 Ga0496121_0277381 Ga0496121_0277381_472_1095 201
50 3300006946 Ga0079104_1009456 Ga0079104_10094562 202
51 3300044673 Ga0453683_0304766 Ga0453683_0304766_99_713 202
52 3300045051 Ga0451576_0022898 Ga0451576_0022898_4235_4849 202
53 3300045051 Ga0451576_0310553 Ga0451576_0310553_665_1279 202
54 3300046517 Ga0495630_0763021 Ga0495630_0763021_16_624 202
55 3300005329 Ga0070683_100147324 Ga0070683_1001473243 203
56 3300005347 Ga0070668_100250619 Ga0070668_1002506191 203
57 3300005355 Ga0070671_100715368 Ga0070671_1007153681 203
58 3300005367 Ga0070667_100086398 Ga0070667_1000863983 203
59 3300005535 Ga0070684_100308855 Ga0070684_1003088552 203
60 3300005577 Ga0068857_100137185 Ga0068857_1001371853 203
61 3300005617 Ga0068859_100007672 Ga0068859_1000076725 203
62 3300005841 Ga0068863_100124737 Ga0068863_1001247372 203
63 3300006881 Ga0068865_100022089 Ga0068865_1000220894 203
64 3300006931 Ga0097620_100007672 Ga0097620_1000076728 203
65 3300013297 Ga0157378_10033515 Ga0157378_100335154 203
66 3300013306 Ga0163162_10020264 Ga0163162_100202646 203
67 3300013307 Ga0157372_10306878 Ga0157372_103068781 203
68 3300013307 Ga0157372_10979357 Ga0157372_109793572 203
69 3300013308 Ga0157375_10011112 Ga0157375_100111125 203
70 3300014969 Ga0157376_10065464 Ga0157376_100654644 203
71 3300025904 Ga0207647_10101997 Ga0207647_101019971 203
72 3300025931 Ga0207644_10672711 Ga0207644_106727111 203
73 3300025938 Ga0207704_10019166 Ga0207704_100191664 203
74 3300025944 Ga0207661_10689385 Ga0207661_106893851 203
75 3300026067 Ga0207678_10223754 Ga0207678_102237542 203
76 3300026088 Ga0207641_10081093 Ga0207641_100810933 203
77 3300026116 Ga0207674_10276512 Ga0207674_102765122 203
78 3300005364 Ga0070673_100648749 Ga0070673_1006487491 204
79 3300005456 Ga0070678_100188811 Ga0070678_1001888113 204
80 3300006177 Ga0075362_10003058 Ga0075362_100030582 204
81 3300006195 Ga0075366_10018256 Ga0075366_100182564 204
82 3300006353 Ga0075370_10002475 Ga0075370_100024752 204
83 3300009147 Ga0114129_11226688 Ga0114129_112266882 204
84 3300025937 Ga0207669_10173859 Ga0207669_101738592 204
85 3300025940 Ga0207691_10148675 Ga0207691_101486752 204
86 3300025960 Ga0207651_10059515 Ga0207651_100595152 204
87 3300025981 Ga0207640_10508665 Ga0207640_105086652 204
88 3300026089 Ga0207648_10070177 Ga0207648_100701772 204
89 3300026121 Ga0207683_10232501 Ga0207683_102325013 204
90 3300028379 Ga0268266_10018918 Ga0268266_100189183 204
91 3300028794 Ga0307515_10001854 Ga0307515_100018544 204
92 3300032002 Ga0307416_100186040 Ga0307416_1001860402 204
93 3300035724 Ga0373933_0722555 Ga0373933_0722555_14_637 204
94 3300036401 Ga0373937_0355919 Ga0373937_0355919_636_1259 204
95 3300041451 Ga0451791_1176561 Ga0451791_1176561_134_748 204
96 3300041997 Ga0439431_0025673 Ga0439431_0025673_551_1165 204
97 3300042004 Ga0439445_0061969 Ga0439445_0061969_197_811 204
98 3300042006 Ga0439432_015392 Ga0439432_015392_440_1054 204
99 3300042006 Ga0439432_044439 Ga0439432_044439_76_690 204
100 3300042007 Ga0439449_0004240 Ga0439449_0004240_2933_3547 204
101 3300042010 Ga0439452_040743 Ga0439452_040743_274_888 204
102 3300042015 Ga0439462_0008185 Ga0439462_0008185_1744_2358 204
103 3300042115 Ga0450911_015639 Ga0450911_015639_132_746 204
104 3300042184 Ga0450908_004295 Ga0450908_004295_1711_2325 204
105 3300042435 Ga0439434_0009318 Ga0439434_0009318_461_1075 204
106 3300046539 Ga0495621_0039258 Ga0495621_0039258_658_1272 204
107 3300046615 Ga0495656_0000646 Ga0495656_0000646_6396_7010 204
108 3300050489 nmdc:mga03683_3784_c1 nmdc:mga03683_3784_c1_3937_4551 204
109 3300050496 nmdc:mga07m45_6363_c1 nmdc:mga07m45_6363_c1_3501_4115 204
110 iso_pu_bacteria 2687453129 2687580754 204
111 iso_pu_bacteria 2510065053 2510283075 205
112 iso_pu_bacteria 2510065055 2510293749 205
113 iso_pu_bacteria 2510065058 2510310645 205
114 iso_pu_bacteria 2773857672 2774131227 205
115 iso_pu_bacteria 2917832318 2917837022 205
116 iso_pu_bacteria 2919125081 2919127159 205
117 iso_pu_bacteria 2974298342 2974302706 205
118 iso_pu_bacteria 2984499530 2984499709 205
119 iso_pu_bacteria 2984504281 2984506089 205
120 iso_pu_bacteria 8016728285 8016731935 205
121 iso_pu_bacteria 8057160832 8057163529 205
122 iso_pu_bacteria 2846033681 2846037559 206
123 iso_pu_bacteria 2846037992 2846041672 206
124 iso_pu_bacteria 2989392574 2989393697 206
125 iso_pu_bacteria 2998344455 2998345334 207
126 3300045051 Ga0451576_0307668 Ga0451576_0307668_438_1064 208
127 3300009011 Ga0105251_10006725 Ga0105251_100067256 209
128 3300013100 Ga0157373_10043497 Ga0157373_100434973 209
129 3300013105 Ga0157369_10003810 Ga0157369_100038106 209
130 3300025728 Ga0207655_1078064 Ga0207655_10780642 209
131 3300046454 Ga0495592_0423909 Ga0495592_0423909_29_658 209
132 3300046516 Ga0495628_0009437 Ga0495628_0009437_6478_7107 209
133 3300046522 Ga0495643_0052018 Ga0495643_0052018_1285_1914 209
134 3300046529 Ga0495652_0002976 Ga0495652_0002976_3415_4044 209
135 3300046543 Ga0495645_0000247 Ga0495645_0000247_24939_25568 209
136 3300046678 Ga0495599_0000345 Ga0495599_0000345_20933_21562 209
137 3300053077 Ga0495601_0021328 Ga0495601_0021328_128_757 209
138 iso_pu_bacteria 2515154122 2515684797 209
139 iso_pu_bacteria 2547132103 2547376147 209
140 iso_pu_bacteria 2843690924 2843695246 209
141 iso_pu_bacteria 2902682994 2902686741 209
142 3300031250 Ga0265331_10014771 Ga0265331_100147713 210
143 3300031251 Ga0265327_10000027 Ga0265327_10000027292 210
144 3300031251 Ga0265327_10078488 Ga0265327_100784882 210
145 3300031727 Ga0316576_10062561 Ga0316576_100625612 210
146 3300035086 Ga0373934_0000524 Ga0373934_0000524_8659_9291 210
147 3300035119 Ga0373956_0000135 Ga0373956_0000135_22006_22638 210
148 3300035120 Ga0373957_0007330 Ga0373957_0007330_2187_2819 210
149 3300035172 Ga0373955_0012069 Ga0373955_0012069_2918_3550 210
150 3300035398 Ga0316574_0394069 Ga0316574_0394069_61_708 210
151 3300035724 Ga0373933_0008376 Ga0373933_0008376_3451_4083 210
152 3300036647 Ga0316582_0001520 Ga0316582_0001520_8228_8875 210
153 3300039437 Ga0436365_1300655 Ga0436365_1300655_555_1199 210
154 3300042876 Ga0451577_0000096 Ga0451577_0000096_82204_82845 210
155 3300044712 Ga0453684_0003157 Ga0453684_0003157_36498_37139 210
156 3300046462 Ga0495651_0000274 Ga0495651_0000274_17994_18626 210
157 3300049571 Ga0501034_0250653 Ga0501034_0250653_664_1302 210
158 3300006946 Ga0079104_1005095 Ga0079104_10050953 211
159 3300021361 Ga0213872_10001257 Ga0213872_1000125718 211
160 3300021361 Ga0213872_10004111 Ga0213872_100041114 211
161 3300027111 Ga0209281_1007353 Ga0209281_10073533 211
162 3300031242 Ga0265329_10052169 Ga0265329_100521692 211
163 3300031250 Ga0265331_10002484 Ga0265331_100024844 211
164 3300031250 Ga0265331_10073850 Ga0265331_100738502 211
165 3300031251 Ga0265327_10000742 Ga0265327_100007428 211
166 3300031251 Ga0265327_10002682 Ga0265327_100026828 211
167 3300031251 Ga0265327_10008485 Ga0265327_100084857 211
168 3300031665 Ga0316575_10009300 Ga0316575_100093002 211
169 3300031727 Ga0316576_10202702 Ga0316576_102027022 211
170 3300031728 Ga0316578_10035558 Ga0316578_100355582 211
171 3300031728 Ga0316578_10046304 Ga0316578_100463042 211
172 3300031733 Ga0316577_10031404 Ga0316577_100314043 211
173 3300031733 Ga0316577_10033920 Ga0316577_100339202 211
174 3300031733 Ga0316577_10123696 Ga0316577_101236962 211
175 3300032139 Ga0316580_10023039 Ga0316580_100230392 211
176 3300032168 Ga0316593_10004055 Ga0316593_100040552 211
177 3300032168 Ga0316593_10011174 Ga0316593_100111743 211
178 3300033529 Ga0316587_1038100 Ga0316587_10381002 211
179 3300035113 Ga0373936_0003119 Ga0373936_0003119_2057_2692 211
180 3300035118 Ga0373954_0006395 Ga0373954_0006395_1395_2030 211
181 3300035398 Ga0316574_0005184 Ga0316574_0005184_1376_2020 211
182 3300035398 Ga0316574_0081505 Ga0316574_0081505_769_1419 211
183 3300035692 Ga0373935_0411724 Ga0373935_0411724_172_807 211
184 3300036647 Ga0316582_0096469 Ga0316582_0096469_747_1397 211
185 3300036647 Ga0316582_0099818 Ga0316582_0099818_987_1637 211
186 3300036647 Ga0316582_0471619 Ga0316582_0471619_161_811 211
187 3300036712 Ga0316584_0062563 Ga0316584_0062563_1630_2280 211
188 3300037068 Ga0373925_0995375 Ga0373925_0995375_34_669 211
189 3300039062 Ga0400483_018941 Ga0400483_018941_1465_2121 211
190 3300039062 Ga0400483_281087 Ga0400483_281087_1704_2360 211
191 3300039447 Ga0436361_0293841 Ga0436361_0293841_60502_61149 211
192 3300039447 Ga0436361_1160515 Ga0436361_1160515_131_772 211
193 3300044656 Ga0466969_0006652 Ga0466969_0006652_4430_5071 211
194 3300044683 Ga0466965_0005697 Ga0466965_0005697_1980_2621 211
195 3300044684 Ga0466966_0011833 Ga0466966_0011833_300_941 211
196 3300044693 Ga0466961_0001619 Ga0466961_0001619_11202_11843 211
197 3300046454 Ga0495592_0010390 Ga0495592_0010390_831_1466 211
198 3300046516 Ga0495628_0029940 Ga0495628_0029940_1886_2521 211
199 3300046517 Ga0495630_0235684 Ga0495630_0235684_38_673 211
200 3300046529 Ga0495652_0105783 Ga0495652_0105783_965_1600 211
201 3300046536 Ga0495587_0136318 Ga0495587_0136318_443_1078 211
202 3300046559 Ga0495667_0043265 Ga0495667_0043265_2009_2644 211
203 3300046678 Ga0495599_0003076 Ga0495599_0003076_8451_9086 211
204 3300046678 Ga0495599_0230269 Ga0495599_0230269_20_655 211
205 3300047322 Ga0495680_0702176 Ga0495680_0702176_19_654 211
206 3300049570 Ga0501033_0466963 Ga0501033_0466963_22_669 211
207 3300049581 Ga0501047_0047097 Ga0501047_0047097_1879_2526 211
208 3300049582 Ga0501048_0093101 Ga0501048_0093101_1322_1969 211
209 3300049649 Ga0501198_019489 Ga0501198_019489_287_937 211
210 3300049822 Ga0501035_0009715 Ga0501035_0009715_6829_7470 211
211 3300049822 Ga0501035_0033897 Ga0501035_0033897_2299_2946 211
212 3300049823 Ga0501044_0000086 Ga0501044_0000086_77068_77715 211
213 3300049823 Ga0501044_0769439 Ga0501044_0769439_148_789 211
214 3300053077 Ga0495601_0003245 Ga0495601_0003245_1844_2479 211
215 3300053098 Ga0500650_0000375 Ga0500650_0000375_9792_10463 211
216 iso_pu_bacteria 2585428057 2587725534 211
217 iso_pu_bacteria 2585428058 2587735002 211
218 iso_pu_bacteria 2588253510 2588290534 211
219 iso_pu_bacteria 2643221592 2643970049 211
220 iso_pu_bacteria 2643221625 2644142977 211
221 iso_pu_bacteria 2643221648 2644271963 211
222 iso_pu_bacteria 2738543013 2739250125 211
223 3300021361 Ga0213872_10093803 Ga0213872_100938032 212
224 3300039062 Ga0400483_028483 Ga0400483_028483_153099_153749 212
225 3300039062 Ga0400483_151143 Ga0400483_151143_123577_124227 212
226 3300039062 Ga0400483_170726 Ga0400483_170726_1625_2275 212
227 3300039447 Ga0436361_0675274 Ga0436361_0675274_480_1124 212
228 3300039447 Ga0436361_0921278 Ga0436361_0921278_6579_7223 212
229 iso_pu_bacteria 2738541276 2738714173 212
230 iso_pu_bacteria 2885192300 2885196982 212
231 3300032168 Ga0316593_10025497 Ga0316593_100254972 213
232 3300042876 Ga0451577_0130851 Ga0451577_0130851_36_677 213
233 3300053136 Ga0500559_0134036 Ga0500559_0134036_241_903 213
234 3300053138 Ga0500564_004611 Ga0500564_004611_743_1402 213
235 iso_pu_bacteria 2511231002 2511244658 213
236 3300003323 rootH1_10031907 rootH1_1003190717 214
237 3300003347 JGI26128J50194_1002153 JGI26128J50194_10021531 214
238 3300005331 Ga0070670_100000010 Ga0070670_10000001032 214
239 3300005335 Ga0070666_10004810 Ga0070666_100048104 214
240 3300005353 Ga0070669_100001528 Ga0070669_1000015288 214
241 3300005355 Ga0070671_100000060 Ga0070671_10000006050 214
242 3300005365 Ga0070688_100006123 Ga0070688_1000061235 214
243 3300005367 Ga0070667_100000124 Ga0070667_10000012484 214
244 3300005367 Ga0070667_100303747 Ga0070667_1003037471 214
245 3300005466 Ga0070685_10000001 Ga0070685_10000001136 214
246 3300005548 Ga0070665_100093104 Ga0070665_1000931042 214
247 3300005617 Ga0068859_100095948 Ga0068859_1000959484 214
248 3300005618 Ga0068864_100000018 Ga0068864_100000018263 214
249 3300005841 Ga0068863_100344398 Ga0068863_1003443982 214
250 3300005841 Ga0068863_100411760 Ga0068863_1004117602 214
251 3300005842 Ga0068858_100308203 Ga0068858_1003082032 214
252 3300005844 Ga0068862_100017911 Ga0068862_1000179116 214
253 3300006931 Ga0097620_100095944 Ga0097620_1000959442 214
254 3300009101 Ga0105247_10080772 Ga0105247_100807723 214
255 3300009177 Ga0105248_10238124 Ga0105248_102381243 214
256 3300009553 Ga0105249_10051700 Ga0105249_100517003 214
257 3300014325 Ga0163163_10000203 Ga0163163_1000020334 214
258 3300014968 Ga0157379_10140216 Ga0157379_101402164 214
259 3300025900 Ga0207710_10016403 Ga0207710_100164034 214
260 3300025923 Ga0207681_10000850 Ga0207681_100008502 214
261 3300025925 Ga0207650_10000003 Ga0207650_10000003469 214
262 3300025931 Ga0207644_10000036 Ga0207644_1000003642 214
263 3300025941 Ga0207711_10011123 Ga0207711_100111236 214
264 3300025986 Ga0207658_10000007 Ga0207658_10000007258 214
265 3300026088 Ga0207641_10018000 Ga0207641_100180005 214
266 3300026088 Ga0207641_10050928 Ga0207641_100509282 214
267 3300026088 Ga0207641_10395133 Ga0207641_103951332 214
268 3300026095 Ga0207676_10000003 Ga0207676_10000003626 214
269 3300028379 Ga0268266_10024646 Ga0268266_100246464 214
270 3300028379 Ga0268266_10202406 Ga0268266_102024063 214
271 3300028380 Ga0268265_10000387 Ga0268265_1000038740 214
272 3300028381 Ga0268264_10000009 Ga0268264_10000009195 214
273 3300031548 Ga0307408_100000005 Ga0307408_100000005217 214
274 3300031548 Ga0307408_100000262 Ga0307408_10000026244 214
275 3300031901 Ga0307406_10000030 Ga0307406_1000003027 214
276 3300031901 Ga0307406_10958401 Ga0307406_109584011 214
277 3300042007 Ga0439449_0051822 Ga0439449_0051822_610_1254 214
278 3300048905 Ga0496102_0088537 Ga0496102_0088537_1240_1887 214
279 3300048927 Ga0496124_0058848 Ga0496124_0058848_428_1087 214
280 iso_pu_bacteria 2643221628 2644162168 214
281 iso_pu_bacteria 2738541277 2738720463 214
282 iso_pu_bacteria 2738541307 2738884035 214
283 iso_pu_bacteria 2738543019 2739279662 214
284 iso_pu_bacteria 2842677519 2842680590 214
285 iso_pu_bacteria 2842733646 2842736408 214
286 iso_pu_bacteria 2842747753 2842748915 214
287 iso_pu_bacteria 2894023352 2894024286 214
288 iso_pu_bacteria 2904449895 2904450765 214
289 iso_pu_bacteria 2904456579 2904459735 214
290 iso_pu_bacteria 2919462493 2919462705 214
291 iso_pu_bacteria 2928084124 2928087009 214
292 iso_pu_bacteria 2929520902 2929521483 214
293 iso_pu_bacteria 2945945610 2945949495 214
294 iso_pu_bacteria 2945972063 2945973541 214
295 3300003784 Ga0055534_1005062 Ga0055534_10050623 215
296 3300005459 Ga0068867_100000063 Ga0068867_1000000632 215
297 3300006048 Ga0075363_100038287 Ga0075363_1000382873 215
298 3300006186 Ga0075369_10152865 Ga0075369_101528652 215
299 3300006353 Ga0075370_10000282 Ga0075370_1000028221 215
300 3300009148 Ga0105243_10002786 Ga0105243_100027864 215
301 3300013306 Ga0163162_10682723 Ga0163162_106827232 215
302 3300014497 Ga0182008_10001806 Ga0182008_100018065 215
303 3300014745 Ga0157377_10000132 Ga0157377_1000013254 215
304 3300017792 Ga0163161_10022442 Ga0163161_100224422 215
305 3300025273 Ga0209673_1063161 Ga0209673_10631611 215
306 3300025291 Ga0209675_1000431 Ga0209675_10004313 215
307 3300025292 Ga0209676_1005235 Ga0209676_10052355 215
308 3300025298 Ga0209050_1000770 Ga0209050_100077015 215
309 3300025298 Ga0209050_1036125 Ga0209050_10361252 215
310 3300025303 Ga0209051_1023463 Ga0209051_10234631 215
311 3300025303 Ga0209051_1095202 Ga0209051_10952022 215
312 3300025304 Ga0209257_1017545 Ga0209257_10175452 215
313 3300025926 Ga0207659_10522801 Ga0207659_105228012 215
314 3300025935 Ga0207709_10001786 Ga0207709_1000178616 215
315 3300026089 Ga0207648_10000176 Ga0207648_1000017660 215
316 3300028794 Ga0307515_10017584 Ga0307515_1001758416 215
317 3300028794 Ga0307515_10020861 Ga0307515_1002086110 215
318 3300028794 Ga0307515_10041425 Ga0307515_100414258 215
319 3300030522 Ga0307512_10046777 Ga0307512_100467772 215
320 3300030522 Ga0307512_10097717 Ga0307512_100977172 215
321 3300031456 Ga0307513_10239419 Ga0307513_102394192 215
322 3300031507 Ga0307509_10000063 Ga0307509_10000063105 215
323 3300031548 Ga0307408_100200325 Ga0307408_1002003252 215
324 3300031649 Ga0307514_10010207 Ga0307514_100102079 215
325 3300031730 Ga0307516_10005097 Ga0307516_100050978 215
326 3300031852 Ga0307410_10155565 Ga0307410_101555652 215
327 3300031911 Ga0307412_10081734 Ga0307412_100817342 215
328 3300032004 Ga0307414_10534930 Ga0307414_105349301 215
329 3300032005 Ga0307411_10019929 Ga0307411_100199294 215
330 3300032126 Ga0307415_100201816 Ga0307415_1002018163 215
331 3300033180 Ga0307510_10017213 Ga0307510_100172139 215
332 3300035114 Ga0373939_0101516 Ga0373939_0101516_194_841 215
333 3300035691 Ga0373931_0043621 Ga0373931_0043621_597_1244 215
334 3300036401 Ga0373937_0090127 Ga0373937_0090127_1331_1978 215
335 3300041443 Ga0451789_0802377 Ga0451789_0802377_331_987 215
336 3300041458 Ga0451798_0222356 Ga0451798_0222356_165_821 215
337 3300042014 Ga0439457_062022 Ga0439457_062022_64_711 215
338 3300042129 Ga0450891_000371 Ga0450891_000371_2300_2968 215
339 3300044712 Ga0453684_0041490 Ga0453684_0041490_4524_5171 215
340 3300045051 Ga0451576_0655865 Ga0451576_0655865_400_1047 215
341 3300046454 Ga0495592_0006972 Ga0495592_0006972_450_1097 215
342 3300046460 Ga0495638_0150545 Ga0495638_0150545_541_1188 215
343 3300046512 Ga0495610_0025793 Ga0495610_0025793_2054_2701 215
344 3300046515 Ga0495620_0054020 Ga0495620_0054020_459_1106 215
345 3300046519 Ga0495632_0005292 Ga0495632_0005292_3783_4439 215
346 3300046519 Ga0495632_0009066 Ga0495632_0009066_470_1117 215
347 3300046522 Ga0495643_0065254 Ga0495643_0065254_18_665 215
348 3300046660 Ga0495625_0001672 Ga0495625_0001672_2317_2964 215
349 3300046660 Ga0495625_0180559 Ga0495625_0180559_338_994 215
350 3300046683 Ga0495658_0174951 Ga0495658_0174951_295_945 215
351 3300046692 Ga0495671_0136312 Ga0495671_0136312_356_1003 215
352 3300048904 Ga0496101_0538268 Ga0496101_0538268_75_722 215
353 3300048904 Ga0496101_0760937 Ga0496101_0760937_60_707 215
354 3300049460 Ga0495682_0090024 Ga0495682_0090024_439_1086 215
355 3300049670 Ga0501236_027983 Ga0501236_027983_56_724 215
356 3300050489 nmdc:mga03683_92812_c1 nmdc:mga03683_92812_c1_239_895 215
357 3300050490 nmdc:mga03n38_74259_c1 nmdc:mga03n38_74259_c1_457_1113 215
358 3300050493 nmdc:mga0k408_83317_c1 nmdc:mga0k408_83317_c1_384_1031 215
359 3300050494 nmdc:mga06z11_79587_c1 nmdc:mga06z11_79587_c1_855_1502 215
360 3300050496 nmdc:mga07m45_121343_c1 nmdc:mga07m45_121343_c1_293_940 215
361 3300050496 nmdc:mga07m45_3613_c1 nmdc:mga07m45_3613_c1_1498_2154 215
362 3300050508 nmdc:mga09592_805051_c1 nmdc:mga09592_805051_c1_122_769 215
363 3300050516 nmdc:mga0sz30_37592_c1 nmdc:mga0sz30_37592_c1_1033_1689 215
364 3300053086 Ga0500578_0000025 Ga0500578_0000025_46761_47417 215
365 3300053088 Ga0500644_0005645 Ga0500644_0005645_2137_2784 215
366 3300053090 Ga0500646_0036683 Ga0500646_0036683_479_1135 215
367 3300053093 Ga0500651_0126864 Ga0500651_0126864_248_895 215
368 3300053098 Ga0500650_0047704 Ga0500650_0047704_440_1096 215
369 3300053108 Ga0500562_020379 Ga0500562_020379_187_843 215
370 3300053118 Ga0500594_0035126 Ga0500594_0035126_282_929 215
371 3300053126 Ga0500621_160234 Ga0500621_160234_57_704 215
372 3300053127 Ga0500623_151897 Ga0500623_151897_14_670 215
373 3300053129 Ga0500628_016326 Ga0500628_016326_497_1153 215
374 3300053130 Ga0500642_0115794 Ga0500642_0115794_430_1086 215
375 3300053131 Ga0500652_000177 Ga0500652_000177_8445_9101 215
376 3300053134 Ga0500658_0055414 Ga0500658_0055414_931_1578 215
377 3300053136 Ga0500559_0000013 Ga0500559_0000013_107750_108397 215
378 3300053143 Ga0500579_129897 Ga0500579_129897_135_791 215
379 3300053151 Ga0500604_0071760 Ga0500604_0071760_354_1001 215
380 3300053156 Ga0500622_0000087 Ga0500622_0000087_97520_98176 215
381 3300053156 Ga0500622_0003359 Ga0500622_0003359_2487_3134 215
382 3300053156 Ga0500622_0179192 Ga0500622_0179192_210_866 215
383 3300053177 Ga0500636_0207570 Ga0500636_0207570_331_978 215
384 3300053724 Ga0500570_042244 Ga0500570_042244_311_967 215
385 3300053739 Ga0500587_003796 Ga0500587_003796_375_1022 215
386 3300059424 Ga0590075_008347 Ga0590075_008347_759_1415 215
387 iso_pu_bacteria 2513020051 2513230082 215
388 iso_pu_bacteria 2599185214 2599620569 215
389 iso_pu_bacteria 2599185226 2599673868 215
390 iso_pu_bacteria 2599185227 2599678815 215
391 iso_pu_bacteria 2599185229 2599690080 215
392 iso_pu_bacteria 2643221672 2644396132 215
393 iso_pu_bacteria 2643221683 2644464956 215
394 iso_pu_bacteria 2818991446 2819601146 215
395 iso_pu_bacteria 2831265667 2831271540 215
396 iso_pu_bacteria 2838054893 2838055441 215
397 iso_pu_bacteria 2885198086 2885201026 215
398 iso_pu_bacteria 2885211737 2885214191 215
399 iso_pu_bacteria 2899924645 2899927508 215
400 iso_pu_bacteria 2928037797 2928042580 215
401 iso_pu_bacteria 2928044640 2928048993 215
402 iso_pu_bacteria 2928051484 2928051543 215
403 iso_pu_bacteria 2928064002 2928068754 215
404 iso_pu_bacteria 2928070936 2928073248 215
405 iso_pu_bacteria 2945909444 2945913940 215
406 iso_pu_bacteria 2945984333 2945990662 215
407 iso_pu_bacteria 2954767861 2954770845 215
408 3300006195 Ga0075366_10368630 Ga0075366_103686302 216
409 3300015683 Ga0183362_10003 Ga0183362_10003631 216
410 3300017792 Ga0163161_10209572 Ga0163161_102095722 216
411 3300026121 Ga0207683_10363461 Ga0207683_103634612 216
412 3300028794 Ga0307515_10000011 Ga0307515_10000011168 216
413 3300031251 Ga0265327_10000789 Ga0265327_1000078913 216
414 3300037418 Ga0395900_0098013 Ga0395900_0098013_1462_2112 216
415 3300037471 Ga0395905_0004208 Ga0395905_0004208_11749_12459 216
416 3300037471 Ga0395905_0103949 Ga0395905_0103949_1261_1911 216
417 3300041404 Ga0439436_0003328 Ga0439436_0003328_307_957 216
418 3300041407 Ga0439447_016801 Ga0439447_016801_1258_1908 216
419 3300041411 Ga0439466_0065511 Ga0439466_0065511_213_863 216
420 3300041413 Ga0439465_0004991 Ga0439465_0004991_3386_4036 216
421 3300041997 Ga0439431_0002005 Ga0439431_0002005_1872_2522 216
422 3300041999 Ga0439433_0002498 Ga0439433_0002498_2443_3093 216
423 3300042002 Ga0439442_031416 Ga0439442_031416_153_803 216
424 3300042004 Ga0439445_0000954 Ga0439445_0000954_2517_3167 216
425 3300042006 Ga0439432_001040 Ga0439432_001040_702_1352 216
426 3300042007 Ga0439449_0011935 Ga0439449_0011935_2081_2731 216
427 3300042014 Ga0439457_015663 Ga0439457_015663_339_989 216
428 3300042015 Ga0439462_0006257 Ga0439462_0006257_1934_2584 216
429 3300042435 Ga0439434_0007314 Ga0439434_0007314_717_1367 216
430 3300044683 Ga0466965_0001255 Ga0466965_0001255_3427_4077 216
431 3300044901 Ga0466960_0001088 Ga0466960_0001088_2985_3635 216
432 3300046664 Ga0495659_0115977 Ga0495659_0115977_225_875 216
433 3300053088 Ga0500644_0046041 Ga0500644_0046041_524_1210 216
434 3300053094 Ga0500566_0099025 Ga0500566_0099025_265_951 216
435 3300053098 Ga0500650_0105629 Ga0500650_0105629_374_1060 216
436 3300053103 Ga0500555_042074 Ga0500555_042074_339_1025 216
437 3300053117 Ga0500593_001145 Ga0500593_001145_3169_3855 216
438 3300053129 Ga0500628_023032 Ga0500628_023032_236_922 216
439 3300053156 Ga0500622_0207171 Ga0500622_0207171_181_831 216
440 iso_pu_bacteria 8002745576 8002746948 216
441 3300002704 JGI25155J39150_1000022 JGI25155J39150_1000022128 217
442 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005120 217
443 3300002738 JGI25154J39366_1000017 JGI25154J39366_1000017112 217
444 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003128 217
445 3300002774 JGI25150J39212_1007128 JGI25150J39212_10071282 217
446 3300002774 JGI25150J39212_1012415 JGI25150J39212_10124152 217
447 3300002987 JGI25159J45721_1000561 JGI25159J45721_100056118 217
448 3300002987 JGI25159J45721_1001840 JGI25159J45721_10018408 217
449 3300003187 JGI25151J46595_10004893 JGI25151J46595_100048937 217
450 3300003187 JGI25151J46595_10010356 JGI25151J46595_100103564 217
451 3300003187 JGI25151J46595_10020356 JGI25151J46595_100203564 217
452 3300003187 JGI25151J46595_10027780 JGI25151J46595_100277803 217
453 3300003354 JGI25160J50197_1000691 JGI25160J50197_10006917 217
454 3300003374 JGI25161J50226_1000095 JGI25161J50226_100009566 217
455 3300003771 Ga0055526_1023266 Ga0055526_10232662 217
456 3300003771 Ga0055526_1024718 Ga0055526_10247183 217
457 3300003773 Ga0055537_1000205 Ga0055537_100020531 217
458 3300003773 Ga0055537_1001935 Ga0055537_10019356 217
459 3300003775 Ga0055524_1000073 Ga0055524_100007343 217
460 3300003784 Ga0055534_1003549 Ga0055534_10035493 217
461 3300003790 Ga0055528_1002836 Ga0055528_100283611 217
462 3300003791 Ga0055530_10000848 Ga0055530_1000084817 217
463 3300003791 Ga0055530_10029586 Ga0055530_100295861 217
464 3300003792 Ga0055540_1000037 Ga0055540_100003755 217
465 3300003794 Ga0055531_10002177 Ga0055531_100021777 217
466 3300004625 Ga0055543_1001829 Ga0055543_10018292 217
467 3300005262 Ga0065165_1046483 Ga0065165_10464832 217
468 3300005456 Ga0070678_100426878 Ga0070678_1004268781 217
469 3300005578 Ga0068854_100165835 Ga0068854_1001658352 217
470 3300006948 Ga0099826_10066499 Ga0099826_100664993 217
471 3300009551 Ga0105238_10863482 Ga0105238_108634822 217
472 3300013306 Ga0163162_10425225 Ga0163162_104252252 217
473 3300014497 Ga0182008_10001633 Ga0182008_1000163318 217
474 3300015261 Ga0182006_1072523 Ga0182006_10725232 217
475 3300015262 Ga0182007_10003308 Ga0182007_100033084 217
476 3300015265 Ga0182005_1043524 Ga0182005_10435242 217
477 3300017792 Ga0163161_10131696 Ga0163161_101316962 217
478 3300025206 Ga0209435_100002 Ga0209435_100002236 217
479 3300025245 Ga0207425_1002888 Ga0207425_10028885 217
480 3300025245 Ga0207425_1014399 Ga0207425_10143992 217
481 3300025246 Ga0209646_1000001 Ga0209646_10000012379 217
482 3300025250 Ga0209026_1000001 Ga0209026_10000011036 217
483 3300025256 Ga0209759_1000001 Ga0209759_10000012010 217
484 3300025263 Ga0209565_1000128 Ga0209565_100012853 217
485 3300025263 Ga0209565_1000574 Ga0209565_100057418 217
486 3300025273 Ga0209673_1000008 Ga0209673_100000876 217
487 3300025284 Ga0209130_1000072 Ga0209130_100007236 217
488 3300025284 Ga0209130_1000338 Ga0209130_100033817 217
489 3300025291 Ga0209675_1000099 Ga0209675_100009920 217
490 3300025291 Ga0209675_1010411 Ga0209675_10104113 217
491 3300025291 Ga0209675_1030195 Ga0209675_10301952 217
492 3300025292 Ga0209676_1000023 Ga0209676_1000023358 217
493 3300025292 Ga0209676_1005294 Ga0209676_100529411 217
494 3300025294 Ga0209025_1002647 Ga0209025_100264719 217
495 3300025294 Ga0209025_1006074 Ga0209025_100607410 217
496 3300025294 Ga0209025_1006765 Ga0209025_100676511 217
497 3300025294 Ga0209025_1039025 Ga0209025_10390252 217
498 3300025295 Ga0209564_1002522 Ga0209564_100252215 217
499 3300025295 Ga0209564_1003391 Ga0209564_10033911 217
500 3300025297 Ga0209758_1013703 Ga0209758_10137034 217
501 3300025298 Ga0209050_1000022 Ga0209050_1000022340 217
502 3300025298 Ga0209050_1006011 Ga0209050_10060118 217
503 3300025298 Ga0209050_1029036 Ga0209050_10290362 217
504 3300025299 Ga0209256_1000001 Ga0209256_10000011826 217
505 3300025299 Ga0209256_1019740 Ga0209256_10197403 217
506 3300025302 Ga0207426_1000319 Ga0207426_100031930 217
507 3300025302 Ga0207426_1005271 Ga0207426_10052715 217
508 3300025303 Ga0209051_1000013 Ga0209051_1000013340 217
509 3300025304 Ga0209257_1000042 Ga0209257_1000042147 217
510 3300026121 Ga0207683_10140105 Ga0207683_101401052 217
511 3300027876 Ga0209974_10125776 Ga0209974_101257762 217
512 3300031251 Ga0265327_10022404 Ga0265327_100224044 217
513 3300031456 Ga0307513_10000029 Ga0307513_10000029172 217
514 3300031456 Ga0307513_10000038 Ga0307513_10000038130 217
515 3300031456 Ga0307513_10428596 Ga0307513_104285961 217
516 3300031548 Ga0307408_100004302 Ga0307408_10000430210 217
517 3300031730 Ga0307516_10136191 Ga0307516_101361912 217
518 3300031911 Ga0307412_10139740 Ga0307412_101397402 217
519 3300032002 Ga0307416_100551188 Ga0307416_1005511882 217
520 3300041509 Ga0451843_1675037 Ga0451843_1675037_27_716 217
521 3300046475 Ga0495639_0009801 Ga0495639_0009801_1925_2581 217
522 3300046517 Ga0495630_0653360 Ga0495630_0653360_43_699 217
523 3300046528 Ga0495642_0072470 Ga0495642_0072470_219_875 217
524 3300046539 Ga0495621_0098877 Ga0495621_0098877_125_781 217
525 3300046558 Ga0495633_0128256 Ga0495633_0128256_136_792 217
526 3300046674 Ga0495588_0020755 Ga0495588_0020755_606_1262 217
527 3300046683 Ga0495658_0288275 Ga0495658_0288275_227_883 217
528 3300047673 Ga0495593_0087345 Ga0495593_0087345_226_882 217
529 3300048903 Ga0496100_0141394 Ga0496100_0141394_323_979 217
530 3300048904 Ga0496101_0082422 Ga0496101_0082422_690_1346 217
531 3300048907 Ga0496104_0108684 Ga0496104_0108684_200_856 217
532 3300048908 Ga0496105_0004053 Ga0496105_0004053_3844_4500 217
533 3300048909 Ga0496106_0009081 Ga0496106_0009081_6315_6971 217
534 3300048911 Ga0496108_0448977 Ga0496108_0448977_223_879 217
535 3300048914 Ga0496111_0017568 Ga0496111_0017568_861_1517 217
536 3300048915 Ga0496112_0331441 Ga0496112_0331441_503_1159 217
537 3300048917 Ga0496114_0081997 Ga0496114_0081997_149_805 217
538 3300053100 Ga0500660_143127 Ga0500660_143127_81_770 217
539 3300053730 Ga0500645_001112 Ga0500645_001112_180_869 217
540 3300053730 Ga0500645_005684 Ga0500645_005684_2840_3529 217
541 3300053730 Ga0500645_019096 Ga0500645_019096_1237_1926 217
542 iso_pu_bacteria 2904541872 2904547987 217
543 iso_pu_bacteria 2929160207 2929161618 217
544 3300001989 JGI24739J22299_10018303 JGI24739J22299_100183033 218
545 3300002773 JGI25152J39213_1035849 JGI25152J39213_10358491 218
546 3300003187 JGI25151J46595_10004998 JGI25151J46595_100049988 218
547 3300003578 Ga0006562J51391_1149086 Ga0006562J51391_11490863 218
548 3300003773 Ga0055537_1000150 Ga0055537_100015010 218
549 3300003784 Ga0055534_1000016 Ga0055534_1000016100 218
550 3300003790 Ga0055528_1000894 Ga0055528_100089410 218
551 3300003792 Ga0055540_1005600 Ga0055540_10056001 218
552 3300005288 Ga0065714_10201064 Ga0065714_102010641 218
553 3300005353 Ga0070669_100034324 Ga0070669_1000343242 218
554 3300005366 Ga0070659_100082251 Ga0070659_1000822513 218
555 3300005617 Ga0068859_101517848 Ga0068859_1015178481 218
556 3300005844 Ga0068862_100035210 Ga0068862_1000352104 218
557 3300006038 Ga0075365_10069730 Ga0075365_100697301 218
558 3300006048 Ga0075363_100002569 Ga0075363_1000025692 218
559 3300006048 Ga0075363_100216359 Ga0075363_1002163592 218
560 3300006058 Ga0075432_10003468 Ga0075432_100034684 218
561 3300006177 Ga0075362_10021197 Ga0075362_100211972 218
562 3300006178 Ga0075367_10089860 Ga0075367_100898603 218
563 3300006186 Ga0075369_10139567 Ga0075369_101395672 218
564 3300006186 Ga0075369_10174700 Ga0075369_101747001 218
565 3300006195 Ga0075366_10041111 Ga0075366_100411112 218
566 3300006353 Ga0075370_10000304 Ga0075370_1000030416 218
567 3300006353 Ga0075370_10009367 Ga0075370_100093672 218
568 3300006353 Ga0075370_10181620 Ga0075370_101816202 218
569 3300006931 Ga0097620_101517874 Ga0097620_1015178741 218
570 3300006948 Ga0099826_10000101 Ga0099826_1000010128 218
571 3300009093 Ga0105240_10630627 Ga0105240_106306271 218
572 3300009551 Ga0105238_10097633 Ga0105238_100976334 218
573 3300010375 Ga0105239_10191146 Ga0105239_101911463 218
574 3300011119 Ga0105246_10702987 Ga0105246_107029872 218
575 3300013100 Ga0157373_10101206 Ga0157373_101012062 218
576 3300013104 Ga0157370_10104976 Ga0157370_101049762 218
577 3300013105 Ga0157369_10120724 Ga0157369_101207243 218
578 3300013306 Ga0163162_10187962 Ga0163162_101879622 218
579 3300013308 Ga0157375_10321531 Ga0157375_103215312 218
580 3300014497 Ga0182008_10115321 Ga0182008_101153212 218
581 3300015261 Ga0182006_1100042 Ga0182006_11000422 218
582 3300017792 Ga0163161_10066343 Ga0163161_100663433 218
583 3300025258 Ga0209129_1004573 Ga0209129_10045737 218
584 3300025263 Ga0209565_1000098 Ga0209565_100009878 218
585 3300025273 Ga0209673_1000058 Ga0209673_1000058173 218
586 3300025291 Ga0209675_1000010 Ga0209675_100001092 218
587 3300025294 Ga0209025_1001904 Ga0209025_100190421 218
588 3300025294 Ga0209025_1046707 Ga0209025_10467072 218
589 3300025298 Ga0209050_1051191 Ga0209050_10511912 218
590 3300025299 Ga0209256_1029604 Ga0209256_10296042 218
591 3300025303 Ga0209051_1000545 Ga0209051_100054534 218
592 3300025303 Ga0209051_1053008 Ga0209051_10530082 218
593 3300025913 Ga0207695_10820715 Ga0207695_108207152 218
594 3300025914 Ga0207671_10085604 Ga0207671_100856043 218
595 3300025923 Ga0207681_10007397 Ga0207681_100073975 218
596 3300025933 Ga0207706_10034754 Ga0207706_100347545 218
597 3300025949 Ga0207667_10301778 Ga0207667_103017782 218
598 3300026089 Ga0207648_10200231 Ga0207648_102002312 218
599 3300027666 Ga0209282_1001024 Ga0209282_10010244 218
600 3300027666 Ga0209282_1102538 Ga0209282_11025381 218
601 3300027866 Ga0209813_10009313 Ga0209813_100093132 218
602 3300027907 Ga0207428_10265812 Ga0207428_102658122 218
603 3300028379 Ga0268266_10537199 Ga0268266_105371992 218
604 3300028380 Ga0268265_10020224 Ga0268265_100202243 218
605 3300030522 Ga0307512_10131821 Ga0307512_101318212 218
606 3300030731 Ga0316177_1219794 Ga0316177_12197942 218
607 3300030732 Ga0316176_1008742 Ga0316176_10087422 218
608 3300030742 Ga0316183_1181937 Ga0316183_11819376 218
609 3300030744 Ga0316181_1015975 Ga0316181_10159752 218
610 3300030745 Ga0316182_1239831 Ga0316182_12398313 218
611 3300031548 Ga0307408_100011106 Ga0307408_1000111067 218
612 3300031649 Ga0307514_10004647 Ga0307514_100046475 218
613 3300031731 Ga0307405_10203538 Ga0307405_102035382 218
614 3300031731 Ga0307405_10407120 Ga0307405_104071202 218
615 3300031824 Ga0307413_10362740 Ga0307413_103627401 218
616 3300031901 Ga0307406_10012286 Ga0307406_100122862 218
617 3300031911 Ga0307412_10471827 Ga0307412_104718272 218
618 3300031995 Ga0307409_100422127 Ga0307409_1004221272 218
619 3300032004 Ga0307414_10341241 Ga0307414_103412412 218
620 3300032005 Ga0307411_10105394 Ga0307411_101053943 218
621 3300032005 Ga0307411_10426992 Ga0307411_104269921 218
622 3300041404 Ga0439436_0035644 Ga0439436_0035644_456_1112 218
623 3300041411 Ga0439466_0045545 Ga0439466_0045545_455_1111 218
624 3300042002 Ga0439442_002272 Ga0439442_002272_306_962 218
625 3300042134 Ga0450898_022768 Ga0450898_022768_325_981 218
626 3300042147 Ga0450910_013516 Ga0450910_013516_156_812 218
627 3300042156 Ga0439446_0082320 Ga0439446_0082320_106_762 218
628 3300042184 Ga0450908_034319 Ga0450908_034319_160_816 218
629 3300042435 Ga0439434_0018453 Ga0439434_0018453_1050_1706 218
630 3300042531 Ga0450918_002840 Ga0450918_002840_736_1392 218
631 3300046453 Ga0495627_025534 Ga0495627_025534_204_860 218
632 3300046453 Ga0495627_034041 Ga0495627_034041_546_1202 218
633 3300046506 Ga0495583_0126900 Ga0495583_0126900_184_840 218
634 3300046512 Ga0495610_0252387 Ga0495610_0252387_29_685 218
635 3300046513 Ga0495616_0008804 Ga0495616_0008804_1538_2194 218
636 3300046518 Ga0495631_0004715 Ga0495631_0004715_3272_3928 218
637 3300046520 Ga0495637_0036167 Ga0495637_0036167_1208_1864 218
638 3300046520 Ga0495637_0097975 Ga0495637_0097975_246_902 218
639 3300046660 Ga0495625_0000950 Ga0495625_0000950_32378_33034 218
640 3300046691 Ga0495670_0302483 Ga0495670_0302483_153_809 218
641 3300046692 Ga0495671_0005567 Ga0495671_0005567_3119_3775 218
642 3300046810 Ga0495660_0126290 Ga0495660_0126290_559_1215 218
643 3300047321 Ga0495676_0073681 Ga0495676_0073681_1203_1859 218
644 3300047673 Ga0495593_0028693 Ga0495593_0028693_699_1355 218
645 3300048089 Ga0495614_0035030 Ga0495614_0035030_888_1544 218
646 3300048904 Ga0496101_0010666 Ga0496101_0010666_2962_3618 218
647 3300048920 Ga0496117_0252043 Ga0496117_0252043_210_866 218
648 3300048922 Ga0496119_0063738 Ga0496119_0063738_1252_1908 218
649 3300048924 Ga0496121_0211697 Ga0496121_0211697_138_794 218
650 3300048925 Ga0496122_0000612 Ga0496122_0000612_57456_58112 218
651 3300048925 Ga0496122_0191324 Ga0496122_0191324_412_1068 218
652 3300048926 Ga0496123_0000274 Ga0496123_0000274_43684_44340 218
653 3300048926 Ga0496123_0265468 Ga0496123_0265468_133_789 218
654 3300048927 Ga0496124_0021958 Ga0496124_0021958_1745_2401 218
655 3300048927 Ga0496124_0589494 Ga0496124_0589494_35_691 218
656 3300048929 Ga0496126_0079885 Ga0496126_0079885_532_1188 218
657 3300048929 Ga0496126_0148644 Ga0496126_0148644_1103_1759 218
658 3300049679 Ga0501249_005254 Ga0501249_005254_168_824 218
659 3300049705 Ga0501225_0009291 Ga0501225_0009291_543_1199 218
660 3300049759 Ga0501262_006502 Ga0501262_006502_393_1049 218
661 3300050489 nmdc:mga03683_3463_c1 nmdc:mga03683_3463_c1_3661_4317 218
662 3300050490 nmdc:mga03n38_29675_c1 nmdc:mga03n38_29675_c1_433_1089 218
663 3300050491 nmdc:mga00v17_566364_c1 nmdc:mga00v17_566364_c1_53_709 218
664 3300050491 nmdc:mga00v17_8095_c2 nmdc:mga00v17_8095_c2_620_1276 218
665 3300050492 nmdc:mga0yw44_25142_c1 nmdc:mga0yw44_25142_c1_736_1392 218
666 3300050493 nmdc:mga0k408_2586_c1 nmdc:mga0k408_2586_c1_1332_1988 218
667 3300050496 nmdc:mga07m45_4636_c1 nmdc:mga07m45_4636_c1_3525_4181 218
668 3300050516 nmdc:mga0sz30_111202_c1 nmdc:mga0sz30_111202_c1_328_984 218
669 3300053087 Ga0500643_025592 Ga0500643_025592_805_1461 218
670 3300053093 Ga0500651_0000347 Ga0500651_0000347_7132_7788 218
671 3300053110 Ga0500571_013161 Ga0500571_013161_3586_4242 218
672 3300053117 Ga0500593_001062 Ga0500593_001062_3247_3903 218
673 3300053118 Ga0500594_0022989 Ga0500594_0022989_567_1223 218
674 3300053121 Ga0500607_017870 Ga0500607_017870_3141_3797 218
675 3300053133 Ga0500655_006394 Ga0500655_006394_646_1302 218
676 3300053136 Ga0500559_0011545 Ga0500559_0011545_2745_3401 218
677 3300053139 Ga0500568_0011721 Ga0500568_0011721_3259_3915 218
678 3300053141 Ga0500574_002285 Ga0500574_002285_498_1154 218
679 3300053158 Ga0500627_0016227 Ga0500627_0016227_432_1088 218
680 3300053161 Ga0500634_0024759 Ga0500634_0024759_109_765 218
681 3300053162 Ga0500638_095707 Ga0500638_095707_350_1006 218
682 3300053177 Ga0500636_0105326 Ga0500636_0105326_541_1197 218
683 3300053734 Ga0500565_005334 Ga0500565_005334_168_824 218
684 3300001979 JGI24740J21852_10003858 JGI24740J21852_100038586 219
685 3300001989 JGI24739J22299_10063752 JGI24739J22299_100637522 219
686 3300002739 JGI25158J39367_1002842 JGI25158J39367_10028423 219
687 3300002739 JGI25158J39367_1005105 JGI25158J39367_10051053 219
688 3300002773 JGI25152J39213_1004641 JGI25152J39213_10046416 219
689 3300002773 JGI25152J39213_1020643 JGI25152J39213_10206432 219
690 3300002773 JGI25152J39213_1025480 JGI25152J39213_10254801 219
691 3300002774 JGI25150J39212_1009905 JGI25150J39212_10099053 219
692 3300002774 JGI25150J39212_1018097 JGI25150J39212_10180972 219
693 3300002987 JGI25159J45721_1005446 JGI25159J45721_10054461 219
694 3300002987 JGI25159J45721_1018716 JGI25159J45721_10187162 219
695 3300003187 JGI25151J46595_10004741 JGI25151J46595_100047412 219
696 3300003187 JGI25151J46595_10007286 JGI25151J46595_100072867 219
697 3300003187 JGI25151J46595_10076324 JGI25151J46595_100763242 219
698 3300003187 JGI25151J46595_10076756 JGI25151J46595_100767561 219
699 3300003215 JGI25153J46596_10010237 JGI25153J46596_100102371 219
700 3300003215 JGI25153J46596_10034417 JGI25153J46596_100344173 219
701 3300003215 JGI25153J46596_10040105 JGI25153J46596_100401052 219
702 3300003316 rootH1_10063531 rootH1_100635312 219
703 3300003323 rootH1_10010075 rootH1_100100752 219
704 3300003354 JGI25160J50197_1008221 JGI25160J50197_10082211 219
705 3300003354 JGI25160J50197_1009957 JGI25160J50197_10099575 219
706 3300003374 JGI25161J50226_1002715 JGI25161J50226_10027152 219
707 3300003374 JGI25161J50226_1003084 JGI25161J50226_10030841 219
708 3300003578 Ga0006562J51391_1040310 Ga0006562J51391_10403102 219
709 3300003758 Ga0055532_1010496 Ga0055532_10104962 219
710 3300003761 Ga0055535_1000966 Ga0055535_100096619 219
711 3300003762 Ga0055542_1000080 Ga0055542_100008089 219
712 3300003771 Ga0055526_1016604 Ga0055526_10166042 219
713 3300003771 Ga0055526_1020873 Ga0055526_10208733 219
714 3300003773 Ga0055537_1008735 Ga0055537_10087353 219
715 3300003775 Ga0055524_1005814 Ga0055524_10058147 219
716 3300003775 Ga0055524_1005838 Ga0055524_10058387 219
717 3300003781 Ga0055536_1005910 Ga0055536_10059102 219
718 3300003781 Ga0055536_1010264 Ga0055536_10102642 219
719 3300003781 Ga0055536_1019004 Ga0055536_10190043 219
720 3300003784 Ga0055534_1008144 Ga0055534_10081443 219
721 3300003784 Ga0055534_1013820 Ga0055534_10138202 219
722 3300003790 Ga0055528_1018968 Ga0055528_10189683 219
723 3300003790 Ga0055528_1022186 Ga0055528_10221863 219
724 3300003791 Ga0055530_10005116 Ga0055530_100051168 219
725 3300003791 Ga0055530_10025185 Ga0055530_100251852 219
726 3300003792 Ga0055540_1004443 Ga0055540_10044438 219
727 3300003792 Ga0055540_1005810 Ga0055540_10058106 219
728 3300003792 Ga0055540_1011326 Ga0055540_10113264 219
729 3300003792 Ga0055540_1029069 Ga0055540_10290692 219
730 3300003794 Ga0055531_10006920 Ga0055531_100069208 219
731 3300003794 Ga0055531_10010770 Ga0055531_100107706 219
732 3300004625 Ga0055543_1009482 Ga0055543_10094823 219
733 3300005262 Ga0065165_1006524 Ga0065165_10065248 219
734 3300005262 Ga0065165_1066742 Ga0065165_10667422 219
735 3300005539 Ga0068853_100009734 Ga0068853_1000097345 219
736 3300005539 Ga0068853_100438824 Ga0068853_1004388242 219
737 3300005564 Ga0070664_100013607 Ga0070664_1000136076 219
738 3300005834 Ga0068851_10010947 Ga0068851_100109474 219
739 3300006353 Ga0075370_10323069 Ga0075370_103230692 219
740 3300006358 Ga0068871_100211717 Ga0068871_1002117172 219
741 3300009036 Ga0105244_10038393 Ga0105244_100383933 219
742 3300009098 Ga0105245_10212067 Ga0105245_102120673 219
743 3300009148 Ga0105243_10262641 Ga0105243_102626412 219
744 3300012490 Ga0157322_1000857 Ga0157322_10008572 219
745 3300013100 Ga0157373_10470197 Ga0157373_104701972 219
746 3300013104 Ga0157370_10033859 Ga0157370_100338597 219
747 3300014497 Ga0182008_10005156 Ga0182008_100051568 219
748 3300014497 Ga0182008_10038809 Ga0182008_100388093 219
749 3300015261 Ga0182006_1069364 Ga0182006_10693641 219
750 3300015262 Ga0182007_10000853 Ga0182007_100008537 219
751 3300017792 Ga0163161_10001891 Ga0163161_1000189119 219
752 3300025228 Ga0209672_100378 Ga0209672_10037823 219
753 3300025229 Ga0209147_100696 Ga0209147_10069615 219
754 3300025242 Ga0209258_100093 Ga0209258_10009321 219
755 3300025245 Ga0207425_1001814 Ga0207425_10018145 219
756 3300025245 Ga0207425_1017383 Ga0207425_10173832 219
757 3300025254 Ga0209148_1000007 Ga0209148_1000007988 219
758 3300025258 Ga0209129_1000024 Ga0209129_100002489 219
759 3300025258 Ga0209129_1003815 Ga0209129_10038152 219
760 3300025258 Ga0209129_1021504 Ga0209129_10215042 219
761 3300025258 Ga0209129_1022465 Ga0209129_10224652 219
762 3300025263 Ga0209565_1000633 Ga0209565_100063320 219
763 3300025263 Ga0209565_1009387 Ga0209565_10093873 219
764 3300025273 Ga0209673_1002178 Ga0209673_100217812 219
765 3300025284 Ga0209130_1000654 Ga0209130_100065425 219
766 3300025284 Ga0209130_1001114 Ga0209130_100111420 219
767 3300025291 Ga0209675_1000151 Ga0209675_100015110 219
768 3300025291 Ga0209675_1002776 Ga0209675_10027765 219
769 3300025291 Ga0209675_1048985 Ga0209675_10489851 219
770 3300025292 Ga0209676_1000028 Ga0209676_1000028267 219
771 3300025292 Ga0209676_1002526 Ga0209676_10025268 219
772 3300025292 Ga0209676_1005287 Ga0209676_10052878 219
773 3300025292 Ga0209676_1051699 Ga0209676_10516992 219
774 3300025292 Ga0209676_1065223 Ga0209676_10652232 219
775 3300025294 Ga0209025_1000685 Ga0209025_100068520 219
776 3300025294 Ga0209025_1005469 Ga0209025_100546913 219
777 3300025294 Ga0209025_1028371 Ga0209025_10283713 219
778 3300025294 Ga0209025_1080782 Ga0209025_10807822 219
779 3300025295 Ga0209564_1000209 Ga0209564_100020984 219
780 3300025295 Ga0209564_1002281 Ga0209564_100228112 219
781 3300025297 Ga0209758_1000049 Ga0209758_10000498 219
782 3300025297 Ga0209758_1005721 Ga0209758_10057215 219
783 3300025297 Ga0209758_1034441 Ga0209758_10344412 219
784 3300025298 Ga0209050_1000072 Ga0209050_100007223 219
785 3300025298 Ga0209050_1000721 Ga0209050_100072143 219
786 3300025298 Ga0209050_1000927 Ga0209050_100092721 219
787 3300025299 Ga0209256_1000088 Ga0209256_1000088176 219
788 3300025299 Ga0209256_1004126 Ga0209256_10041265 219
789 3300025302 Ga0207426_1000038 Ga0207426_1000038370 219
790 3300025302 Ga0207426_1000053 Ga0207426_100005344 219
791 3300025303 Ga0209051_1000015 Ga0209051_1000015196 219
792 3300025303 Ga0209051_1000056 Ga0209051_1000056204 219
793 3300025303 Ga0209051_1000424 Ga0209051_100042419 219
794 3300025303 Ga0209051_1006138 Ga0209051_10061388 219
795 3300025303 Ga0209051_1011319 Ga0209051_10113192 219
796 3300025304 Ga0209257_1003278 Ga0209257_10032788 219
797 3300025304 Ga0209257_1003691 Ga0209257_100369110 219
798 3300025304 Ga0209257_1011169 Ga0209257_10111692 219
799 3300025728 Ga0207655_1013363 Ga0207655_10133634 219
800 3300025934 Ga0207686_10167190 Ga0207686_101671902 219
801 3300025935 Ga0207709_10000958 Ga0207709_1000095817 219
802 3300025935 Ga0207709_10001025 Ga0207709_1000102517 219
803 3300025935 Ga0207709_10002735 Ga0207709_1000273514 219
804 3300025945 Ga0207679_10060887 Ga0207679_100608874 219
805 3300026041 Ga0207639_10047011 Ga0207639_100470114 219
806 3300026041 Ga0207639_10464946 Ga0207639_104649462 219
807 3300026041 Ga0207639_10665601 Ga0207639_106656011 219
808 3300026067 Ga0207678_10277557 Ga0207678_102775572 219
809 3300026142 Ga0207698_10018899 Ga0207698_100188996 219
810 3300028794 Ga0307515_10231820 Ga0307515_102318202 219
811 3300030742 Ga0316183_1012351 Ga0316183_10123512 219
812 3300030745 Ga0316182_1411386 Ga0316182_14113862 219
813 3300031911 Ga0307412_10048788 Ga0307412_100487882 219
814 3300032002 Ga0307416_100033193 Ga0307416_1000331933 219
815 3300048905 Ga0496102_0187708 Ga0496102_0187708_909_1568 219
816 3300048919 Ga0496116_0025714 Ga0496116_0025714_3317_3976 219
817 3300048919 Ga0496116_0045013 Ga0496116_0045013_609_1268 219
818 3300048920 Ga0496117_0015225 Ga0496117_0015225_2680_3339 219
819 3300048920 Ga0496117_0149709 Ga0496117_0149709_219_878 219
820 3300048921 Ga0496118_0025618 Ga0496118_0025618_474_1133 219
821 3300048921 Ga0496118_0082736 Ga0496118_0082736_390_1049 219
822 3300048926 Ga0496123_0070033 Ga0496123_0070033_527_1186 219
823 3300048927 Ga0496124_0241630 Ga0496124_0241630_266_925 219
824 3300048928 Ga0496125_0100067 Ga0496125_0100067_831_1490 219
825 3300048928 Ga0496125_0189991 Ga0496125_0189991_432_1091 219
826 3300050491 nmdc:mga00v17_206043_c1 nmdc:mga00v17_206043_c1_158_817 219
827 3300050493 nmdc:mga0k408_2741_c1 nmdc:mga0k408_2741_c1_3659_4330 219
828 3300050494 nmdc:mga06z11_240425_c1 nmdc:mga06z11_240425_c1_329_988 219
829 3300050496 nmdc:mga07m45_26799_c1 nmdc:mga07m45_26799_c1_1365_2036 219
830 3300050496 nmdc:mga07m45_38151_c1 nmdc:mga07m45_38151_c1_2002_2661 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

8

227

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9337 7 215
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9195 8 213
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9194 7 217
2wjz-assembly1.cif.gz_B crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9139 8 216
2wjz-assembly3.cif.gz_D crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9109 8 216
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9563 9 217 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9467 9 217 3.40.50.880
1ka9H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9195 8 213 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9166 6 217 3.40.50.880
2wjzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9139 8 216 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A853QX37-F1-model_v4 deleted 0.9983 112 219
AF-A0A519JB90-F1-model_v4 deleted 0.9978 7 219
AF-A0A519EW63-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9975 89 219 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A4Q3PCV0-F1-model_v4 deleted 0.9965 6 189
AF-A0A699Q1T2-F1-model_v4 deleted 0.996 135 218

Feature Viewer

pLDDT pTM Quality
94.82 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map