F482478

General Info

Members Datasets Scaffolds Average Seq Length
826 389 773 248

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10285261|Ga0207707_102852613
Length 248
Sequence MNQIDLAGKNAIVTGGARGIGYSIAQRLLESGATCSLWDRDAEALEGAAKSLGSRVHTAAVKINEPASVQSAAQATLKALGSIEILVNNAGIAGVTKKMWEMTPAEWNEVIETNLNGLFLCCHAVVPLMLARKYGRIVNIASIAGKEGNPNASHYSAAKAGVIALTKSLAKETAQSGILVNCITPAVIQTDILKQVTQQHIDYMLSKIPMGRFGKKEEAAALVAWLCSDDCSFSTGAVFDLSGGRATY

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
11 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
12 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
13 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
14 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
15 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
16 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
17 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
18 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
19 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
20 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
21 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
22 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
23 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
24 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
25 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
26 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
27 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
28 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
29 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
30 2818991450 Burkholderia sp. 604 Isolate Unclassified
31 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
32 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
33 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
34 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
35 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
36 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
37 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
38 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
39 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
40 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
41 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
42 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
43 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
44 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
45 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
46 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
47 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
48 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
52 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
56 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
57 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
58 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
240 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
383 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
386 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
387 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
388 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
389 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.58
Metatranscriptomes 0
Isolates 6.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 1.82
Rhizoplane 6.42
Rhizosphere 71.43
Stem 0
Stem Tuber 0.12
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002892 3300001979 Bacteria 7678
2 JGI24739J22299_10002400 3300001989 Bacteria 7225
3 JGI24739J22299_10004739 3300001989 Bacteria 5192
4 JGI24735J21928_10000332 3300002067 Bacteria 16484
5 JGI24735J21928_10015757 3300002067 Bacteria 2353
6 JGI25156J39149_1000199 3300002705 Bacteria 42014
7 JGI25156J39149_1000208 3300002705 Bacteria 40617
8 JGI25156J39149_1000209 3300002705 Bacteria 40586
9 JGI25165J46597_1001358 3300003214 Bacteria 13623
10 JGI25153J46596_10002472 3300003215 Bacteria 10616
11 JGI25160J50197_1006354 3300003354 Bacteria 4795
12 Ga0055533_1000232 3300003756 Bacteria 36511
13 Ga0055533_1000933 3300003756 Bacteria 8687
14 Ga0055532_1000011 3300003758 Bacteria 385294
15 Ga0055527_1000009 3300003760 Bacteria 385294
16 Ga0055535_1000008 3300003761 Bacteria 385294
17 Ga0055542_1000014 3300003762 Bacteria 385294
18 Ga0055529_1000010 3300003763 Bacteria 385294
19 Ga0055526_1002114 3300003771 Bacteria 13643
20 Ga0055536_1000026 3300003781 Bacteria 166220
21 Ga0055534_1001609 3300003784 Bacteria 8765
22 Ga0055528_1026862 3300003790 Bacteria 1639
23 Ga0055540_1012288 3300003792 Bacteria 2698
24 Ga0055540_1022000 3300003792 Bacteria 1641
25 Ga0065165_1008403 3300005262 Bacteria 4839
26 Ga0065715_10129378 3300005293 Bacteria 2046
27 Ga0065707_10001895 3300005295 Bacteria 5571
28 Ga0070658_10001405 3300005327 Bacteria 20559
29 Ga0070658_10118069 3300005327 Bacteria 2202
30 Ga0070658_10282260 3300005327 Bacteria 1414
31 Ga0070670_100001840 3300005331 Bacteria 17293
32 Ga0070670_100037169 3300005331 Bacteria 4189
33 Ga0070670_100118387 3300005331 Bacteria 2284
34 Ga0070677_10013220 3300005333 Bacteria 2882
35 Ga0068869_100011954 3300005334 Bacteria 5714
36 Ga0070682_100203526 3300005337 Bacteria 1398
37 Ga0068868_100120077 3300005338 Bacteria 2143
38 Ga0068868_100166965 3300005338 Bacteria 1821
39 Ga0068868_100407332 3300005338 Bacteria 1175
40 Ga0068868_100502158 3300005338 Bacteria 1062
41 Ga0070660_100000004 3300005339 Bacteria 171018
42 Ga0070661_100004818 3300005344 Bacteria 9289
43 Ga0070668_100104988 3300005347 Bacteria 2243
44 Ga0070669_100000378 3300005353 Bacteria 34229
45 Ga0070675_100015079 3300005354 Bacteria 6103
46 Ga0070675_100055653 3300005354 Bacteria 3257
47 Ga0070671_100004335 3300005355 Bacteria 11225
48 Ga0070671_100229851 3300005355 Bacteria 1574
49 Ga0070671_100578654 3300005355 Bacteria 970
50 Ga0070674_100023729 3300005356 Bacteria 3974
51 Ga0070674_100244923 3300005356 Bacteria 1405
52 Ga0070673_100006343 3300005364 Bacteria 7684
53 Ga0070673_100051998 3300005364 Bacteria 3212
54 Ga0070659_100000023 3300005366 Bacteria 150907
55 Ga0070659_100008933 3300005366 Bacteria 7345
56 Ga0070659_100125002 3300005366 Bacteria 2086
57 Ga0070659_100143402 3300005366 Bacteria 1945
58 Ga0070701_10235995 3300005438 Bacteria 1097
59 Ga0070700_100140206 3300005441 Bacteria 1642
60 Ga0070678_100020258 3300005456 Bacteria 4359
61 Ga0070678_100031159 3300005456 Bacteria 3675
62 Ga0070678_100207393 3300005456 Bacteria 1622
63 Ga0070678_100798821 3300005456 Bacteria 857
64 Ga0070662_100054070 3300005457 Bacteria 2909
65 Ga0070681_10150995 3300005458 Unclassified 2249
66 Ga0070706_100000271 3300005467 Bacteria 63046
67 Ga0070706_100267178 3300005467 Bacteria 1596
68 Ga0070707_100053914 3300005468 Bacteria 3855
69 Ga0070684_100008207 3300005535 Bacteria 8157
70 Ga0068853_100227396 3300005539 Bacteria 1706
71 Ga0070672_100130322 3300005543 Bacteria 2066
72 Ga0070672_100139104 3300005543 Bacteria 2001
73 Ga0070693_100016242 3300005547 Bacteria 3849
74 Ga0070693_100111813 3300005547 Bacteria 1681
75 Ga0070693_100114911 3300005547 Bacteria 1661
76 Ga0070665_100092825 3300005548 Bacteria 3023
77 Ga0070665_100415694 3300005548 Bacteria 1353
78 Ga0068855_100007936 3300005563 Bacteria 12827
79 Ga0068855_100071618 3300005563 Bacteria 4031
80 Ga0070664_100004354 3300005564 Bacteria 11375
81 Ga0070664_100181683 3300005564 Bacteria 1870
82 Ga0070664_100409567 3300005564 Bacteria 1241
83 Ga0068857_100015285 3300005577 Bacteria 6700
84 Ga0068854_100006013 3300005578 Bacteria 7688
85 Ga0068856_100219106 3300005614 Bacteria 1918
86 Ga0070702_100410249 3300005615 Bacteria 972
87 Ga0068852_100012297 3300005616 Bacteria 6492
88 Ga0068852_100020522 3300005616 Bacteria 5255
89 Ga0068852_100049509 3300005616 Bacteria 3595
90 Ga0068852_100128234 3300005616 Bacteria 2333
91 Ga0068864_100049553 3300005618 Bacteria 3614
92 Ga0068864_100131611 3300005618 Bacteria 2248
93 Ga0068861_100001865 3300005719 Bacteria 13569
94 Ga0068851_10004511 3300005834 Bacteria 6281
95 Ga0068851_10014115 3300005834 Bacteria 3788
96 Ga0068863_100152637 3300005841 Bacteria 2211
97 Ga0068860_100087569 3300005843 Bacteria 2964
98 Ga0068862_100072538 3300005844 Bacteria 2974
99 Ga0075368_10030664 3300006042 Bacteria 2082
100 Ga0075368_10094152 3300006042 Bacteria 1227
101 Ga0075367_10003415 3300006178 Bacteria 7568
102 Ga0075369_10002321 3300006186 Bacteria 6766
103 Ga0075366_10001538 3300006195 Bacteria 11541
104 Ga0075366_10005093 3300006195 Bacteria 7109
105 Ga0075366_10063701 3300006195 Bacteria 2191
106 Ga0075366_10074401 3300006195 Bacteria 2026
107 Ga0097621_100066610 3300006237 Bacteria 2967
108 Ga0097621_100297117 3300006237 Bacteria 1426
109 Ga0097621_100315399 3300006237 Bacteria 1384
110 Ga0075370_10000157 3300006353 Bacteria 23226
111 Ga0075370_10001313 3300006353 Bacteria 10640
112 Ga0075370_10018871 3300006353 Bacteria 3745
113 Ga0075370_10024875 3300006353 Bacteria 3310
114 Ga0068871_100039522 3300006358 Bacteria 3775
115 Ga0068871_100060131 3300006358 Bacteria 3098
116 Ga0068871_100113834 3300006358 Bacteria 2278
117 Ga0068871_100275849 3300006358 Bacteria 1470
118 Ga0075434_100004654 3300006871 Bacteria 12400
119 Ga0075434_100196325 3300006871 Bacteria 2038
120 Ga0075434_100489308 3300006871 Bacteria 1251
121 Ga0075429_100104985 3300006880 Bacteria 2468
122 Ga0105251_10000654 3300009011 Bacteria 31960
123 Ga0105251_10000816 3300009011 Bacteria 28017
124 Ga0105251_10099615 3300009011 Bacteria 1329
125 Ga0105244_10078900 3300009036 Bacteria 1632
126 Ga0105250_10004967 3300009092 Bacteria 6033
127 Ga0105240_10002938 3300009093 Bacteria 26885
128 Ga0105240_10018434 3300009093 Bacteria 9370
129 Ga0105240_10099453 3300009093 Bacteria 3540
130 Ga0105240_10324987 3300009093 Bacteria 1752
131 Ga0111539_10001639 3300009094 Bacteria 29898
132 Ga0111539_10193872 3300009094 Bacteria 2370
133 Ga0111539_10264131 3300009094 Bacteria 2003
134 Ga0105245_10156052 3300009098 Bacteria 2162
135 Ga0105247_10353627 3300009101 Bacteria 1034
136 Ga0105247_10493248 3300009101 Bacteria 891
137 Ga0105243_10010046 3300009148 Bacteria 7199
138 Ga0105241_10223857 3300009174 Bacteria 1583
139 Ga0105241_10237052 3300009174 Bacteria 1541
140 Ga0105248_10045951 3300009177 Bacteria 4895
141 Ga0105248_10060337 3300009177 Bacteria 4257
142 Ga0105248_10074722 3300009177 Bacteria 3809
143 Ga0105248_10203080 3300009177 Bacteria 2233
144 Ga0105248_10479972 3300009177 Bacteria 1401
145 Ga0105237_10006766 3300009545 Bacteria 12649
146 Ga0105237_10007760 3300009545 Bacteria 11705
147 Ga0105237_10024983 3300009545 Bacteria 6112
148 Ga0105237_10038836 3300009545 Bacteria 4808
149 Ga0105237_10181999 3300009545 Bacteria 2102
150 Ga0105237_10220013 3300009545 Bacteria 1899
151 Ga0105238_10006338 3300009551 Bacteria 11764
152 Ga0105238_10010968 3300009551 Bacteria 9113
153 Ga0105238_10032852 3300009551 Bacteria 5282
154 Ga0105238_10244530 3300009551 Bacteria 1772
155 Ga0105238_10319875 3300009551 Bacteria 1537
156 Ga0105238_10580783 3300009551 Bacteria 1127
157 Ga0105249_10023626 3300009553 Bacteria 5518
158 Ga0105239_10004145 3300010375 Bacteria 17402
159 Ga0105239_10158799 3300010375 Bacteria 2526
160 Ga0157373_10076687 3300013100 Bacteria 2359
161 Ga0157371_10015829 3300013102 Bacteria 5642
162 Ga0157370_10008953 3300013104 Bacteria 10750
163 Ga0157369_10000326 3300013105 Bacteria 63940
164 Ga0157369_10008064 3300013105 Bacteria 12076
165 Ga0157369_10048315 3300013105 Bacteria 4617
166 Ga0157369_10055294 3300013105 Bacteria 4285
167 Ga0157369_10398390 3300013105 Bacteria 1428
168 Ga0163162_10027756 3300013306 Bacteria 5598
169 Ga0163162_10147222 3300013306 Bacteria 2471
170 Ga0163162_10159032 3300013306 Bacteria 2380
171 Ga0157372_10018776 3300013307 Bacteria 7438
172 Ga0157372_10040036 3300013307 Bacteria 5175
173 Ga0157375_10008280 3300013308 Bacteria 9107
174 Ga0157375_10010581 3300013308 Bacteria 8121
175 Ga0157375_10379925 3300013308 Bacteria 1579
176 Ga0163163_10324860 3300014325 Bacteria 1592
177 Ga0163163_10599417 3300014325 Bacteria 1165
178 Ga0163163_10744869 3300014325 Bacteria 1043
179 Ga0182008_10035841 3300014497 Bacteria 2483
180 Ga0182008_10046294 3300014497 Bacteria 2162
181 Ga0182007_10001190 3300015262 Bacteria 14136
182 Ga0182007_10040498 3300015262 Bacteria 1555
183 Ga0182005_1016050 3300015265 Bacteria 2085
184 Ga0183361_10005 3300016635 Bacteria 413599
185 Ga0163161_10056646 3300017792 Bacteria 2847
186 Ga0163161_10378753 3300017792 Bacteria 1130
187 Ga0163161_10394363 3300017792 Bacteria 1109
188 Ga0209435_104039 3300025206 Bacteria 1666
189 Ga0209674_100011 3300025226 Bacteria 997175
190 Ga0209674_100093 3300025226 Bacteria 170423
191 Ga0209672_100002 3300025228 Bacteria 1733325
192 Ga0209672_101742 3300025228 Bacteria 6902
193 Ga0209147_100003 3300025229 Bacteria 1733325
194 Ga0209563_101191 3300025230 Bacteria 7297
195 Ga0207427_101004 3300025231 Bacteria 11826
196 Ga0209258_100005 3300025242 Bacteria 1087938
197 Ga0209148_1000006 3300025254 Bacteria 1733325
198 Ga0209759_1000002 3300025256 Bacteria 1027596
199 Ga0209759_1000006 3300025256 Bacteria 492407
200 Ga0209759_1000039 3300025256 Bacteria 256444
201 Ga0209129_1000124 3300025258 Bacteria 133610
202 Ga0209233_1000018 3300025261 Bacteria 886857
203 Ga0209233_1009841 3300025261 Bacteria 2891
204 Ga0209565_1008371 3300025263 Bacteria 2709
205 Ga0209455_1000003 3300025272 Bacteria 1471893
206 Ga0209673_1000586 3300025273 Bacteria 57290
207 Ga0209675_1000026 3300025291 Bacteria 284716
208 Ga0209675_1036722 3300025291 Bacteria 1107
209 Ga0209676_1000059 3300025292 Bacteria 344882
210 Ga0209025_1000066 3300025294 Bacteria 298742
211 Ga0209564_1000057 3300025295 Bacteria 340400
212 Ga0209564_1000161 3300025295 Bacteria 162489
213 Ga0209564_1008977 3300025295 Bacteria 4838
214 Ga0209564_1015001 3300025295 Bacteria 3183
215 Ga0209758_1000214 3300025297 Bacteria 126364
216 Ga0207426_1000014 3300025302 Bacteria 649413
217 Ga0207426_1002337 3300025302 Bacteria 12380
218 Ga0209051_1000362 3300025303 Bacteria 66692
219 Ga0209051_1002074 3300025303 Bacteria 15151
220 Ga0209051_1033002 3300025303 Bacteria 1965
221 Ga0207656_10004453 3300025321 Bacteria 4896
222 Ga0207713_1003352 3300025735 Bacteria 10995
223 Ga0207647_10015441 3300025904 Bacteria 5236
224 Ga0207647_10017475 3300025904 Bacteria 4875
225 Ga0207647_10049311 3300025904 Bacteria 2612
226 Ga0207647_10196453 3300025904 Bacteria 1168
227 Ga0207645_10016293 3300025907 Bacteria 4921
228 Ga0207643_10022963 3300025908 Bacteria 3439
229 Ga0207705_10000481 3300025909 Bacteria 34247
230 Ga0207705_10008567 3300025909 Bacteria 7456
231 Ga0207705_10380409 3300025909 Bacteria 1090
232 Ga0207684_10011762 3300025910 Bacteria 7633
233 Ga0207684_10220226 3300025910 Bacteria 1638
234 Ga0207654_10145504 3300025911 Bacteria 1516
235 Ga0207707_10285261 3300025912 Unclassified 1429
236 Ga0207695_10015843 3300025913 Bacteria 8855
237 Ga0207695_10022800 3300025913 Bacteria 7093
238 Ga0207671_10006346 3300025914 Bacteria 10548
239 Ga0207671_10007479 3300025914 Bacteria 9474
240 Ga0207671_10037912 3300025914 Bacteria 3573
241 Ga0207671_10058955 3300025914 Bacteria 2846
242 Ga0207671_10260891 3300025914 Bacteria 1364
243 Ga0207657_10000001 3300025919 Bacteria 458536
244 Ga0207657_10046823 3300025919 Bacteria 3786
245 Ga0207657_10109383 3300025919 Bacteria 2284
246 Ga0207649_10044580 3300025920 Bacteria 2716
247 Ga0207649_10281780 3300025920 Bacteria 1209
248 Ga0207646_10469854 3300025922 Bacteria 1134
249 Ga0207681_10048400 3300025923 Bacteria 2869
250 Ga0207694_10005550 3300025924 Bacteria 9668
251 Ga0207694_10054135 3300025924 Bacteria 3113
252 Ga0207694_10530550 3300025924 Bacteria 987
253 Ga0207650_10257656 3300025925 Bacteria 1414
254 Ga0207650_10476427 3300025925 Bacteria 1041
255 Ga0207659_10014234 3300025926 Bacteria 5121
256 Ga0207659_10346553 3300025926 Bacteria 1231
257 Ga0207644_10000392 3300025931 Bacteria 28471
258 Ga0207690_10000029 3300025932 Bacteria 160406
259 Ga0207690_10008231 3300025932 Bacteria 6185
260 Ga0207690_10109320 3300025932 Bacteria 1989
261 Ga0207706_10010426 3300025933 Bacteria 8490
262 Ga0207709_10013152 3300025935 Bacteria 4565
263 Ga0207669_10321809 3300025937 Bacteria 1184
264 Ga0207691_10012083 3300025940 Bacteria 8281
265 Ga0207691_10026762 3300025940 Bacteria 5412
266 Ga0207691_10032575 3300025940 Bacteria 4859
267 Ga0207691_10151221 3300025940 Bacteria 2041
268 Ga0207691_10153293 3300025940 Bacteria 2025
269 Ga0207711_10003165 3300025941 Bacteria 14351
270 Ga0207711_10061080 3300025941 Bacteria 3249
271 Ga0207711_10129829 3300025941 Bacteria 2258
272 Ga0207689_10000550 3300025942 Bacteria 35746
273 Ga0207689_10109199 3300025942 Bacteria 2273
274 Ga0207679_10044751 3300025945 Bacteria 3196
275 Ga0207679_10501911 3300025945 Bacteria 1083
276 Ga0207667_10006345 3300025949 Bacteria 14335
277 Ga0207667_10055440 3300025949 Bacteria 4167
278 Ga0207651_10018745 3300025960 Bacteria 4128
279 Ga0207651_10390749 3300025960 Bacteria 1181
280 Ga0207712_10227369 3300025961 Bacteria 1495
281 Ga0207668_10079114 3300025972 Bacteria 2377
282 Ga0207640_10240210 3300025981 Bacteria 1399
283 Ga0207640_10501040 3300025981 Bacteria 1011
284 Ga0207658_10130856 3300025986 Bacteria 2016
285 Ga0207677_10068986 3300026023 Bacteria 2484
286 Ga0207677_10133597 3300026023 Bacteria 1888
287 Ga0207703_10141411 3300026035 Bacteria 2089
288 Ga0207639_10070327 3300026041 Bacteria 2733
289 Ga0207639_10170379 3300026041 Bacteria 1843
290 Ga0207678_10036125 3300026067 Bacteria 4301
291 Ga0207678_10170964 3300026067 Bacteria 1855
292 Ga0207678_10210428 3300026067 Bacteria 1663
293 Ga0207702_10008513 3300026078 Bacteria 8649
294 Ga0207641_10050151 3300026088 Bacteria 3530
295 Ga0207641_10138229 3300026088 Bacteria 2195
296 Ga0207648_10104753 3300026089 Bacteria 2481
297 Ga0207674_10031664 3300026116 Bacteria 5553
298 Ga0207674_10056720 3300026116 Bacteria 3975
299 Ga0207675_100000576 3300026118 Bacteria 35873
300 Ga0207683_10017139 3300026121 Bacteria 6167
301 Ga0207683_10019815 3300026121 Bacteria 5746
302 Ga0207683_10042404 3300026121 Bacteria 3975
303 Ga0207683_10052369 3300026121 Bacteria 3576
304 Ga0207683_10071900 3300026121 Bacteria 3059
305 Ga0207683_10172797 3300026121 Bacteria 1958
306 Ga0207698_10039709 3300026142 Bacteria 3489
307 Ga0207698_10410848 3300026142 Bacteria 1296
308 Ga0209974_10035856 3300027876 Bacteria 1647
309 Ga0207428_10014971 3300027907 Bacteria 6721
310 Ga0307517_10007185 3300028786 Bacteria 16312
311 Ga0307515_10000525 3300028794 Bacteria 91297
312 Ga0265338_10000191 3300028800 Bacteria 115408
313 Ga0265338_10021618 3300028800 Bacteria 6700
314 Ga0268256_1003074 3300030500 Bacteria 7819
315 Ga0265340_10035668 3300031247 Bacteria 2470
316 Ga0265340_10076910 3300031247 Bacteria 1576
317 Ga0307513_10000011 3300031456 Bacteria 354929
318 Ga0307513_10183020 3300031456 Bacteria 1956
319 Ga0307513_10194937 3300031456 Bacteria 1873
320 Ga0307509_10106685 3300031507 Bacteria 2819
321 Ga0307509_10360711 3300031507 Bacteria 1173
322 Ga0307408_100022895 3300031548 Bacteria 4251
323 Ga0307508_10159040 3300031616 Bacteria 1863
324 Ga0307516_10220884 3300031730 Bacteria 1604
325 Ga0307412_10000002 3300031911 Bacteria 743446
326 Ga0307412_10442626 3300031911 Bacteria 1068
327 Ga0307414_10327325 3300032004 Bacteria 1307
328 Ga0307510_10010761 3300033180 Bacteria 10880
329 Ga0307510_10029893 3300033180 Bacteria 6189
330 Ga0373941_0085855 3300035115 Bacteria 1071
331 Ga0373942_0061684 3300035207 Bacteria 1076
332 Ga0373962_0026751 3300035242 Bacteria 1557
333 Ga0373924_0097278 3300035410 Bacteria 1264
334 Ga0373931_0002282 3300035691 Bacteria 8477
335 Ga0373935_0035034 3300035692 Bacteria 3132
336 Ga0373947_0046995 3300035725 Bacteria 2586
337 Ga0373925_0050253 3300037068 Bacteria 3110
338 Ga0395899_0000203 3300037312 Bacteria 87248
339 Ga0395900_0000233 3300037418 Bacteria 87254
340 Ga0395900_0004885 3300037418 Bacteria 14116
341 Ga0395900_0157074 3300037418 Bacteria 2323
342 Ga0395898_0000201 3300037466 Bacteria 153821
343 Ga0395898_0000722 3300037466 Bacteria 58151
344 Ga0395898_0005186 3300037466 Bacteria 14091
345 Ga0395898_0006940 3300037466 Bacteria 12039
346 Ga0395905_0000157 3300037471 Bacteria 112004
347 Ga0395905_0002320 3300037471 Bacteria 21297
348 Ga0395905_0019997 3300037471 Bacteria 6344
349 Ga0395905_0692179 3300037471 Bacteria 922
350 Ga0395901_0000144 3300038443 Bacteria 91753
351 Ga0395901_0070109 3300038443 Bacteria 3651
352 Ga0395901_0161585 3300038443 Bacteria 2352
353 Ga0400488_42310 3300038741 Bacteria 2100
354 Ga0439449_0108508 3300042007 Bacteria 1028
355 Ga0466969_0000232 3300044656 Bacteria 30397
356 Ga0466969_0015812 3300044656 Bacteria 3955
357 Ga0466973_0093852 3300044659 Bacteria 2573
358 Ga0466965_0000082 3300044683 Bacteria 27799
359 Ga0466965_0053780 3300044683 Bacteria 2002
360 Ga0466966_0036290 3300044684 Bacteria 3183
361 Ga0466966_0044541 3300044684 Bacteria 2840
362 Ga0466961_0000229 3300044693 Bacteria 37957
363 Ga0466961_0086891 3300044693 Bacteria 1976
364 Ga0466963_0005033 3300044694 Bacteria 7722
365 Ga0466971_0004861 3300044719 Bacteria 5813
366 Ga0466970_0087915 3300044765 Bacteria 1685
367 Ga0466957_0005060 3300044842 Bacteria 7379
368 Ga0466959_0013955 3300045049 Bacteria 5832
369 Ga0451576_0139943 3300045051 Bacteria 2524
370 Ga0451576_0249911 3300045051 Bacteria 1853
371 Ga0466958_0013651 3300045836 Bacteria 4629
372 Ga0495592_0000142 3300046454 Bacteria 63571
373 Ga0495592_0002963 3300046454 Bacteria 12082
374 Ga0495603_0010016 3300046455 Bacteria 5734
375 Ga0495603_0067853 3300046455 Bacteria 2098
376 Ga0495590_0009231 3300046457 Bacteria 3743
377 Ga0495590_0018317 3300046457 Bacteria 2507
378 Ga0495590_0105361 3300046457 Bacteria 1004
379 Ga0495591_004866 3300046458 Bacteria 6398
380 Ga0495591_076876 3300046458 Bacteria 857
381 Ga0495629_0000068 3300046459 Bacteria 92619
382 Ga0495629_0000662 3300046459 Bacteria 27832
383 Ga0495629_0008157 3300046459 Bacteria 7703
384 Ga0495629_0029086 3300046459 Bacteria 3921
385 Ga0495629_0210114 3300046459 Bacteria 1344
386 Ga0495629_0363658 3300046459 Bacteria 986
387 Ga0495638_0014841 3300046460 Bacteria 5252
388 Ga0495638_0049446 3300046460 Bacteria 2629
389 Ga0495641_0014143 3300046461 Bacteria 4333
390 Ga0495641_0107956 3300046461 Bacteria 1242
391 Ga0495651_0027843 3300046462 Bacteria 4404
392 Ga0495651_0159127 3300046462 Bacteria 1620
393 Ga0495653_0006423 3300046463 Bacteria 9636
394 Ga0495653_0018524 3300046463 Bacteria 5652
395 Ga0495653_0121450 3300046463 Bacteria 1861
396 Ga0495653_0244834 3300046463 Bacteria 1193
397 Ga0495650_0000155 3300046471 Bacteria 155947
398 Ga0495650_0009077 3300046471 Bacteria 5705
399 Ga0495650_0013638 3300046471 Bacteria 4285
400 Ga0495650_0019517 3300046471 Bacteria 3333
401 Ga0495650_0028122 3300046471 Bacteria 2587
402 Ga0495650_0034120 3300046471 Bacteria 2257
403 Ga0495580_0001817 3300046472 Bacteria 18776
404 Ga0495580_0002260 3300046472 Bacteria 16818
405 Ga0495580_0002859 3300046472 Bacteria 14860
406 Ga0495580_0003220 3300046472 Bacteria 13966
407 Ga0495580_0005202 3300046472 Bacteria 10810
408 Ga0495580_0019602 3300046472 Bacteria 5025
409 Ga0495580_0065112 3300046472 Bacteria 2553
410 Ga0495580_0167700 3300046472 Bacteria 1518
411 Ga0495580_0171931 3300046472 Bacteria 1498
412 Ga0495580_0251421 3300046472 Bacteria 1210
413 Ga0495582_0010344 3300046473 Bacteria 5133
414 Ga0495582_0027116 3300046473 Bacteria 3139
415 Ga0495582_0104404 3300046473 Bacteria 1588
416 Ga0495605_0003476 3300046474 Bacteria 9371
417 Ga0495605_0005346 3300046474 Bacteria 7484
418 Ga0495605_0011742 3300046474 Bacteria 4875
419 Ga0495605_0080555 3300046474 Bacteria 1524
420 Ga0495662_0014406 3300046476 Bacteria 3846
421 Ga0495662_0028255 3300046476 Bacteria 2708
422 Ga0495662_0084977 3300046476 Bacteria 1541
423 Ga0495664_0025316 3300046477 Bacteria 3454
424 Ga0495664_0026141 3300046477 Bacteria 3400
425 Ga0495664_0042592 3300046477 Bacteria 2689
426 Ga0495664_0288974 3300046477 Bacteria 990
427 Ga0495584_0067639 3300046491 Bacteria 1795
428 Ga0495585_0078174 3300046492 Bacteria 1795
429 Ga0495594_0034875 3300046499 Bacteria 2739
430 Ga0495596_0002466 3300046500 Bacteria 9944
431 Ga0495596_0004389 3300046500 Bacteria 6885
432 Ga0495596_0104689 3300046500 Bacteria 1099
433 Ga0495607_0175307 3300046501 Bacteria 1079
434 Ga0495583_0010866 3300046506 Bacteria 5266
435 Ga0495583_0015678 3300046506 Bacteria 4107
436 Ga0495583_0039756 3300046506 Bacteria 2213
437 Ga0495606_0007997 3300046507 Bacteria 9299
438 Ga0495606_0089929 3300046507 Bacteria 1890
439 Ga0495606_0134284 3300046507 Bacteria 1467
440 Ga0495606_0139488 3300046507 Bacteria 1433
441 Ga0495608_0001012 3300046511 Bacteria 19796
442 Ga0495608_0047409 3300046511 Bacteria 2857
443 Ga0495608_0133633 3300046511 Bacteria 1586
444 Ga0495610_0003374 3300046512 Bacteria 12492
445 Ga0495610_0043589 3300046512 Bacteria 2234
446 Ga0495616_0052034 3300046513 Bacteria 2040
447 Ga0495616_0058344 3300046513 Bacteria 1901
448 Ga0495618_0001130 3300046514 Bacteria 18033
449 Ga0495618_0045549 3300046514 Bacteria 2767
450 Ga0495620_0014380 3300046515 Bacteria 4024
451 Ga0495620_0044150 3300046515 Bacteria 1938
452 Ga0495620_0082293 3300046515 Bacteria 1301
453 Ga0495620_0124961 3300046515 Bacteria 1012
454 Ga0495628_0005223 3300046516 Bacteria 11398
455 Ga0495628_0010662 3300046516 Bacteria 7787
456 Ga0495628_0012117 3300046516 Bacteria 7268
457 Ga0495628_0032140 3300046516 Bacteria 4239
458 Ga0495628_0049860 3300046516 Bacteria 3313
459 Ga0495628_0085338 3300046516 Bacteria 2449
460 Ga0495628_0095157 3300046516 Bacteria 2301
461 Ga0495630_0006020 3300046517 Bacteria 8585
462 Ga0495630_0013709 3300046517 Bacteria 5894
463 Ga0495630_0016286 3300046517 Bacteria 5431
464 Ga0495630_0167455 3300046517 Bacteria 1673
465 Ga0495643_0046130 3300046522 Bacteria 2364
466 Ga0495643_0118131 3300046522 Bacteria 1342
467 Ga0495644_0013611 3300046523 Bacteria 3120
468 Ga0495644_0082320 3300046523 Bacteria 1213
469 Ga0495648_0006327 3300046524 Bacteria 9685
470 Ga0495648_0043992 3300046524 Bacteria 2792
471 Ga0495648_0063606 3300046524 Bacteria 2177
472 Ga0495648_0074152 3300046524 Bacteria 1961
473 Ga0495648_0139547 3300046524 Bacteria 1277
474 Ga0495648_0212006 3300046524 Bacteria 961
475 Ga0495666_0000438 3300046526 Bacteria 18485
476 Ga0495666_0002524 3300046526 Bacteria 9090
477 Ga0495666_0012255 3300046526 Bacteria 4275
478 Ga0495666_0030746 3300046526 Bacteria 2633
479 Ga0495666_0119741 3300046526 Bacteria 1233
480 Ga0495666_0168116 3300046526 Bacteria 1015
481 Ga0495642_0005060 3300046528 Bacteria 5078
482 Ga0495642_0031563 3300046528 Bacteria 2124
483 Ga0495642_0040738 3300046528 Bacteria 1888
484 Ga0495652_0001699 3300046529 Bacteria 23777
485 Ga0495652_0015047 3300046529 Bacteria 6929
486 Ga0495652_0044531 3300046529 Bacteria 3820
487 Ga0495652_0083740 3300046529 Bacteria 2624
488 Ga0495652_0244804 3300046529 Bacteria 1332
489 Ga0495654_0006843 3300046530 Bacteria 6433
490 Ga0495665_0001450 3300046531 Bacteria 12718
491 Ga0495665_0011982 3300046531 Bacteria 4693
492 Ga0495665_0228708 3300046531 Bacteria 960
493 Ga0495640_0012116 3300046533 Bacteria 6603
494 Ga0495640_0032364 3300046533 Bacteria 3725
495 Ga0495640_0035452 3300046533 Bacteria 3531
496 Ga0495586_0037783 3300046535 Bacteria 2592
497 Ga0495587_0032929 3300046536 Bacteria 3130
498 Ga0495587_0044503 3300046536 Bacteria 2640
499 Ga0495597_0080253 3300046542 Bacteria 1396
500 Ga0495645_0000045 3300046543 Bacteria 89793
501 Ga0495645_0011401 3300046543 Bacteria 6254
502 Ga0495645_0014740 3300046543 Bacteria 5552
503 Ga0495622_0000005 3300046557 Bacteria 254434
504 Ga0495622_0169663 3300046557 Bacteria 981
505 Ga0495634_0037410 3300046642 Bacteria 3315
506 Ga0495634_0057254 3300046642 Bacteria 2602
507 Ga0495611_0062364 3300046648 Bacteria 1696
508 Ga0495625_0013439 3300046660 Bacteria 6580
509 Ga0495625_0080834 3300046660 Bacteria 2263
510 Ga0495625_0177615 3300046660 Bacteria 1418
511 Ga0495635_0008309 3300046663 Bacteria 7245
512 Ga0495635_0012101 3300046663 Bacteria 6048
513 Ga0495635_0019842 3300046663 Bacteria 4683
514 Ga0495635_0057370 3300046663 Bacteria 2679
515 Ga0495599_0052079 3300046678 Bacteria 2564
516 Ga0495599_0066671 3300046678 Bacteria 2248
517 Ga0495599_0165863 3300046678 Bacteria 1364
518 Ga0495623_0002188 3300046679 Bacteria 13035
519 Ga0495623_0023150 3300046679 Bacteria 4008
520 Ga0495623_0025270 3300046679 Bacteria 3826
521 Ga0495623_0167627 3300046679 Bacteria 1285
522 Ga0495646_0008890 3300046680 Bacteria 6380
523 Ga0495646_0011375 3300046680 Bacteria 5650
524 Ga0495646_0047204 3300046680 Bacteria 2622
525 Ga0495646_0079349 3300046680 Bacteria 1916
526 Ga0495646_0157674 3300046680 Bacteria 1258
527 Ga0495669_0007072 3300046684 Bacteria 4699
528 Ga0495669_0046922 3300046684 Bacteria 1929
529 Ga0495669_0053059 3300046684 Bacteria 1823
530 Ga0495669_0220059 3300046684 Bacteria 910
531 Ga0495613_0023284 3300046689 Bacteria 4613
532 Ga0495613_0076974 3300046689 Bacteria 2427
533 Ga0495624_0001622 3300046690 Bacteria 17246
534 Ga0495624_0002636 3300046690 Bacteria 13543
535 Ga0495624_0002917 3300046690 Bacteria 12783
536 Ga0495624_0009333 3300046690 Bacteria 6796
537 Ga0495624_0223820 3300046690 Bacteria 1140
538 Ga0495624_0402638 3300046690 Bacteria 821
539 Ga0495671_0100248 3300046692 Bacteria 1416
540 Ga0495671_0172999 3300046692 Bacteria 1049
541 Ga0495671_0197754 3300046692 Bacteria 975
542 Ga0495649_0003998 3300046694 Bacteria 9719
543 Ga0495649_0024276 3300046694 Bacteria 3381
544 Ga0495649_0034384 3300046694 Bacteria 2788
545 Ga0495649_0178311 3300046694 Bacteria 1109
546 Ga0495589_0002911 3300046794 Bacteria 9457
547 Ga0495589_0009528 3300046794 Bacteria 5047
548 Ga0495589_0038022 3300046794 Bacteria 2410
549 Ga0495589_0071419 3300046794 Bacteria 1696
550 Ga0495600_0006217 3300046809 Bacteria 7245
551 Ga0495600_0011428 3300046809 Bacteria 5530
552 Ga0495600_0035843 3300046809 Bacteria 3224
553 Ga0495600_0072139 3300046809 Bacteria 2256
554 Ga0495660_0030746 3300046810 Bacteria 3024
555 Ga0495660_0098835 3300046810 Bacteria 1505
556 Ga0495660_0144117 3300046810 Bacteria 1182
557 Ga0495660_0150485 3300046810 Bacteria 1149
558 Ga0495581_0003152 3300047315 Bacteria 9438
559 Ga0495581_0053089 3300047315 Bacteria 2341
560 Ga0495581_0147953 3300047315 Bacteria 1371
561 Ga0495604_0003834 3300047317 Bacteria 11974
562 Ga0495604_0004152 3300047317 Bacteria 11499
563 Ga0495604_0004786 3300047317 Bacteria 10728
564 Ga0495604_0010331 3300047317 Bacteria 7395
565 Ga0495604_0012062 3300047317 Bacteria 6871
566 Ga0495604_0075846 3300047317 Bacteria 2530
567 Ga0495604_0105976 3300047317 Bacteria 2057
568 Ga0495636_0009936 3300047318 Bacteria 3748
569 Ga0495674_0006553 3300047319 Bacteria 11171
570 Ga0495674_0020301 3300047319 Bacteria 6154
571 Ga0495674_0023154 3300047319 Bacteria 5725
572 Ga0495674_0029686 3300047319 Bacteria 4977
573 Ga0495674_0041504 3300047319 Bacteria 4109
574 Ga0495674_0173458 3300047319 Bacteria 1799
575 Ga0495674_0181558 3300047319 Bacteria 1752
576 Ga0495674_0248726 3300047319 Bacteria 1463
577 Ga0495674_0328025 3300047319 Bacteria 1245
578 Ga0495674_0376325 3300047319 Bacteria 1149
579 Ga0495674_0462206 3300047319 Bacteria 1018
580 Ga0495672_0045865 3300047320 Bacteria 2611
581 Ga0495672_0120030 3300047320 Bacteria 1399
582 Ga0495676_0026798 3300047321 Bacteria 4953
583 Ga0495676_0099354 3300047321 Bacteria 2157
584 Ga0495676_0174983 3300047321 Bacteria 1508
585 Ga0495676_0365596 3300047321 Bacteria 962
586 Ga0495680_0005170 3300047322 Bacteria 12306
587 Ga0495680_0005562 3300047322 Bacteria 11828
588 Ga0495680_0010291 3300047322 Bacteria 8343
589 Ga0495680_0021548 3300047322 Bacteria 5393
590 Ga0495680_0054024 3300047322 Bacteria 3121
591 Ga0495680_0057319 3300047322 Bacteria 3013
592 Ga0495680_0300769 3300047322 Bacteria 1126
593 Ga0495683_0001115 3300047323 Bacteria 18552
594 Ga0495683_0001532 3300047323 Bacteria 14984
595 Ga0495683_0003052 3300047323 Bacteria 9840
596 Ga0495683_0007950 3300047323 Bacteria 5692
597 Ga0495683_0023725 3300047323 Bacteria 3152
598 Ga0495683_0062477 3300047323 Bacteria 1842
599 Ga0495683_0099523 3300047323 Bacteria 1399
600 Ga0495687_000051 3300047443 Bacteria 200568
601 Ga0495687_009807 3300047443 Bacteria 5317
602 Ga0495687_010322 3300047443 Bacteria 5127
603 Ga0495687_017693 3300047443 Bacteria 3543
604 Ga0495687_022881 3300047443 Bacteria 2993
605 Ga0495687_040885 3300047443 Bacteria 2039
606 Ga0495687_057441 3300047443 Bacteria 1618
607 Ga0495675_0001723 3300047444 Bacteria 13085
608 Ga0495675_0032099 3300047444 Bacteria 3351
609 Ga0495675_0055987 3300047444 Bacteria 2501
610 Ga0495675_0061429 3300047444 Bacteria 2380
611 Ga0495675_0079787 3300047444 Bacteria 2061
612 Ga0495675_0160302 3300047444 Bacteria 1385
613 Ga0495675_0196204 3300047444 Bacteria 1230
614 Ga0495679_000009 3300047446 Bacteria 343637
615 Ga0495679_003419 3300047446 Bacteria 7640
616 Ga0495679_061355 3300047446 Bacteria 1101
617 Ga0495673_0025699 3300047469 Bacteria 2823
618 Ga0495684_0061781 3300047471 Bacteria 2850
619 Ga0495684_0119704 3300047471 Bacteria 1984
620 Ga0495686_0198355 3300047472 Bacteria 1153
621 Ga0495593_0001510 3300047673 Bacteria 13683
622 Ga0495593_0002335 3300047673 Bacteria 11391
623 Ga0495593_0025682 3300047673 Bacteria 3260
624 Ga0495593_0043670 3300047673 Bacteria 2400
625 Ga0495602_0004008 3300048088 Bacteria 15340
626 Ga0495602_0006361 3300048088 Bacteria 12386
627 Ga0495602_0008808 3300048088 Bacteria 10522
628 Ga0495602_0022428 3300048088 Bacteria 6179
629 Ga0495602_0034549 3300048088 Bacteria 4729
630 Ga0495602_0123052 3300048088 Bacteria 2083
631 Ga0495602_0131183 3300048088 Bacteria 1998
632 Ga0495602_0143567 3300048088 Bacteria 1886
633 Ga0495614_0001260 3300048089 Bacteria 10884
634 Ga0495614_0038232 3300048089 Bacteria 2060
635 Ga0495626_0003050 3300048091 Bacteria 10998
636 Ga0495626_0018733 3300048091 Bacteria 3469
637 Ga0495626_0035616 3300048091 Bacteria 2375
638 Ga0495626_0067804 3300048091 Bacteria 1610
639 Ga0496100_0030789 3300048903 Bacteria 3331
640 Ga0496100_0045519 3300048903 Bacteria 2816
641 Ga0496100_0071996 3300048903 Bacteria 2309
642 Ga0496100_0075322 3300048903 Bacteria 2263
643 Ga0496100_0083907 3300048903 Bacteria 2158
644 Ga0496101_0002488 3300048904 Bacteria 11318
645 Ga0496101_0040464 3300048904 Bacteria 3319
646 Ga0496101_0054637 3300048904 Bacteria 2883
647 Ga0496101_0084234 3300048904 Bacteria 2354
648 Ga0496101_0111543 3300048904 Bacteria 2059
649 Ga0496102_0015576 3300048905 Bacteria 6624
650 Ga0496102_0028105 3300048905 Bacteria 5026
651 Ga0496102_0048665 3300048905 Bacteria 3854
652 Ga0496102_0086645 3300048905 Bacteria 2893
653 Ga0496102_0133926 3300048905 Bacteria 2321
654 Ga0496103_0001364 3300048906 Bacteria 16468
655 Ga0496103_0007406 3300048906 Bacteria 6540
656 Ga0496104_0040881 3300048907 Bacteria 4347
657 Ga0496104_0078406 3300048907 Bacteria 3148
658 Ga0496104_0164534 3300048907 Bacteria 2127
659 Ga0496104_0203008 3300048907 Bacteria 1894
660 Ga0496104_0240679 3300048907 Bacteria 1722
661 Ga0496105_0014366 3300048908 Bacteria 6301
662 Ga0496105_0190781 3300048908 Bacteria 1675
663 Ga0496105_0267795 3300048908 Bacteria 1380
664 Ga0496106_0000010 3300048909 Bacteria 232347
665 Ga0496106_0001335 3300048909 Bacteria 18490
666 Ga0496106_0007766 3300048909 Bacteria 7936
667 Ga0496106_0158591 3300048909 Bacteria 1788
668 Ga0496106_0262101 3300048909 Bacteria 1383
669 Ga0496107_0040403 3300048910 Bacteria 3348
670 Ga0496107_0042712 3300048910 Bacteria 3256
671 Ga0496107_0131393 3300048910 Bacteria 1848
672 Ga0496108_0063235 3300048911 Bacteria 3117
673 Ga0496108_0357990 3300048911 Bacteria 1273
674 Ga0496109_0020549 3300048912 Bacteria 5832
675 Ga0496109_0217732 3300048912 Bacteria 1796
676 Ga0496110_0019939 3300048913 Bacteria 5652
677 Ga0496110_0095738 3300048913 Bacteria 2659
678 Ga0496110_0315233 3300048913 Bacteria 1424
679 Ga0496111_0039607 3300048914 Bacteria 3380
680 Ga0496111_0134034 3300048914 Bacteria 1834
681 Ga0496112_0035917 3300048915 Bacteria 4830
682 Ga0496112_0057459 3300048915 Bacteria 3830
683 Ga0496112_0169736 3300048915 Bacteria 2147
684 Ga0496113_0007496 3300048916 Bacteria 7028
685 Ga0496113_0362199 3300048916 Bacteria 1163
686 Ga0496114_0000403 3300048917 Bacteria 31960
687 Ga0496114_0067003 3300048917 Bacteria 3011
688 Ga0496115_0038592 3300048918 Bacteria 3790
689 Ga0496115_0047951 3300048918 Bacteria 3417
690 Ga0496115_0136774 3300048918 Bacteria 2020
691 Ga0496116_0012547 3300048919 Bacteria 6914
692 Ga0496116_0026783 3300048919 Bacteria 4207
693 Ga0496116_0058750 3300048919 Bacteria 2505
694 Ga0496117_0001592 3300048920 Bacteria 32118
695 Ga0496117_0001963 3300048920 Bacteria 27350
696 Ga0496117_0004398 3300048920 Bacteria 15595
697 Ga0496117_0011858 3300048920 Bacteria 7756
698 Ga0496117_0019150 3300048920 Bacteria 5633
699 Ga0496117_0080808 3300048920 Bacteria 2136
700 Ga0496117_0294637 3300048920 Bacteria 862
701 Ga0496118_0001562 3300048921 Bacteria 34004
702 Ga0496118_0001704 3300048921 Bacteria 32149
703 Ga0496118_0001971 3300048921 Bacteria 29134
704 Ga0496118_0002437 3300048921 Bacteria 25046
705 Ga0496118_0003290 3300048921 Bacteria 20560
706 Ga0496118_0008219 3300048921 Bacteria 10832
707 Ga0496118_0019471 3300048921 Bacteria 6064
708 Ga0496118_0021702 3300048921 Bacteria 5642
709 Ga0496118_0077431 3300048921 Bacteria 2359
710 Ga0496118_0152458 3300048921 Bacteria 1444
711 Ga0496119_0063981 3300048922 Bacteria 2186
712 Ga0496119_0213985 3300048922 Bacteria 990
713 Ga0496120_0105905 3300048923 Bacteria 1478
714 Ga0496121_0002486 3300048924 Bacteria 28054
715 Ga0496121_0006106 3300048924 Bacteria 15152
716 Ga0496121_0006275 3300048924 Bacteria 14866
717 Ga0496121_0024985 3300048924 Bacteria 5690
718 Ga0496121_0188038 3300048924 Bacteria 1483
719 Ga0496121_0208267 3300048924 Bacteria 1387
720 Ga0496122_0002222 3300048925 Bacteria 28327
721 Ga0496122_0046426 3300048925 Bacteria 3364
722 Ga0496122_0183193 3300048925 Bacteria 1246
723 Ga0496123_0000903 3300048926 Bacteria 46887
724 Ga0496123_0028624 3300048926 Bacteria 4119
725 Ga0496123_0126677 3300048926 Bacteria 1424
726 Ga0496124_0050922 3300048927 Bacteria 3526
727 Ga0496124_0152308 3300048927 Bacteria 1812
728 Ga0496125_0010341 3300048928 Bacteria 9439
729 Ga0496126_0000193 3300048929 Bacteria 136394
730 Ga0496126_0000337 3300048929 Bacteria 98585
731 Ga0496126_0000475 3300048929 Bacteria 79715
732 Ga0496126_0010301 3300048929 Bacteria 9817
733 Ga0496126_0112074 3300048929 Bacteria 2376
734 Ga0495682_0024617 3300049460 Bacteria 2243
735 Ga0495682_0043883 3300049460 Bacteria 1636
736 Ga0501032_0188592 3300049569 Unclassified 1348
737 Ga0501043_0009431 3300049579 Bacteria 7661
738 Ga0501047_0142826 3300049581 Bacteria 2272
739 Ga0501070_0491625 3300049586 Bacteria 986
740 Ga0501080_0018606 3300049742 Bacteria 6429
741 Ga0501044_0163507 3300049823 Bacteria 2201
742 Ga0501044_0596606 3300049823 Bacteria 998
743 nmdc:mga0yw44_114293_c1 3300050492 Bacteria 1732
744 nmdc:mga0k408_100319_c1 3300050493 Bacteria 1707
745 nmdc:mga0k408_113322_c1 3300050493 Bacteria 1604
746 nmdc:mga0k408_223927_c1 3300050493 Bacteria 1123
747 nmdc:mga0k408_63984_c1 3300050493 Bacteria 2140
748 nmdc:mga0k408_6516_c1 3300050493 Bacteria 6220
749 nmdc:mga06z11_19680_c1 3300050494 Bacteria 3108
750 nmdc:mga06z11_95428_c1 3300050494 Bacteria 1622
751 nmdc:mga07m45_4464_c1 3300050496 Bacteria 6846
752 nmdc:mga07m45_919_c1 3300050496 Bacteria 12885
753 nmdc:mga09592_85690_c1 3300050508 Bacteria 2687
754 nmdc:mga08y16_517421_c1 3300050511 Bacteria 1211
755 nmdc:mga0n895_516677_c1 3300050512 Bacteria 1202
756 nmdc:mga0n895_592094_c1 3300050512 Bacteria 1112
757 nmdc:mga0n895_6971_c1 3300050512 Bacteria 9648
758 nmdc:mga0a205_742132_c1 3300050515 Bacteria 831
759 nmdc:mga0sz30_11010_c1 3300050516 Bacteria 3480
760 Ga0495655_0017069 3300053083 Bacteria 1575
761 Ga0495595_0108287 3300053084 Bacteria 1346
762 Ga0495619_0024042 3300053085 Bacteria 3908
763 Ga0500647_0003099 3300053091 Bacteria 6391
764 Ga0500583_0004151 3300053092 Bacteria 4679
765 Ga0500572_000038 3300053111 Bacteria 42226
766 Ga0500652_027187 3300053131 Bacteria 2210
767 Ga0500655_011291 3300053133 Bacteria 1617
768 Ga0500559_0000014 3300053136 Bacteria 160139
769 Ga0500568_0016410 3300053139 Bacteria 3294
770 Ga0500622_0002290 3300053156 Bacteria 14025
771 Ga0500622_0153216 3300053156 Bacteria 1087
772 Ga0500587_011104 3300053739 Bacteria 1139
773 Ga0466962_0017319 3300061719 Bacteria 3469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10074401 Ga0075366_100744012 225
2 3300050493 nmdc:mga0k408_63984_c1 nmdc:mga0k408_63984_c1_816_1568 225
3 3300046476 Ga0495662_0084977 Ga0495662_0084977_389_1069 226
4 3300047317 Ga0495604_0105976 Ga0495604_0105976_1135_1887 227
5 3300048912 Ga0496109_0217732 Ga0496109_0217732_859_1542 227
6 3300013102 Ga0157371_10015829 Ga0157371_100158296 229
7 3300013105 Ga0157369_10000326 Ga0157369_1000032633 229
8 3300037466 Ga0395898_0000201 Ga0395898_0000201_138838_139590 229
9 3300038443 Ga0395901_0161585 Ga0395901_0161585_653_1405 229
10 3300050511 nmdc:mga08y16_517421_c1 nmdc:mga08y16_517421_c1_91_780 229
11 3300031456 Ga0307513_10000011 Ga0307513_1000001128 231
12 3300038443 Ga0395901_0070109 Ga0395901_0070109_1378_2130 231
13 3300047321 Ga0495676_0174983 Ga0495676_0174983_430_1182 231
14 3300003792 Ga0055540_1012288 Ga0055540_10122882 233
15 3300025303 Ga0209051_1000362 Ga0209051_100036231 233
16 3300046507 Ga0495606_0139488 Ga0495606_0139488_125_877 233
17 3300046524 Ga0495648_0139547 Ga0495648_0139547_385_1137 233
18 3300047319 Ga0495674_0376325 Ga0495674_0376325_311_1063 233
19 3300047320 Ga0495672_0120030 Ga0495672_0120030_102_854 233
20 3300053083 Ga0495655_0017069 Ga0495655_0017069_560_1312 233
21 3300009148 Ga0105243_10010046 Ga0105243_100100467 234
22 3300025935 Ga0207709_10013152 Ga0207709_100131522 234
23 3300046455 Ga0495603_0010016 Ga0495603_0010016_816_1568 234
24 3300046457 Ga0495590_0018317 Ga0495590_0018317_225_977 234
25 3300046459 Ga0495629_0000068 Ga0495629_0000068_22710_23462 234
26 3300046459 Ga0495629_0029086 Ga0495629_0029086_3130_3882 234
27 3300046460 Ga0495638_0014841 Ga0495638_0014841_2174_2926 234
28 3300046461 Ga0495641_0014143 Ga0495641_0014143_197_949 234
29 3300046462 Ga0495651_0159127 Ga0495651_0159127_472_1224 234
30 3300046463 Ga0495653_0018524 Ga0495653_0018524_4307_5059 234
31 3300046472 Ga0495580_0002859 Ga0495580_0002859_3362_4114 234
32 3300046473 Ga0495582_0010344 Ga0495582_0010344_3899_4651 234
33 3300046473 Ga0495582_0027116 Ga0495582_0027116_1848_2600 234
34 3300046474 Ga0495605_0005346 Ga0495605_0005346_3457_4209 234
35 3300046476 Ga0495662_0028255 Ga0495662_0028255_1344_2096 234
36 3300046499 Ga0495594_0034875 Ga0495594_0034875_1326_2078 234
37 3300046506 Ga0495583_0010866 Ga0495583_0010866_4349_5101 234
38 3300046514 Ga0495618_0045549 Ga0495618_0045549_361_1113 234
39 3300046516 Ga0495628_0010662 Ga0495628_0010662_1561_2313 234
40 3300046516 Ga0495628_0012117 Ga0495628_0012117_908_1660 234
41 3300046517 Ga0495630_0016286 Ga0495630_0016286_2792_3544 234
42 3300046524 Ga0495648_0074152 Ga0495648_0074152_166_918 234
43 3300046526 Ga0495666_0002524 Ga0495666_0002524_7830_8582 234
44 3300046528 Ga0495642_0040738 Ga0495642_0040738_724_1476 234
45 3300046531 Ga0495665_0228708 Ga0495665_0228708_103_855 234
46 3300046533 Ga0495640_0035452 Ga0495640_0035452_1035_1787 234
47 3300046535 Ga0495586_0037783 Ga0495586_0037783_634_1386 234
48 3300046536 Ga0495587_0032929 Ga0495587_0032929_385_1137 234
49 3300046642 Ga0495634_0037410 Ga0495634_0037410_2055_2807 234
50 3300046648 Ga0495611_0062364 Ga0495611_0062364_700_1452 234
51 3300046660 Ga0495625_0177615 Ga0495625_0177615_254_1006 234
52 3300046663 Ga0495635_0057370 Ga0495635_0057370_335_1087 234
53 3300046678 Ga0495599_0066671 Ga0495599_0066671_684_1436 234
54 3300046679 Ga0495623_0023150 Ga0495623_0023150_758_1510 234
55 3300046679 Ga0495623_0025270 Ga0495623_0025270_1232_1984 234
56 3300046680 Ga0495646_0079349 Ga0495646_0079349_349_1101 234
57 3300046689 Ga0495613_0023284 Ga0495613_0023284_1958_2710 234
58 3300046690 Ga0495624_0002917 Ga0495624_0002917_8604_9356 234
59 3300046690 Ga0495624_0223820 Ga0495624_0223820_40_792 234
60 3300046692 Ga0495671_0172999 Ga0495671_0172999_259_1011 234
61 3300047315 Ga0495581_0003152 Ga0495581_0003152_7732_8484 234
62 3300047317 Ga0495604_0004152 Ga0495604_0004152_8703_9455 234
63 3300047317 Ga0495604_0075846 Ga0495604_0075846_155_907 234
64 3300047319 Ga0495674_0248726 Ga0495674_0248726_163_915 234
65 3300047321 Ga0495676_0026798 Ga0495676_0026798_1461_2213 234
66 3300047321 Ga0495676_0365596 Ga0495676_0365596_106_858 234
67 3300047322 Ga0495680_0054024 Ga0495680_0054024_1862_2614 234
68 3300047322 Ga0495680_0300769 Ga0495680_0300769_147_899 234
69 3300047323 Ga0495683_0099523 Ga0495683_0099523_498_1250 234
70 3300047444 Ga0495675_0032099 Ga0495675_0032099_1172_1924 234
71 3300047444 Ga0495675_0061429 Ga0495675_0061429_1489_2241 234
72 3300047446 Ga0495679_000009 Ga0495679_000009_287684_288436 234
73 3300047446 Ga0495679_003419 Ga0495679_003419_6380_7132 234
74 3300047471 Ga0495684_0119704 Ga0495684_0119704_715_1467 234
75 3300047472 Ga0495686_0198355 Ga0495686_0198355_165_917 234
76 3300047673 Ga0495593_0043670 Ga0495593_0043670_100_852 234
77 3300048088 Ga0495602_0008808 Ga0495602_0008808_9248_10000 234
78 3300048088 Ga0495602_0022428 Ga0495602_0022428_2356_3108 234
79 3300048088 Ga0495602_0131183 Ga0495602_0131183_40_792 234
80 3300048089 Ga0495614_0001260 Ga0495614_0001260_4899_5651 234
81 3300048089 Ga0495614_0038232 Ga0495614_0038232_1270_2022 234
82 3300048091 Ga0495626_0018733 Ga0495626_0018733_2129_2881 234
83 3300048920 Ga0496117_0080808 Ga0496117_0080808_473_1225 234
84 3300048921 Ga0496118_0008219 Ga0496118_0008219_1002_1754 234
85 3300048924 Ga0496121_0006275 Ga0496121_0006275_711_1463 234
86 3300048929 Ga0496126_0112074 Ga0496126_0112074_702_1454 234
87 3300049460 Ga0495682_0043883 Ga0495682_0043883_370_1122 234
88 3300048905 Ga0496102_0086645 Ga0496102_0086645_1921_2673 237
89 3300048920 Ga0496117_0001963 Ga0496117_0001963_16237_16989 237
90 3300048921 Ga0496118_0002437 Ga0496118_0002437_15437_16189 237
91 3300048929 Ga0496126_0000193 Ga0496126_0000193_119639_120391 237
92 3300048925 Ga0496122_0002222 Ga0496122_0002222_17959_18711 239
93 3300048926 Ga0496123_0000903 Ga0496123_0000903_35282_36034 239
94 3300009011 Ga0105251_10000654 Ga0105251_100006547 240
95 3300025735 Ga0207713_1003352 Ga0207713_10033528 240
96 3300046471 Ga0495650_0034120 Ga0495650_0034120_1134_1886 240
97 3300046473 Ga0495582_0104404 Ga0495582_0104404_299_1051 240
98 3300046477 Ga0495664_0025316 Ga0495664_0025316_2414_3166 240
99 3300046511 Ga0495608_0001012 Ga0495608_0001012_42_794 240
100 3300046516 Ga0495628_0032140 Ga0495628_0032140_2586_3338 240
101 3300046526 Ga0495666_0119741 Ga0495666_0119741_93_845 240
102 3300046529 Ga0495652_0083740 Ga0495652_0083740_13_765 240
103 3300046557 Ga0495622_0000005 Ga0495622_0000005_94904_95656 240
104 3300046679 Ga0495623_0167627 Ga0495623_0167627_168_920 240
105 3300046809 Ga0495600_0006217 Ga0495600_0006217_169_921 240
106 3300047322 Ga0495680_0021548 Ga0495680_0021548_1996_2748 240
107 3300047444 Ga0495675_0160302 Ga0495675_0160302_390_1142 240
108 iso_pu_bacteria 2855020534 2855022103 240
109 3300048921 Ga0496118_0077431 Ga0496118_0077431_1589_2341 241
110 3300013105 Ga0157369_10055294 Ga0157369_100552943 242
111 3300017792 Ga0163161_10394363 Ga0163161_103943632 242
112 3300046463 Ga0495653_0244834 Ga0495653_0244834_326_1078 242
113 3300046516 Ga0495628_0049860 Ga0495628_0049860_2257_3009 242
114 3300046526 Ga0495666_0030746 Ga0495666_0030746_1331_2083 242
115 3300046529 Ga0495652_0244804 Ga0495652_0244804_168_920 242
116 3300046680 Ga0495646_0157674 Ga0495646_0157674_421_1173 242
117 3300047317 Ga0495604_0012062 Ga0495604_0012062_523_1275 242
118 3300047322 Ga0495680_0057319 Ga0495680_0057319_298_1050 242
119 3300047444 Ga0495675_0079787 Ga0495675_0079787_1028_1780 242
120 3300002705 JGI25156J39149_1000199 JGI25156J39149_100019920 243
121 3300025256 Ga0209759_1000002 Ga0209759_100000261 243
122 3300046472 Ga0495580_0167700 Ga0495580_0167700_247_999 243
123 3300046517 Ga0495630_0006020 Ga0495630_0006020_6469_7221 243
124 3300047319 Ga0495674_0328025 Ga0495674_0328025_379_1131 243
125 3300048929 Ga0496126_0000475 Ga0496126_0000475_13690_14442 243
126 3300005356 Ga0070674_100244923 Ga0070674_1002449232 246
127 3300028794 Ga0307515_10000525 Ga0307515_1000052561 246
128 3300031456 Ga0307513_10194937 Ga0307513_101949372 246
129 3300046458 Ga0495591_076876 Ga0495591_076876_76_822 246
130 iso_pu_bacteria 2501025501 2501072369 246
131 iso_pu_bacteria 2501025502 2501080040 246
132 iso_pu_bacteria 2501025504 2501412379 246
133 iso_pu_bacteria 2508501125 2509129609 246
134 iso_pu_bacteria 2510065045 2510249157 246
135 iso_pu_bacteria 2510917013 2511087924 246
136 iso_pu_bacteria 2510917014 2511101485 246
137 iso_pu_bacteria 2510917015 2511107912 246
138 iso_pu_bacteria 2512047030 2512352371 246
139 iso_pu_bacteria 2513237151 2513958710 246
140 iso_pu_bacteria 2513237166 2514049434 246
141 iso_pu_bacteria 2515154122 2515680512 246
142 iso_pu_bacteria 2515154123 2515687615 246
143 iso_pu_bacteria 2515154189 2516018198 246
144 iso_pu_bacteria 2526164713 2527076013 246
145 iso_pu_bacteria 2562617112 2563061380 246
146 iso_pu_bacteria 2585428057 2587727854 246
147 iso_pu_bacteria 2600255067 2600814146 246
148 iso_pu_bacteria 2711768613 2713476344 246
149 iso_pu_bacteria 2718217991 2719642434 246
150 iso_pu_bacteria 2738541296 2738820380 246
151 iso_pu_bacteria 2738541298 2738832860 246
152 iso_pu_bacteria 2738541306 2738874387 246
153 iso_pu_bacteria 2738543002 2739186017 246
154 iso_pu_bacteria 2738543008 2739220985 246
155 iso_pu_bacteria 2744054900 2746089821 246
156 iso_pu_bacteria 2744054901 2746098001 246
157 iso_pu_bacteria 2751185846 2753570735 246
158 iso_pu_bacteria 2791355137 2792837763 246
159 iso_pu_bacteria 2818991450 2819624522 246
160 iso_pu_bacteria 2842324504 2842329410 246
161 iso_pu_bacteria 2842348783 2842354491 246
162 iso_pu_bacteria 2842454564 2842456378 246
163 iso_pu_bacteria 2856287931 2856289887 246
164 iso_pu_bacteria 2857357740 2857363074 246
165 iso_pu_bacteria 2883087390 2883090393 246
166 iso_pu_bacteria 2885270888 2885277470 246
167 iso_pu_bacteria 2900634093 2900640604 246
168 iso_pu_bacteria 2902682994 2902687755 246
169 iso_pu_bacteria 2904483920 2904486467 246
170 iso_pu_bacteria 2904615490 2904621837 246
171 iso_pu_bacteria 2919527303 2919527812 246
172 iso_pu_bacteria 2928108538 2928108566 246
173 iso_pu_bacteria 2928135762 2928135790 246
174 iso_pu_bacteria 2928503688 2928508252 246
175 iso_pu_bacteria 2945934425 2945938839 246
176 iso_pu_bacteria 2990703756 2990708839 246
177 iso_pu_bacteria 641736151 642420986 246
178 iso_pu_bacteria 642555112 642595257 246
179 iso_pu_bacteria 642555113 642616764 246
180 iso_pu_bacteria 8055266321 8055270639 246
181 iso_pu_bacteria 8055301274 8055304466 246
182 3300005458 Ga0070681_10150995 Ga0070681_101509952 248
183 3300025912 Ga0207707_10285261 Ga0207707_102852613 248
184 3300005467 Ga0070706_100267178 Ga0070706_1002671782 249
185 3300025910 Ga0207684_10220226 Ga0207684_102202262 249
186 3300025937 Ga0207669_10321809 Ga0207669_103218091 249
187 3300001979 JGI24740J21852_10002892 JGI24740J21852_100028928 250
188 3300001989 JGI24739J22299_10002400 JGI24739J22299_100024008 250
189 3300001989 JGI24739J22299_10004739 JGI24739J22299_100047393 250
190 3300002067 JGI24735J21928_10000332 JGI24735J21928_100003325 250
191 3300002067 JGI24735J21928_10015757 JGI24735J21928_100157572 250
192 3300002705 JGI25156J39149_1000208 JGI25156J39149_100020839 250
193 3300002705 JGI25156J39149_1000209 JGI25156J39149_100020913 250
194 3300003214 JGI25165J46597_1001358 JGI25165J46597_10013583 250
195 3300003215 JGI25153J46596_10002472 JGI25153J46596_100024727 250
196 3300003354 JGI25160J50197_1006354 JGI25160J50197_10063544 250
197 3300003756 Ga0055533_1000232 Ga0055533_100023211 250
198 3300003756 Ga0055533_1000933 Ga0055533_100093310 250
199 3300003758 Ga0055532_1000011 Ga0055532_1000011192 250
200 3300003760 Ga0055527_1000009 Ga0055527_1000009191 250
201 3300003761 Ga0055535_1000008 Ga0055535_1000008177 250
202 3300003762 Ga0055542_1000014 Ga0055542_1000014177 250
203 3300003763 Ga0055529_1000010 Ga0055529_1000010177 250
204 3300003771 Ga0055526_1002114 Ga0055526_100211411 250
205 3300003781 Ga0055536_1000026 Ga0055536_1000026137 250
206 3300003784 Ga0055534_1001609 Ga0055534_10016094 250
207 3300003790 Ga0055528_1026862 Ga0055528_10268622 250
208 3300003792 Ga0055540_1022000 Ga0055540_10220002 250
209 3300005262 Ga0065165_1008403 Ga0065165_10084034 250
210 3300005293 Ga0065715_10129378 Ga0065715_101293781 250
211 3300005295 Ga0065707_10001895 Ga0065707_100018957 250
212 3300005327 Ga0070658_10001405 Ga0070658_100014052 250
213 3300005327 Ga0070658_10118069 Ga0070658_101180692 250
214 3300005327 Ga0070658_10282260 Ga0070658_102822601 250
215 3300005331 Ga0070670_100001840 Ga0070670_1000018405 250
216 3300005331 Ga0070670_100037169 Ga0070670_1000371696 250
217 3300005331 Ga0070670_100118387 Ga0070670_1001183874 250
218 3300005333 Ga0070677_10013220 Ga0070677_100132203 250
219 3300005334 Ga0068869_100011954 Ga0068869_1000119542 250
220 3300005337 Ga0070682_100203526 Ga0070682_1002035262 250
221 3300005338 Ga0068868_100120077 Ga0068868_1001200771 250
222 3300005338 Ga0068868_100166965 Ga0068868_1001669653 250
223 3300005338 Ga0068868_100407332 Ga0068868_1004073321 250
224 3300005338 Ga0068868_100502158 Ga0068868_1005021581 250
225 3300005339 Ga0070660_100000004 Ga0070660_10000000443 250
226 3300005344 Ga0070661_100004818 Ga0070661_1000048183 250
227 3300005347 Ga0070668_100104988 Ga0070668_1001049882 250
228 3300005353 Ga0070669_100000378 Ga0070669_1000003782 250
229 3300005354 Ga0070675_100015079 Ga0070675_1000150793 250
230 3300005354 Ga0070675_100055653 Ga0070675_1000556533 250
231 3300005355 Ga0070671_100004335 Ga0070671_1000043358 250
232 3300005355 Ga0070671_100229851 Ga0070671_1002298512 250
233 3300005355 Ga0070671_100578654 Ga0070671_1005786541 250
234 3300005356 Ga0070674_100023729 Ga0070674_1000237295 250
235 3300005364 Ga0070673_100006343 Ga0070673_1000063436 250
236 3300005364 Ga0070673_100051998 Ga0070673_1000519983 250
237 3300005366 Ga0070659_100000023 Ga0070659_10000002327 250
238 3300005366 Ga0070659_100008933 Ga0070659_1000089336 250
239 3300005366 Ga0070659_100125002 Ga0070659_1001250022 250
240 3300005366 Ga0070659_100143402 Ga0070659_1001434022 250
241 3300005438 Ga0070701_10235995 Ga0070701_102359951 250
242 3300005441 Ga0070700_100140206 Ga0070700_1001402062 250
243 3300005456 Ga0070678_100020258 Ga0070678_1000202583 250
244 3300005456 Ga0070678_100031159 Ga0070678_1000311592 250
245 3300005456 Ga0070678_100207393 Ga0070678_1002073932 250
246 3300005456 Ga0070678_100798821 Ga0070678_1007988211 250
247 3300005457 Ga0070662_100054070 Ga0070662_1000540702 250
248 3300005467 Ga0070706_100000271 Ga0070706_10000027128 250
249 3300005468 Ga0070707_100053914 Ga0070707_1000539141 250
250 3300005535 Ga0070684_100008207 Ga0070684_1000082072 250
251 3300005539 Ga0068853_100227396 Ga0068853_1002273962 250
252 3300005543 Ga0070672_100130322 Ga0070672_1001303223 250
253 3300005543 Ga0070672_100139104 Ga0070672_1001391043 250
254 3300005547 Ga0070693_100016242 Ga0070693_1000162425 250
255 3300005547 Ga0070693_100111813 Ga0070693_1001118132 250
256 3300005547 Ga0070693_100114911 Ga0070693_1001149112 250
257 3300005548 Ga0070665_100092825 Ga0070665_1000928252 250
258 3300005548 Ga0070665_100415694 Ga0070665_1004156942 250
259 3300005563 Ga0068855_100007936 Ga0068855_1000079363 250
260 3300005563 Ga0068855_100071618 Ga0068855_1000716184 250
261 3300005564 Ga0070664_100004354 Ga0070664_1000043546 250
262 3300005564 Ga0070664_100181683 Ga0070664_1001816832 250
263 3300005564 Ga0070664_100409567 Ga0070664_1004095672 250
264 3300005577 Ga0068857_100015285 Ga0068857_1000152856 250
265 3300005578 Ga0068854_100006013 Ga0068854_1000060135 250
266 3300005614 Ga0068856_100219106 Ga0068856_1002191062 250
267 3300005615 Ga0070702_100410249 Ga0070702_1004102491 250
268 3300005616 Ga0068852_100012297 Ga0068852_1000122976 250
269 3300005616 Ga0068852_100020522 Ga0068852_1000205222 250
270 3300005616 Ga0068852_100049509 Ga0068852_1000495092 250
271 3300005616 Ga0068852_100128234 Ga0068852_1001282343 250
272 3300005618 Ga0068864_100049553 Ga0068864_1000495532 250
273 3300005618 Ga0068864_100131611 Ga0068864_1001316112 250
274 3300005719 Ga0068861_100001865 Ga0068861_1000018659 250
275 3300005834 Ga0068851_10004511 Ga0068851_100045116 250
276 3300005834 Ga0068851_10014115 Ga0068851_100141152 250
277 3300005841 Ga0068863_100152637 Ga0068863_1001526373 250
278 3300005843 Ga0068860_100087569 Ga0068860_1000875693 250
279 3300005844 Ga0068862_100072538 Ga0068862_1000725384 250
280 3300006042 Ga0075368_10030664 Ga0075368_100306642 250
281 3300006042 Ga0075368_10094152 Ga0075368_100941521 250
282 3300006178 Ga0075367_10003415 Ga0075367_100034157 250
283 3300006186 Ga0075369_10002321 Ga0075369_100023216 250
284 3300006195 Ga0075366_10001538 Ga0075366_100015389 250
285 3300006195 Ga0075366_10005093 Ga0075366_100050935 250
286 3300006195 Ga0075366_10063701 Ga0075366_100637011 250
287 3300006237 Ga0097621_100066610 Ga0097621_1000666102 250
288 3300006237 Ga0097621_100297117 Ga0097621_1002971172 250
289 3300006237 Ga0097621_100315399 Ga0097621_1003153992 250
290 3300006353 Ga0075370_10000157 Ga0075370_100001576 250
291 3300006353 Ga0075370_10001313 Ga0075370_100013134 250
292 3300006353 Ga0075370_10018871 Ga0075370_100188714 250
293 3300006353 Ga0075370_10024875 Ga0075370_100248753 250
294 3300006358 Ga0068871_100039522 Ga0068871_1000395224 250
295 3300006358 Ga0068871_100060131 Ga0068871_1000601314 250
296 3300006358 Ga0068871_100113834 Ga0068871_1001138342 250
297 3300006358 Ga0068871_100275849 Ga0068871_1002758492 250
298 3300006871 Ga0075434_100004654 Ga0075434_1000046544 250
299 3300006871 Ga0075434_100196325 Ga0075434_1001963252 250
300 3300006871 Ga0075434_100489308 Ga0075434_1004893082 250
301 3300006880 Ga0075429_100104985 Ga0075429_1001049852 250
302 3300009011 Ga0105251_10000816 Ga0105251_100008167 250
303 3300009011 Ga0105251_10099615 Ga0105251_100996151 250
304 3300009036 Ga0105244_10078900 Ga0105244_100789002 250
305 3300009092 Ga0105250_10004967 Ga0105250_100049673 250
306 3300009093 Ga0105240_10002938 Ga0105240_1000293819 250
307 3300009093 Ga0105240_10018434 Ga0105240_100184343 250
308 3300009093 Ga0105240_10099453 Ga0105240_100994532 250
309 3300009093 Ga0105240_10324987 Ga0105240_103249871 250
310 3300009094 Ga0111539_10001639 Ga0111539_1000163914 250
311 3300009094 Ga0111539_10193872 Ga0111539_101938721 250
312 3300009094 Ga0111539_10264131 Ga0111539_102641312 250
313 3300009098 Ga0105245_10156052 Ga0105245_101560522 250
314 3300009101 Ga0105247_10353627 Ga0105247_103536271 250
315 3300009101 Ga0105247_10493248 Ga0105247_104932481 250
316 3300009174 Ga0105241_10223857 Ga0105241_102238572 250
317 3300009174 Ga0105241_10237052 Ga0105241_102370522 250
318 3300009177 Ga0105248_10045951 Ga0105248_100459511 250
319 3300009177 Ga0105248_10060337 Ga0105248_100603372 250
320 3300009177 Ga0105248_10074722 Ga0105248_100747222 250
321 3300009177 Ga0105248_10203080 Ga0105248_102030802 250
322 3300009177 Ga0105248_10479972 Ga0105248_104799722 250
323 3300009545 Ga0105237_10006766 Ga0105237_100067666 250
324 3300009545 Ga0105237_10007760 Ga0105237_100077608 250
325 3300009545 Ga0105237_10024983 Ga0105237_100249836 250
326 3300009545 Ga0105237_10038836 Ga0105237_100388364 250
327 3300009545 Ga0105237_10181999 Ga0105237_101819992 250
328 3300009545 Ga0105237_10220013 Ga0105237_102200132 250
329 3300009551 Ga0105238_10006338 Ga0105238_100063387 250
330 3300009551 Ga0105238_10010968 Ga0105238_100109682 250
331 3300009551 Ga0105238_10032852 Ga0105238_100328523 250
332 3300009551 Ga0105238_10244530 Ga0105238_102445302 250
333 3300009551 Ga0105238_10319875 Ga0105238_103198752 250
334 3300009551 Ga0105238_10580783 Ga0105238_105807831 250
335 3300009553 Ga0105249_10023626 Ga0105249_100236265 250
336 3300010375 Ga0105239_10004145 Ga0105239_1000414511 250
337 3300010375 Ga0105239_10158799 Ga0105239_101587992 250
338 3300013100 Ga0157373_10076687 Ga0157373_100766873 250
339 3300013104 Ga0157370_10008953 Ga0157370_100089537 250
340 3300013105 Ga0157369_10008064 Ga0157369_100080647 250
341 3300013105 Ga0157369_10048315 Ga0157369_100483155 250
342 3300013105 Ga0157369_10398390 Ga0157369_103983902 250
343 3300013306 Ga0163162_10027756 Ga0163162_100277562 250
344 3300013306 Ga0163162_10147222 Ga0163162_101472222 250
345 3300013306 Ga0163162_10159032 Ga0163162_101590322 250
346 3300013307 Ga0157372_10018776 Ga0157372_100187767 250
347 3300013307 Ga0157372_10040036 Ga0157372_100400363 250
348 3300013308 Ga0157375_10008280 Ga0157375_100082805 250
349 3300013308 Ga0157375_10010581 Ga0157375_100105817 250
350 3300013308 Ga0157375_10379925 Ga0157375_103799252 250
351 3300014325 Ga0163163_10324860 Ga0163163_103248602 250
352 3300014325 Ga0163163_10599417 Ga0163163_105994172 250
353 3300014325 Ga0163163_10744869 Ga0163163_107448691 250
354 3300014497 Ga0182008_10035841 Ga0182008_100358412 250
355 3300014497 Ga0182008_10046294 Ga0182008_100462943 250
356 3300015262 Ga0182007_10001190 Ga0182007_100011909 250
357 3300015262 Ga0182007_10040498 Ga0182007_100404982 250
358 3300015265 Ga0182005_1016050 Ga0182005_10160502 250
359 3300016635 Ga0183361_10005 Ga0183361_10005173 250
360 3300017792 Ga0163161_10056646 Ga0163161_100566462 250
361 3300017792 Ga0163161_10378753 Ga0163161_103787531 250
362 3300025206 Ga0209435_104039 Ga0209435_1040392 250
363 3300025226 Ga0209674_100011 Ga0209674_100011722 250
364 3300025226 Ga0209674_100093 Ga0209674_100093130 250
365 3300025228 Ga0209672_100002 Ga0209672_100002716 250
366 3300025228 Ga0209672_101742 Ga0209672_1017426 250
367 3300025229 Ga0209147_100003 Ga0209147_100003716 250
368 3300025230 Ga0209563_101191 Ga0209563_1011918 250
369 3300025231 Ga0207427_101004 Ga0207427_1010042 250
370 3300025242 Ga0209258_100005 Ga0209258_100005358 250
371 3300025254 Ga0209148_1000006 Ga0209148_1000006716 250
372 3300025256 Ga0209759_1000006 Ga0209759_1000006283 250
373 3300025256 Ga0209759_1000039 Ga0209759_100003929 250
374 3300025258 Ga0209129_1000124 Ga0209129_100012448 250
375 3300025261 Ga0209233_1000018 Ga0209233_1000018633 250
376 3300025261 Ga0209233_1009841 Ga0209233_10098412 250
377 3300025263 Ga0209565_1008371 Ga0209565_10083712 250
378 3300025272 Ga0209455_1000003 Ga0209455_1000003716 250
379 3300025273 Ga0209673_1000586 Ga0209673_100058624 250
380 3300025291 Ga0209675_1000026 Ga0209675_100002682 250
381 3300025291 Ga0209675_1036722 Ga0209675_10367222 250
382 3300025292 Ga0209676_1000059 Ga0209676_1000059240 250
383 3300025294 Ga0209025_1000066 Ga0209025_100006689 250
384 3300025295 Ga0209564_1000057 Ga0209564_100005773 250
385 3300025295 Ga0209564_1000161 Ga0209564_100016175 250
386 3300025295 Ga0209564_1008977 Ga0209564_10089775 250
387 3300025295 Ga0209564_1015001 Ga0209564_10150012 250
388 3300025297 Ga0209758_1000214 Ga0209758_100021443 250
389 3300025302 Ga0207426_1000014 Ga0207426_10000149 250
390 3300025302 Ga0207426_1002337 Ga0207426_10023371 250
391 3300025303 Ga0209051_1002074 Ga0209051_100207413 250
392 3300025303 Ga0209051_1033002 Ga0209051_10330022 250
393 3300025321 Ga0207656_10004453 Ga0207656_100044535 250
394 3300025904 Ga0207647_10015441 Ga0207647_100154413 250
395 3300025904 Ga0207647_10017475 Ga0207647_100174755 250
396 3300025904 Ga0207647_10049311 Ga0207647_100493112 250
397 3300025904 Ga0207647_10196453 Ga0207647_101964532 250
398 3300025907 Ga0207645_10016293 Ga0207645_100162935 250
399 3300025908 Ga0207643_10022963 Ga0207643_100229632 250
400 3300025909 Ga0207705_10000481 Ga0207705_1000048120 250
401 3300025909 Ga0207705_10008567 Ga0207705_100085674 250
402 3300025909 Ga0207705_10380409 Ga0207705_103804092 250
403 3300025910 Ga0207684_10011762 Ga0207684_100117623 250
404 3300025911 Ga0207654_10145504 Ga0207654_101455042 250
405 3300025913 Ga0207695_10015843 Ga0207695_100158436 250
406 3300025913 Ga0207695_10022800 Ga0207695_100228008 250
407 3300025914 Ga0207671_10006346 Ga0207671_100063467 250
408 3300025914 Ga0207671_10007479 Ga0207671_100074794 250
409 3300025914 Ga0207671_10037912 Ga0207671_100379123 250
410 3300025914 Ga0207671_10058955 Ga0207671_100589552 250
411 3300025914 Ga0207671_10260891 Ga0207671_102608911 250
412 3300025919 Ga0207657_10000001 Ga0207657_10000001113 250
413 3300025919 Ga0207657_10046823 Ga0207657_100468233 250
414 3300025919 Ga0207657_10109383 Ga0207657_101093833 250
415 3300025920 Ga0207649_10044580 Ga0207649_100445802 250
416 3300025920 Ga0207649_10281780 Ga0207649_102817802 250
417 3300025922 Ga0207646_10469854 Ga0207646_104698541 250
418 3300025923 Ga0207681_10048400 Ga0207681_100484002 250
419 3300025924 Ga0207694_10005550 Ga0207694_100055508 250
420 3300025924 Ga0207694_10054135 Ga0207694_100541353 250
421 3300025924 Ga0207694_10530550 Ga0207694_105305501 250
422 3300025925 Ga0207650_10257656 Ga0207650_102576561 250
423 3300025925 Ga0207650_10476427 Ga0207650_104764272 250
424 3300025926 Ga0207659_10014234 Ga0207659_100142342 250
425 3300025926 Ga0207659_10346553 Ga0207659_103465532 250
426 3300025931 Ga0207644_10000392 Ga0207644_100003922 250
427 3300025932 Ga0207690_10000029 Ga0207690_1000002932 250
428 3300025932 Ga0207690_10008231 Ga0207690_100082316 250
429 3300025932 Ga0207690_10109320 Ga0207690_101093202 250
430 3300025933 Ga0207706_10010426 Ga0207706_100104262 250
431 3300025940 Ga0207691_10012083 Ga0207691_100120835 250
432 3300025940 Ga0207691_10026762 Ga0207691_100267624 250
433 3300025940 Ga0207691_10032575 Ga0207691_100325756 250
434 3300025940 Ga0207691_10151221 Ga0207691_101512212 250
435 3300025940 Ga0207691_10153293 Ga0207691_101532932 250
436 3300025941 Ga0207711_10003165 Ga0207711_100031656 250
437 3300025941 Ga0207711_10061080 Ga0207711_100610802 250
438 3300025941 Ga0207711_10129829 Ga0207711_101298292 250
439 3300025942 Ga0207689_10000550 Ga0207689_100005507 250
440 3300025942 Ga0207689_10109199 Ga0207689_101091991 250
441 3300025945 Ga0207679_10044751 Ga0207679_100447514 250
442 3300025945 Ga0207679_10501911 Ga0207679_105019112 250
443 3300025949 Ga0207667_10006345 Ga0207667_100063455 250
444 3300025949 Ga0207667_10055440 Ga0207667_100554404 250
445 3300025960 Ga0207651_10018745 Ga0207651_100187454 250
446 3300025960 Ga0207651_10390749 Ga0207651_103907491 250
447 3300025961 Ga0207712_10227369 Ga0207712_102273692 250
448 3300025972 Ga0207668_10079114 Ga0207668_100791142 250
449 3300025981 Ga0207640_10240210 Ga0207640_102402102 250
450 3300025981 Ga0207640_10501040 Ga0207640_105010401 250
451 3300025986 Ga0207658_10130856 Ga0207658_101308562 250
452 3300026023 Ga0207677_10068986 Ga0207677_100689864 250
453 3300026023 Ga0207677_10133597 Ga0207677_101335972 250
454 3300026035 Ga0207703_10141411 Ga0207703_101414112 250
455 3300026041 Ga0207639_10070327 Ga0207639_100703273 250
456 3300026041 Ga0207639_10170379 Ga0207639_101703792 250
457 3300026067 Ga0207678_10036125 Ga0207678_100361252 250
458 3300026067 Ga0207678_10170964 Ga0207678_101709642 250
459 3300026067 Ga0207678_10210428 Ga0207678_102104282 250
460 3300026078 Ga0207702_10008513 Ga0207702_100085136 250
461 3300026088 Ga0207641_10050151 Ga0207641_100501512 250
462 3300026088 Ga0207641_10138229 Ga0207641_101382293 250
463 3300026089 Ga0207648_10104753 Ga0207648_101047532 250
464 3300026116 Ga0207674_10031664 Ga0207674_100316646 250
465 3300026116 Ga0207674_10056720 Ga0207674_100567204 250
466 3300026118 Ga0207675_100000576 Ga0207675_1000005767 250
467 3300026121 Ga0207683_10017139 Ga0207683_100171393 250
468 3300026121 Ga0207683_10019815 Ga0207683_100198153 250
469 3300026121 Ga0207683_10042404 Ga0207683_100424043 250
470 3300026121 Ga0207683_10052369 Ga0207683_100523694 250
471 3300026121 Ga0207683_10071900 Ga0207683_100719003 250
472 3300026121 Ga0207683_10172797 Ga0207683_101727972 250
473 3300026142 Ga0207698_10039709 Ga0207698_100397092 250
474 3300026142 Ga0207698_10410848 Ga0207698_104108481 250
475 3300027876 Ga0209974_10035856 Ga0209974_100358562 250
476 3300027907 Ga0207428_10014971 Ga0207428_100149714 250
477 3300028786 Ga0307517_10007185 Ga0307517_100071858 250
478 3300028800 Ga0265338_10000191 Ga0265338_1000019171 250
479 3300028800 Ga0265338_10021618 Ga0265338_100216186 250
480 3300030500 Ga0268256_1003074 Ga0268256_10030742 250
481 3300031247 Ga0265340_10035668 Ga0265340_100356682 250
482 3300031247 Ga0265340_10076910 Ga0265340_100769101 250
483 3300031456 Ga0307513_10183020 Ga0307513_101830202 250
484 3300031507 Ga0307509_10106685 Ga0307509_101066853 250
485 3300031507 Ga0307509_10360711 Ga0307509_103607111 250
486 3300031548 Ga0307408_100022895 Ga0307408_1000228952 250
487 3300031616 Ga0307508_10159040 Ga0307508_101590401 250
488 3300031730 Ga0307516_10220884 Ga0307516_102208842 250
489 3300031911 Ga0307412_10000002 Ga0307412_1000000286 250
490 3300031911 Ga0307412_10442626 Ga0307412_104426262 250
491 3300032004 Ga0307414_10327325 Ga0307414_103273251 250
492 3300033180 Ga0307510_10010761 Ga0307510_100107612 250
493 3300033180 Ga0307510_10029893 Ga0307510_100298933 250
494 3300035115 Ga0373941_0085855 Ga0373941_0085855_225_977 250
495 3300035207 Ga0373942_0061684 Ga0373942_0061684_89_841 250
496 3300035242 Ga0373962_0026751 Ga0373962_0026751_755_1507 250
497 3300035410 Ga0373924_0097278 Ga0373924_0097278_273_1025 250
498 3300035691 Ga0373931_0002282 Ga0373931_0002282_664_1416 250
499 3300035692 Ga0373935_0035034 Ga0373935_0035034_2132_2884 250
500 3300035725 Ga0373947_0046995 Ga0373947_0046995_42_794 250
501 3300037068 Ga0373925_0050253 Ga0373925_0050253_1544_2296 250
502 3300037312 Ga0395899_0000203 Ga0395899_0000203_61536_62288 250
503 3300037418 Ga0395900_0000233 Ga0395900_0000233_24961_25713 250
504 3300037418 Ga0395900_0004885 Ga0395900_0004885_3304_4056 250
505 3300037418 Ga0395900_0157074 Ga0395900_0157074_1226_1978 250
506 3300037466 Ga0395898_0000722 Ga0395898_0000722_32644_33396 250
507 3300037466 Ga0395898_0005186 Ga0395898_0005186_5864_6616 250
508 3300037466 Ga0395898_0006940 Ga0395898_0006940_7440_8192 250
509 3300037471 Ga0395905_0000157 Ga0395905_0000157_3959_4711 250
510 3300037471 Ga0395905_0002320 Ga0395905_0002320_19163_19915 250
511 3300037471 Ga0395905_0019997 Ga0395905_0019997_863_1624 250
512 3300037471 Ga0395905_0692179 Ga0395905_0692179_68_820 250
513 3300038443 Ga0395901_0000144 Ga0395901_0000144_62617_63369 250
514 3300038741 Ga0400488_42310 Ga0400488_42310_45_797 250
515 3300042007 Ga0439449_0108508 Ga0439449_0108508_40_792 250
516 3300044656 Ga0466969_0000232 Ga0466969_0000232_7314_8066 250
517 3300044656 Ga0466969_0015812 Ga0466969_0015812_687_1439 250
518 3300044659 Ga0466973_0093852 Ga0466973_0093852_1469_2221 250
519 3300044683 Ga0466965_0000082 Ga0466965_0000082_20936_21688 250
520 3300044683 Ga0466965_0053780 Ga0466965_0053780_1213_1965 250
521 3300044684 Ga0466966_0036290 Ga0466966_0036290_707_1459 250
522 3300044684 Ga0466966_0044541 Ga0466966_0044541_1274_2026 250
523 3300044693 Ga0466961_0000229 Ga0466961_0000229_29892_30644 250
524 3300044693 Ga0466961_0086891 Ga0466961_0086891_270_1022 250
525 3300044694 Ga0466963_0005033 Ga0466963_0005033_3828_4580 250
526 3300044719 Ga0466971_0004861 Ga0466971_0004861_4325_5077 250
527 3300044765 Ga0466970_0087915 Ga0466970_0087915_752_1504 250
528 3300044842 Ga0466957_0005060 Ga0466957_0005060_4198_4950 250
529 3300045049 Ga0466959_0013955 Ga0466959_0013955_2818_3570 250
530 3300045051 Ga0451576_0139943 Ga0451576_0139943_20_772 250
531 3300045051 Ga0451576_0249911 Ga0451576_0249911_627_1379 250
532 3300045836 Ga0466958_0013651 Ga0466958_0013651_165_917 250
533 3300046454 Ga0495592_0000142 Ga0495592_0000142_34058_34810 250
534 3300046454 Ga0495592_0002963 Ga0495592_0002963_3200_3952 250
535 3300046455 Ga0495603_0067853 Ga0495603_0067853_91_843 250
536 3300046457 Ga0495590_0009231 Ga0495590_0009231_2650_3411 250
537 3300046457 Ga0495590_0105361 Ga0495590_0105361_12_764 250
538 3300046458 Ga0495591_004866 Ga0495591_004866_867_1619 250
539 3300046459 Ga0495629_0000662 Ga0495629_0000662_15974_16726 250
540 3300046459 Ga0495629_0008157 Ga0495629_0008157_937_1689 250
541 3300046459 Ga0495629_0210114 Ga0495629_0210114_258_1010 250
542 3300046459 Ga0495629_0363658 Ga0495629_0363658_183_935 250
543 3300046460 Ga0495638_0049446 Ga0495638_0049446_385_1137 250
544 3300046461 Ga0495641_0107956 Ga0495641_0107956_423_1175 250
545 3300046462 Ga0495651_0027843 Ga0495651_0027843_2902_3654 250
546 3300046463 Ga0495653_0006423 Ga0495653_0006423_365_1117 250
547 3300046463 Ga0495653_0121450 Ga0495653_0121450_936_1688 250
548 3300046471 Ga0495650_0000155 Ga0495650_0000155_63378_64130 250
549 3300046471 Ga0495650_0009077 Ga0495650_0009077_2137_2889 250
550 3300046471 Ga0495650_0013638 Ga0495650_0013638_3055_3807 250
551 3300046471 Ga0495650_0019517 Ga0495650_0019517_1645_2397 250
552 3300046471 Ga0495650_0028122 Ga0495650_0028122_1344_2183 250
553 3300046472 Ga0495580_0001817 Ga0495580_0001817_9339_10091 250
554 3300046472 Ga0495580_0002260 Ga0495580_0002260_11061_11813 250
555 3300046472 Ga0495580_0003220 Ga0495580_0003220_1927_2679 250
556 3300046472 Ga0495580_0005202 Ga0495580_0005202_9616_10368 250
557 3300046472 Ga0495580_0019602 Ga0495580_0019602_1867_2622 250
558 3300046472 Ga0495580_0065112 Ga0495580_0065112_920_1672 250
559 3300046472 Ga0495580_0171931 Ga0495580_0171931_263_1015 250
560 3300046472 Ga0495580_0251421 Ga0495580_0251421_289_1041 250
561 3300046474 Ga0495605_0003476 Ga0495605_0003476_7808_8560 250
562 3300046474 Ga0495605_0011742 Ga0495605_0011742_1386_2138 250
563 3300046474 Ga0495605_0080555 Ga0495605_0080555_559_1332 250
564 3300046476 Ga0495662_0014406 Ga0495662_0014406_1955_2707 250
565 3300046477 Ga0495664_0026141 Ga0495664_0026141_2064_2816 250
566 3300046477 Ga0495664_0042592 Ga0495664_0042592_1860_2621 250
567 3300046477 Ga0495664_0288974 Ga0495664_0288974_156_908 250
568 3300046491 Ga0495584_0067639 Ga0495584_0067639_955_1716 250
569 3300046492 Ga0495585_0078174 Ga0495585_0078174_950_1702 250
570 3300046500 Ga0495596_0002466 Ga0495596_0002466_8830_9582 250
571 3300046500 Ga0495596_0004389 Ga0495596_0004389_1563_2315 250
572 3300046500 Ga0495596_0104689 Ga0495596_0104689_227_988 250
573 3300046501 Ga0495607_0175307 Ga0495607_0175307_68_820 250
574 3300046506 Ga0495583_0015678 Ga0495583_0015678_2508_3260 250
575 3300046506 Ga0495583_0039756 Ga0495583_0039756_909_1661 250
576 3300046507 Ga0495606_0007997 Ga0495606_0007997_4855_5607 250
577 3300046507 Ga0495606_0089929 Ga0495606_0089929_411_1163 250
578 3300046507 Ga0495606_0134284 Ga0495606_0134284_317_1069 250
579 3300046511 Ga0495608_0047409 Ga0495608_0047409_1930_2682 250
580 3300046511 Ga0495608_0133633 Ga0495608_0133633_110_862 250
581 3300046512 Ga0495610_0003374 Ga0495610_0003374_2459_3211 250
582 3300046512 Ga0495610_0043589 Ga0495610_0043589_785_1558 250
583 3300046513 Ga0495616_0052034 Ga0495616_0052034_1209_1961 250
584 3300046513 Ga0495616_0058344 Ga0495616_0058344_723_1475 250
585 3300046514 Ga0495618_0001130 Ga0495618_0001130_9616_10368 250
586 3300046515 Ga0495620_0014380 Ga0495620_0014380_1811_2572 250
587 3300046515 Ga0495620_0044150 Ga0495620_0044150_295_1047 250
588 3300046515 Ga0495620_0082293 Ga0495620_0082293_229_981 250
589 3300046515 Ga0495620_0124961 Ga0495620_0124961_200_952 250
590 3300046516 Ga0495628_0005223 Ga0495628_0005223_376_1128 250
591 3300046516 Ga0495628_0085338 Ga0495628_0085338_377_1129 250
592 3300046516 Ga0495628_0095157 Ga0495628_0095157_591_1343 250
593 3300046517 Ga0495630_0013709 Ga0495630_0013709_1601_2362 250
594 3300046517 Ga0495630_0167455 Ga0495630_0167455_319_1071 250
595 3300046522 Ga0495643_0046130 Ga0495643_0046130_844_1596 250
596 3300046522 Ga0495643_0118131 Ga0495643_0118131_304_1077 250
597 3300046523 Ga0495644_0013611 Ga0495644_0013611_1915_2667 250
598 3300046523 Ga0495644_0082320 Ga0495644_0082320_332_1084 250
599 3300046524 Ga0495648_0006327 Ga0495648_0006327_8558_9310 250
600 3300046524 Ga0495648_0043992 Ga0495648_0043992_1949_2704 250
601 3300046524 Ga0495648_0063606 Ga0495648_0063606_1284_2036 250
602 3300046524 Ga0495648_0212006 Ga0495648_0212006_172_924 250
603 3300046526 Ga0495666_0000438 Ga0495666_0000438_2950_3702 250
604 3300046526 Ga0495666_0012255 Ga0495666_0012255_3082_3834 250
605 3300046526 Ga0495666_0168116 Ga0495666_0168116_235_987 250
606 3300046528 Ga0495642_0005060 Ga0495642_0005060_1044_1796 250
607 3300046528 Ga0495642_0031563 Ga0495642_0031563_805_1557 250
608 3300046529 Ga0495652_0001699 Ga0495652_0001699_4887_5648 250
609 3300046529 Ga0495652_0015047 Ga0495652_0015047_5291_6043 250
610 3300046529 Ga0495652_0044531 Ga0495652_0044531_348_1100 250
611 3300046530 Ga0495654_0006843 Ga0495654_0006843_3898_4650 250
612 3300046531 Ga0495665_0001450 Ga0495665_0001450_1626_2387 250
613 3300046531 Ga0495665_0011982 Ga0495665_0011982_3469_4221 250
614 3300046533 Ga0495640_0012116 Ga0495640_0012116_3299_4051 250
615 3300046533 Ga0495640_0032364 Ga0495640_0032364_1033_1785 250
616 3300046536 Ga0495587_0044503 Ga0495587_0044503_788_1540 250
617 3300046542 Ga0495597_0080253 Ga0495597_0080253_559_1311 250
618 3300046543 Ga0495645_0000045 Ga0495645_0000045_63016_63768 250
619 3300046543 Ga0495645_0011401 Ga0495645_0011401_2110_2862 250
620 3300046543 Ga0495645_0014740 Ga0495645_0014740_3546_4298 250
621 3300046557 Ga0495622_0169663 Ga0495622_0169663_43_795 250
622 3300046642 Ga0495634_0057254 Ga0495634_0057254_681_1433 250
623 3300046660 Ga0495625_0013439 Ga0495625_0013439_2842_3615 250
624 3300046660 Ga0495625_0080834 Ga0495625_0080834_428_1180 250
625 3300046663 Ga0495635_0008309 Ga0495635_0008309_5446_6198 250
626 3300046663 Ga0495635_0012101 Ga0495635_0012101_632_1393 250
627 3300046663 Ga0495635_0019842 Ga0495635_0019842_816_1568 250
628 3300046678 Ga0495599_0052079 Ga0495599_0052079_1098_1850 250
629 3300046678 Ga0495599_0165863 Ga0495599_0165863_415_1167 250
630 3300046679 Ga0495623_0002188 Ga0495623_0002188_6375_7136 250
631 3300046680 Ga0495646_0008890 Ga0495646_0008890_1241_2002 250
632 3300046680 Ga0495646_0011375 Ga0495646_0011375_107_859 250
633 3300046680 Ga0495646_0047204 Ga0495646_0047204_1170_1922 250
634 3300046684 Ga0495669_0007072 Ga0495669_0007072_1405_2157 250
635 3300046684 Ga0495669_0046922 Ga0495669_0046922_185_937 250
636 3300046684 Ga0495669_0053059 Ga0495669_0053059_963_1715 250
637 3300046684 Ga0495669_0220059 Ga0495669_0220059_109_861 250
638 3300046689 Ga0495613_0076974 Ga0495613_0076974_506_1258 250
639 3300046690 Ga0495624_0001622 Ga0495624_0001622_1705_2457 250
640 3300046690 Ga0495624_0002636 Ga0495624_0002636_5191_5943 250
641 3300046690 Ga0495624_0009333 Ga0495624_0009333_2760_3521 250
642 3300046690 Ga0495624_0402638 Ga0495624_0402638_49_801 250
643 3300046692 Ga0495671_0100248 Ga0495671_0100248_46_798 250
644 3300046692 Ga0495671_0197754 Ga0495671_0197754_55_810 250
645 3300046694 Ga0495649_0003998 Ga0495649_0003998_3960_4712 250
646 3300046694 Ga0495649_0024276 Ga0495649_0024276_1859_2632 250
647 3300046694 Ga0495649_0034384 Ga0495649_0034384_910_1662 250
648 3300046694 Ga0495649_0178311 Ga0495649_0178311_45_797 250
649 3300046794 Ga0495589_0002911 Ga0495589_0002911_2423_3175 250
650 3300046794 Ga0495589_0009528 Ga0495589_0009528_1516_2268 250
651 3300046794 Ga0495589_0038022 Ga0495589_0038022_1295_2047 250
652 3300046794 Ga0495589_0071419 Ga0495589_0071419_529_1281 250
653 3300046809 Ga0495600_0011428 Ga0495600_0011428_1557_2309 250
654 3300046809 Ga0495600_0035843 Ga0495600_0035843_290_1042 250
655 3300046809 Ga0495600_0072139 Ga0495600_0072139_509_1270 250
656 3300046810 Ga0495660_0030746 Ga0495660_0030746_1493_2245 250
657 3300046810 Ga0495660_0098835 Ga0495660_0098835_267_1040 250
658 3300046810 Ga0495660_0144117 Ga0495660_0144117_58_819 250
659 3300046810 Ga0495660_0150485 Ga0495660_0150485_62_814 250
660 3300047315 Ga0495581_0053089 Ga0495581_0053089_826_1578 250
661 3300047315 Ga0495581_0147953 Ga0495581_0147953_342_1094 250
662 3300047317 Ga0495604_0003834 Ga0495604_0003834_180_932 250
663 3300047317 Ga0495604_0004786 Ga0495604_0004786_9163_9915 250
664 3300047317 Ga0495604_0010331 Ga0495604_0010331_637_1389 250
665 3300047318 Ga0495636_0009936 Ga0495636_0009936_2128_2880 250
666 3300047319 Ga0495674_0006553 Ga0495674_0006553_674_1426 250
667 3300047319 Ga0495674_0020301 Ga0495674_0020301_3690_4442 250
668 3300047319 Ga0495674_0023154 Ga0495674_0023154_2361_3122 250
669 3300047319 Ga0495674_0029686 Ga0495674_0029686_585_1337 250
670 3300047319 Ga0495674_0041504 Ga0495674_0041504_2107_2859 250
671 3300047319 Ga0495674_0173458 Ga0495674_0173458_467_1219 250
672 3300047319 Ga0495674_0181558 Ga0495674_0181558_320_1072 250
673 3300047319 Ga0495674_0462206 Ga0495674_0462206_21_773 250
674 3300047320 Ga0495672_0045865 Ga0495672_0045865_1009_1761 250
675 3300047321 Ga0495676_0099354 Ga0495676_0099354_1063_1815 250
676 3300047322 Ga0495680_0005170 Ga0495680_0005170_4615_5376 250
677 3300047322 Ga0495680_0005562 Ga0495680_0005562_9638_10390 250
678 3300047322 Ga0495680_0010291 Ga0495680_0010291_6143_6895 250
679 3300047323 Ga0495683_0001115 Ga0495683_0001115_8388_9140 250
680 3300047323 Ga0495683_0001532 Ga0495683_0001532_11212_11973 250
681 3300047323 Ga0495683_0003052 Ga0495683_0003052_2307_3059 250
682 3300047323 Ga0495683_0007950 Ga0495683_0007950_4199_4951 250
683 3300047323 Ga0495683_0023725 Ga0495683_0023725_875_1627 250
684 3300047323 Ga0495683_0062477 Ga0495683_0062477_728_1480 250
685 3300047443 Ga0495687_000051 Ga0495687_000051_79995_80756 250
686 3300047443 Ga0495687_009807 Ga0495687_009807_3512_4264 250
687 3300047443 Ga0495687_010322 Ga0495687_010322_1663_2436 250
688 3300047443 Ga0495687_017693 Ga0495687_017693_79_852 250
689 3300047443 Ga0495687_022881 Ga0495687_022881_431_1183 250
690 3300047443 Ga0495687_040885 Ga0495687_040885_1233_1985 250
691 3300047443 Ga0495687_057441 Ga0495687_057441_392_1144 250
692 3300047444 Ga0495675_0001723 Ga0495675_0001723_9497_10249 250
693 3300047444 Ga0495675_0055987 Ga0495675_0055987_1583_2335 250
694 3300047444 Ga0495675_0196204 Ga0495675_0196204_328_1080 250
695 3300047446 Ga0495679_061355 Ga0495679_061355_145_897 250
696 3300047469 Ga0495673_0025699 Ga0495673_0025699_790_1542 250
697 3300047471 Ga0495684_0061781 Ga0495684_0061781_1710_2462 250
698 3300047673 Ga0495593_0001510 Ga0495593_0001510_12259_13011 250
699 3300047673 Ga0495593_0002335 Ga0495593_0002335_1641_2402 250
700 3300047673 Ga0495593_0025682 Ga0495593_0025682_1035_1787 250
701 3300048088 Ga0495602_0004008 Ga0495602_0004008_13783_14544 250
702 3300048088 Ga0495602_0006361 Ga0495602_0006361_363_1115 250
703 3300048088 Ga0495602_0034549 Ga0495602_0034549_1152_1913 250
704 3300048088 Ga0495602_0123052 Ga0495602_0123052_417_1169 250
705 3300048088 Ga0495602_0143567 Ga0495602_0143567_451_1203 250
706 3300048091 Ga0495626_0003050 Ga0495626_0003050_10150_10902 250
707 3300048091 Ga0495626_0035616 Ga0495626_0035616_1326_2078 250
708 3300048091 Ga0495626_0067804 Ga0495626_0067804_384_1136 250
709 3300048903 Ga0496100_0030789 Ga0496100_0030789_1698_2450 250
710 3300048903 Ga0496100_0045519 Ga0496100_0045519_475_1227 250
711 3300048903 Ga0496100_0071996 Ga0496100_0071996_447_1199 250
712 3300048903 Ga0496100_0075322 Ga0496100_0075322_1339_2091 250
713 3300048903 Ga0496100_0083907 Ga0496100_0083907_624_1385 250
714 3300048904 Ga0496101_0002488 Ga0496101_0002488_2614_3375 250
715 3300048904 Ga0496101_0040464 Ga0496101_0040464_1586_2338 250
716 3300048904 Ga0496101_0054637 Ga0496101_0054637_453_1205 250
717 3300048904 Ga0496101_0084234 Ga0496101_0084234_879_1631 250
718 3300048904 Ga0496101_0111543 Ga0496101_0111543_841_1593 250
719 3300048905 Ga0496102_0015576 Ga0496102_0015576_5398_6150 250
720 3300048905 Ga0496102_0028105 Ga0496102_0028105_3985_4737 250
721 3300048905 Ga0496102_0048665 Ga0496102_0048665_511_1272 250
722 3300048905 Ga0496102_0133926 Ga0496102_0133926_415_1167 250
723 3300048906 Ga0496103_0001364 Ga0496103_0001364_5776_6528 250
724 3300048906 Ga0496103_0007406 Ga0496103_0007406_2171_2923 250
725 3300048907 Ga0496104_0040881 Ga0496104_0040881_1759_2511 250
726 3300048907 Ga0496104_0078406 Ga0496104_0078406_1049_1801 250
727 3300048907 Ga0496104_0164534 Ga0496104_0164534_385_1137 250
728 3300048907 Ga0496104_0203008 Ga0496104_0203008_1015_1767 250
729 3300048907 Ga0496104_0240679 Ga0496104_0240679_369_1121 250
730 3300048908 Ga0496105_0014366 Ga0496105_0014366_3303_4055 250
731 3300048908 Ga0496105_0190781 Ga0496105_0190781_206_958 250
732 3300048908 Ga0496105_0267795 Ga0496105_0267795_532_1284 250
733 3300048909 Ga0496106_0000010 Ga0496106_0000010_209660_210415 250
734 3300048909 Ga0496106_0001335 Ga0496106_0001335_12074_12835 250
735 3300048909 Ga0496106_0007766 Ga0496106_0007766_3966_4718 250
736 3300048909 Ga0496106_0158591 Ga0496106_0158591_28_780 250
737 3300048909 Ga0496106_0262101 Ga0496106_0262101_91_843 250
738 3300048910 Ga0496107_0040403 Ga0496107_0040403_590_1351 250
739 3300048910 Ga0496107_0042712 Ga0496107_0042712_655_1407 250
740 3300048910 Ga0496107_0131393 Ga0496107_0131393_668_1420 250
741 3300048911 Ga0496108_0063235 Ga0496108_0063235_638_1399 250
742 3300048911 Ga0496108_0357990 Ga0496108_0357990_43_795 250
743 3300048912 Ga0496109_0020549 Ga0496109_0020549_1646_2398 250
744 3300048913 Ga0496110_0019939 Ga0496110_0019939_2323_3075 250
745 3300048913 Ga0496110_0095738 Ga0496110_0095738_512_1273 250
746 3300048913 Ga0496110_0315233 Ga0496110_0315233_130_882 250
747 3300048914 Ga0496111_0039607 Ga0496111_0039607_274_1035 250
748 3300048914 Ga0496111_0134034 Ga0496111_0134034_394_1146 250
749 3300048915 Ga0496112_0035917 Ga0496112_0035917_428_1180 250
750 3300048915 Ga0496112_0057459 Ga0496112_0057459_210_971 250
751 3300048915 Ga0496112_0169736 Ga0496112_0169736_234_986 250
752 3300048916 Ga0496113_0007496 Ga0496113_0007496_2066_2827 250
753 3300048916 Ga0496113_0362199 Ga0496113_0362199_20_772 250
754 3300048917 Ga0496114_0000403 Ga0496114_0000403_15299_16051 250
755 3300048917 Ga0496114_0067003 Ga0496114_0067003_1330_2082 250
756 3300048918 Ga0496115_0038592 Ga0496115_0038592_1789_2541 250
757 3300048918 Ga0496115_0047951 Ga0496115_0047951_986_1738 250
758 3300048918 Ga0496115_0136774 Ga0496115_0136774_1248_2000 250
759 3300048919 Ga0496116_0012547 Ga0496116_0012547_3559_4320 250
760 3300048919 Ga0496116_0026783 Ga0496116_0026783_1960_2712 250
761 3300048919 Ga0496116_0058750 Ga0496116_0058750_388_1140 250
762 3300048920 Ga0496117_0001592 Ga0496117_0001592_15703_16455 250
763 3300048920 Ga0496117_0004398 Ga0496117_0004398_14369_15121 250
764 3300048920 Ga0496117_0011858 Ga0496117_0011858_5276_6028 250
765 3300048920 Ga0496117_0019150 Ga0496117_0019150_3154_3915 250
766 3300048920 Ga0496117_0294637 Ga0496117_0294637_63_815 250
767 3300048921 Ga0496118_0001562 Ga0496118_0001562_4449_5201 250
768 3300048921 Ga0496118_0001704 Ga0496118_0001704_15698_16450 250
769 3300048921 Ga0496118_0001971 Ga0496118_0001971_27908_28660 250
770 3300048921 Ga0496118_0003290 Ga0496118_0003290_169_921 250
771 3300048921 Ga0496118_0019471 Ga0496118_0019471_391_1143 250
772 3300048921 Ga0496118_0021702 Ga0496118_0021702_1559_2311 250
773 3300048921 Ga0496118_0152458 Ga0496118_0152458_336_1097 250
774 3300048922 Ga0496119_0063981 Ga0496119_0063981_253_1005 250
775 3300048922 Ga0496119_0213985 Ga0496119_0213985_133_894 250
776 3300048923 Ga0496120_0105905 Ga0496120_0105905_507_1259 250
777 3300048924 Ga0496121_0002486 Ga0496121_0002486_9864_10616 250
778 3300048924 Ga0496121_0006106 Ga0496121_0006106_5768_6523 250
779 3300048924 Ga0496121_0024985 Ga0496121_0024985_4501_5262 250
780 3300048924 Ga0496121_0188038 Ga0496121_0188038_199_951 250
781 3300048924 Ga0496121_0208267 Ga0496121_0208267_218_970 250
782 3300048925 Ga0496122_0046426 Ga0496122_0046426_1601_2353 250
783 3300048925 Ga0496122_0183193 Ga0496122_0183193_303_1055 250
784 3300048926 Ga0496123_0028624 Ga0496123_0028624_548_1300 250
785 3300048926 Ga0496123_0126677 Ga0496123_0126677_535_1287 250
786 3300048927 Ga0496124_0050922 Ga0496124_0050922_461_1213 250
787 3300048927 Ga0496124_0152308 Ga0496124_0152308_184_939 250
788 3300048928 Ga0496125_0010341 Ga0496125_0010341_6205_6957 250
789 3300048929 Ga0496126_0000337 Ga0496126_0000337_21136_21888 250
790 3300048929 Ga0496126_0010301 Ga0496126_0010301_5370_6122 250
791 3300049460 Ga0495682_0024617 Ga0495682_0024617_1112_1864 250
792 3300049569 Ga0501032_0188592 Ga0501032_0188592_139_891 250
793 3300049579 Ga0501043_0009431 Ga0501043_0009431_3816_4568 250
794 3300049581 Ga0501047_0142826 Ga0501047_0142826_327_1079 250
795 3300049586 Ga0501070_0491625 Ga0501070_0491625_149_916 250
796 3300049742 Ga0501080_0018606 Ga0501080_0018606_1757_2509 250
797 3300049823 Ga0501044_0163507 Ga0501044_0163507_720_1472 250
798 3300049823 Ga0501044_0596606 Ga0501044_0596606_39_791 250
799 3300050492 nmdc:mga0yw44_114293_c1 nmdc:mga0yw44_114293_c1_394_1167 250
800 3300050493 nmdc:mga0k408_100319_c1 nmdc:mga0k408_100319_c1_566_1318 250
801 3300050493 nmdc:mga0k408_113322_c1 nmdc:mga0k408_113322_c1_768_1541 250
802 3300050493 nmdc:mga0k408_223927_c1 nmdc:mga0k408_223927_c1_318_1070 250
803 3300050493 nmdc:mga0k408_6516_c1 nmdc:mga0k408_6516_c1_3362_4114 250
804 3300050494 nmdc:mga06z11_19680_c1 nmdc:mga06z11_19680_c1_1275_2048 250
805 3300050494 nmdc:mga06z11_95428_c1 nmdc:mga06z11_95428_c1_306_1079 250
806 3300050496 nmdc:mga07m45_4464_c1 nmdc:mga07m45_4464_c1_5409_6182 250
807 3300050496 nmdc:mga07m45_919_c1 nmdc:mga07m45_919_c1_3227_4000 250
808 3300050508 nmdc:mga09592_85690_c1 nmdc:mga09592_85690_c1_812_1564 250
809 3300050512 nmdc:mga0n895_516677_c1 nmdc:mga0n895_516677_c1_228_980 250
810 3300050512 nmdc:mga0n895_592094_c1 nmdc:mga0n895_592094_c1_215_967 250
811 3300050512 nmdc:mga0n895_6971_c1 nmdc:mga0n895_6971_c1_5365_6117 250
812 3300050515 nmdc:mga0a205_742132_c1 nmdc:mga0a205_742132_c1_33_785 250
813 3300050516 nmdc:mga0sz30_11010_c1 nmdc:mga0sz30_11010_c1_1227_2000 250
814 3300053084 Ga0495595_0108287 Ga0495595_0108287_273_1025 250
815 3300053085 Ga0495619_0024042 Ga0495619_0024042_668_1420 250
816 3300053091 Ga0500647_0003099 Ga0500647_0003099_5563_6363 250
817 3300053092 Ga0500583_0004151 Ga0500583_0004151_3241_3993 250
818 3300053111 Ga0500572_000038 Ga0500572_000038_3391_4188 250
819 3300053131 Ga0500652_027187 Ga0500652_027187_383_1135 250
820 3300053133 Ga0500655_011291 Ga0500655_011291_358_1110 250
821 3300053136 Ga0500559_0000014 Ga0500559_0000014_138764_139516 250
822 3300053139 Ga0500568_0016410 Ga0500568_0016410_2289_3062 250
823 3300053156 Ga0500622_0002290 Ga0500622_0002290_11248_12000 250
824 3300053156 Ga0500622_0153216 Ga0500622_0153216_243_995 250
825 3300053739 Ga0500587_011104 Ga0500587_011104_186_938 250
826 3300061719 Ga0466962_0017319 Ga0466962_0017319_1716_2468 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

9

201

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

15

246

0.95

PF08659

KR

KR domain

10

188

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wk6-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.962 5 247
6d9y-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad 0.9604 1 250
6d9y-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad 0.9567 1 250
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9536 4 246
1uls-assembly1.cif.gz_A crystal structure of tt0140 from thermus thermophilus hb8 0.9514 4 247
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9647 6 88 3.40.50.720
af_Q5BLE6_285_550_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9555 3 247 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9504 6 250 3.40.50.720
6d9yB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9489 1 250 3.40.50.720
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 3 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6J5FS33-F1-model_v4 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)) (EC 1.1.1.401) 0.9707 1 250 GO:0016491
AF-A0A3N8I9Q9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9691 1 250 GO:0016616
GO:0030497
AF-A0A1X7M7R7-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9685 1 250 GO:0016491
AF-A0A1I3T2W7-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.968 1 250 GO:0016491
AF-A0A372JZD4-F1-model_v4 SDR family oxidoreductase 0.9679 1 250 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.4 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map