F482581

General Info

Members Datasets Scaffolds Average Seq Length
828 443 1656 151

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2855683550|2855688662
Length 173
Sequence SLYQEIILDHYKHPHGRGLRDAADPAARVGEAHHVNPTCGDEITVRVATDGTVFTDISYDGMGCSISQASASILHELLRGRAAADAAVVHEAFVELMSGRGQVTPDEDVLGDGVAFAGVARYPARVKCALLSWMAFKDAAARAGVRVGPEAKTNHQYSAAASQAGAGRSEGAA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
112 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
113 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
117 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
211 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
215 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
233 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
238 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
239 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
240 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
243 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
244 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
264 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
265 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
266 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
267 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
268 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
269 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
270 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
271 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
272 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
275 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
276 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
277 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
325 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
345 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
346 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
347 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
348 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
353 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
354 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
364 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
365 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
372 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
373 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
377 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
381 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 2855683550 Micromonospora sp. RP3T Isolate Unclassified
385 2501939600 Micromonospora sp. L5 Isolate Unclassified
386 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
387 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
388 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
389 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
390 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
391 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
392 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
393 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
394 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
395 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
396 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
397 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
398 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
399 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
400 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
401 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
402 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
403 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
404 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
405 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
406 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
407 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
408 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
409 2858868258 Micromonospora sp. MH33 Isolate Unclassified
410 2858882152 Micromonospora noduli MED15 Isolate Nodule
411 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
412 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
413 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
414 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
415 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
416 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
417 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
418 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
419 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
420 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
421 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
422 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
423 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
424 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
425 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
426 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
427 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
428 2902582711 Micromonospora sp. AP08 Isolate Unclassified
429 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
430 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
431 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
432 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
433 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
434 649633069 Micromonospora sp. L5 Isolate Unclassified
435 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
436 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
437 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
438 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
439 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
440 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
441 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
442 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
443 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.7
Metatranscriptomes 2.05
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.66
Nodule 0.72
Rhizoplane 9.66
Rhizosphere 75.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002315 3300000549 Bacteria 2672
2 LJQas_1012490 3300000549 Bacteria 1004
3 LJQas_1019997 3300000549 Bacteria 779
4 JGI24746J21847_1008254 3300001977 Bacteria 1575
5 JGI24743J22301_10058428 3300001991 Bacteria 792
6 JGI24735J21928_10101990 3300002067 Bacteria 824
7 JGI24745J21846_1000678 3300002073 Bacteria 3076
8 JGI24034J26672_10058940 3300002239 Bacteria 671
9 JGI25152J39213_1000484 3300002773 Bacteria 22618
10 JGI25151J46595_10038438 3300003187 Bacteria 1781
11 JGI25406J46586_10015318 3300003203 Bacteria 3238
12 rootL2_10001222 3300003322 Bacteria 1276
13 Ga0055542_1012830 3300003762 Bacteria 1433
14 JGI25405J52794_10087488 3300003911 Bacteria 688
15 Ga0058861_11910088 3300004800 Bacteria 785
16 Ga0058860_11848639 3300004801 Bacteria 739
17 Ga0065714_10080072 3300005288 Bacteria 2460
18 Ga0070658_10452310 3300005327 Bacteria 1107
19 Ga0070676_10083139 3300005328 Bacteria 1947
20 Ga0070676_10289175 3300005328 Bacteria 1107
21 Ga0070683_100204938 3300005329 Bacteria 1873
22 Ga0070683_101027989 3300005329 Bacteria 791
23 Ga0070690_100048063 3300005330 Bacteria 2716
24 Ga0070690_101163643 3300005330 Bacteria 614
25 Ga0070690_101241291 3300005330 Bacteria 595
26 Ga0070670_100040535 3300005331 Bacteria 4003
27 Ga0070670_100155936 3300005331 Bacteria 1977
28 Ga0070670_100417054 3300005331 Bacteria 1186
29 Ga0070670_100650244 3300005331 Bacteria 946
30 Ga0068869_100072453 3300005334 Bacteria 2552
31 Ga0068869_100393116 3300005334 Bacteria 1139
32 Ga0070666_10023701 3300005335 Bacteria 3996
33 Ga0070666_10047437 3300005335 Bacteria 2883
34 Ga0070682_100021496 3300005337 Bacteria 3808
35 Ga0070682_100290533 3300005337 Bacteria 1195
36 Ga0068868_100122686 3300005338 Bacteria 2120
37 Ga0068868_100552529 3300005338 Bacteria 1015
38 Ga0068868_100847825 3300005338 Bacteria 827
39 Ga0070660_100080462 3300005339 Bacteria 2556
40 Ga0070660_100182482 3300005339 Bacteria 1698
41 Ga0070660_101000440 3300005339 Bacteria 706
42 Ga0070689_100199859 3300005340 Bacteria 1632
43 Ga0070691_10035731 3300005341 Bacteria 2340
44 Ga0070687_100116168 3300005343 Bacteria 1523
45 Ga0070661_100202932 3300005344 Bacteria 1516
46 Ga0070668_100007296 3300005347 Bacteria 8201
47 Ga0070668_100009293 3300005347 Bacteria 7291
48 Ga0070668_100095240 3300005347 Bacteria 2352
49 Ga0070668_100116469 3300005347 Bacteria 2131
50 Ga0070668_100476718 3300005347 Bacteria 1077
51 Ga0070669_100040952 3300005353 Bacteria 3368
52 Ga0070669_100127385 3300005353 Bacteria 1949
53 Ga0070669_100298659 3300005353 Bacteria 1295
54 Ga0070675_100023676 3300005354 Bacteria 4912
55 Ga0070675_100176705 3300005354 Bacteria 1844
56 Ga0070675_100242627 3300005354 Bacteria 1574
57 Ga0070675_100724598 3300005354 Bacteria 906
58 Ga0070671_100000431 3300005355 Bacteria 29129
59 Ga0070671_100071000 3300005355 Bacteria 2906
60 Ga0070671_100147122 3300005355 Bacteria 1989
61 Ga0070671_100356653 3300005355 Bacteria 1248
62 Ga0070674_100040311 3300005356 Bacteria 3158
63 Ga0070674_100263626 3300005356 Bacteria 1359
64 Ga0070674_100309265 3300005356 Bacteria 1263
65 Ga0070673_100017750 3300005364 Bacteria 5069
66 Ga0070673_100158376 3300005364 Bacteria 1924
67 Ga0070688_100017118 3300005365 Bacteria 4158
68 Ga0070659_100007399 3300005366 Bacteria 7977
69 Ga0070659_100668427 3300005366 Bacteria 896
70 Ga0070659_100885665 3300005366 Bacteria 779
71 Ga0070667_100046723 3300005367 Bacteria 3642
72 Ga0070667_100175146 3300005367 Bacteria 1895
73 Ga0070709_10004976 3300005434 Bacteria 7180
74 Ga0070714_100038390 3300005435 Bacteria 4025
75 Ga0070714_100487002 3300005435 Bacteria 1175
76 Ga0070714_100732429 3300005435 Bacteria 955
77 Ga0070714_101259090 3300005435 Bacteria 722
78 Ga0070713_100204213 3300005436 Bacteria 1786
79 Ga0070713_100309860 3300005436 Bacteria 1456
80 Ga0070710_10009351 3300005437 Bacteria 4794
81 Ga0070710_10448692 3300005437 Bacteria 874
82 Ga0070701_10329215 3300005438 Bacteria 948
83 Ga0070711_100065711 3300005439 Bacteria 2538
84 Ga0070705_100469352 3300005440 Bacteria 948
85 Ga0070694_100040043 3300005444 Bacteria 3122
86 Ga0070663_100018384 3300005455 Bacteria 4582
87 Ga0070663_100041300 3300005455 Bacteria 3234
88 Ga0070663_100194699 3300005455 Bacteria 1579
89 Ga0070663_100481277 3300005455 Bacteria 1028
90 Ga0070678_100110095 3300005456 Bacteria 2153
91 Ga0070678_100303954 3300005456 Bacteria 1356
92 Ga0070678_101192856 3300005456 Bacteria 706
93 Ga0070662_100002401 3300005457 Bacteria 11506
94 Ga0070662_100511365 3300005457 Bacteria 1003
95 Ga0068867_100728595 3300005459 Bacteria 878
96 Ga0070685_10026265 3300005466 Bacteria 3209
97 Ga0070706_101148716 3300005467 Bacteria 714
98 Ga0070707_100874222 3300005468 Bacteria 863
99 Ga0070699_100958510 3300005518 Bacteria 784
100 Ga0070684_100229364 3300005535 Bacteria 1695
101 Ga0070684_100375834 3300005535 Bacteria 1308
102 Ga0068853_100006284 3300005539 Bacteria 9419
103 Ga0070672_100022082 3300005543 Bacteria 4667
104 Ga0070672_100362651 3300005543 Bacteria 1237
105 Ga0070686_100019054 3300005544 Bacteria 4038
106 Ga0070686_100841131 3300005544 Bacteria 743
107 Ga0070695_100057549 3300005545 Bacteria 2512
108 Ga0070696_100008911 3300005546 Bacteria 6715
109 Ga0070665_100008865 3300005548 Bacteria 10185
110 Ga0070665_100180245 3300005548 Bacteria 2113
111 Ga0070665_100188143 3300005548 Bacteria 2066
112 Ga0070665_100242126 3300005548 Bacteria 1804
113 Ga0070665_100967175 3300005548 Bacteria 864
114 Ga0070665_101050281 3300005548 Bacteria 826
115 Ga0070704_100201032 3300005549 Bacteria 1608
116 Ga0068855_100045061 3300005563 Bacteria 5217
117 Ga0070664_100085733 3300005564 Bacteria 2721
118 Ga0070664_100623021 3300005564 Bacteria 1001
119 Ga0070664_100726084 3300005564 Bacteria 926
120 Ga0068857_100089283 3300005577 Bacteria 2758
121 Ga0068857_100445943 3300005577 Bacteria 1209
122 Ga0068857_100918169 3300005577 Bacteria 840
123 Ga0068854_100059576 3300005578 Bacteria 2759
124 Ga0068854_100428251 3300005578 Bacteria 1100
125 Ga0068856_100406323 3300005614 Bacteria 1381
126 Ga0068856_100441847 3300005614 Bacteria 1321
127 Ga0068856_100872445 3300005614 Bacteria 919
128 Ga0070702_100019236 3300005615 Bacteria 3557
129 Ga0068852_100011591 3300005616 Bacteria 6648
130 Ga0068852_100106718 3300005616 Bacteria 2539
131 Ga0068852_100365354 3300005616 Bacteria 1412
132 Ga0068852_100517278 3300005616 Bacteria 1190
133 Ga0068859_100142497 3300005617 Bacteria 2470
134 Ga0068866_10004728 3300005718 Bacteria 5586
135 Ga0068861_100021481 3300005719 Bacteria 4639
136 Ga0068861_100286116 3300005719 Bacteria 1421
137 Ga0068861_100339019 3300005719 Bacteria 1315
138 Ga0068851_10078466 3300005834 Bacteria 1721
139 Ga0068870_10101394 3300005840 Bacteria 1627
140 Ga0068870_10595296 3300005840 Bacteria 751
141 Ga0068870_10686025 3300005840 Bacteria 705
142 Ga0068863_100024821 3300005841 Bacteria 5717
143 Ga0068863_100031392 3300005841 Bacteria 5070
144 Ga0068863_100932203 3300005841 Bacteria 869
145 Ga0068858_100094327 3300005842 Bacteria 2787
146 Ga0068860_100021633 3300005843 Bacteria 6227
147 Ga0068860_100039224 3300005843 Bacteria 4530
148 Ga0068860_100723393 3300005843 Bacteria 1006
149 Ga0068860_101174599 3300005843 Bacteria 787
150 Ga0068862_100118927 3300005844 Bacteria 2327
151 Ga0081455_10010396 3300005937 Bacteria 9454
152 Ga0081540_1052139 3300005983 Bacteria 2017
153 Ga0081539_10000031 3300005985 Bacteria 313232
154 Ga0081539_10000348 3300005985 Bacteria 101459
155 Ga0081539_10000981 3300005985 Bacteria 53166
156 Ga0081539_10017439 3300005985 Bacteria 5042
157 Ga0081539_10030911 3300005985 Bacteria 3312
158 Ga0081539_10035617 3300005985 Bacteria 2988
159 Ga0081539_10042827 3300005985 Bacteria 2632
160 Ga0081539_10193218 3300005985 Bacteria 946
161 Ga0070717_10014298 3300006028 Bacteria 6104
162 Ga0070717_10036911 3300006028 Bacteria 3966
163 Ga0070717_10278576 3300006028 Bacteria 1483
164 Ga0075364_10511588 3300006051 Bacteria 821
165 Ga0070716_100016498 3300006173 Bacteria 3813
166 Ga0070712_100013922 3300006175 Bacteria 5151
167 Ga0070712_100988036 3300006175 Bacteria 728
168 Ga0068871_100021447 3300006358 Bacteria 4965
169 Ga0075428_100014716 3300006844 Bacteria 8689
170 Ga0075428_100649501 3300006844 Bacteria 1125
171 Ga0075428_100892651 3300006844 Bacteria 943
172 Ga0075428_101152374 3300006844 Bacteria 818
173 Ga0075430_100010166 3300006846 Bacteria 7968
174 Ga0075431_100008087 3300006847 Bacteria 10499
175 Ga0075433_10021553 3300006852 Bacteria 5404
176 Ga0075434_100042832 3300006871 Bacteria 4489
177 Ga0075429_100005038 3300006880 Bacteria 11370
178 Ga0075429_100051484 3300006880 Bacteria 3583
179 Ga0075429_100780479 3300006880 Bacteria 837
180 Ga0068865_100232725 3300006881 Bacteria 1446
181 Ga0075436_100014127 3300006914 Bacteria 5467
182 Ga0097620_100142505 3300006931 Bacteria 2470
183 Ga0075435_100003733 3300007076 Bacteria 10378
184 Ga0105251_10009977 3300009011 Bacteria 5555
185 Ga0105244_10061347 3300009036 Bacteria 1893
186 Ga0105244_10088564 3300009036 Bacteria 1524
187 Ga0105240_10043944 3300009093 Bacteria 5681
188 Ga0111539_11228829 3300009094 Bacteria 870
189 Ga0105245_10007755 3300009098 Bacteria 9401
190 Ga0105245_10039722 3300009098 Bacteria 4188
191 Ga0105245_10070192 3300009098 Bacteria 3178
192 Ga0105245_10131873 3300009098 Bacteria 2345
193 Ga0105245_10383779 3300009098 Bacteria 1400
194 Ga0105245_12458968 3300009098 Bacteria 574
195 Ga0105247_10010962 3300009101 Bacteria 5473
196 Ga0105247_10741654 3300009101 Bacteria 743
197 Ga0105247_11515082 3300009101 Bacteria 547
198 Ga0114129_10000016 3300009147 Bacteria 127415
199 Ga0114129_10018183 3300009147 Bacteria 10007
200 Ga0105243_10007613 3300009148 Bacteria 8325
201 Ga0105243_10025174 3300009148 Bacteria 4545
202 Ga0105243_10033781 3300009148 Bacteria 3956
203 Ga0105243_10267891 3300009148 Bacteria 1532
204 Ga0105243_10941614 3300009148 Bacteria 862
205 Ga0105241_10038887 3300009174 Bacteria 3587
206 Ga0105241_10494985 3300009174 Bacteria 1089
207 Ga0105241_10597541 3300009174 Bacteria 996
208 Ga0105242_10028174 3300009176 Bacteria 4469
209 Ga0105242_11090558 3300009176 Bacteria 812
210 Ga0105248_10172392 3300009177 Bacteria 2439
211 Ga0105248_10243017 3300009177 Bacteria 2026
212 Ga0105237_10060214 3300009545 Bacteria 3798
213 Ga0105238_10029659 3300009551 Bacteria 5572
214 Ga0105238_10091019 3300009551 Bacteria 3038
215 Ga0105238_10591649 3300009551 Bacteria 1117
216 Ga0105238_12820680 3300009551 Bacteria 522
217 Ga0105249_10016172 3300009553 Bacteria 6615
218 Ga0105249_10398333 3300009553 Bacteria 1406
219 Ga0105032_102697 3300009979 Bacteria 1575
220 Ga0105029_106752 3300009984 Bacteria 824
221 Ga0105035_103612 3300009988 Bacteria 1198
222 Ga0105239_10066177 3300010375 Bacteria 3970
223 Ga0105239_11014617 3300010375 Bacteria 954
224 Ga0105246_10000059 3300011119 Bacteria 44382
225 Ga0105246_10097510 3300011119 Bacteria 2133
226 Ga0105246_10123032 3300011119 Bacteria 1925
227 Ga0105246_10357548 3300011119 Bacteria 1199
228 Ga0105246_10468634 3300011119 Bacteria 1063
229 Ga0105246_11051150 3300011119 Bacteria 740
230 Ga0157326_1020209 3300012513 Bacteria 817
231 Ga0154012_168285 3300013059 Bacteria 573
232 Ga0157373_10379534 3300013100 Bacteria 1011
233 Ga0157373_10409455 3300013100 Bacteria 973
234 Ga0157371_10078462 3300013102 Bacteria 2339
235 Ga0157370_10029256 3300013104 Bacteria 5411
236 Ga0157369_10078721 3300013105 Bacteria 3531
237 Ga0157369_10326755 3300013105 Bacteria 1594
238 Ga0157369_10396413 3300013105 Bacteria 1432
239 Ga0157374_10013648 3300013296 Bacteria 7096
240 Ga0157374_10212567 3300013296 Bacteria 1896
241 Ga0157378_10034418 3300013297 Bacteria 4480
242 Ga0163162_10015491 3300013306 Bacteria 7451
243 Ga0163162_10607552 3300013306 Bacteria 1219
244 Ga0163162_11834737 3300013306 Bacteria 693
245 Ga0157372_10207208 3300013307 Bacteria 2272
246 Ga0157372_10233956 3300013307 Bacteria 2130
247 Ga0157372_10751006 3300013307 Bacteria 1134
248 Ga0157372_11901383 3300013307 Bacteria 684
249 Ga0157375_10125040 3300013308 Bacteria 2686
250 Ga0157375_10194462 3300013308 Bacteria 2183
251 Ga0157375_11916624 3300013308 Bacteria 704
252 Ga0163163_10038809 3300014325 Bacteria 4643
253 Ga0163163_10079261 3300014325 Bacteria 3282
254 Ga0163163_10252913 3300014325 Bacteria 1813
255 Ga0163163_12576145 3300014325 Bacteria 566
256 Ga0157380_10143610 3300014326 Bacteria 2054
257 Ga0157380_10693123 3300014326 Bacteria 1022
258 Ga0157377_11213685 3300014745 Bacteria 585
259 Ga0157379_10005809 3300014968 Bacteria 10613
260 Ga0157379_10013445 3300014968 Bacteria 7170
261 Ga0157379_10171362 3300014968 Bacteria 1959
262 Ga0157379_10347206 3300014968 Bacteria 1358
263 Ga0157376_10044193 3300014969 Bacteria 3661
264 Ga0163161_10054479 3300017792 Bacteria 2902
265 Ga0163161_10084107 3300017792 Bacteria 2346
266 Ga0163161_10173653 3300017792 Bacteria 1649
267 Ga0197907_11219863 3300020069 Bacteria 536
268 Ga0206356_10287260 3300020070 Bacteria 763
269 Ga0206356_11265802 3300020070 Bacteria 718
270 Ga0206355_1605974 3300020076 Bacteria 659
271 Ga0206352_11143867 3300020078 Bacteria 613
272 Ga0206350_11506103 3300020080 Bacteria 751
273 Ga0213876_10013261 3300021384 Bacteria 4380
274 Ga0213875_10001737 3300021388 Bacteria 13652
275 Ga0224712_10012011 3300022467 Bacteria 2708
276 Ga0224712_10409217 3300022467 Bacteria 647
277 Ga0207425_1009132 3300025245 Bacteria 2486
278 Ga0209148_1002167 3300025254 Bacteria 7287
279 Ga0209129_1000059 3300025258 Bacteria 250603
280 Ga0209025_1000398 3300025294 Bacteria 89204
281 Ga0209051_1018373 3300025303 Bacteria 3095
282 Ga0207697_10056764 3300025315 Bacteria 1625
283 Ga0207656_10529467 3300025321 Bacteria 599
284 Ga0207655_1042430 3300025728 Bacteria 1937
285 Ga0207713_1028085 3300025735 Bacteria 2543
286 Ga0207642_10435364 3300025899 Bacteria 791
287 Ga0207710_10578772 3300025900 Bacteria 586
288 Ga0207688_10004756 3300025901 Bacteria 7394
289 Ga0207688_10036477 3300025901 Bacteria 2724
290 Ga0207647_10049705 3300025904 Bacteria 2599
291 Ga0207647_10414975 3300025904 Bacteria 757
292 Ga0207647_10466753 3300025904 Bacteria 706
293 Ga0207699_10067673 3300025906 Bacteria 2172
294 Ga0207645_10005087 3300025907 Bacteria 9627
295 Ga0207645_10091871 3300025907 Bacteria 1952
296 Ga0207645_10151289 3300025907 Bacteria 1515
297 Ga0207643_10017190 3300025908 Bacteria 3951
298 Ga0207643_10712508 3300025908 Bacteria 649
299 Ga0207705_10316672 3300025909 Bacteria 1198
300 Ga0207654_10121447 3300025911 Bacteria 1641
301 Ga0207671_10072423 3300025914 Bacteria 2572
302 Ga0207671_10166215 3300025914 Bacteria 1711
303 Ga0207693_10000799 3300025915 Bacteria 28106
304 Ga0207660_10357056 3300025917 Bacteria 1172
305 Ga0207660_10439112 3300025917 Bacteria 1054
306 Ga0207662_10060011 3300025918 Bacteria 2281
307 Ga0207662_10081223 3300025918 Bacteria 1978
308 Ga0207657_10119875 3300025919 Bacteria 2165
309 Ga0207657_10125004 3300025919 Bacteria 2113
310 Ga0207681_10123735 3300025923 Bacteria 1901
311 Ga0207681_10567507 3300025923 Bacteria 935
312 Ga0207681_10906049 3300025923 Bacteria 738
313 Ga0207694_10066680 3300025924 Bacteria 2808
314 Ga0207694_11051372 3300025924 Bacteria 689
315 Ga0207650_10046702 3300025925 Bacteria 3189
316 Ga0207650_10340973 3300025925 Bacteria 1231
317 Ga0207659_10149309 3300025926 Bacteria 1823
318 Ga0207659_10586665 3300025926 Bacteria 949
319 Ga0207659_11062412 3300025926 Bacteria 697
320 Ga0207687_10017444 3300025927 Bacteria 4728
321 Ga0207687_10049965 3300025927 Bacteria 2910
322 Ga0207687_10179924 3300025927 Bacteria 1637
323 Ga0207700_10032920 3300025928 Bacteria 3703
324 Ga0207700_10042105 3300025928 Bacteria 3346
325 Ga0207700_10220526 3300025928 Bacteria 1607
326 Ga0207664_10758757 3300025929 Bacteria 872
327 Ga0207664_10884150 3300025929 Bacteria 802
328 Ga0207664_11100318 3300025929 Bacteria 710
329 Ga0207644_10001209 3300025931 Bacteria 16631
330 Ga0207644_10581936 3300025931 Bacteria 928
331 Ga0207690_10363335 3300025932 Bacteria 1147
332 Ga0207690_10369467 3300025932 Bacteria 1138
333 Ga0207706_10002301 3300025933 Bacteria 18622
334 Ga0207706_10082192 3300025933 Bacteria 2831
335 Ga0207686_10219582 3300025934 Bacteria 1372
336 Ga0207686_10314569 3300025934 Bacteria 1167
337 Ga0207709_10013564 3300025935 Bacteria 4494
338 Ga0207709_10018620 3300025935 Bacteria 3892
339 Ga0207709_10043369 3300025935 Bacteria 2711
340 Ga0207709_10184279 3300025935 Bacteria 1477
341 Ga0207670_10335348 3300025936 Bacteria 1194
342 Ga0207669_10123464 3300025937 Bacteria 1763
343 Ga0207669_10240651 3300025937 Bacteria 1341
344 Ga0207704_10211738 3300025938 Bacteria 1427
345 Ga0207665_10014087 3300025939 Bacteria 5261
346 Ga0207691_10002726 3300025940 Bacteria 17257
347 Ga0207691_10445605 3300025940 Bacteria 1102
348 Ga0207711_10151002 3300025941 Bacteria 2096
349 Ga0207711_10706443 3300025941 Bacteria 940
350 Ga0207689_10011631 3300025942 Bacteria 7542
351 Ga0207689_10037140 3300025942 Bacteria 4042
352 Ga0207689_10802747 3300025942 Bacteria 794
353 Ga0207661_10752574 3300025944 Bacteria 897
354 Ga0207679_10099360 3300025945 Bacteria 2272
355 Ga0207679_10398676 3300025945 Bacteria 1210
356 Ga0207679_10798240 3300025945 Bacteria 860
357 Ga0207667_10037126 3300025949 Bacteria 5211
358 Ga0207651_10145116 3300025960 Bacteria 1839
359 Ga0207651_10375188 3300025960 Bacteria 1204
360 Ga0207712_10022721 3300025961 Bacteria 4134
361 Ga0207712_10035695 3300025961 Bacteria 3380
362 Ga0207712_11069016 3300025961 Bacteria 718
363 Ga0207668_10026647 3300025972 Bacteria 3755
364 Ga0207668_10042246 3300025972 Bacteria 3087
365 Ga0207668_10056105 3300025972 Bacteria 2742
366 Ga0207668_10066202 3300025972 Bacteria 2560
367 Ga0207668_10110807 3300025972 Bacteria 2059
368 Ga0207668_10532314 3300025972 Bacteria 1015
369 Ga0207640_10071665 3300025981 Bacteria 2335
370 Ga0207640_10911668 3300025981 Bacteria 768
371 Ga0207658_10109657 3300025986 Bacteria 2180
372 Ga0207658_10473862 3300025986 Bacteria 1111
373 Ga0207658_11102131 3300025986 Bacteria 725
374 Ga0207677_10015012 3300026023 Bacteria 4541
375 Ga0207677_10076324 3300026023 Bacteria 2385
376 Ga0207677_10596548 3300026023 Bacteria 969
377 Ga0207703_10049358 3300026035 Bacteria 3402
378 Ga0207703_10974476 3300026035 Bacteria 813
379 Ga0207639_10018450 3300026041 Bacteria 4958
380 Ga0207639_10322801 3300026041 Bacteria 1371
381 Ga0207678_10028908 3300026067 Bacteria 4838
382 Ga0207678_10048416 3300026067 Bacteria 3674
383 Ga0207678_10072614 3300026067 Bacteria 2948
384 Ga0207678_11733001 3300026067 Bacteria 548
385 Ga0207708_10006256 3300026075 Bacteria 8822
386 Ga0207702_10133170 3300026078 Bacteria 2239
387 Ga0207702_10547866 3300026078 Bacteria 1131
388 Ga0207702_11500704 3300026078 Bacteria 668
389 Ga0207641_10003337 3300026088 Bacteria 14271
390 Ga0207641_10115035 3300026088 Bacteria 2391
391 Ga0207641_10178980 3300026088 Bacteria 1941
392 Ga0207641_10196054 3300026088 Bacteria 1859
393 Ga0207641_10341158 3300026088 Bacteria 1426
394 Ga0207648_11294031 3300026089 Bacteria 685
395 Ga0207676_10188699 3300026095 Bacteria 1812
396 Ga0207676_10402517 3300026095 Bacteria 1279
397 Ga0207674_10124063 3300026116 Bacteria 2548
398 Ga0207674_10124704 3300026116 Bacteria 2541
399 Ga0207674_10661496 3300026116 Bacteria 1009
400 Ga0207674_10755690 3300026116 Bacteria 938
401 Ga0207675_100033142 3300026118 Bacteria 4813
402 Ga0207675_100068865 3300026118 Bacteria 3307
403 Ga0207675_100319659 3300026118 Bacteria 1515
404 Ga0207683_10004160 3300026121 Bacteria 12526
405 Ga0207683_10004697 3300026121 Bacteria 11773
406 Ga0207683_10225782 3300026121 Bacteria 1707
407 Ga0207683_10918042 3300026121 Bacteria 813
408 Ga0207683_10980642 3300026121 Bacteria 785
409 Ga0207683_11274497 3300026121 Bacteria 681
410 Ga0207698_10012564 3300026142 Bacteria 5547
411 Ga0207698_10181716 3300026142 Bacteria 1864
412 Ga0207698_10775756 3300026142 Bacteria 959
413 Ga0207428_10342448 3300027907 Bacteria 1101
414 Ga0268266_10050540 3300028379 Bacteria 3567
415 Ga0268266_10073473 3300028379 Bacteria 2967
416 Ga0268266_10112482 3300028379 Bacteria 2414
417 Ga0268266_10133547 3300028379 Bacteria 2222
418 Ga0268266_10231611 3300028379 Bacteria 1702
419 Ga0268266_11354481 3300028379 Bacteria 687
420 Ga0268265_10036450 3300028380 Bacteria 3603
421 Ga0268265_10040196 3300028380 Bacteria 3453
422 Ga0268265_10167714 3300028380 Bacteria 1873
423 Ga0268265_12472910 3300028380 Bacteria 525
424 Ga0268264_10047939 3300028381 Bacteria 3553
425 Ga0268264_10867915 3300028381 Bacteria 904
426 Ga0307517_10088689 3300028786 Bacteria 2554
427 Ga0307515_10001347 3300028794 Bacteria 55605
428 Ga0307515_10012974 3300028794 Bacteria 15613
429 Ga0307515_10049119 3300028794 Bacteria 6360
430 Ga0307515_10121801 3300028794 Bacteria 2948
431 Ga0307512_10011812 3300030522 Bacteria 8255
432 Ga0307512_10033447 3300030522 Bacteria 4419
433 Ga0307512_10248109 3300030522 Bacteria 891
434 Ga0307513_10025107 3300031456 Bacteria 6914
435 Ga0307513_10152307 3300031456 Bacteria 2218
436 Ga0307513_10712449 3300031456 Bacteria 709
437 Ga0307509_10418684 3300031507 Bacteria 1041
438 Ga0307408_100504075 3300031548 Bacteria 1060
439 Ga0307508_10000287 3300031616 Bacteria 61945
440 Ga0307508_10047869 3300031616 Bacteria 3810
441 Ga0307508_10133476 3300031616 Bacteria 2086
442 Ga0316579_10102105 3300031691 Bacteria 1374
443 Ga0316576_10003944 3300031727 Bacteria 8810
444 Ga0316576_10035999 3300031727 Bacteria 3537
445 Ga0316576_10075103 3300031727 Bacteria 2500
446 Ga0316576_10090976 3300031727 Bacteria 2273
447 Ga0316576_10339236 3300031727 Bacteria 1119
448 Ga0316576_11036886 3300031727 Bacteria 583
449 Ga0316578_10010893 3300031728 Bacteria 4738
450 Ga0316578_10032835 3300031728 Bacteria 2969
451 Ga0316578_10109836 3300031728 Bacteria 1656
452 Ga0307516_10012224 3300031730 Bacteria 9270
453 Ga0307516_10014641 3300031730 Bacteria 8287
454 Ga0307516_10137161 3300031730 Bacteria 2219
455 Ga0307516_10418510 3300031730 Bacteria 998
456 Ga0307405_10094356 3300031731 Bacteria 1990
457 Ga0307405_10136393 3300031731 Bacteria 1704
458 Ga0307405_10576442 3300031731 Bacteria 915
459 Ga0316577_10548901 3300031733 Bacteria 657
460 Ga0307413_10167013 3300031824 Bacteria 1553
461 Ga0307413_10211404 3300031824 Bacteria 1409
462 Ga0307413_10350758 3300031824 Bacteria 1139
463 Ga0307413_10495247 3300031824 Bacteria 980
464 Ga0307413_10865073 3300031824 Bacteria 765
465 Ga0307410_10010649 3300031852 Bacteria 5221
466 Ga0326468_10001718 3300031889 Bacteria 1885
467 Ga0307406_10081944 3300031901 Bacteria 2147
468 Ga0307406_10145773 3300031901 Bacteria 1682
469 Ga0307406_10150058 3300031901 Bacteria 1661
470 Ga0307406_10186655 3300031901 Bacteria 1514
471 Ga0307406_10781133 3300031901 Bacteria 804
472 Ga0307407_10016032 3300031903 Bacteria 3722
473 Ga0307412_10148017 3300031911 Bacteria 1729
474 Ga0307412_11380512 3300031911 Bacteria 637
475 Ga0307412_11782637 3300031911 Bacteria 566
476 Ga0307409_100054485 3300031995 Bacteria 3080
477 Ga0307409_100519800 3300031995 Bacteria 1163
478 Ga0307409_101169311 3300031995 Bacteria 792
479 Ga0307409_101444855 3300031995 Bacteria 714
480 Ga0307416_100031227 3300032002 Bacteria 4007
481 Ga0307416_101067898 3300032002 Bacteria 911
482 Ga0307416_101518969 3300032002 Bacteria 775
483 Ga0307416_101964029 3300032002 Bacteria 688
484 Ga0307414_11143974 3300032004 Bacteria 720
485 Ga0307414_11474038 3300032004 Bacteria 633
486 Ga0307411_10395496 3300032005 Bacteria 1141
487 Ga0307415_100090303 3300032126 Bacteria 2215
488 Ga0307415_100149797 3300032126 Bacteria 1794
489 Ga0307415_100289460 3300032126 Bacteria 1351
490 Ga0307415_100298379 3300032126 Bacteria 1334
491 Ga0307415_100615678 3300032126 Bacteria 968
492 Ga0316580_10037533 3300032139 Bacteria 1498
493 Ga0316593_10113179 3300032168 Bacteria 970
494 Ga0307507_10141098 3300033179 Bacteria 1847
495 Ga0316592_1121510 3300033524 Bacteria 607
496 Ga0316596_1046672 3300033541 Bacteria 1144
497 Ga0373930_0023021 3300034816 Bacteria 1236
498 Ga0373948_0016068 3300034817 Bacteria 1380
499 Ga0373948_0028682 3300034817 Bacteria 1109
500 Ga0373938_0011251 3300034957 Bacteria 1660
501 Ga0373929_0021769 3300035085 Bacteria 1303
502 Ga0373940_0001975 3300035088 Bacteria 3876
503 Ga0373949_0052114 3300035090 Bacteria 1033
504 Ga0373951_0000068 3300035091 Bacteria 41054
505 Ga0373932_0007775 3300035112 Bacteria 2558
506 Ga0373939_0005189 3300035114 Bacteria 3094
507 Ga0373941_0021774 3300035115 Bacteria 1813
508 Ga0373941_0042949 3300035115 Bacteria 1405
509 Ga0373942_0000311 3300035207 Bacteria 13255
510 Ga0373942_0137490 3300035207 Bacteria 775
511 Ga0373961_0011159 3300035241 Bacteria 2227
512 Ga0373961_0116157 3300035241 Bacteria 882
513 Ga0373962_0000528 3300035242 Bacteria 8551
514 Ga0373962_0002101 3300035242 Bacteria 4756
515 Ga0316574_0040234 3300035398 Bacteria 2878
516 Ga0316574_0173180 3300035398 Bacteria 1389
517 Ga0316574_0275589 3300035398 Bacteria 1072
518 Ga0316574_0427248 3300035398 Bacteria 832
519 Ga0373931_0004395 3300035691 Bacteria 6437
520 Ga0373927_0422648 3300035695 Bacteria 880
521 Ga0373937_0906203 3300036401 Bacteria 830
522 Ga0316584_0001888 3300036712 Bacteria 13013
523 Ga0316584_0016524 3300036712 Bacteria 5290
524 Ga0316584_0077573 3300036712 Bacteria 2489
525 Ga0373925_1071907 3300037068 Bacteria 663
526 Ga0395899_0302699 3300037312 Bacteria 1081
527 Ga0395899_0771123 3300037312 Bacteria 597
528 Ga0395900_0164762 3300037418 Bacteria 2259
529 Ga0395900_0359634 3300037418 Bacteria 1427
530 Ga0395898_0007929 3300037466 Bacteria 11265
531 Ga0395898_0050454 3300037466 Bacteria 4072
532 Ga0395905_0022384 3300037471 Bacteria 5978
533 Ga0395905_0095109 3300037471 Bacteria 2796
534 Ga0436364_0050479 3300037853 Bacteria 121594
535 Ga0395901_0011404 3300038443 Bacteria 9006
536 Ga0395901_0062103 3300038443 Bacteria 3888
537 Ga0436365_0146122 3300039437 Bacteria 1061
538 Ga0436365_0443017 3300039437 Bacteria 4511
539 Ga0439436_0042886 3300041404 Bacteria 1292
540 Ga0439466_0036477 3300041411 Bacteria 1660
541 Ga0451791_0323868 3300041451 Bacteria 1749
542 Ga0451791_0882355 3300041451 Bacteria 658
543 Ga0451798_0172777 3300041458 Bacteria 953
544 Ga0451833_0345166 3300041491 Bacteria 595
545 Ga0451837_0164855 3300041494 Bacteria 847
546 Ga0451839_0199935 3300041496 Bacteria 641
547 Ga0451839_1601581 3300041496 Bacteria 665
548 Ga0451845_0394427 3300041501 Bacteria 765
549 Ga0451849_0903322 3300041505 Bacteria 613
550 Ga0451843_0444267 3300041509 Bacteria 680
551 Ga0451843_0778232 3300041509 Bacteria 975
552 Ga0451853_0020962 3300041512 Bacteria 3094
553 Ga0439442_014042 3300042002 Bacteria 1647
554 Ga0439449_0001332 3300042007 Bacteria 9667
555 Ga0450920_000047 3300042122 Bacteria 15115
556 Ga0450907_002437 3300042146 Bacteria 3549
557 Ga0439434_0007543 3300042435 Bacteria 3188
558 Ga0439464_0144071 3300042439 Bacteria 743
559 Ga0439460_0021952 3300042461 Bacteria 1748
560 Ga0466963_0050368 3300044694 Bacteria 2756
561 Ga0466963_0408350 3300044694 Bacteria 958
562 Ga0466963_0852800 3300044694 Bacteria 642
563 Ga0466960_0196896 3300044901 Bacteria 1099
564 Ga0466958_0019269 3300045836 Bacteria 3971
565 Ga0466958_0222636 3300045836 Bacteria 1204
566 Ga0466967_0020834 3300045976 Bacteria 5310
567 Ga0466967_0036796 3300045976 Bacteria 4182
568 Ga0466967_0043986 3300045976 Bacteria 3870
569 Ga0466967_0146024 3300045976 Bacteria 2206
570 Ga0466967_0376515 3300045976 Bacteria 1378
571 Ga0466967_0497602 3300045976 Bacteria 1196
572 Ga0466967_1254592 3300045976 Bacteria 738
573 Ga0466967_1410206 3300045976 Bacteria 694
574 Ga0495627_170783 3300046453 Bacteria 604
575 Ga0495629_0057218 3300046459 Bacteria 2727
576 Ga0495653_0004179 3300046463 Bacteria 11684
577 Ga0495580_0404746 3300046472 Bacteria 920
578 Ga0495582_0008853 3300046473 Bacteria 5553
579 Ga0495582_0033252 3300046473 Bacteria 2834
580 Ga0495639_0244593 3300046475 Bacteria 886
581 Ga0495639_0319337 3300046475 Bacteria 776
582 Ga0495662_0002460 3300046476 Bacteria 9329
583 Ga0495664_0013795 3300046477 Bacteria 4582
584 Ga0495594_0022954 3300046499 Bacteria 3341
585 Ga0495610_0140319 3300046512 Bacteria 1041
586 Ga0495630_0035162 3300046517 Bacteria 3744
587 Ga0495631_0014329 3300046518 Bacteria 3831
588 Ga0495632_0132160 3300046519 Bacteria 1161
589 Ga0495648_0007395 3300046524 Bacteria 8792
590 Ga0495663_0185372 3300046525 Bacteria 722
591 Ga0495642_0030088 3300046528 Bacteria 2171
592 Ga0495642_0080954 3300046528 Bacteria 1367
593 Ga0495642_0196479 3300046528 Bacteria 879
594 Ga0495665_0003224 3300046531 Bacteria 8828
595 Ga0495640_0581612 3300046533 Bacteria 677
596 Ga0495586_0003992 3300046535 Bacteria 7907
597 Ga0495586_0005755 3300046535 Bacteria 6628
598 Ga0495587_0008958 3300046536 Bacteria 6422
599 Ga0495645_0001405 3300046543 Bacteria 16237
600 Ga0495622_0088329 3300046557 Bacteria 1425
601 Ga0495667_0000603 3300046559 Bacteria 22905
602 Ga0495656_0015163 3300046615 Bacteria 2904
603 Ga0495656_0041925 3300046615 Bacteria 1915
604 Ga0495656_0100878 3300046615 Bacteria 1335
605 Ga0495656_0101517 3300046615 Bacteria 1331
606 Ga0495656_0121164 3300046615 Bacteria 1235
607 Ga0495635_0166055 3300046663 Bacteria 1502
608 Ga0495659_0012906 3300046664 Bacteria 2714
609 Ga0495588_0010345 3300046674 Bacteria 4337
610 Ga0495588_0032967 3300046674 Bacteria 2613
611 Ga0495588_0033185 3300046674 Bacteria 2606
612 Ga0495588_0052619 3300046674 Bacteria 2099
613 Ga0495588_0229390 3300046674 Bacteria 980
614 Ga0495588_0440912 3300046674 Bacteria 683
615 Ga0495657_0017054 3300046675 Bacteria 5279
616 Ga0495623_0051823 3300046679 Bacteria 2595
617 Ga0495670_0005557 3300046691 Bacteria 6185
618 Ga0495670_0082052 3300046691 Bacteria 1643
619 Ga0495671_0138738 3300046692 Bacteria 1185
620 Ga0495600_0151207 3300046809 Bacteria 1503
621 Ga0495581_0076857 3300047315 Bacteria 1931
622 Ga0495581_0159075 3300047315 Bacteria 1320
623 Ga0495581_0242667 3300047315 Bacteria 1053
624 Ga0495581_0710343 3300047315 Bacteria 579
625 Ga0495604_0100897 3300047317 Bacteria 2121
626 Ga0495636_0002653 3300047318 Bacteria 6900
627 Ga0495636_0054324 3300047318 Bacteria 1683
628 Ga0495676_0043243 3300047321 Bacteria 3690
629 Ga0495680_0036599 3300047322 Bacteria 3939
630 Ga0495680_0160751 3300047322 Bacteria 1631
631 Ga0495675_0007164 3300047444 Bacteria 6865
632 Ga0495677_0040485 3300047445 Bacteria 1704
633 Ga0495677_0188750 3300047445 Bacteria 800
634 Ga0495685_028216 3300047447 Bacteria 1931
635 Ga0495681_0064003 3300047470 Bacteria 1686
636 Ga0495684_0065469 3300047471 Bacteria 2763
637 Ga0495615_0089099 3300048090 Bacteria 857
638 Ga0496100_0008042 3300048903 Bacteria 5861
639 Ga0496100_0176079 3300048903 Bacteria 1544
640 Ga0496100_0556702 3300048903 Bacteria 888
641 Ga0496101_0001424 3300048904 Bacteria 14297
642 Ga0496101_0011744 3300048904 Bacteria 5823
643 Ga0496101_0058218 3300048904 Bacteria 2797
644 Ga0496101_0112314 3300048904 Bacteria 2052
645 Ga0496102_0000046 3300048905 Bacteria 184899
646 Ga0496102_0044470 3300048905 Bacteria 4030
647 Ga0496102_0080105 3300048905 Bacteria 3008
648 Ga0496102_0144296 3300048905 Bacteria 2233
649 Ga0496102_0470232 3300048905 Bacteria 1178
650 Ga0496102_1232415 3300048905 Bacteria 667
651 Ga0496103_0000392 3300048906 Bacteria 38854
652 Ga0496103_0044195 3300048906 Bacteria 2744
653 Ga0496103_0050092 3300048906 Bacteria 2583
654 Ga0496103_0314405 3300048906 Bacteria 1007
655 Ga0496103_0365749 3300048906 Bacteria 927
656 Ga0496104_0016450 3300048907 Bacteria 6718
657 Ga0496104_0032926 3300048907 Bacteria 4825
658 Ga0496104_0571189 3300048907 Bacteria 1041
659 Ga0496104_0920522 3300048907 Bacteria 779
660 Ga0496104_1198495 3300048907 Bacteria 662
661 Ga0496105_0017585 3300048908 Bacteria 5735
662 Ga0496105_0083826 3300048908 Bacteria 2632
663 Ga0496106_0014765 3300048909 Bacteria 5774
664 Ga0496106_0238296 3300048909 Bacteria 1453
665 Ga0496106_0457961 3300048909 Bacteria 1025
666 Ga0496107_0001831 3300048910 Bacteria 13425
667 Ga0496107_0283742 3300048910 Bacteria 1232
668 Ga0496107_0305464 3300048910 Bacteria 1184
669 Ga0496108_0000050 3300048911 Bacteria 131829
670 Ga0496108_0001275 3300048911 Bacteria 19725
671 Ga0496108_0029019 3300048911 Bacteria 4578
672 Ga0496108_0047653 3300048911 Bacteria 3582
673 Ga0496108_0061143 3300048911 Bacteria 3169
674 Ga0496108_0073119 3300048911 Bacteria 2895
675 Ga0496108_0151625 3300048911 Bacteria 2000
676 Ga0496108_0230236 3300048911 Bacteria 1611
677 Ga0496108_0363438 3300048911 Bacteria 1263
678 Ga0496108_0503905 3300048911 Bacteria 1057
679 Ga0496108_0962168 3300048911 Bacteria 730
680 Ga0496109_0003095 3300048912 Bacteria 13873
681 Ga0496109_0030291 3300048912 Bacteria 4850
682 Ga0496109_0142141 3300048912 Bacteria 2244
683 Ga0496109_0149630 3300048912 Bacteria 2185
684 Ga0496109_0370826 3300048912 Bacteria 1352
685 Ga0496109_0374900 3300048912 Bacteria 1344
686 Ga0496109_0623950 3300048912 Bacteria 1014
687 Ga0496109_0973980 3300048912 Bacteria 786
688 Ga0496110_0025299 3300048913 Bacteria 5072
689 Ga0496110_0047742 3300048913 Bacteria 3751
690 Ga0496110_0152837 3300048913 Bacteria 2090
691 Ga0496110_0171483 3300048913 Bacteria 1968
692 Ga0496110_0431837 3300048913 Bacteria 1200
693 Ga0496110_1085150 3300048913 Bacteria 708
694 Ga0496111_0037137 3300048914 Bacteria 3486
695 Ga0496111_0072106 3300048914 Bacteria 2514
696 Ga0496111_0122668 3300048914 Bacteria 1919
697 Ga0496111_0202431 3300048914 Bacteria 1476
698 Ga0496111_0348881 3300048914 Bacteria 1095
699 Ga0496111_0388880 3300048914 Bacteria 1031
700 Ga0496111_0452321 3300048914 Bacteria 947
701 Ga0496111_0693953 3300048914 Bacteria 741
702 Ga0496112_0060991 3300048915 Bacteria 3717
703 Ga0496112_0129111 3300048915 Bacteria 2498
704 Ga0496112_0547757 3300048915 Bacteria 1091
705 Ga0496112_1304783 3300048915 Bacteria 641
706 Ga0496113_0034282 3300048916 Bacteria 3703
707 Ga0496113_0053961 3300048916 Bacteria 3007
708 Ga0496113_0242765 3300048916 Bacteria 1437
709 Ga0496113_1427529 3300048916 Bacteria 535
710 Ga0496114_0090205 3300048917 Bacteria 2602
711 Ga0496114_0167869 3300048917 Bacteria 1911
712 Ga0496115_0017053 3300048918 Bacteria 5540
713 Ga0496115_0235609 3300048918 Bacteria 1509
714 Ga0496115_1403074 3300048918 Bacteria 516
715 Ga0496116_0000328 3300048919 Bacteria 76892
716 Ga0496117_0000109 3300048920 Bacteria 184635
717 Ga0496118_0000132 3300048921 Bacteria 131401
718 Ga0496118_0258457 3300048921 Bacteria 985
719 Ga0496119_0000061 3300048922 Bacteria 171442
720 Ga0496119_0000534 3300048922 Bacteria 51791
721 Ga0496119_0088449 3300048922 Bacteria 1766
722 Ga0496119_0297601 3300048922 Bacteria 797
723 Ga0496120_0002712 3300048923 Bacteria 17322
724 Ga0496120_0025658 3300048923 Bacteria 3654
725 Ga0496121_0021844 3300048924 Bacteria 6249
726 Ga0496122_0243142 3300048925 Bacteria 1013
727 Ga0496122_0273084 3300048925 Bacteria 930
728 Ga0496124_0408619 3300048927 Bacteria 940
729 Ga0496124_0430869 3300048927 Bacteria 905
730 Ga0496125_0055483 3300048928 Bacteria 3227
731 Ga0496125_0281324 3300048928 Bacteria 1030
732 Ga0496126_0000345 3300048929 Bacteria 97255
733 Ga0496126_0055674 3300048929 Bacteria 3577
734 Ga0501318_009466 3300049534 Bacteria 1063
735 Ga0501034_0178690 3300049571 Bacteria 2088
736 Ga0501042_0901076 3300049578 Bacteria 644
737 Ga0501067_0089254 3300049583 Bacteria 1711
738 Ga0501068_0304683 3300049584 Bacteria 1020
739 Ga0501068_0385945 3300049584 Bacteria 902
740 Ga0501069_0833465 3300049585 Bacteria 560
741 Ga0501072_0247686 3300049588 Bacteria 1419
742 nmdc:mga00v17_434494_c1 3300050491 Bacteria 852
743 nmdc:mga05p37_770_c1 3300050507 Bacteria 35623
744 nmdc:mga05p37_85945_c1 3300050507 Bacteria 3877
745 nmdc:mga09592_1009484_c1 3300050508 Bacteria 695
746 nmdc:mga09592_1_c1 3300050508 Bacteria 201102
747 nmdc:mga0qj67_12_c1 3300050509 Bacteria 76377
748 nmdc:mga06r32_7_c1 3300050510 Bacteria 117700
749 nmdc:mga08y16_209214_c1 3300050511 Bacteria 2020
750 nmdc:mga0n895_21204_c1 3300050512 Bacteria 6071
751 nmdc:mga0rr50_42326_c1 3300050513 Bacteria 3326
752 nmdc:mga08x19_31163_c1 3300050514 Bacteria 3353
753 nmdc:mga0a205_167381_c1 3300050515 Bacteria 2094
754 Ga0500644_0012688 3300053088 Bacteria 2336
755 Ga0500644_0091462 3300053088 Bacteria 1139
756 Ga0500583_0266230 3300053092 Bacteria 844
757 Ga0500651_0161478 3300053093 Bacteria 1340
758 Ga0500650_0146641 3300053098 Bacteria 1093
759 Ga0500556_0142396 3300053104 Bacteria 943
760 Ga0500569_074585 3300053109 Bacteria 1074
761 Ga0500594_0009796 3300053118 Bacteria 2214
762 Ga0500652_016594 3300053131 Bacteria 2683
763 Ga0500568_0001254 3300053139 Bacteria 16796
764 Ga0500579_057663 3300053143 Bacteria 2328
765 Ga0500588_0000316 3300053146 Bacteria 7246
766 Ga0501084_0403248 3300054114 Bacteria 1156
767 Ga0587083_0138008 3300059505 Bacteria 647
768 Ga0587083_0225023 3300059505 Bacteria 548
769 2855688662 2855683550 Bacteria 7134265
770 2501939967 2501939600 Bacteria 6907073
771 2515495277 2515154088 Bacteria 5526283
772 2515722232 2515154129 Bacteria 5584369
773 2515754771 2515154137 Bacteria 5711575
774 2516085370 2515154202 Bacteria 5471270
775 2516088412 2515154203 Bacteria 5458536
776 2558908473 2558860112 Bacteria 9931328
777 2623590658 2622736626 Bacteria 7181580
778 2676485187 2675903059 Bacteria 8644972
779 2676493213 2675903060 Bacteria 10051191
780 2739205141 2738543005 Bacteria 5278128
781 2753268155 2751185782 Bacteria 11227053
782 2772646982 2772190715 Bacteria 6959372
783 2816510392 2816332139 Bacteria 9138787
784 2831937370 2831935698 Bacteria 5963223
785 2832008206 2832004796 Bacteria 6538017
786 2837273361 2837268691 Bacteria 7850704
787 2844852055 2844849076 Bacteria 4091819
788 2852645959 2852643534 Bacteria 3013378
789 2855675304 2855670206 Bacteria 7120389
790 2856864311 2856858025 Bacteria 7255264
791 2857290305 2857288857 Bacteria 7189066
792 2857711453 2857710386 Bacteria 3186771
793 2858853935 2858848962 Bacteria 6963058
794 2858873217 2858868258 Bacteria 7683772
795 2858884972 2858882152 Bacteria 7230291
796 2858891097 2858888857 Bacteria 7060307
797 2858898448 2858895516 Bacteria 7378898
798 2858906647 2858902515 Bacteria 7086037
799 2866070006 2866065130 Bacteria 6518152
800 2867303695 2867302475 Bacteria 7087181
801 2867318789 2867312974 Bacteria 7058875
802 2867320798 2867319477 Bacteria 7069771
803 2867511926 2867507094 Bacteria 6506033
804 2869055253 2869048445 Bacteria 6875584
805 2869068253 2869061728 Bacteria 7112407
806 2869075261 2869068681 Bacteria 7205615
807 2873319428 2873314349 Bacteria 8512634
808 2880489864 2880489317 Bacteria 7096270
809 2880502722 2880495981 Bacteria 7340502
810 2884700557 2884693830 Bacteria 11273186
811 2895430731 2895427314 Bacteria 13147766
812 2895450222 2895442618 Bacteria 11027144
813 2902585869 2902582711 Bacteria 6187705
814 2915358778 2915358134 Bacteria 6050864
815 2928144542 2928142448 Bacteria 5288925
816 2929224522 2929219909 Bacteria 6984360
817 2929232544 2929226422 Bacteria 7248583
818 2996223107 2996221748 Bacteria 6799777
819 649814161 649633069 Bacteria 6962533
820 8003832499 8003830390 Bacteria 6541657
821 8003861604 8003856774 Bacteria 7675274
822 8003873449 8003870546 Bacteria 7396674
823 8054707629 8054704163 Bacteria 7247792
824 8054732518 8054727385 Bacteria 7558670
825 8054736654 8054734606 Bacteria 6947278
826 8055068654 8055066027 Bacteria 9479577
827 8055174547 8055172936 Bacteria 9305943
828 8055418323 8055412473 Bacteria 6257500
829 LJQas_1002315
830 LJQas_1012490
831 LJQas_1019997
832 JGI24746J21847_1008254
833 JGI24743J22301_10058428
834 JGI24735J21928_10101990
835 JGI24745J21846_1000678
836 JGI24034J26672_10058940
837 JGI25152J39213_1000484
838 JGI25151J46595_10038438
839 JGI25406J46586_10015318
840 rootL2_10001222
841 Ga0055542_1012830
842 JGI25405J52794_10087488
843 Ga0058861_11910088
844 Ga0058860_11848639
845 Ga0065714_10080072
846 Ga0070658_10452310
847 Ga0070676_10083139
848 Ga0070676_10289175
849 Ga0070683_100204938
850 Ga0070683_101027989
851 Ga0070690_100048063
852 Ga0070690_101163643
853 Ga0070690_101241291
854 Ga0070670_100040535
855 Ga0070670_100155936
856 Ga0070670_100417054
857 Ga0070670_100650244
858 Ga0068869_100072453
859 Ga0068869_100393116
860 Ga0070666_10023701
861 Ga0070666_10047437
862 Ga0070682_100021496
863 Ga0070682_100290533
864 Ga0068868_100122686
865 Ga0068868_100552529
866 Ga0068868_100847825
867 Ga0070660_100080462
868 Ga0070660_100182482
869 Ga0070660_101000440
870 Ga0070689_100199859
871 Ga0070691_10035731
872 Ga0070687_100116168
873 Ga0070661_100202932
874 Ga0070668_100007296
875 Ga0070668_100009293
876 Ga0070668_100095240
877 Ga0070668_100116469
878 Ga0070668_100476718
879 Ga0070669_100040952
880 Ga0070669_100127385
881 Ga0070669_100298659
882 Ga0070675_100023676
883 Ga0070675_100176705
884 Ga0070675_100242627
885 Ga0070675_100724598
886 Ga0070671_100000431
887 Ga0070671_100071000
888 Ga0070671_100147122
889 Ga0070671_100356653
890 Ga0070674_100040311
891 Ga0070674_100263626
892 Ga0070674_100309265
893 Ga0070673_100017750
894 Ga0070673_100158376
895 Ga0070688_100017118
896 Ga0070659_100007399
897 Ga0070659_100668427
898 Ga0070659_100885665
899 Ga0070667_100046723
900 Ga0070667_100175146
901 Ga0070709_10004976
902 Ga0070714_100038390
903 Ga0070714_100487002
904 Ga0070714_100732429
905 Ga0070714_101259090
906 Ga0070713_100204213
907 Ga0070713_100309860
908 Ga0070710_10009351
909 Ga0070710_10448692
910 Ga0070701_10329215
911 Ga0070711_100065711
912 Ga0070705_100469352
913 Ga0070694_100040043
914 Ga0070663_100018384
915 Ga0070663_100041300
916 Ga0070663_100194699
917 Ga0070663_100481277
918 Ga0070678_100110095
919 Ga0070678_100303954
920 Ga0070678_101192856
921 Ga0070662_100002401
922 Ga0070662_100511365
923 Ga0068867_100728595
924 Ga0070685_10026265
925 Ga0070706_101148716
926 Ga0070707_100874222
927 Ga0070699_100958510
928 Ga0070684_100229364
929 Ga0070684_100375834
930 Ga0068853_100006284
931 Ga0070672_100022082
932 Ga0070672_100362651
933 Ga0070686_100019054
934 Ga0070686_100841131
935 Ga0070695_100057549
936 Ga0070696_100008911
937 Ga0070665_100008865
938 Ga0070665_100180245
939 Ga0070665_100188143
940 Ga0070665_100242126
941 Ga0070665_100967175
942 Ga0070665_101050281
943 Ga0070704_100201032
944 Ga0068855_100045061
945 Ga0070664_100085733
946 Ga0070664_100623021
947 Ga0070664_100726084
948 Ga0068857_100089283
949 Ga0068857_100445943
950 Ga0068857_100918169
951 Ga0068854_100059576
952 Ga0068854_100428251
953 Ga0068856_100406323
954 Ga0068856_100441847
955 Ga0068856_100872445
956 Ga0070702_100019236
957 Ga0068852_100011591
958 Ga0068852_100106718
959 Ga0068852_100365354
960 Ga0068852_100517278
961 Ga0068859_100142497
962 Ga0068866_10004728
963 Ga0068861_100021481
964 Ga0068861_100286116
965 Ga0068861_100339019
966 Ga0068851_10078466
967 Ga0068870_10101394
968 Ga0068870_10595296
969 Ga0068870_10686025
970 Ga0068863_100024821
971 Ga0068863_100031392
972 Ga0068863_100932203
973 Ga0068858_100094327
974 Ga0068860_100021633
975 Ga0068860_100039224
976 Ga0068860_100723393
977 Ga0068860_101174599
978 Ga0068862_100118927
979 Ga0081455_10010396
980 Ga0081540_1052139
981 Ga0081539_10000031
982 Ga0081539_10000348
983 Ga0081539_10000981
984 Ga0081539_10017439
985 Ga0081539_10030911
986 Ga0081539_10035617
987 Ga0081539_10042827
988 Ga0081539_10193218
989 Ga0070717_10014298
990 Ga0070717_10036911
991 Ga0070717_10278576
992 Ga0075364_10511588
993 Ga0070716_100016498
994 Ga0070712_100013922
995 Ga0070712_100988036
996 Ga0068871_100021447
997 Ga0075428_100014716
998 Ga0075428_100649501
999 Ga0075428_100892651
1000 Ga0075428_101152374
1001 Ga0075430_100010166
1002 Ga0075431_100008087
1003 Ga0075433_10021553
1004 Ga0075434_100042832
1005 Ga0075429_100005038
1006 Ga0075429_100051484
1007 Ga0075429_100780479
1008 Ga0068865_100232725
1009 Ga0075436_100014127
1010 Ga0097620_100142505
1011 Ga0075435_100003733
1012 Ga0105251_10009977
1013 Ga0105244_10061347
1014 Ga0105244_10088564
1015 Ga0105240_10043944
1016 Ga0111539_11228829
1017 Ga0105245_10007755
1018 Ga0105245_10039722
1019 Ga0105245_10070192
1020 Ga0105245_10131873
1021 Ga0105245_10383779
1022 Ga0105245_12458968
1023 Ga0105247_10010962
1024 Ga0105247_10741654
1025 Ga0105247_11515082
1026 Ga0114129_10000016
1027 Ga0114129_10018183
1028 Ga0105243_10007613
1029 Ga0105243_10025174
1030 Ga0105243_10033781
1031 Ga0105243_10267891
1032 Ga0105243_10941614
1033 Ga0105241_10038887
1034 Ga0105241_10494985
1035 Ga0105241_10597541
1036 Ga0105242_10028174
1037 Ga0105242_11090558
1038 Ga0105248_10172392
1039 Ga0105248_10243017
1040 Ga0105237_10060214
1041 Ga0105238_10029659
1042 Ga0105238_10091019
1043 Ga0105238_10591649
1044 Ga0105238_12820680
1045 Ga0105249_10016172
1046 Ga0105249_10398333
1047 Ga0105032_102697
1048 Ga0105029_106752
1049 Ga0105035_103612
1050 Ga0105239_10066177
1051 Ga0105239_11014617
1052 Ga0105246_10000059
1053 Ga0105246_10097510
1054 Ga0105246_10123032
1055 Ga0105246_10357548
1056 Ga0105246_10468634
1057 Ga0105246_11051150
1058 Ga0157326_1020209
1059 Ga0154012_168285
1060 Ga0157373_10379534
1061 Ga0157373_10409455
1062 Ga0157371_10078462
1063 Ga0157370_10029256
1064 Ga0157369_10078721
1065 Ga0157369_10326755
1066 Ga0157369_10396413
1067 Ga0157374_10013648
1068 Ga0157374_10212567
1069 Ga0157378_10034418
1070 Ga0163162_10015491
1071 Ga0163162_10607552
1072 Ga0163162_11834737
1073 Ga0157372_10207208
1074 Ga0157372_10233956
1075 Ga0157372_10751006
1076 Ga0157372_11901383
1077 Ga0157375_10125040
1078 Ga0157375_10194462
1079 Ga0157375_11916624
1080 Ga0163163_10038809
1081 Ga0163163_10079261
1082 Ga0163163_10252913
1083 Ga0163163_12576145
1084 Ga0157380_10143610
1085 Ga0157380_10693123
1086 Ga0157377_11213685
1087 Ga0157379_10005809
1088 Ga0157379_10013445
1089 Ga0157379_10171362
1090 Ga0157379_10347206
1091 Ga0157376_10044193
1092 Ga0163161_10054479
1093 Ga0163161_10084107
1094 Ga0163161_10173653
1095 Ga0197907_11219863
1096 Ga0206356_10287260
1097 Ga0206356_11265802
1098 Ga0206355_1605974
1099 Ga0206352_11143867
1100 Ga0206350_11506103
1101 Ga0213876_10013261
1102 Ga0213875_10001737
1103 Ga0224712_10012011
1104 Ga0224712_10409217
1105 Ga0207425_1009132
1106 Ga0209148_1002167
1107 Ga0209129_1000059
1108 Ga0209025_1000398
1109 Ga0209051_1018373
1110 Ga0207697_10056764
1111 Ga0207656_10529467
1112 Ga0207655_1042430
1113 Ga0207713_1028085
1114 Ga0207642_10435364
1115 Ga0207710_10578772
1116 Ga0207688_10004756
1117 Ga0207688_10036477
1118 Ga0207647_10049705
1119 Ga0207647_10414975
1120 Ga0207647_10466753
1121 Ga0207699_10067673
1122 Ga0207645_10005087
1123 Ga0207645_10091871
1124 Ga0207645_10151289
1125 Ga0207643_10017190
1126 Ga0207643_10712508
1127 Ga0207705_10316672
1128 Ga0207654_10121447
1129 Ga0207671_10072423
1130 Ga0207671_10166215
1131 Ga0207693_10000799
1132 Ga0207660_10357056
1133 Ga0207660_10439112
1134 Ga0207662_10060011
1135 Ga0207662_10081223
1136 Ga0207657_10119875
1137 Ga0207657_10125004
1138 Ga0207681_10123735
1139 Ga0207681_10567507
1140 Ga0207681_10906049
1141 Ga0207694_10066680
1142 Ga0207694_11051372
1143 Ga0207650_10046702
1144 Ga0207650_10340973
1145 Ga0207659_10149309
1146 Ga0207659_10586665
1147 Ga0207659_11062412
1148 Ga0207687_10017444
1149 Ga0207687_10049965
1150 Ga0207687_10179924
1151 Ga0207700_10032920
1152 Ga0207700_10042105
1153 Ga0207700_10220526
1154 Ga0207664_10758757
1155 Ga0207664_10884150
1156 Ga0207664_11100318
1157 Ga0207644_10001209
1158 Ga0207644_10581936
1159 Ga0207690_10363335
1160 Ga0207690_10369467
1161 Ga0207706_10002301
1162 Ga0207706_10082192
1163 Ga0207686_10219582
1164 Ga0207686_10314569
1165 Ga0207709_10013564
1166 Ga0207709_10018620
1167 Ga0207709_10043369
1168 Ga0207709_10184279
1169 Ga0207670_10335348
1170 Ga0207669_10123464
1171 Ga0207669_10240651
1172 Ga0207704_10211738
1173 Ga0207665_10014087
1174 Ga0207691_10002726
1175 Ga0207691_10445605
1176 Ga0207711_10151002
1177 Ga0207711_10706443
1178 Ga0207689_10011631
1179 Ga0207689_10037140
1180 Ga0207689_10802747
1181 Ga0207661_10752574
1182 Ga0207679_10099360
1183 Ga0207679_10398676
1184 Ga0207679_10798240
1185 Ga0207667_10037126
1186 Ga0207651_10145116
1187 Ga0207651_10375188
1188 Ga0207712_10022721
1189 Ga0207712_10035695
1190 Ga0207712_11069016
1191 Ga0207668_10026647
1192 Ga0207668_10042246
1193 Ga0207668_10056105
1194 Ga0207668_10066202
1195 Ga0207668_10110807
1196 Ga0207668_10532314
1197 Ga0207640_10071665
1198 Ga0207640_10911668
1199 Ga0207658_10109657
1200 Ga0207658_10473862
1201 Ga0207658_11102131
1202 Ga0207677_10015012
1203 Ga0207677_10076324
1204 Ga0207677_10596548
1205 Ga0207703_10049358
1206 Ga0207703_10974476
1207 Ga0207639_10018450
1208 Ga0207639_10322801
1209 Ga0207678_10028908
1210 Ga0207678_10048416
1211 Ga0207678_10072614
1212 Ga0207678_11733001
1213 Ga0207708_10006256
1214 Ga0207702_10133170
1215 Ga0207702_10547866
1216 Ga0207702_11500704
1217 Ga0207641_10003337
1218 Ga0207641_10115035
1219 Ga0207641_10178980
1220 Ga0207641_10196054
1221 Ga0207641_10341158
1222 Ga0207648_11294031
1223 Ga0207676_10188699
1224 Ga0207676_10402517
1225 Ga0207674_10124063
1226 Ga0207674_10124704
1227 Ga0207674_10661496
1228 Ga0207674_10755690
1229 Ga0207675_100033142
1230 Ga0207675_100068865
1231 Ga0207675_100319659
1232 Ga0207683_10004160
1233 Ga0207683_10004697
1234 Ga0207683_10225782
1235 Ga0207683_10918042
1236 Ga0207683_10980642
1237 Ga0207683_11274497
1238 Ga0207698_10012564
1239 Ga0207698_10181716
1240 Ga0207698_10775756
1241 Ga0207428_10342448
1242 Ga0268266_10050540
1243 Ga0268266_10073473
1244 Ga0268266_10112482
1245 Ga0268266_10133547
1246 Ga0268266_10231611
1247 Ga0268266_11354481
1248 Ga0268265_10036450
1249 Ga0268265_10040196
1250 Ga0268265_10167714
1251 Ga0268265_12472910
1252 Ga0268264_10047939
1253 Ga0268264_10867915
1254 Ga0307517_10088689
1255 Ga0307515_10001347
1256 Ga0307515_10012974
1257 Ga0307515_10049119
1258 Ga0307515_10121801
1259 Ga0307512_10011812
1260 Ga0307512_10033447
1261 Ga0307512_10248109
1262 Ga0307513_10025107
1263 Ga0307513_10152307
1264 Ga0307513_10712449
1265 Ga0307509_10418684
1266 Ga0307408_100504075
1267 Ga0307508_10000287
1268 Ga0307508_10047869
1269 Ga0307508_10133476
1270 Ga0316579_10102105
1271 Ga0316576_10003944
1272 Ga0316576_10035999
1273 Ga0316576_10075103
1274 Ga0316576_10090976
1275 Ga0316576_10339236
1276 Ga0316576_11036886
1277 Ga0316578_10010893
1278 Ga0316578_10032835
1279 Ga0316578_10109836
1280 Ga0307516_10012224
1281 Ga0307516_10014641
1282 Ga0307516_10137161
1283 Ga0307516_10418510
1284 Ga0307405_10094356
1285 Ga0307405_10136393
1286 Ga0307405_10576442
1287 Ga0316577_10548901
1288 Ga0307413_10167013
1289 Ga0307413_10211404
1290 Ga0307413_10350758
1291 Ga0307413_10495247
1292 Ga0307413_10865073
1293 Ga0307410_10010649
1294 Ga0326468_10001718
1295 Ga0307406_10081944
1296 Ga0307406_10145773
1297 Ga0307406_10150058
1298 Ga0307406_10186655
1299 Ga0307406_10781133
1300 Ga0307407_10016032
1301 Ga0307412_10148017
1302 Ga0307412_11380512
1303 Ga0307412_11782637
1304 Ga0307409_100054485
1305 Ga0307409_100519800
1306 Ga0307409_101169311
1307 Ga0307409_101444855
1308 Ga0307416_100031227
1309 Ga0307416_101067898
1310 Ga0307416_101518969
1311 Ga0307416_101964029
1312 Ga0307414_11143974
1313 Ga0307414_11474038
1314 Ga0307411_10395496
1315 Ga0307415_100090303
1316 Ga0307415_100149797
1317 Ga0307415_100289460
1318 Ga0307415_100298379
1319 Ga0307415_100615678
1320 Ga0316580_10037533
1321 Ga0316593_10113179
1322 Ga0307507_10141098
1323 Ga0316592_1121510
1324 Ga0316596_1046672
1325 Ga0373930_0023021
1326 Ga0373948_0016068
1327 Ga0373948_0028682
1328 Ga0373938_0011251
1329 Ga0373929_0021769
1330 Ga0373940_0001975
1331 Ga0373949_0052114
1332 Ga0373951_0000068
1333 Ga0373932_0007775
1334 Ga0373939_0005189
1335 Ga0373941_0021774
1336 Ga0373941_0042949
1337 Ga0373942_0000311
1338 Ga0373942_0137490
1339 Ga0373961_0011159
1340 Ga0373961_0116157
1341 Ga0373962_0000528
1342 Ga0373962_0002101
1343 Ga0316574_0040234
1344 Ga0316574_0173180
1345 Ga0316574_0275589
1346 Ga0316574_0427248
1347 Ga0373931_0004395
1348 Ga0373927_0422648
1349 Ga0373937_0906203
1350 Ga0316584_0001888
1351 Ga0316584_0016524
1352 Ga0316584_0077573
1353 Ga0373925_1071907
1354 Ga0395899_0302699
1355 Ga0395899_0771123
1356 Ga0395900_0164762
1357 Ga0395900_0359634
1358 Ga0395898_0007929
1359 Ga0395898_0050454
1360 Ga0395905_0022384
1361 Ga0395905_0095109
1362 Ga0436364_0050479
1363 Ga0395901_0011404
1364 Ga0395901_0062103
1365 Ga0436365_0146122
1366 Ga0436365_0443017
1367 Ga0439436_0042886
1368 Ga0439466_0036477
1369 Ga0451791_0323868
1370 Ga0451791_0882355
1371 Ga0451798_0172777
1372 Ga0451833_0345166
1373 Ga0451837_0164855
1374 Ga0451839_0199935
1375 Ga0451839_1601581
1376 Ga0451845_0394427
1377 Ga0451849_0903322
1378 Ga0451843_0444267
1379 Ga0451843_0778232
1380 Ga0451853_0020962
1381 Ga0439442_014042
1382 Ga0439449_0001332
1383 Ga0450920_000047
1384 Ga0450907_002437
1385 Ga0439434_0007543
1386 Ga0439464_0144071
1387 Ga0439460_0021952
1388 Ga0466963_0050368
1389 Ga0466963_0408350
1390 Ga0466963_0852800
1391 Ga0466960_0196896
1392 Ga0466958_0019269
1393 Ga0466958_0222636
1394 Ga0466967_0020834
1395 Ga0466967_0036796
1396 Ga0466967_0043986
1397 Ga0466967_0146024
1398 Ga0466967_0376515
1399 Ga0466967_0497602
1400 Ga0466967_1254592
1401 Ga0466967_1410206
1402 Ga0495627_170783
1403 Ga0495629_0057218
1404 Ga0495653_0004179
1405 Ga0495580_0404746
1406 Ga0495582_0008853
1407 Ga0495582_0033252
1408 Ga0495639_0244593
1409 Ga0495639_0319337
1410 Ga0495662_0002460
1411 Ga0495664_0013795
1412 Ga0495594_0022954
1413 Ga0495610_0140319
1414 Ga0495630_0035162
1415 Ga0495631_0014329
1416 Ga0495632_0132160
1417 Ga0495648_0007395
1418 Ga0495663_0185372
1419 Ga0495642_0030088
1420 Ga0495642_0080954
1421 Ga0495642_0196479
1422 Ga0495665_0003224
1423 Ga0495640_0581612
1424 Ga0495586_0003992
1425 Ga0495586_0005755
1426 Ga0495587_0008958
1427 Ga0495645_0001405
1428 Ga0495622_0088329
1429 Ga0495667_0000603
1430 Ga0495656_0015163
1431 Ga0495656_0041925
1432 Ga0495656_0100878
1433 Ga0495656_0101517
1434 Ga0495656_0121164
1435 Ga0495635_0166055
1436 Ga0495659_0012906
1437 Ga0495588_0010345
1438 Ga0495588_0032967
1439 Ga0495588_0033185
1440 Ga0495588_0052619
1441 Ga0495588_0229390
1442 Ga0495588_0440912
1443 Ga0495657_0017054
1444 Ga0495623_0051823
1445 Ga0495670_0005557
1446 Ga0495670_0082052
1447 Ga0495671_0138738
1448 Ga0495600_0151207
1449 Ga0495581_0076857
1450 Ga0495581_0159075
1451 Ga0495581_0242667
1452 Ga0495581_0710343
1453 Ga0495604_0100897
1454 Ga0495636_0002653
1455 Ga0495636_0054324
1456 Ga0495676_0043243
1457 Ga0495680_0036599
1458 Ga0495680_0160751
1459 Ga0495675_0007164
1460 Ga0495677_0040485
1461 Ga0495677_0188750
1462 Ga0495685_028216
1463 Ga0495681_0064003
1464 Ga0495684_0065469
1465 Ga0495615_0089099
1466 Ga0496100_0008042
1467 Ga0496100_0176079
1468 Ga0496100_0556702
1469 Ga0496101_0001424
1470 Ga0496101_0011744
1471 Ga0496101_0058218
1472 Ga0496101_0112314
1473 Ga0496102_0000046
1474 Ga0496102_0044470
1475 Ga0496102_0080105
1476 Ga0496102_0144296
1477 Ga0496102_0470232
1478 Ga0496102_1232415
1479 Ga0496103_0000392
1480 Ga0496103_0044195
1481 Ga0496103_0050092
1482 Ga0496103_0314405
1483 Ga0496103_0365749
1484 Ga0496104_0016450
1485 Ga0496104_0032926
1486 Ga0496104_0571189
1487 Ga0496104_0920522
1488 Ga0496104_1198495
1489 Ga0496105_0017585
1490 Ga0496105_0083826
1491 Ga0496106_0014765
1492 Ga0496106_0238296
1493 Ga0496106_0457961
1494 Ga0496107_0001831
1495 Ga0496107_0283742
1496 Ga0496107_0305464
1497 Ga0496108_0000050
1498 Ga0496108_0001275
1499 Ga0496108_0029019
1500 Ga0496108_0047653
1501 Ga0496108_0061143
1502 Ga0496108_0073119
1503 Ga0496108_0151625
1504 Ga0496108_0230236
1505 Ga0496108_0363438
1506 Ga0496108_0503905
1507 Ga0496108_0962168
1508 Ga0496109_0003095
1509 Ga0496109_0030291
1510 Ga0496109_0142141
1511 Ga0496109_0149630
1512 Ga0496109_0370826
1513 Ga0496109_0374900
1514 Ga0496109_0623950
1515 Ga0496109_0973980
1516 Ga0496110_0025299
1517 Ga0496110_0047742
1518 Ga0496110_0152837
1519 Ga0496110_0171483
1520 Ga0496110_0431837
1521 Ga0496110_1085150
1522 Ga0496111_0037137
1523 Ga0496111_0072106
1524 Ga0496111_0122668
1525 Ga0496111_0202431
1526 Ga0496111_0348881
1527 Ga0496111_0388880
1528 Ga0496111_0452321
1529 Ga0496111_0693953
1530 Ga0496112_0060991
1531 Ga0496112_0129111
1532 Ga0496112_0547757
1533 Ga0496112_1304783
1534 Ga0496113_0034282
1535 Ga0496113_0053961
1536 Ga0496113_0242765
1537 Ga0496113_1427529
1538 Ga0496114_0090205
1539 Ga0496114_0167869
1540 Ga0496115_0017053
1541 Ga0496115_0235609
1542 Ga0496115_1403074
1543 Ga0496116_0000328
1544 Ga0496117_0000109
1545 Ga0496118_0000132
1546 Ga0496118_0258457
1547 Ga0496119_0000061
1548 Ga0496119_0000534
1549 Ga0496119_0088449
1550 Ga0496119_0297601
1551 Ga0496120_0002712
1552 Ga0496120_0025658
1553 Ga0496121_0021844
1554 Ga0496122_0243142
1555 Ga0496122_0273084
1556 Ga0496124_0408619
1557 Ga0496124_0430869
1558 Ga0496125_0055483
1559 Ga0496125_0281324
1560 Ga0496126_0000345
1561 Ga0496126_0055674
1562 Ga0501318_009466
1563 Ga0501034_0178690
1564 Ga0501042_0901076
1565 Ga0501067_0089254
1566 Ga0501068_0304683
1567 Ga0501068_0385945
1568 Ga0501069_0833465
1569 Ga0501072_0247686
1570 nmdc:mga00v17_434494_c1
1571 nmdc:mga05p37_770_c1
1572 nmdc:mga05p37_85945_c1
1573 nmdc:mga09592_1009484_c1
1574 nmdc:mga09592_1_c1
1575 nmdc:mga0qj67_12_c1
1576 nmdc:mga06r32_7_c1
1577 nmdc:mga08y16_209214_c1
1578 nmdc:mga0n895_21204_c1
1579 nmdc:mga0rr50_42326_c1
1580 nmdc:mga08x19_31163_c1
1581 nmdc:mga0a205_167381_c1
1582 Ga0500644_0012688
1583 Ga0500644_0091462
1584 Ga0500583_0266230
1585 Ga0500651_0161478
1586 Ga0500650_0146641
1587 Ga0500556_0142396
1588 Ga0500569_074585
1589 Ga0500594_0009796
1590 Ga0500652_016594
1591 Ga0500568_0001254
1592 Ga0500579_057663
1593 Ga0500588_0000316
1594 Ga0501084_0403248
1595 Ga0587083_0138008
1596 Ga0587083_0225023
1597 2855688662
1598 2501939967
1599 2515495277
1600 2515722232
1601 2515754771
1602 2516085370
1603 2516088412
1604 2558908473
1605 2623590658
1606 2676485187
1607 2676493213
1608 2739205141
1609 2753268155
1610 2772646982
1611 2816510392
1612 2831937370
1613 2832008206
1614 2837273361
1615 2844852055
1616 2852645959
1617 2855675304
1618 2856864311
1619 2857290305
1620 2857711453
1621 2858853935
1622 2858873217
1623 2858884972
1624 2858891097
1625 2858898448
1626 2858906647
1627 2866070006
1628 2867303695
1629 2867318789
1630 2867320798
1631 2867511926
1632 2869055253
1633 2869068253
1634 2869075261
1635 2873319428
1636 2880489864
1637 2880502722
1638 2884700557
1639 2895430731
1640 2895450222
1641 2902585869
1642 2915358778
1643 2928144542
1644 2929224522
1645 2929232544
1646 2996223107
1647 649814161
1648 8003832499
1649 8003861604
1650 8003873449
1651 8054707629
1652 8054732518
1653 8054736654
1654 8055068654
1655 8055174547
1656 8055418323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

2

129

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9423 3 145
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9159 3 145
8odq-assembly1.cif.gz_C sufs-sufu complex from mycobacterium tuberculosis 0.913 2 150
8odq-assembly1.cif.gz_C sufs-sufu complex from mycobacterium tuberculosis 0.889 2 150
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.8874 3 149
ID Description Score Start End Superfamily
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9552 3 150 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9417 3 145 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9153 3 145 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9057 3 150 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8815 2 143 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A0K2QZL7-F1-model_v4 deleted 0.9967 54 148
AF-A0A5B8K512-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9951 1 150 GO:0005506
GO:0016226
GO:0051536
AF-A0A353ZWG1-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9945 35 148 GO:0005506
GO:0016226
GO:0051536
AF-A0A1M9VG33-F1-model_v4 deleted 0.9918 40 150
AF-A0A0K8Q8G6-F1-model_v4 NifU-like protein 0.9908 60 151 GO:0005506
GO:0016226
GO:0051536

Map