F482478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 826 | 389 | 773 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10285261|Ga0207707_102852613 |
| Length | 248 |
| Sequence | MNQIDLAGKNAIVTGGARGIGYSIAQRLLESGATCSLWDRDAEALEGAAKSLGSRVHTAAVKINEPASVQSAAQATLKALGSIEILVNNAGIAGVTKKMWEMTPAEWNEVIETNLNGLFLCCHAVVPLMLARKYGRIVNIASIAGKEGNPNASHYSAAKAGVIALTKSLAKETAQSGILVNCITPAVIQTDILKQVTQQHIDYMLSKIPMGRFGKKEEAAALVAWLCSDDCSFSTGAVFDLSGGRATY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 11 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 12 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 13 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 14 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 15 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 16 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 17 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 18 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 19 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 20 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 21 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 22 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 23 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 24 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 25 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 26 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 27 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 28 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 29 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 30 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 31 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 32 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 33 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 34 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 35 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 36 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 37 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 38 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 39 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 40 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 41 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 42 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 43 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 44 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 45 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 46 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 47 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 48 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 49 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 50 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 51 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 52 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 53 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 54 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 55 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 56 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 68 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 107 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 110 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 240 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 352 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 376 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 377 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 379 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 380 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 383 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 385 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 386 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 387 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 388 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 389 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.58 |
| Metatranscriptomes | 0 |
| Isolates | 6.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.56 |
| Nodule | 1.82 |
| Rhizoplane | 6.42 |
| Rhizosphere | 71.43 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 10.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002892 | 3300001979 | Bacteria | 7678 |
| 2 | JGI24739J22299_10002400 | 3300001989 | Bacteria | 7225 |
| 3 | JGI24739J22299_10004739 | 3300001989 | Bacteria | 5192 |
| 4 | JGI24735J21928_10000332 | 3300002067 | Bacteria | 16484 |
| 5 | JGI24735J21928_10015757 | 3300002067 | Bacteria | 2353 |
| 6 | JGI25156J39149_1000199 | 3300002705 | Bacteria | 42014 |
| 7 | JGI25156J39149_1000208 | 3300002705 | Bacteria | 40617 |
| 8 | JGI25156J39149_1000209 | 3300002705 | Bacteria | 40586 |
| 9 | JGI25165J46597_1001358 | 3300003214 | Bacteria | 13623 |
| 10 | JGI25153J46596_10002472 | 3300003215 | Bacteria | 10616 |
| 11 | JGI25160J50197_1006354 | 3300003354 | Bacteria | 4795 |
| 12 | Ga0055533_1000232 | 3300003756 | Bacteria | 36511 |
| 13 | Ga0055533_1000933 | 3300003756 | Bacteria | 8687 |
| 14 | Ga0055532_1000011 | 3300003758 | Bacteria | 385294 |
| 15 | Ga0055527_1000009 | 3300003760 | Bacteria | 385294 |
| 16 | Ga0055535_1000008 | 3300003761 | Bacteria | 385294 |
| 17 | Ga0055542_1000014 | 3300003762 | Bacteria | 385294 |
| 18 | Ga0055529_1000010 | 3300003763 | Bacteria | 385294 |
| 19 | Ga0055526_1002114 | 3300003771 | Bacteria | 13643 |
| 20 | Ga0055536_1000026 | 3300003781 | Bacteria | 166220 |
| 21 | Ga0055534_1001609 | 3300003784 | Bacteria | 8765 |
| 22 | Ga0055528_1026862 | 3300003790 | Bacteria | 1639 |
| 23 | Ga0055540_1012288 | 3300003792 | Bacteria | 2698 |
| 24 | Ga0055540_1022000 | 3300003792 | Bacteria | 1641 |
| 25 | Ga0065165_1008403 | 3300005262 | Bacteria | 4839 |
| 26 | Ga0065715_10129378 | 3300005293 | Bacteria | 2046 |
| 27 | Ga0065707_10001895 | 3300005295 | Bacteria | 5571 |
| 28 | Ga0070658_10001405 | 3300005327 | Bacteria | 20559 |
| 29 | Ga0070658_10118069 | 3300005327 | Bacteria | 2202 |
| 30 | Ga0070658_10282260 | 3300005327 | Bacteria | 1414 |
| 31 | Ga0070670_100001840 | 3300005331 | Bacteria | 17293 |
| 32 | Ga0070670_100037169 | 3300005331 | Bacteria | 4189 |
| 33 | Ga0070670_100118387 | 3300005331 | Bacteria | 2284 |
| 34 | Ga0070677_10013220 | 3300005333 | Bacteria | 2882 |
| 35 | Ga0068869_100011954 | 3300005334 | Bacteria | 5714 |
| 36 | Ga0070682_100203526 | 3300005337 | Bacteria | 1398 |
| 37 | Ga0068868_100120077 | 3300005338 | Bacteria | 2143 |
| 38 | Ga0068868_100166965 | 3300005338 | Bacteria | 1821 |
| 39 | Ga0068868_100407332 | 3300005338 | Bacteria | 1175 |
| 40 | Ga0068868_100502158 | 3300005338 | Bacteria | 1062 |
| 41 | Ga0070660_100000004 | 3300005339 | Bacteria | 171018 |
| 42 | Ga0070661_100004818 | 3300005344 | Bacteria | 9289 |
| 43 | Ga0070668_100104988 | 3300005347 | Bacteria | 2243 |
| 44 | Ga0070669_100000378 | 3300005353 | Bacteria | 34229 |
| 45 | Ga0070675_100015079 | 3300005354 | Bacteria | 6103 |
| 46 | Ga0070675_100055653 | 3300005354 | Bacteria | 3257 |
| 47 | Ga0070671_100004335 | 3300005355 | Bacteria | 11225 |
| 48 | Ga0070671_100229851 | 3300005355 | Bacteria | 1574 |
| 49 | Ga0070671_100578654 | 3300005355 | Bacteria | 970 |
| 50 | Ga0070674_100023729 | 3300005356 | Bacteria | 3974 |
| 51 | Ga0070674_100244923 | 3300005356 | Bacteria | 1405 |
| 52 | Ga0070673_100006343 | 3300005364 | Bacteria | 7684 |
| 53 | Ga0070673_100051998 | 3300005364 | Bacteria | 3212 |
| 54 | Ga0070659_100000023 | 3300005366 | Bacteria | 150907 |
| 55 | Ga0070659_100008933 | 3300005366 | Bacteria | 7345 |
| 56 | Ga0070659_100125002 | 3300005366 | Bacteria | 2086 |
| 57 | Ga0070659_100143402 | 3300005366 | Bacteria | 1945 |
| 58 | Ga0070701_10235995 | 3300005438 | Bacteria | 1097 |
| 59 | Ga0070700_100140206 | 3300005441 | Bacteria | 1642 |
| 60 | Ga0070678_100020258 | 3300005456 | Bacteria | 4359 |
| 61 | Ga0070678_100031159 | 3300005456 | Bacteria | 3675 |
| 62 | Ga0070678_100207393 | 3300005456 | Bacteria | 1622 |
| 63 | Ga0070678_100798821 | 3300005456 | Bacteria | 857 |
| 64 | Ga0070662_100054070 | 3300005457 | Bacteria | 2909 |
| 65 | Ga0070681_10150995 | 3300005458 | Unclassified | 2249 |
| 66 | Ga0070706_100000271 | 3300005467 | Bacteria | 63046 |
| 67 | Ga0070706_100267178 | 3300005467 | Bacteria | 1596 |
| 68 | Ga0070707_100053914 | 3300005468 | Bacteria | 3855 |
| 69 | Ga0070684_100008207 | 3300005535 | Bacteria | 8157 |
| 70 | Ga0068853_100227396 | 3300005539 | Bacteria | 1706 |
| 71 | Ga0070672_100130322 | 3300005543 | Bacteria | 2066 |
| 72 | Ga0070672_100139104 | 3300005543 | Bacteria | 2001 |
| 73 | Ga0070693_100016242 | 3300005547 | Bacteria | 3849 |
| 74 | Ga0070693_100111813 | 3300005547 | Bacteria | 1681 |
| 75 | Ga0070693_100114911 | 3300005547 | Bacteria | 1661 |
| 76 | Ga0070665_100092825 | 3300005548 | Bacteria | 3023 |
| 77 | Ga0070665_100415694 | 3300005548 | Bacteria | 1353 |
| 78 | Ga0068855_100007936 | 3300005563 | Bacteria | 12827 |
| 79 | Ga0068855_100071618 | 3300005563 | Bacteria | 4031 |
| 80 | Ga0070664_100004354 | 3300005564 | Bacteria | 11375 |
| 81 | Ga0070664_100181683 | 3300005564 | Bacteria | 1870 |
| 82 | Ga0070664_100409567 | 3300005564 | Bacteria | 1241 |
| 83 | Ga0068857_100015285 | 3300005577 | Bacteria | 6700 |
| 84 | Ga0068854_100006013 | 3300005578 | Bacteria | 7688 |
| 85 | Ga0068856_100219106 | 3300005614 | Bacteria | 1918 |
| 86 | Ga0070702_100410249 | 3300005615 | Bacteria | 972 |
| 87 | Ga0068852_100012297 | 3300005616 | Bacteria | 6492 |
| 88 | Ga0068852_100020522 | 3300005616 | Bacteria | 5255 |
| 89 | Ga0068852_100049509 | 3300005616 | Bacteria | 3595 |
| 90 | Ga0068852_100128234 | 3300005616 | Bacteria | 2333 |
| 91 | Ga0068864_100049553 | 3300005618 | Bacteria | 3614 |
| 92 | Ga0068864_100131611 | 3300005618 | Bacteria | 2248 |
| 93 | Ga0068861_100001865 | 3300005719 | Bacteria | 13569 |
| 94 | Ga0068851_10004511 | 3300005834 | Bacteria | 6281 |
| 95 | Ga0068851_10014115 | 3300005834 | Bacteria | 3788 |
| 96 | Ga0068863_100152637 | 3300005841 | Bacteria | 2211 |
| 97 | Ga0068860_100087569 | 3300005843 | Bacteria | 2964 |
| 98 | Ga0068862_100072538 | 3300005844 | Bacteria | 2974 |
| 99 | Ga0075368_10030664 | 3300006042 | Bacteria | 2082 |
| 100 | Ga0075368_10094152 | 3300006042 | Bacteria | 1227 |
| 101 | Ga0075367_10003415 | 3300006178 | Bacteria | 7568 |
| 102 | Ga0075369_10002321 | 3300006186 | Bacteria | 6766 |
| 103 | Ga0075366_10001538 | 3300006195 | Bacteria | 11541 |
| 104 | Ga0075366_10005093 | 3300006195 | Bacteria | 7109 |
| 105 | Ga0075366_10063701 | 3300006195 | Bacteria | 2191 |
| 106 | Ga0075366_10074401 | 3300006195 | Bacteria | 2026 |
| 107 | Ga0097621_100066610 | 3300006237 | Bacteria | 2967 |
| 108 | Ga0097621_100297117 | 3300006237 | Bacteria | 1426 |
| 109 | Ga0097621_100315399 | 3300006237 | Bacteria | 1384 |
| 110 | Ga0075370_10000157 | 3300006353 | Bacteria | 23226 |
| 111 | Ga0075370_10001313 | 3300006353 | Bacteria | 10640 |
| 112 | Ga0075370_10018871 | 3300006353 | Bacteria | 3745 |
| 113 | Ga0075370_10024875 | 3300006353 | Bacteria | 3310 |
| 114 | Ga0068871_100039522 | 3300006358 | Bacteria | 3775 |
| 115 | Ga0068871_100060131 | 3300006358 | Bacteria | 3098 |
| 116 | Ga0068871_100113834 | 3300006358 | Bacteria | 2278 |
| 117 | Ga0068871_100275849 | 3300006358 | Bacteria | 1470 |
| 118 | Ga0075434_100004654 | 3300006871 | Bacteria | 12400 |
| 119 | Ga0075434_100196325 | 3300006871 | Bacteria | 2038 |
| 120 | Ga0075434_100489308 | 3300006871 | Bacteria | 1251 |
| 121 | Ga0075429_100104985 | 3300006880 | Bacteria | 2468 |
| 122 | Ga0105251_10000654 | 3300009011 | Bacteria | 31960 |
| 123 | Ga0105251_10000816 | 3300009011 | Bacteria | 28017 |
| 124 | Ga0105251_10099615 | 3300009011 | Bacteria | 1329 |
| 125 | Ga0105244_10078900 | 3300009036 | Bacteria | 1632 |
| 126 | Ga0105250_10004967 | 3300009092 | Bacteria | 6033 |
| 127 | Ga0105240_10002938 | 3300009093 | Bacteria | 26885 |
| 128 | Ga0105240_10018434 | 3300009093 | Bacteria | 9370 |
| 129 | Ga0105240_10099453 | 3300009093 | Bacteria | 3540 |
| 130 | Ga0105240_10324987 | 3300009093 | Bacteria | 1752 |
| 131 | Ga0111539_10001639 | 3300009094 | Bacteria | 29898 |
| 132 | Ga0111539_10193872 | 3300009094 | Bacteria | 2370 |
| 133 | Ga0111539_10264131 | 3300009094 | Bacteria | 2003 |
| 134 | Ga0105245_10156052 | 3300009098 | Bacteria | 2162 |
| 135 | Ga0105247_10353627 | 3300009101 | Bacteria | 1034 |
| 136 | Ga0105247_10493248 | 3300009101 | Bacteria | 891 |
| 137 | Ga0105243_10010046 | 3300009148 | Bacteria | 7199 |
| 138 | Ga0105241_10223857 | 3300009174 | Bacteria | 1583 |
| 139 | Ga0105241_10237052 | 3300009174 | Bacteria | 1541 |
| 140 | Ga0105248_10045951 | 3300009177 | Bacteria | 4895 |
| 141 | Ga0105248_10060337 | 3300009177 | Bacteria | 4257 |
| 142 | Ga0105248_10074722 | 3300009177 | Bacteria | 3809 |
| 143 | Ga0105248_10203080 | 3300009177 | Bacteria | 2233 |
| 144 | Ga0105248_10479972 | 3300009177 | Bacteria | 1401 |
| 145 | Ga0105237_10006766 | 3300009545 | Bacteria | 12649 |
| 146 | Ga0105237_10007760 | 3300009545 | Bacteria | 11705 |
| 147 | Ga0105237_10024983 | 3300009545 | Bacteria | 6112 |
| 148 | Ga0105237_10038836 | 3300009545 | Bacteria | 4808 |
| 149 | Ga0105237_10181999 | 3300009545 | Bacteria | 2102 |
| 150 | Ga0105237_10220013 | 3300009545 | Bacteria | 1899 |
| 151 | Ga0105238_10006338 | 3300009551 | Bacteria | 11764 |
| 152 | Ga0105238_10010968 | 3300009551 | Bacteria | 9113 |
| 153 | Ga0105238_10032852 | 3300009551 | Bacteria | 5282 |
| 154 | Ga0105238_10244530 | 3300009551 | Bacteria | 1772 |
| 155 | Ga0105238_10319875 | 3300009551 | Bacteria | 1537 |
| 156 | Ga0105238_10580783 | 3300009551 | Bacteria | 1127 |
| 157 | Ga0105249_10023626 | 3300009553 | Bacteria | 5518 |
| 158 | Ga0105239_10004145 | 3300010375 | Bacteria | 17402 |
| 159 | Ga0105239_10158799 | 3300010375 | Bacteria | 2526 |
| 160 | Ga0157373_10076687 | 3300013100 | Bacteria | 2359 |
| 161 | Ga0157371_10015829 | 3300013102 | Bacteria | 5642 |
| 162 | Ga0157370_10008953 | 3300013104 | Bacteria | 10750 |
| 163 | Ga0157369_10000326 | 3300013105 | Bacteria | 63940 |
| 164 | Ga0157369_10008064 | 3300013105 | Bacteria | 12076 |
| 165 | Ga0157369_10048315 | 3300013105 | Bacteria | 4617 |
| 166 | Ga0157369_10055294 | 3300013105 | Bacteria | 4285 |
| 167 | Ga0157369_10398390 | 3300013105 | Bacteria | 1428 |
| 168 | Ga0163162_10027756 | 3300013306 | Bacteria | 5598 |
| 169 | Ga0163162_10147222 | 3300013306 | Bacteria | 2471 |
| 170 | Ga0163162_10159032 | 3300013306 | Bacteria | 2380 |
| 171 | Ga0157372_10018776 | 3300013307 | Bacteria | 7438 |
| 172 | Ga0157372_10040036 | 3300013307 | Bacteria | 5175 |
| 173 | Ga0157375_10008280 | 3300013308 | Bacteria | 9107 |
| 174 | Ga0157375_10010581 | 3300013308 | Bacteria | 8121 |
| 175 | Ga0157375_10379925 | 3300013308 | Bacteria | 1579 |
| 176 | Ga0163163_10324860 | 3300014325 | Bacteria | 1592 |
| 177 | Ga0163163_10599417 | 3300014325 | Bacteria | 1165 |
| 178 | Ga0163163_10744869 | 3300014325 | Bacteria | 1043 |
| 179 | Ga0182008_10035841 | 3300014497 | Bacteria | 2483 |
| 180 | Ga0182008_10046294 | 3300014497 | Bacteria | 2162 |
| 181 | Ga0182007_10001190 | 3300015262 | Bacteria | 14136 |
| 182 | Ga0182007_10040498 | 3300015262 | Bacteria | 1555 |
| 183 | Ga0182005_1016050 | 3300015265 | Bacteria | 2085 |
| 184 | Ga0183361_10005 | 3300016635 | Bacteria | 413599 |
| 185 | Ga0163161_10056646 | 3300017792 | Bacteria | 2847 |
| 186 | Ga0163161_10378753 | 3300017792 | Bacteria | 1130 |
| 187 | Ga0163161_10394363 | 3300017792 | Bacteria | 1109 |
| 188 | Ga0209435_104039 | 3300025206 | Bacteria | 1666 |
| 189 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 190 | Ga0209674_100093 | 3300025226 | Bacteria | 170423 |
| 191 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 192 | Ga0209672_101742 | 3300025228 | Bacteria | 6902 |
| 193 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 194 | Ga0209563_101191 | 3300025230 | Bacteria | 7297 |
| 195 | Ga0207427_101004 | 3300025231 | Bacteria | 11826 |
| 196 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 197 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 198 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 199 | Ga0209759_1000006 | 3300025256 | Bacteria | 492407 |
| 200 | Ga0209759_1000039 | 3300025256 | Bacteria | 256444 |
| 201 | Ga0209129_1000124 | 3300025258 | Bacteria | 133610 |
| 202 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 203 | Ga0209233_1009841 | 3300025261 | Bacteria | 2891 |
| 204 | Ga0209565_1008371 | 3300025263 | Bacteria | 2709 |
| 205 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 206 | Ga0209673_1000586 | 3300025273 | Bacteria | 57290 |
| 207 | Ga0209675_1000026 | 3300025291 | Bacteria | 284716 |
| 208 | Ga0209675_1036722 | 3300025291 | Bacteria | 1107 |
| 209 | Ga0209676_1000059 | 3300025292 | Bacteria | 344882 |
| 210 | Ga0209025_1000066 | 3300025294 | Bacteria | 298742 |
| 211 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 212 | Ga0209564_1000161 | 3300025295 | Bacteria | 162489 |
| 213 | Ga0209564_1008977 | 3300025295 | Bacteria | 4838 |
| 214 | Ga0209564_1015001 | 3300025295 | Bacteria | 3183 |
| 215 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 216 | Ga0207426_1000014 | 3300025302 | Bacteria | 649413 |
| 217 | Ga0207426_1002337 | 3300025302 | Bacteria | 12380 |
| 218 | Ga0209051_1000362 | 3300025303 | Bacteria | 66692 |
| 219 | Ga0209051_1002074 | 3300025303 | Bacteria | 15151 |
| 220 | Ga0209051_1033002 | 3300025303 | Bacteria | 1965 |
| 221 | Ga0207656_10004453 | 3300025321 | Bacteria | 4896 |
| 222 | Ga0207713_1003352 | 3300025735 | Bacteria | 10995 |
| 223 | Ga0207647_10015441 | 3300025904 | Bacteria | 5236 |
| 224 | Ga0207647_10017475 | 3300025904 | Bacteria | 4875 |
| 225 | Ga0207647_10049311 | 3300025904 | Bacteria | 2612 |
| 226 | Ga0207647_10196453 | 3300025904 | Bacteria | 1168 |
| 227 | Ga0207645_10016293 | 3300025907 | Bacteria | 4921 |
| 228 | Ga0207643_10022963 | 3300025908 | Bacteria | 3439 |
| 229 | Ga0207705_10000481 | 3300025909 | Bacteria | 34247 |
| 230 | Ga0207705_10008567 | 3300025909 | Bacteria | 7456 |
| 231 | Ga0207705_10380409 | 3300025909 | Bacteria | 1090 |
| 232 | Ga0207684_10011762 | 3300025910 | Bacteria | 7633 |
| 233 | Ga0207684_10220226 | 3300025910 | Bacteria | 1638 |
| 234 | Ga0207654_10145504 | 3300025911 | Bacteria | 1516 |
| 235 | Ga0207707_10285261 | 3300025912 | Unclassified | 1429 |
| 236 | Ga0207695_10015843 | 3300025913 | Bacteria | 8855 |
| 237 | Ga0207695_10022800 | 3300025913 | Bacteria | 7093 |
| 238 | Ga0207671_10006346 | 3300025914 | Bacteria | 10548 |
| 239 | Ga0207671_10007479 | 3300025914 | Bacteria | 9474 |
| 240 | Ga0207671_10037912 | 3300025914 | Bacteria | 3573 |
| 241 | Ga0207671_10058955 | 3300025914 | Bacteria | 2846 |
| 242 | Ga0207671_10260891 | 3300025914 | Bacteria | 1364 |
| 243 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 244 | Ga0207657_10046823 | 3300025919 | Bacteria | 3786 |
| 245 | Ga0207657_10109383 | 3300025919 | Bacteria | 2284 |
| 246 | Ga0207649_10044580 | 3300025920 | Bacteria | 2716 |
| 247 | Ga0207649_10281780 | 3300025920 | Bacteria | 1209 |
| 248 | Ga0207646_10469854 | 3300025922 | Bacteria | 1134 |
| 249 | Ga0207681_10048400 | 3300025923 | Bacteria | 2869 |
| 250 | Ga0207694_10005550 | 3300025924 | Bacteria | 9668 |
| 251 | Ga0207694_10054135 | 3300025924 | Bacteria | 3113 |
| 252 | Ga0207694_10530550 | 3300025924 | Bacteria | 987 |
| 253 | Ga0207650_10257656 | 3300025925 | Bacteria | 1414 |
| 254 | Ga0207650_10476427 | 3300025925 | Bacteria | 1041 |
| 255 | Ga0207659_10014234 | 3300025926 | Bacteria | 5121 |
| 256 | Ga0207659_10346553 | 3300025926 | Bacteria | 1231 |
| 257 | Ga0207644_10000392 | 3300025931 | Bacteria | 28471 |
| 258 | Ga0207690_10000029 | 3300025932 | Bacteria | 160406 |
| 259 | Ga0207690_10008231 | 3300025932 | Bacteria | 6185 |
| 260 | Ga0207690_10109320 | 3300025932 | Bacteria | 1989 |
| 261 | Ga0207706_10010426 | 3300025933 | Bacteria | 8490 |
| 262 | Ga0207709_10013152 | 3300025935 | Bacteria | 4565 |
| 263 | Ga0207669_10321809 | 3300025937 | Bacteria | 1184 |
| 264 | Ga0207691_10012083 | 3300025940 | Bacteria | 8281 |
| 265 | Ga0207691_10026762 | 3300025940 | Bacteria | 5412 |
| 266 | Ga0207691_10032575 | 3300025940 | Bacteria | 4859 |
| 267 | Ga0207691_10151221 | 3300025940 | Bacteria | 2041 |
| 268 | Ga0207691_10153293 | 3300025940 | Bacteria | 2025 |
| 269 | Ga0207711_10003165 | 3300025941 | Bacteria | 14351 |
| 270 | Ga0207711_10061080 | 3300025941 | Bacteria | 3249 |
| 271 | Ga0207711_10129829 | 3300025941 | Bacteria | 2258 |
| 272 | Ga0207689_10000550 | 3300025942 | Bacteria | 35746 |
| 273 | Ga0207689_10109199 | 3300025942 | Bacteria | 2273 |
| 274 | Ga0207679_10044751 | 3300025945 | Bacteria | 3196 |
| 275 | Ga0207679_10501911 | 3300025945 | Bacteria | 1083 |
| 276 | Ga0207667_10006345 | 3300025949 | Bacteria | 14335 |
| 277 | Ga0207667_10055440 | 3300025949 | Bacteria | 4167 |
| 278 | Ga0207651_10018745 | 3300025960 | Bacteria | 4128 |
| 279 | Ga0207651_10390749 | 3300025960 | Bacteria | 1181 |
| 280 | Ga0207712_10227369 | 3300025961 | Bacteria | 1495 |
| 281 | Ga0207668_10079114 | 3300025972 | Bacteria | 2377 |
| 282 | Ga0207640_10240210 | 3300025981 | Bacteria | 1399 |
| 283 | Ga0207640_10501040 | 3300025981 | Bacteria | 1011 |
| 284 | Ga0207658_10130856 | 3300025986 | Bacteria | 2016 |
| 285 | Ga0207677_10068986 | 3300026023 | Bacteria | 2484 |
| 286 | Ga0207677_10133597 | 3300026023 | Bacteria | 1888 |
| 287 | Ga0207703_10141411 | 3300026035 | Bacteria | 2089 |
| 288 | Ga0207639_10070327 | 3300026041 | Bacteria | 2733 |
| 289 | Ga0207639_10170379 | 3300026041 | Bacteria | 1843 |
| 290 | Ga0207678_10036125 | 3300026067 | Bacteria | 4301 |
| 291 | Ga0207678_10170964 | 3300026067 | Bacteria | 1855 |
| 292 | Ga0207678_10210428 | 3300026067 | Bacteria | 1663 |
| 293 | Ga0207702_10008513 | 3300026078 | Bacteria | 8649 |
| 294 | Ga0207641_10050151 | 3300026088 | Bacteria | 3530 |
| 295 | Ga0207641_10138229 | 3300026088 | Bacteria | 2195 |
| 296 | Ga0207648_10104753 | 3300026089 | Bacteria | 2481 |
| 297 | Ga0207674_10031664 | 3300026116 | Bacteria | 5553 |
| 298 | Ga0207674_10056720 | 3300026116 | Bacteria | 3975 |
| 299 | Ga0207675_100000576 | 3300026118 | Bacteria | 35873 |
| 300 | Ga0207683_10017139 | 3300026121 | Bacteria | 6167 |
| 301 | Ga0207683_10019815 | 3300026121 | Bacteria | 5746 |
| 302 | Ga0207683_10042404 | 3300026121 | Bacteria | 3975 |
| 303 | Ga0207683_10052369 | 3300026121 | Bacteria | 3576 |
| 304 | Ga0207683_10071900 | 3300026121 | Bacteria | 3059 |
| 305 | Ga0207683_10172797 | 3300026121 | Bacteria | 1958 |
| 306 | Ga0207698_10039709 | 3300026142 | Bacteria | 3489 |
| 307 | Ga0207698_10410848 | 3300026142 | Bacteria | 1296 |
| 308 | Ga0209974_10035856 | 3300027876 | Bacteria | 1647 |
| 309 | Ga0207428_10014971 | 3300027907 | Bacteria | 6721 |
| 310 | Ga0307517_10007185 | 3300028786 | Bacteria | 16312 |
| 311 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 312 | Ga0265338_10000191 | 3300028800 | Bacteria | 115408 |
| 313 | Ga0265338_10021618 | 3300028800 | Bacteria | 6700 |
| 314 | Ga0268256_1003074 | 3300030500 | Bacteria | 7819 |
| 315 | Ga0265340_10035668 | 3300031247 | Bacteria | 2470 |
| 316 | Ga0265340_10076910 | 3300031247 | Bacteria | 1576 |
| 317 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 318 | Ga0307513_10183020 | 3300031456 | Bacteria | 1956 |
| 319 | Ga0307513_10194937 | 3300031456 | Bacteria | 1873 |
| 320 | Ga0307509_10106685 | 3300031507 | Bacteria | 2819 |
| 321 | Ga0307509_10360711 | 3300031507 | Bacteria | 1173 |
| 322 | Ga0307408_100022895 | 3300031548 | Bacteria | 4251 |
| 323 | Ga0307508_10159040 | 3300031616 | Bacteria | 1863 |
| 324 | Ga0307516_10220884 | 3300031730 | Bacteria | 1604 |
| 325 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 326 | Ga0307412_10442626 | 3300031911 | Bacteria | 1068 |
| 327 | Ga0307414_10327325 | 3300032004 | Bacteria | 1307 |
| 328 | Ga0307510_10010761 | 3300033180 | Bacteria | 10880 |
| 329 | Ga0307510_10029893 | 3300033180 | Bacteria | 6189 |
| 330 | Ga0373941_0085855 | 3300035115 | Bacteria | 1071 |
| 331 | Ga0373942_0061684 | 3300035207 | Bacteria | 1076 |
| 332 | Ga0373962_0026751 | 3300035242 | Bacteria | 1557 |
| 333 | Ga0373924_0097278 | 3300035410 | Bacteria | 1264 |
| 334 | Ga0373931_0002282 | 3300035691 | Bacteria | 8477 |
| 335 | Ga0373935_0035034 | 3300035692 | Bacteria | 3132 |
| 336 | Ga0373947_0046995 | 3300035725 | Bacteria | 2586 |
| 337 | Ga0373925_0050253 | 3300037068 | Bacteria | 3110 |
| 338 | Ga0395899_0000203 | 3300037312 | Bacteria | 87248 |
| 339 | Ga0395900_0000233 | 3300037418 | Bacteria | 87254 |
| 340 | Ga0395900_0004885 | 3300037418 | Bacteria | 14116 |
| 341 | Ga0395900_0157074 | 3300037418 | Bacteria | 2323 |
| 342 | Ga0395898_0000201 | 3300037466 | Bacteria | 153821 |
| 343 | Ga0395898_0000722 | 3300037466 | Bacteria | 58151 |
| 344 | Ga0395898_0005186 | 3300037466 | Bacteria | 14091 |
| 345 | Ga0395898_0006940 | 3300037466 | Bacteria | 12039 |
| 346 | Ga0395905_0000157 | 3300037471 | Bacteria | 112004 |
| 347 | Ga0395905_0002320 | 3300037471 | Bacteria | 21297 |
| 348 | Ga0395905_0019997 | 3300037471 | Bacteria | 6344 |
| 349 | Ga0395905_0692179 | 3300037471 | Bacteria | 922 |
| 350 | Ga0395901_0000144 | 3300038443 | Bacteria | 91753 |
| 351 | Ga0395901_0070109 | 3300038443 | Bacteria | 3651 |
| 352 | Ga0395901_0161585 | 3300038443 | Bacteria | 2352 |
| 353 | Ga0400488_42310 | 3300038741 | Bacteria | 2100 |
| 354 | Ga0439449_0108508 | 3300042007 | Bacteria | 1028 |
| 355 | Ga0466969_0000232 | 3300044656 | Bacteria | 30397 |
| 356 | Ga0466969_0015812 | 3300044656 | Bacteria | 3955 |
| 357 | Ga0466973_0093852 | 3300044659 | Bacteria | 2573 |
| 358 | Ga0466965_0000082 | 3300044683 | Bacteria | 27799 |
| 359 | Ga0466965_0053780 | 3300044683 | Bacteria | 2002 |
| 360 | Ga0466966_0036290 | 3300044684 | Bacteria | 3183 |
| 361 | Ga0466966_0044541 | 3300044684 | Bacteria | 2840 |
| 362 | Ga0466961_0000229 | 3300044693 | Bacteria | 37957 |
| 363 | Ga0466961_0086891 | 3300044693 | Bacteria | 1976 |
| 364 | Ga0466963_0005033 | 3300044694 | Bacteria | 7722 |
| 365 | Ga0466971_0004861 | 3300044719 | Bacteria | 5813 |
| 366 | Ga0466970_0087915 | 3300044765 | Bacteria | 1685 |
| 367 | Ga0466957_0005060 | 3300044842 | Bacteria | 7379 |
| 368 | Ga0466959_0013955 | 3300045049 | Bacteria | 5832 |
| 369 | Ga0451576_0139943 | 3300045051 | Bacteria | 2524 |
| 370 | Ga0451576_0249911 | 3300045051 | Bacteria | 1853 |
| 371 | Ga0466958_0013651 | 3300045836 | Bacteria | 4629 |
| 372 | Ga0495592_0000142 | 3300046454 | Bacteria | 63571 |
| 373 | Ga0495592_0002963 | 3300046454 | Bacteria | 12082 |
| 374 | Ga0495603_0010016 | 3300046455 | Bacteria | 5734 |
| 375 | Ga0495603_0067853 | 3300046455 | Bacteria | 2098 |
| 376 | Ga0495590_0009231 | 3300046457 | Bacteria | 3743 |
| 377 | Ga0495590_0018317 | 3300046457 | Bacteria | 2507 |
| 378 | Ga0495590_0105361 | 3300046457 | Bacteria | 1004 |
| 379 | Ga0495591_004866 | 3300046458 | Bacteria | 6398 |
| 380 | Ga0495591_076876 | 3300046458 | Bacteria | 857 |
| 381 | Ga0495629_0000068 | 3300046459 | Bacteria | 92619 |
| 382 | Ga0495629_0000662 | 3300046459 | Bacteria | 27832 |
| 383 | Ga0495629_0008157 | 3300046459 | Bacteria | 7703 |
| 384 | Ga0495629_0029086 | 3300046459 | Bacteria | 3921 |
| 385 | Ga0495629_0210114 | 3300046459 | Bacteria | 1344 |
| 386 | Ga0495629_0363658 | 3300046459 | Bacteria | 986 |
| 387 | Ga0495638_0014841 | 3300046460 | Bacteria | 5252 |
| 388 | Ga0495638_0049446 | 3300046460 | Bacteria | 2629 |
| 389 | Ga0495641_0014143 | 3300046461 | Bacteria | 4333 |
| 390 | Ga0495641_0107956 | 3300046461 | Bacteria | 1242 |
| 391 | Ga0495651_0027843 | 3300046462 | Bacteria | 4404 |
| 392 | Ga0495651_0159127 | 3300046462 | Bacteria | 1620 |
| 393 | Ga0495653_0006423 | 3300046463 | Bacteria | 9636 |
| 394 | Ga0495653_0018524 | 3300046463 | Bacteria | 5652 |
| 395 | Ga0495653_0121450 | 3300046463 | Bacteria | 1861 |
| 396 | Ga0495653_0244834 | 3300046463 | Bacteria | 1193 |
| 397 | Ga0495650_0000155 | 3300046471 | Bacteria | 155947 |
| 398 | Ga0495650_0009077 | 3300046471 | Bacteria | 5705 |
| 399 | Ga0495650_0013638 | 3300046471 | Bacteria | 4285 |
| 400 | Ga0495650_0019517 | 3300046471 | Bacteria | 3333 |
| 401 | Ga0495650_0028122 | 3300046471 | Bacteria | 2587 |
| 402 | Ga0495650_0034120 | 3300046471 | Bacteria | 2257 |
| 403 | Ga0495580_0001817 | 3300046472 | Bacteria | 18776 |
| 404 | Ga0495580_0002260 | 3300046472 | Bacteria | 16818 |
| 405 | Ga0495580_0002859 | 3300046472 | Bacteria | 14860 |
| 406 | Ga0495580_0003220 | 3300046472 | Bacteria | 13966 |
| 407 | Ga0495580_0005202 | 3300046472 | Bacteria | 10810 |
| 408 | Ga0495580_0019602 | 3300046472 | Bacteria | 5025 |
| 409 | Ga0495580_0065112 | 3300046472 | Bacteria | 2553 |
| 410 | Ga0495580_0167700 | 3300046472 | Bacteria | 1518 |
| 411 | Ga0495580_0171931 | 3300046472 | Bacteria | 1498 |
| 412 | Ga0495580_0251421 | 3300046472 | Bacteria | 1210 |
| 413 | Ga0495582_0010344 | 3300046473 | Bacteria | 5133 |
| 414 | Ga0495582_0027116 | 3300046473 | Bacteria | 3139 |
| 415 | Ga0495582_0104404 | 3300046473 | Bacteria | 1588 |
| 416 | Ga0495605_0003476 | 3300046474 | Bacteria | 9371 |
| 417 | Ga0495605_0005346 | 3300046474 | Bacteria | 7484 |
| 418 | Ga0495605_0011742 | 3300046474 | Bacteria | 4875 |
| 419 | Ga0495605_0080555 | 3300046474 | Bacteria | 1524 |
| 420 | Ga0495662_0014406 | 3300046476 | Bacteria | 3846 |
| 421 | Ga0495662_0028255 | 3300046476 | Bacteria | 2708 |
| 422 | Ga0495662_0084977 | 3300046476 | Bacteria | 1541 |
| 423 | Ga0495664_0025316 | 3300046477 | Bacteria | 3454 |
| 424 | Ga0495664_0026141 | 3300046477 | Bacteria | 3400 |
| 425 | Ga0495664_0042592 | 3300046477 | Bacteria | 2689 |
| 426 | Ga0495664_0288974 | 3300046477 | Bacteria | 990 |
| 427 | Ga0495584_0067639 | 3300046491 | Bacteria | 1795 |
| 428 | Ga0495585_0078174 | 3300046492 | Bacteria | 1795 |
| 429 | Ga0495594_0034875 | 3300046499 | Bacteria | 2739 |
| 430 | Ga0495596_0002466 | 3300046500 | Bacteria | 9944 |
| 431 | Ga0495596_0004389 | 3300046500 | Bacteria | 6885 |
| 432 | Ga0495596_0104689 | 3300046500 | Bacteria | 1099 |
| 433 | Ga0495607_0175307 | 3300046501 | Bacteria | 1079 |
| 434 | Ga0495583_0010866 | 3300046506 | Bacteria | 5266 |
| 435 | Ga0495583_0015678 | 3300046506 | Bacteria | 4107 |
| 436 | Ga0495583_0039756 | 3300046506 | Bacteria | 2213 |
| 437 | Ga0495606_0007997 | 3300046507 | Bacteria | 9299 |
| 438 | Ga0495606_0089929 | 3300046507 | Bacteria | 1890 |
| 439 | Ga0495606_0134284 | 3300046507 | Bacteria | 1467 |
| 440 | Ga0495606_0139488 | 3300046507 | Bacteria | 1433 |
| 441 | Ga0495608_0001012 | 3300046511 | Bacteria | 19796 |
| 442 | Ga0495608_0047409 | 3300046511 | Bacteria | 2857 |
| 443 | Ga0495608_0133633 | 3300046511 | Bacteria | 1586 |
| 444 | Ga0495610_0003374 | 3300046512 | Bacteria | 12492 |
| 445 | Ga0495610_0043589 | 3300046512 | Bacteria | 2234 |
| 446 | Ga0495616_0052034 | 3300046513 | Bacteria | 2040 |
| 447 | Ga0495616_0058344 | 3300046513 | Bacteria | 1901 |
| 448 | Ga0495618_0001130 | 3300046514 | Bacteria | 18033 |
| 449 | Ga0495618_0045549 | 3300046514 | Bacteria | 2767 |
| 450 | Ga0495620_0014380 | 3300046515 | Bacteria | 4024 |
| 451 | Ga0495620_0044150 | 3300046515 | Bacteria | 1938 |
| 452 | Ga0495620_0082293 | 3300046515 | Bacteria | 1301 |
| 453 | Ga0495620_0124961 | 3300046515 | Bacteria | 1012 |
| 454 | Ga0495628_0005223 | 3300046516 | Bacteria | 11398 |
| 455 | Ga0495628_0010662 | 3300046516 | Bacteria | 7787 |
| 456 | Ga0495628_0012117 | 3300046516 | Bacteria | 7268 |
| 457 | Ga0495628_0032140 | 3300046516 | Bacteria | 4239 |
| 458 | Ga0495628_0049860 | 3300046516 | Bacteria | 3313 |
| 459 | Ga0495628_0085338 | 3300046516 | Bacteria | 2449 |
| 460 | Ga0495628_0095157 | 3300046516 | Bacteria | 2301 |
| 461 | Ga0495630_0006020 | 3300046517 | Bacteria | 8585 |
| 462 | Ga0495630_0013709 | 3300046517 | Bacteria | 5894 |
| 463 | Ga0495630_0016286 | 3300046517 | Bacteria | 5431 |
| 464 | Ga0495630_0167455 | 3300046517 | Bacteria | 1673 |
| 465 | Ga0495643_0046130 | 3300046522 | Bacteria | 2364 |
| 466 | Ga0495643_0118131 | 3300046522 | Bacteria | 1342 |
| 467 | Ga0495644_0013611 | 3300046523 | Bacteria | 3120 |
| 468 | Ga0495644_0082320 | 3300046523 | Bacteria | 1213 |
| 469 | Ga0495648_0006327 | 3300046524 | Bacteria | 9685 |
| 470 | Ga0495648_0043992 | 3300046524 | Bacteria | 2792 |
| 471 | Ga0495648_0063606 | 3300046524 | Bacteria | 2177 |
| 472 | Ga0495648_0074152 | 3300046524 | Bacteria | 1961 |
| 473 | Ga0495648_0139547 | 3300046524 | Bacteria | 1277 |
| 474 | Ga0495648_0212006 | 3300046524 | Bacteria | 961 |
| 475 | Ga0495666_0000438 | 3300046526 | Bacteria | 18485 |
| 476 | Ga0495666_0002524 | 3300046526 | Bacteria | 9090 |
| 477 | Ga0495666_0012255 | 3300046526 | Bacteria | 4275 |
| 478 | Ga0495666_0030746 | 3300046526 | Bacteria | 2633 |
| 479 | Ga0495666_0119741 | 3300046526 | Bacteria | 1233 |
| 480 | Ga0495666_0168116 | 3300046526 | Bacteria | 1015 |
| 481 | Ga0495642_0005060 | 3300046528 | Bacteria | 5078 |
| 482 | Ga0495642_0031563 | 3300046528 | Bacteria | 2124 |
| 483 | Ga0495642_0040738 | 3300046528 | Bacteria | 1888 |
| 484 | Ga0495652_0001699 | 3300046529 | Bacteria | 23777 |
| 485 | Ga0495652_0015047 | 3300046529 | Bacteria | 6929 |
| 486 | Ga0495652_0044531 | 3300046529 | Bacteria | 3820 |
| 487 | Ga0495652_0083740 | 3300046529 | Bacteria | 2624 |
| 488 | Ga0495652_0244804 | 3300046529 | Bacteria | 1332 |
| 489 | Ga0495654_0006843 | 3300046530 | Bacteria | 6433 |
| 490 | Ga0495665_0001450 | 3300046531 | Bacteria | 12718 |
| 491 | Ga0495665_0011982 | 3300046531 | Bacteria | 4693 |
| 492 | Ga0495665_0228708 | 3300046531 | Bacteria | 960 |
| 493 | Ga0495640_0012116 | 3300046533 | Bacteria | 6603 |
| 494 | Ga0495640_0032364 | 3300046533 | Bacteria | 3725 |
| 495 | Ga0495640_0035452 | 3300046533 | Bacteria | 3531 |
| 496 | Ga0495586_0037783 | 3300046535 | Bacteria | 2592 |
| 497 | Ga0495587_0032929 | 3300046536 | Bacteria | 3130 |
| 498 | Ga0495587_0044503 | 3300046536 | Bacteria | 2640 |
| 499 | Ga0495597_0080253 | 3300046542 | Bacteria | 1396 |
| 500 | Ga0495645_0000045 | 3300046543 | Bacteria | 89793 |
| 501 | Ga0495645_0011401 | 3300046543 | Bacteria | 6254 |
| 502 | Ga0495645_0014740 | 3300046543 | Bacteria | 5552 |
| 503 | Ga0495622_0000005 | 3300046557 | Bacteria | 254434 |
| 504 | Ga0495622_0169663 | 3300046557 | Bacteria | 981 |
| 505 | Ga0495634_0037410 | 3300046642 | Bacteria | 3315 |
| 506 | Ga0495634_0057254 | 3300046642 | Bacteria | 2602 |
| 507 | Ga0495611_0062364 | 3300046648 | Bacteria | 1696 |
| 508 | Ga0495625_0013439 | 3300046660 | Bacteria | 6580 |
| 509 | Ga0495625_0080834 | 3300046660 | Bacteria | 2263 |
| 510 | Ga0495625_0177615 | 3300046660 | Bacteria | 1418 |
| 511 | Ga0495635_0008309 | 3300046663 | Bacteria | 7245 |
| 512 | Ga0495635_0012101 | 3300046663 | Bacteria | 6048 |
| 513 | Ga0495635_0019842 | 3300046663 | Bacteria | 4683 |
| 514 | Ga0495635_0057370 | 3300046663 | Bacteria | 2679 |
| 515 | Ga0495599_0052079 | 3300046678 | Bacteria | 2564 |
| 516 | Ga0495599_0066671 | 3300046678 | Bacteria | 2248 |
| 517 | Ga0495599_0165863 | 3300046678 | Bacteria | 1364 |
| 518 | Ga0495623_0002188 | 3300046679 | Bacteria | 13035 |
| 519 | Ga0495623_0023150 | 3300046679 | Bacteria | 4008 |
| 520 | Ga0495623_0025270 | 3300046679 | Bacteria | 3826 |
| 521 | Ga0495623_0167627 | 3300046679 | Bacteria | 1285 |
| 522 | Ga0495646_0008890 | 3300046680 | Bacteria | 6380 |
| 523 | Ga0495646_0011375 | 3300046680 | Bacteria | 5650 |
| 524 | Ga0495646_0047204 | 3300046680 | Bacteria | 2622 |
| 525 | Ga0495646_0079349 | 3300046680 | Bacteria | 1916 |
| 526 | Ga0495646_0157674 | 3300046680 | Bacteria | 1258 |
| 527 | Ga0495669_0007072 | 3300046684 | Bacteria | 4699 |
| 528 | Ga0495669_0046922 | 3300046684 | Bacteria | 1929 |
| 529 | Ga0495669_0053059 | 3300046684 | Bacteria | 1823 |
| 530 | Ga0495669_0220059 | 3300046684 | Bacteria | 910 |
| 531 | Ga0495613_0023284 | 3300046689 | Bacteria | 4613 |
| 532 | Ga0495613_0076974 | 3300046689 | Bacteria | 2427 |
| 533 | Ga0495624_0001622 | 3300046690 | Bacteria | 17246 |
| 534 | Ga0495624_0002636 | 3300046690 | Bacteria | 13543 |
| 535 | Ga0495624_0002917 | 3300046690 | Bacteria | 12783 |
| 536 | Ga0495624_0009333 | 3300046690 | Bacteria | 6796 |
| 537 | Ga0495624_0223820 | 3300046690 | Bacteria | 1140 |
| 538 | Ga0495624_0402638 | 3300046690 | Bacteria | 821 |
| 539 | Ga0495671_0100248 | 3300046692 | Bacteria | 1416 |
| 540 | Ga0495671_0172999 | 3300046692 | Bacteria | 1049 |
| 541 | Ga0495671_0197754 | 3300046692 | Bacteria | 975 |
| 542 | Ga0495649_0003998 | 3300046694 | Bacteria | 9719 |
| 543 | Ga0495649_0024276 | 3300046694 | Bacteria | 3381 |
| 544 | Ga0495649_0034384 | 3300046694 | Bacteria | 2788 |
| 545 | Ga0495649_0178311 | 3300046694 | Bacteria | 1109 |
| 546 | Ga0495589_0002911 | 3300046794 | Bacteria | 9457 |
| 547 | Ga0495589_0009528 | 3300046794 | Bacteria | 5047 |
| 548 | Ga0495589_0038022 | 3300046794 | Bacteria | 2410 |
| 549 | Ga0495589_0071419 | 3300046794 | Bacteria | 1696 |
| 550 | Ga0495600_0006217 | 3300046809 | Bacteria | 7245 |
| 551 | Ga0495600_0011428 | 3300046809 | Bacteria | 5530 |
| 552 | Ga0495600_0035843 | 3300046809 | Bacteria | 3224 |
| 553 | Ga0495600_0072139 | 3300046809 | Bacteria | 2256 |
| 554 | Ga0495660_0030746 | 3300046810 | Bacteria | 3024 |
| 555 | Ga0495660_0098835 | 3300046810 | Bacteria | 1505 |
| 556 | Ga0495660_0144117 | 3300046810 | Bacteria | 1182 |
| 557 | Ga0495660_0150485 | 3300046810 | Bacteria | 1149 |
| 558 | Ga0495581_0003152 | 3300047315 | Bacteria | 9438 |
| 559 | Ga0495581_0053089 | 3300047315 | Bacteria | 2341 |
| 560 | Ga0495581_0147953 | 3300047315 | Bacteria | 1371 |
| 561 | Ga0495604_0003834 | 3300047317 | Bacteria | 11974 |
| 562 | Ga0495604_0004152 | 3300047317 | Bacteria | 11499 |
| 563 | Ga0495604_0004786 | 3300047317 | Bacteria | 10728 |
| 564 | Ga0495604_0010331 | 3300047317 | Bacteria | 7395 |
| 565 | Ga0495604_0012062 | 3300047317 | Bacteria | 6871 |
| 566 | Ga0495604_0075846 | 3300047317 | Bacteria | 2530 |
| 567 | Ga0495604_0105976 | 3300047317 | Bacteria | 2057 |
| 568 | Ga0495636_0009936 | 3300047318 | Bacteria | 3748 |
| 569 | Ga0495674_0006553 | 3300047319 | Bacteria | 11171 |
| 570 | Ga0495674_0020301 | 3300047319 | Bacteria | 6154 |
| 571 | Ga0495674_0023154 | 3300047319 | Bacteria | 5725 |
| 572 | Ga0495674_0029686 | 3300047319 | Bacteria | 4977 |
| 573 | Ga0495674_0041504 | 3300047319 | Bacteria | 4109 |
| 574 | Ga0495674_0173458 | 3300047319 | Bacteria | 1799 |
| 575 | Ga0495674_0181558 | 3300047319 | Bacteria | 1752 |
| 576 | Ga0495674_0248726 | 3300047319 | Bacteria | 1463 |
| 577 | Ga0495674_0328025 | 3300047319 | Bacteria | 1245 |
| 578 | Ga0495674_0376325 | 3300047319 | Bacteria | 1149 |
| 579 | Ga0495674_0462206 | 3300047319 | Bacteria | 1018 |
| 580 | Ga0495672_0045865 | 3300047320 | Bacteria | 2611 |
| 581 | Ga0495672_0120030 | 3300047320 | Bacteria | 1399 |
| 582 | Ga0495676_0026798 | 3300047321 | Bacteria | 4953 |
| 583 | Ga0495676_0099354 | 3300047321 | Bacteria | 2157 |
| 584 | Ga0495676_0174983 | 3300047321 | Bacteria | 1508 |
| 585 | Ga0495676_0365596 | 3300047321 | Bacteria | 962 |
| 586 | Ga0495680_0005170 | 3300047322 | Bacteria | 12306 |
| 587 | Ga0495680_0005562 | 3300047322 | Bacteria | 11828 |
| 588 | Ga0495680_0010291 | 3300047322 | Bacteria | 8343 |
| 589 | Ga0495680_0021548 | 3300047322 | Bacteria | 5393 |
| 590 | Ga0495680_0054024 | 3300047322 | Bacteria | 3121 |
| 591 | Ga0495680_0057319 | 3300047322 | Bacteria | 3013 |
| 592 | Ga0495680_0300769 | 3300047322 | Bacteria | 1126 |
| 593 | Ga0495683_0001115 | 3300047323 | Bacteria | 18552 |
| 594 | Ga0495683_0001532 | 3300047323 | Bacteria | 14984 |
| 595 | Ga0495683_0003052 | 3300047323 | Bacteria | 9840 |
| 596 | Ga0495683_0007950 | 3300047323 | Bacteria | 5692 |
| 597 | Ga0495683_0023725 | 3300047323 | Bacteria | 3152 |
| 598 | Ga0495683_0062477 | 3300047323 | Bacteria | 1842 |
| 599 | Ga0495683_0099523 | 3300047323 | Bacteria | 1399 |
| 600 | Ga0495687_000051 | 3300047443 | Bacteria | 200568 |
| 601 | Ga0495687_009807 | 3300047443 | Bacteria | 5317 |
| 602 | Ga0495687_010322 | 3300047443 | Bacteria | 5127 |
| 603 | Ga0495687_017693 | 3300047443 | Bacteria | 3543 |
| 604 | Ga0495687_022881 | 3300047443 | Bacteria | 2993 |
| 605 | Ga0495687_040885 | 3300047443 | Bacteria | 2039 |
| 606 | Ga0495687_057441 | 3300047443 | Bacteria | 1618 |
| 607 | Ga0495675_0001723 | 3300047444 | Bacteria | 13085 |
| 608 | Ga0495675_0032099 | 3300047444 | Bacteria | 3351 |
| 609 | Ga0495675_0055987 | 3300047444 | Bacteria | 2501 |
| 610 | Ga0495675_0061429 | 3300047444 | Bacteria | 2380 |
| 611 | Ga0495675_0079787 | 3300047444 | Bacteria | 2061 |
| 612 | Ga0495675_0160302 | 3300047444 | Bacteria | 1385 |
| 613 | Ga0495675_0196204 | 3300047444 | Bacteria | 1230 |
| 614 | Ga0495679_000009 | 3300047446 | Bacteria | 343637 |
| 615 | Ga0495679_003419 | 3300047446 | Bacteria | 7640 |
| 616 | Ga0495679_061355 | 3300047446 | Bacteria | 1101 |
| 617 | Ga0495673_0025699 | 3300047469 | Bacteria | 2823 |
| 618 | Ga0495684_0061781 | 3300047471 | Bacteria | 2850 |
| 619 | Ga0495684_0119704 | 3300047471 | Bacteria | 1984 |
| 620 | Ga0495686_0198355 | 3300047472 | Bacteria | 1153 |
| 621 | Ga0495593_0001510 | 3300047673 | Bacteria | 13683 |
| 622 | Ga0495593_0002335 | 3300047673 | Bacteria | 11391 |
| 623 | Ga0495593_0025682 | 3300047673 | Bacteria | 3260 |
| 624 | Ga0495593_0043670 | 3300047673 | Bacteria | 2400 |
| 625 | Ga0495602_0004008 | 3300048088 | Bacteria | 15340 |
| 626 | Ga0495602_0006361 | 3300048088 | Bacteria | 12386 |
| 627 | Ga0495602_0008808 | 3300048088 | Bacteria | 10522 |
| 628 | Ga0495602_0022428 | 3300048088 | Bacteria | 6179 |
| 629 | Ga0495602_0034549 | 3300048088 | Bacteria | 4729 |
| 630 | Ga0495602_0123052 | 3300048088 | Bacteria | 2083 |
| 631 | Ga0495602_0131183 | 3300048088 | Bacteria | 1998 |
| 632 | Ga0495602_0143567 | 3300048088 | Bacteria | 1886 |
| 633 | Ga0495614_0001260 | 3300048089 | Bacteria | 10884 |
| 634 | Ga0495614_0038232 | 3300048089 | Bacteria | 2060 |
| 635 | Ga0495626_0003050 | 3300048091 | Bacteria | 10998 |
| 636 | Ga0495626_0018733 | 3300048091 | Bacteria | 3469 |
| 637 | Ga0495626_0035616 | 3300048091 | Bacteria | 2375 |
| 638 | Ga0495626_0067804 | 3300048091 | Bacteria | 1610 |
| 639 | Ga0496100_0030789 | 3300048903 | Bacteria | 3331 |
| 640 | Ga0496100_0045519 | 3300048903 | Bacteria | 2816 |
| 641 | Ga0496100_0071996 | 3300048903 | Bacteria | 2309 |
| 642 | Ga0496100_0075322 | 3300048903 | Bacteria | 2263 |
| 643 | Ga0496100_0083907 | 3300048903 | Bacteria | 2158 |
| 644 | Ga0496101_0002488 | 3300048904 | Bacteria | 11318 |
| 645 | Ga0496101_0040464 | 3300048904 | Bacteria | 3319 |
| 646 | Ga0496101_0054637 | 3300048904 | Bacteria | 2883 |
| 647 | Ga0496101_0084234 | 3300048904 | Bacteria | 2354 |
| 648 | Ga0496101_0111543 | 3300048904 | Bacteria | 2059 |
| 649 | Ga0496102_0015576 | 3300048905 | Bacteria | 6624 |
| 650 | Ga0496102_0028105 | 3300048905 | Bacteria | 5026 |
| 651 | Ga0496102_0048665 | 3300048905 | Bacteria | 3854 |
| 652 | Ga0496102_0086645 | 3300048905 | Bacteria | 2893 |
| 653 | Ga0496102_0133926 | 3300048905 | Bacteria | 2321 |
| 654 | Ga0496103_0001364 | 3300048906 | Bacteria | 16468 |
| 655 | Ga0496103_0007406 | 3300048906 | Bacteria | 6540 |
| 656 | Ga0496104_0040881 | 3300048907 | Bacteria | 4347 |
| 657 | Ga0496104_0078406 | 3300048907 | Bacteria | 3148 |
| 658 | Ga0496104_0164534 | 3300048907 | Bacteria | 2127 |
| 659 | Ga0496104_0203008 | 3300048907 | Bacteria | 1894 |
| 660 | Ga0496104_0240679 | 3300048907 | Bacteria | 1722 |
| 661 | Ga0496105_0014366 | 3300048908 | Bacteria | 6301 |
| 662 | Ga0496105_0190781 | 3300048908 | Bacteria | 1675 |
| 663 | Ga0496105_0267795 | 3300048908 | Bacteria | 1380 |
| 664 | Ga0496106_0000010 | 3300048909 | Bacteria | 232347 |
| 665 | Ga0496106_0001335 | 3300048909 | Bacteria | 18490 |
| 666 | Ga0496106_0007766 | 3300048909 | Bacteria | 7936 |
| 667 | Ga0496106_0158591 | 3300048909 | Bacteria | 1788 |
| 668 | Ga0496106_0262101 | 3300048909 | Bacteria | 1383 |
| 669 | Ga0496107_0040403 | 3300048910 | Bacteria | 3348 |
| 670 | Ga0496107_0042712 | 3300048910 | Bacteria | 3256 |
| 671 | Ga0496107_0131393 | 3300048910 | Bacteria | 1848 |
| 672 | Ga0496108_0063235 | 3300048911 | Bacteria | 3117 |
| 673 | Ga0496108_0357990 | 3300048911 | Bacteria | 1273 |
| 674 | Ga0496109_0020549 | 3300048912 | Bacteria | 5832 |
| 675 | Ga0496109_0217732 | 3300048912 | Bacteria | 1796 |
| 676 | Ga0496110_0019939 | 3300048913 | Bacteria | 5652 |
| 677 | Ga0496110_0095738 | 3300048913 | Bacteria | 2659 |
| 678 | Ga0496110_0315233 | 3300048913 | Bacteria | 1424 |
| 679 | Ga0496111_0039607 | 3300048914 | Bacteria | 3380 |
| 680 | Ga0496111_0134034 | 3300048914 | Bacteria | 1834 |
| 681 | Ga0496112_0035917 | 3300048915 | Bacteria | 4830 |
| 682 | Ga0496112_0057459 | 3300048915 | Bacteria | 3830 |
| 683 | Ga0496112_0169736 | 3300048915 | Bacteria | 2147 |
| 684 | Ga0496113_0007496 | 3300048916 | Bacteria | 7028 |
| 685 | Ga0496113_0362199 | 3300048916 | Bacteria | 1163 |
| 686 | Ga0496114_0000403 | 3300048917 | Bacteria | 31960 |
| 687 | Ga0496114_0067003 | 3300048917 | Bacteria | 3011 |
| 688 | Ga0496115_0038592 | 3300048918 | Bacteria | 3790 |
| 689 | Ga0496115_0047951 | 3300048918 | Bacteria | 3417 |
| 690 | Ga0496115_0136774 | 3300048918 | Bacteria | 2020 |
| 691 | Ga0496116_0012547 | 3300048919 | Bacteria | 6914 |
| 692 | Ga0496116_0026783 | 3300048919 | Bacteria | 4207 |
| 693 | Ga0496116_0058750 | 3300048919 | Bacteria | 2505 |
| 694 | Ga0496117_0001592 | 3300048920 | Bacteria | 32118 |
| 695 | Ga0496117_0001963 | 3300048920 | Bacteria | 27350 |
| 696 | Ga0496117_0004398 | 3300048920 | Bacteria | 15595 |
| 697 | Ga0496117_0011858 | 3300048920 | Bacteria | 7756 |
| 698 | Ga0496117_0019150 | 3300048920 | Bacteria | 5633 |
| 699 | Ga0496117_0080808 | 3300048920 | Bacteria | 2136 |
| 700 | Ga0496117_0294637 | 3300048920 | Bacteria | 862 |
| 701 | Ga0496118_0001562 | 3300048921 | Bacteria | 34004 |
| 702 | Ga0496118_0001704 | 3300048921 | Bacteria | 32149 |
| 703 | Ga0496118_0001971 | 3300048921 | Bacteria | 29134 |
| 704 | Ga0496118_0002437 | 3300048921 | Bacteria | 25046 |
| 705 | Ga0496118_0003290 | 3300048921 | Bacteria | 20560 |
| 706 | Ga0496118_0008219 | 3300048921 | Bacteria | 10832 |
| 707 | Ga0496118_0019471 | 3300048921 | Bacteria | 6064 |
| 708 | Ga0496118_0021702 | 3300048921 | Bacteria | 5642 |
| 709 | Ga0496118_0077431 | 3300048921 | Bacteria | 2359 |
| 710 | Ga0496118_0152458 | 3300048921 | Bacteria | 1444 |
| 711 | Ga0496119_0063981 | 3300048922 | Bacteria | 2186 |
| 712 | Ga0496119_0213985 | 3300048922 | Bacteria | 990 |
| 713 | Ga0496120_0105905 | 3300048923 | Bacteria | 1478 |
| 714 | Ga0496121_0002486 | 3300048924 | Bacteria | 28054 |
| 715 | Ga0496121_0006106 | 3300048924 | Bacteria | 15152 |
| 716 | Ga0496121_0006275 | 3300048924 | Bacteria | 14866 |
| 717 | Ga0496121_0024985 | 3300048924 | Bacteria | 5690 |
| 718 | Ga0496121_0188038 | 3300048924 | Bacteria | 1483 |
| 719 | Ga0496121_0208267 | 3300048924 | Bacteria | 1387 |
| 720 | Ga0496122_0002222 | 3300048925 | Bacteria | 28327 |
| 721 | Ga0496122_0046426 | 3300048925 | Bacteria | 3364 |
| 722 | Ga0496122_0183193 | 3300048925 | Bacteria | 1246 |
| 723 | Ga0496123_0000903 | 3300048926 | Bacteria | 46887 |
| 724 | Ga0496123_0028624 | 3300048926 | Bacteria | 4119 |
| 725 | Ga0496123_0126677 | 3300048926 | Bacteria | 1424 |
| 726 | Ga0496124_0050922 | 3300048927 | Bacteria | 3526 |
| 727 | Ga0496124_0152308 | 3300048927 | Bacteria | 1812 |
| 728 | Ga0496125_0010341 | 3300048928 | Bacteria | 9439 |
| 729 | Ga0496126_0000193 | 3300048929 | Bacteria | 136394 |
| 730 | Ga0496126_0000337 | 3300048929 | Bacteria | 98585 |
| 731 | Ga0496126_0000475 | 3300048929 | Bacteria | 79715 |
| 732 | Ga0496126_0010301 | 3300048929 | Bacteria | 9817 |
| 733 | Ga0496126_0112074 | 3300048929 | Bacteria | 2376 |
| 734 | Ga0495682_0024617 | 3300049460 | Bacteria | 2243 |
| 735 | Ga0495682_0043883 | 3300049460 | Bacteria | 1636 |
| 736 | Ga0501032_0188592 | 3300049569 | Unclassified | 1348 |
| 737 | Ga0501043_0009431 | 3300049579 | Bacteria | 7661 |
| 738 | Ga0501047_0142826 | 3300049581 | Bacteria | 2272 |
| 739 | Ga0501070_0491625 | 3300049586 | Bacteria | 986 |
| 740 | Ga0501080_0018606 | 3300049742 | Bacteria | 6429 |
| 741 | Ga0501044_0163507 | 3300049823 | Bacteria | 2201 |
| 742 | Ga0501044_0596606 | 3300049823 | Bacteria | 998 |
| 743 | nmdc:mga0yw44_114293_c1 | 3300050492 | Bacteria | 1732 |
| 744 | nmdc:mga0k408_100319_c1 | 3300050493 | Bacteria | 1707 |
| 745 | nmdc:mga0k408_113322_c1 | 3300050493 | Bacteria | 1604 |
| 746 | nmdc:mga0k408_223927_c1 | 3300050493 | Bacteria | 1123 |
| 747 | nmdc:mga0k408_63984_c1 | 3300050493 | Bacteria | 2140 |
| 748 | nmdc:mga0k408_6516_c1 | 3300050493 | Bacteria | 6220 |
| 749 | nmdc:mga06z11_19680_c1 | 3300050494 | Bacteria | 3108 |
| 750 | nmdc:mga06z11_95428_c1 | 3300050494 | Bacteria | 1622 |
| 751 | nmdc:mga07m45_4464_c1 | 3300050496 | Bacteria | 6846 |
| 752 | nmdc:mga07m45_919_c1 | 3300050496 | Bacteria | 12885 |
| 753 | nmdc:mga09592_85690_c1 | 3300050508 | Bacteria | 2687 |
| 754 | nmdc:mga08y16_517421_c1 | 3300050511 | Bacteria | 1211 |
| 755 | nmdc:mga0n895_516677_c1 | 3300050512 | Bacteria | 1202 |
| 756 | nmdc:mga0n895_592094_c1 | 3300050512 | Bacteria | 1112 |
| 757 | nmdc:mga0n895_6971_c1 | 3300050512 | Bacteria | 9648 |
| 758 | nmdc:mga0a205_742132_c1 | 3300050515 | Bacteria | 831 |
| 759 | nmdc:mga0sz30_11010_c1 | 3300050516 | Bacteria | 3480 |
| 760 | Ga0495655_0017069 | 3300053083 | Bacteria | 1575 |
| 761 | Ga0495595_0108287 | 3300053084 | Bacteria | 1346 |
| 762 | Ga0495619_0024042 | 3300053085 | Bacteria | 3908 |
| 763 | Ga0500647_0003099 | 3300053091 | Bacteria | 6391 |
| 764 | Ga0500583_0004151 | 3300053092 | Bacteria | 4679 |
| 765 | Ga0500572_000038 | 3300053111 | Bacteria | 42226 |
| 766 | Ga0500652_027187 | 3300053131 | Bacteria | 2210 |
| 767 | Ga0500655_011291 | 3300053133 | Bacteria | 1617 |
| 768 | Ga0500559_0000014 | 3300053136 | Bacteria | 160139 |
| 769 | Ga0500568_0016410 | 3300053139 | Bacteria | 3294 |
| 770 | Ga0500622_0002290 | 3300053156 | Bacteria | 14025 |
| 771 | Ga0500622_0153216 | 3300053156 | Bacteria | 1087 |
| 772 | Ga0500587_011104 | 3300053739 | Bacteria | 1139 |
| 773 | Ga0466962_0017319 | 3300061719 | Bacteria | 3469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10074401 | Ga0075366_100744012 | 225 |
| 2 | 3300050493 | nmdc:mga0k408_63984_c1 | nmdc:mga0k408_63984_c1_816_1568 | 225 |
| 3 | 3300046476 | Ga0495662_0084977 | Ga0495662_0084977_389_1069 | 226 |
| 4 | 3300047317 | Ga0495604_0105976 | Ga0495604_0105976_1135_1887 | 227 |
| 5 | 3300048912 | Ga0496109_0217732 | Ga0496109_0217732_859_1542 | 227 |
| 6 | 3300013102 | Ga0157371_10015829 | Ga0157371_100158296 | 229 |
| 7 | 3300013105 | Ga0157369_10000326 | Ga0157369_1000032633 | 229 |
| 8 | 3300037466 | Ga0395898_0000201 | Ga0395898_0000201_138838_139590 | 229 |
| 9 | 3300038443 | Ga0395901_0161585 | Ga0395901_0161585_653_1405 | 229 |
| 10 | 3300050511 | nmdc:mga08y16_517421_c1 | nmdc:mga08y16_517421_c1_91_780 | 229 |
| 11 | 3300031456 | Ga0307513_10000011 | Ga0307513_1000001128 | 231 |
| 12 | 3300038443 | Ga0395901_0070109 | Ga0395901_0070109_1378_2130 | 231 |
| 13 | 3300047321 | Ga0495676_0174983 | Ga0495676_0174983_430_1182 | 231 |
| 14 | 3300003792 | Ga0055540_1012288 | Ga0055540_10122882 | 233 |
| 15 | 3300025303 | Ga0209051_1000362 | Ga0209051_100036231 | 233 |
| 16 | 3300046507 | Ga0495606_0139488 | Ga0495606_0139488_125_877 | 233 |
| 17 | 3300046524 | Ga0495648_0139547 | Ga0495648_0139547_385_1137 | 233 |
| 18 | 3300047319 | Ga0495674_0376325 | Ga0495674_0376325_311_1063 | 233 |
| 19 | 3300047320 | Ga0495672_0120030 | Ga0495672_0120030_102_854 | 233 |
| 20 | 3300053083 | Ga0495655_0017069 | Ga0495655_0017069_560_1312 | 233 |
| 21 | 3300009148 | Ga0105243_10010046 | Ga0105243_100100467 | 234 |
| 22 | 3300025935 | Ga0207709_10013152 | Ga0207709_100131522 | 234 |
| 23 | 3300046455 | Ga0495603_0010016 | Ga0495603_0010016_816_1568 | 234 |
| 24 | 3300046457 | Ga0495590_0018317 | Ga0495590_0018317_225_977 | 234 |
| 25 | 3300046459 | Ga0495629_0000068 | Ga0495629_0000068_22710_23462 | 234 |
| 26 | 3300046459 | Ga0495629_0029086 | Ga0495629_0029086_3130_3882 | 234 |
| 27 | 3300046460 | Ga0495638_0014841 | Ga0495638_0014841_2174_2926 | 234 |
| 28 | 3300046461 | Ga0495641_0014143 | Ga0495641_0014143_197_949 | 234 |
| 29 | 3300046462 | Ga0495651_0159127 | Ga0495651_0159127_472_1224 | 234 |
| 30 | 3300046463 | Ga0495653_0018524 | Ga0495653_0018524_4307_5059 | 234 |
| 31 | 3300046472 | Ga0495580_0002859 | Ga0495580_0002859_3362_4114 | 234 |
| 32 | 3300046473 | Ga0495582_0010344 | Ga0495582_0010344_3899_4651 | 234 |
| 33 | 3300046473 | Ga0495582_0027116 | Ga0495582_0027116_1848_2600 | 234 |
| 34 | 3300046474 | Ga0495605_0005346 | Ga0495605_0005346_3457_4209 | 234 |
| 35 | 3300046476 | Ga0495662_0028255 | Ga0495662_0028255_1344_2096 | 234 |
| 36 | 3300046499 | Ga0495594_0034875 | Ga0495594_0034875_1326_2078 | 234 |
| 37 | 3300046506 | Ga0495583_0010866 | Ga0495583_0010866_4349_5101 | 234 |
| 38 | 3300046514 | Ga0495618_0045549 | Ga0495618_0045549_361_1113 | 234 |
| 39 | 3300046516 | Ga0495628_0010662 | Ga0495628_0010662_1561_2313 | 234 |
| 40 | 3300046516 | Ga0495628_0012117 | Ga0495628_0012117_908_1660 | 234 |
| 41 | 3300046517 | Ga0495630_0016286 | Ga0495630_0016286_2792_3544 | 234 |
| 42 | 3300046524 | Ga0495648_0074152 | Ga0495648_0074152_166_918 | 234 |
| 43 | 3300046526 | Ga0495666_0002524 | Ga0495666_0002524_7830_8582 | 234 |
| 44 | 3300046528 | Ga0495642_0040738 | Ga0495642_0040738_724_1476 | 234 |
| 45 | 3300046531 | Ga0495665_0228708 | Ga0495665_0228708_103_855 | 234 |
| 46 | 3300046533 | Ga0495640_0035452 | Ga0495640_0035452_1035_1787 | 234 |
| 47 | 3300046535 | Ga0495586_0037783 | Ga0495586_0037783_634_1386 | 234 |
| 48 | 3300046536 | Ga0495587_0032929 | Ga0495587_0032929_385_1137 | 234 |
| 49 | 3300046642 | Ga0495634_0037410 | Ga0495634_0037410_2055_2807 | 234 |
| 50 | 3300046648 | Ga0495611_0062364 | Ga0495611_0062364_700_1452 | 234 |
| 51 | 3300046660 | Ga0495625_0177615 | Ga0495625_0177615_254_1006 | 234 |
| 52 | 3300046663 | Ga0495635_0057370 | Ga0495635_0057370_335_1087 | 234 |
| 53 | 3300046678 | Ga0495599_0066671 | Ga0495599_0066671_684_1436 | 234 |
| 54 | 3300046679 | Ga0495623_0023150 | Ga0495623_0023150_758_1510 | 234 |
| 55 | 3300046679 | Ga0495623_0025270 | Ga0495623_0025270_1232_1984 | 234 |
| 56 | 3300046680 | Ga0495646_0079349 | Ga0495646_0079349_349_1101 | 234 |
| 57 | 3300046689 | Ga0495613_0023284 | Ga0495613_0023284_1958_2710 | 234 |
| 58 | 3300046690 | Ga0495624_0002917 | Ga0495624_0002917_8604_9356 | 234 |
| 59 | 3300046690 | Ga0495624_0223820 | Ga0495624_0223820_40_792 | 234 |
| 60 | 3300046692 | Ga0495671_0172999 | Ga0495671_0172999_259_1011 | 234 |
| 61 | 3300047315 | Ga0495581_0003152 | Ga0495581_0003152_7732_8484 | 234 |
| 62 | 3300047317 | Ga0495604_0004152 | Ga0495604_0004152_8703_9455 | 234 |
| 63 | 3300047317 | Ga0495604_0075846 | Ga0495604_0075846_155_907 | 234 |
| 64 | 3300047319 | Ga0495674_0248726 | Ga0495674_0248726_163_915 | 234 |
| 65 | 3300047321 | Ga0495676_0026798 | Ga0495676_0026798_1461_2213 | 234 |
| 66 | 3300047321 | Ga0495676_0365596 | Ga0495676_0365596_106_858 | 234 |
| 67 | 3300047322 | Ga0495680_0054024 | Ga0495680_0054024_1862_2614 | 234 |
| 68 | 3300047322 | Ga0495680_0300769 | Ga0495680_0300769_147_899 | 234 |
| 69 | 3300047323 | Ga0495683_0099523 | Ga0495683_0099523_498_1250 | 234 |
| 70 | 3300047444 | Ga0495675_0032099 | Ga0495675_0032099_1172_1924 | 234 |
| 71 | 3300047444 | Ga0495675_0061429 | Ga0495675_0061429_1489_2241 | 234 |
| 72 | 3300047446 | Ga0495679_000009 | Ga0495679_000009_287684_288436 | 234 |
| 73 | 3300047446 | Ga0495679_003419 | Ga0495679_003419_6380_7132 | 234 |
| 74 | 3300047471 | Ga0495684_0119704 | Ga0495684_0119704_715_1467 | 234 |
| 75 | 3300047472 | Ga0495686_0198355 | Ga0495686_0198355_165_917 | 234 |
| 76 | 3300047673 | Ga0495593_0043670 | Ga0495593_0043670_100_852 | 234 |
| 77 | 3300048088 | Ga0495602_0008808 | Ga0495602_0008808_9248_10000 | 234 |
| 78 | 3300048088 | Ga0495602_0022428 | Ga0495602_0022428_2356_3108 | 234 |
| 79 | 3300048088 | Ga0495602_0131183 | Ga0495602_0131183_40_792 | 234 |
| 80 | 3300048089 | Ga0495614_0001260 | Ga0495614_0001260_4899_5651 | 234 |
| 81 | 3300048089 | Ga0495614_0038232 | Ga0495614_0038232_1270_2022 | 234 |
| 82 | 3300048091 | Ga0495626_0018733 | Ga0495626_0018733_2129_2881 | 234 |
| 83 | 3300048920 | Ga0496117_0080808 | Ga0496117_0080808_473_1225 | 234 |
| 84 | 3300048921 | Ga0496118_0008219 | Ga0496118_0008219_1002_1754 | 234 |
| 85 | 3300048924 | Ga0496121_0006275 | Ga0496121_0006275_711_1463 | 234 |
| 86 | 3300048929 | Ga0496126_0112074 | Ga0496126_0112074_702_1454 | 234 |
| 87 | 3300049460 | Ga0495682_0043883 | Ga0495682_0043883_370_1122 | 234 |
| 88 | 3300048905 | Ga0496102_0086645 | Ga0496102_0086645_1921_2673 | 237 |
| 89 | 3300048920 | Ga0496117_0001963 | Ga0496117_0001963_16237_16989 | 237 |
| 90 | 3300048921 | Ga0496118_0002437 | Ga0496118_0002437_15437_16189 | 237 |
| 91 | 3300048929 | Ga0496126_0000193 | Ga0496126_0000193_119639_120391 | 237 |
| 92 | 3300048925 | Ga0496122_0002222 | Ga0496122_0002222_17959_18711 | 239 |
| 93 | 3300048926 | Ga0496123_0000903 | Ga0496123_0000903_35282_36034 | 239 |
| 94 | 3300009011 | Ga0105251_10000654 | Ga0105251_100006547 | 240 |
| 95 | 3300025735 | Ga0207713_1003352 | Ga0207713_10033528 | 240 |
| 96 | 3300046471 | Ga0495650_0034120 | Ga0495650_0034120_1134_1886 | 240 |
| 97 | 3300046473 | Ga0495582_0104404 | Ga0495582_0104404_299_1051 | 240 |
| 98 | 3300046477 | Ga0495664_0025316 | Ga0495664_0025316_2414_3166 | 240 |
| 99 | 3300046511 | Ga0495608_0001012 | Ga0495608_0001012_42_794 | 240 |
| 100 | 3300046516 | Ga0495628_0032140 | Ga0495628_0032140_2586_3338 | 240 |
| 101 | 3300046526 | Ga0495666_0119741 | Ga0495666_0119741_93_845 | 240 |
| 102 | 3300046529 | Ga0495652_0083740 | Ga0495652_0083740_13_765 | 240 |
| 103 | 3300046557 | Ga0495622_0000005 | Ga0495622_0000005_94904_95656 | 240 |
| 104 | 3300046679 | Ga0495623_0167627 | Ga0495623_0167627_168_920 | 240 |
| 105 | 3300046809 | Ga0495600_0006217 | Ga0495600_0006217_169_921 | 240 |
| 106 | 3300047322 | Ga0495680_0021548 | Ga0495680_0021548_1996_2748 | 240 |
| 107 | 3300047444 | Ga0495675_0160302 | Ga0495675_0160302_390_1142 | 240 |
| 108 | iso_pu_bacteria | 2855020534 | 2855022103 | 240 |
| 109 | 3300048921 | Ga0496118_0077431 | Ga0496118_0077431_1589_2341 | 241 |
| 110 | 3300013105 | Ga0157369_10055294 | Ga0157369_100552943 | 242 |
| 111 | 3300017792 | Ga0163161_10394363 | Ga0163161_103943632 | 242 |
| 112 | 3300046463 | Ga0495653_0244834 | Ga0495653_0244834_326_1078 | 242 |
| 113 | 3300046516 | Ga0495628_0049860 | Ga0495628_0049860_2257_3009 | 242 |
| 114 | 3300046526 | Ga0495666_0030746 | Ga0495666_0030746_1331_2083 | 242 |
| 115 | 3300046529 | Ga0495652_0244804 | Ga0495652_0244804_168_920 | 242 |
| 116 | 3300046680 | Ga0495646_0157674 | Ga0495646_0157674_421_1173 | 242 |
| 117 | 3300047317 | Ga0495604_0012062 | Ga0495604_0012062_523_1275 | 242 |
| 118 | 3300047322 | Ga0495680_0057319 | Ga0495680_0057319_298_1050 | 242 |
| 119 | 3300047444 | Ga0495675_0079787 | Ga0495675_0079787_1028_1780 | 242 |
| 120 | 3300002705 | JGI25156J39149_1000199 | JGI25156J39149_100019920 | 243 |
| 121 | 3300025256 | Ga0209759_1000002 | Ga0209759_100000261 | 243 |
| 122 | 3300046472 | Ga0495580_0167700 | Ga0495580_0167700_247_999 | 243 |
| 123 | 3300046517 | Ga0495630_0006020 | Ga0495630_0006020_6469_7221 | 243 |
| 124 | 3300047319 | Ga0495674_0328025 | Ga0495674_0328025_379_1131 | 243 |
| 125 | 3300048929 | Ga0496126_0000475 | Ga0496126_0000475_13690_14442 | 243 |
| 126 | 3300005356 | Ga0070674_100244923 | Ga0070674_1002449232 | 246 |
| 127 | 3300028794 | Ga0307515_10000525 | Ga0307515_1000052561 | 246 |
| 128 | 3300031456 | Ga0307513_10194937 | Ga0307513_101949372 | 246 |
| 129 | 3300046458 | Ga0495591_076876 | Ga0495591_076876_76_822 | 246 |
| 130 | iso_pu_bacteria | 2501025501 | 2501072369 | 246 |
| 131 | iso_pu_bacteria | 2501025502 | 2501080040 | 246 |
| 132 | iso_pu_bacteria | 2501025504 | 2501412379 | 246 |
| 133 | iso_pu_bacteria | 2508501125 | 2509129609 | 246 |
| 134 | iso_pu_bacteria | 2510065045 | 2510249157 | 246 |
| 135 | iso_pu_bacteria | 2510917013 | 2511087924 | 246 |
| 136 | iso_pu_bacteria | 2510917014 | 2511101485 | 246 |
| 137 | iso_pu_bacteria | 2510917015 | 2511107912 | 246 |
| 138 | iso_pu_bacteria | 2512047030 | 2512352371 | 246 |
| 139 | iso_pu_bacteria | 2513237151 | 2513958710 | 246 |
| 140 | iso_pu_bacteria | 2513237166 | 2514049434 | 246 |
| 141 | iso_pu_bacteria | 2515154122 | 2515680512 | 246 |
| 142 | iso_pu_bacteria | 2515154123 | 2515687615 | 246 |
| 143 | iso_pu_bacteria | 2515154189 | 2516018198 | 246 |
| 144 | iso_pu_bacteria | 2526164713 | 2527076013 | 246 |
| 145 | iso_pu_bacteria | 2562617112 | 2563061380 | 246 |
| 146 | iso_pu_bacteria | 2585428057 | 2587727854 | 246 |
| 147 | iso_pu_bacteria | 2600255067 | 2600814146 | 246 |
| 148 | iso_pu_bacteria | 2711768613 | 2713476344 | 246 |
| 149 | iso_pu_bacteria | 2718217991 | 2719642434 | 246 |
| 150 | iso_pu_bacteria | 2738541296 | 2738820380 | 246 |
| 151 | iso_pu_bacteria | 2738541298 | 2738832860 | 246 |
| 152 | iso_pu_bacteria | 2738541306 | 2738874387 | 246 |
| 153 | iso_pu_bacteria | 2738543002 | 2739186017 | 246 |
| 154 | iso_pu_bacteria | 2738543008 | 2739220985 | 246 |
| 155 | iso_pu_bacteria | 2744054900 | 2746089821 | 246 |
| 156 | iso_pu_bacteria | 2744054901 | 2746098001 | 246 |
| 157 | iso_pu_bacteria | 2751185846 | 2753570735 | 246 |
| 158 | iso_pu_bacteria | 2791355137 | 2792837763 | 246 |
| 159 | iso_pu_bacteria | 2818991450 | 2819624522 | 246 |
| 160 | iso_pu_bacteria | 2842324504 | 2842329410 | 246 |
| 161 | iso_pu_bacteria | 2842348783 | 2842354491 | 246 |
| 162 | iso_pu_bacteria | 2842454564 | 2842456378 | 246 |
| 163 | iso_pu_bacteria | 2856287931 | 2856289887 | 246 |
| 164 | iso_pu_bacteria | 2857357740 | 2857363074 | 246 |
| 165 | iso_pu_bacteria | 2883087390 | 2883090393 | 246 |
| 166 | iso_pu_bacteria | 2885270888 | 2885277470 | 246 |
| 167 | iso_pu_bacteria | 2900634093 | 2900640604 | 246 |
| 168 | iso_pu_bacteria | 2902682994 | 2902687755 | 246 |
| 169 | iso_pu_bacteria | 2904483920 | 2904486467 | 246 |
| 170 | iso_pu_bacteria | 2904615490 | 2904621837 | 246 |
| 171 | iso_pu_bacteria | 2919527303 | 2919527812 | 246 |
| 172 | iso_pu_bacteria | 2928108538 | 2928108566 | 246 |
| 173 | iso_pu_bacteria | 2928135762 | 2928135790 | 246 |
| 174 | iso_pu_bacteria | 2928503688 | 2928508252 | 246 |
| 175 | iso_pu_bacteria | 2945934425 | 2945938839 | 246 |
| 176 | iso_pu_bacteria | 2990703756 | 2990708839 | 246 |
| 177 | iso_pu_bacteria | 641736151 | 642420986 | 246 |
| 178 | iso_pu_bacteria | 642555112 | 642595257 | 246 |
| 179 | iso_pu_bacteria | 642555113 | 642616764 | 246 |
| 180 | iso_pu_bacteria | 8055266321 | 8055270639 | 246 |
| 181 | iso_pu_bacteria | 8055301274 | 8055304466 | 246 |
| 182 | 3300005458 | Ga0070681_10150995 | Ga0070681_101509952 | 248 |
| 183 | 3300025912 | Ga0207707_10285261 | Ga0207707_102852613 | 248 |
| 184 | 3300005467 | Ga0070706_100267178 | Ga0070706_1002671782 | 249 |
| 185 | 3300025910 | Ga0207684_10220226 | Ga0207684_102202262 | 249 |
| 186 | 3300025937 | Ga0207669_10321809 | Ga0207669_103218091 | 249 |
| 187 | 3300001979 | JGI24740J21852_10002892 | JGI24740J21852_100028928 | 250 |
| 188 | 3300001989 | JGI24739J22299_10002400 | JGI24739J22299_100024008 | 250 |
| 189 | 3300001989 | JGI24739J22299_10004739 | JGI24739J22299_100047393 | 250 |
| 190 | 3300002067 | JGI24735J21928_10000332 | JGI24735J21928_100003325 | 250 |
| 191 | 3300002067 | JGI24735J21928_10015757 | JGI24735J21928_100157572 | 250 |
| 192 | 3300002705 | JGI25156J39149_1000208 | JGI25156J39149_100020839 | 250 |
| 193 | 3300002705 | JGI25156J39149_1000209 | JGI25156J39149_100020913 | 250 |
| 194 | 3300003214 | JGI25165J46597_1001358 | JGI25165J46597_10013583 | 250 |
| 195 | 3300003215 | JGI25153J46596_10002472 | JGI25153J46596_100024727 | 250 |
| 196 | 3300003354 | JGI25160J50197_1006354 | JGI25160J50197_10063544 | 250 |
| 197 | 3300003756 | Ga0055533_1000232 | Ga0055533_100023211 | 250 |
| 198 | 3300003756 | Ga0055533_1000933 | Ga0055533_100093310 | 250 |
| 199 | 3300003758 | Ga0055532_1000011 | Ga0055532_1000011192 | 250 |
| 200 | 3300003760 | Ga0055527_1000009 | Ga0055527_1000009191 | 250 |
| 201 | 3300003761 | Ga0055535_1000008 | Ga0055535_1000008177 | 250 |
| 202 | 3300003762 | Ga0055542_1000014 | Ga0055542_1000014177 | 250 |
| 203 | 3300003763 | Ga0055529_1000010 | Ga0055529_1000010177 | 250 |
| 204 | 3300003771 | Ga0055526_1002114 | Ga0055526_100211411 | 250 |
| 205 | 3300003781 | Ga0055536_1000026 | Ga0055536_1000026137 | 250 |
| 206 | 3300003784 | Ga0055534_1001609 | Ga0055534_10016094 | 250 |
| 207 | 3300003790 | Ga0055528_1026862 | Ga0055528_10268622 | 250 |
| 208 | 3300003792 | Ga0055540_1022000 | Ga0055540_10220002 | 250 |
| 209 | 3300005262 | Ga0065165_1008403 | Ga0065165_10084034 | 250 |
| 210 | 3300005293 | Ga0065715_10129378 | Ga0065715_101293781 | 250 |
| 211 | 3300005295 | Ga0065707_10001895 | Ga0065707_100018957 | 250 |
| 212 | 3300005327 | Ga0070658_10001405 | Ga0070658_100014052 | 250 |
| 213 | 3300005327 | Ga0070658_10118069 | Ga0070658_101180692 | 250 |
| 214 | 3300005327 | Ga0070658_10282260 | Ga0070658_102822601 | 250 |
| 215 | 3300005331 | Ga0070670_100001840 | Ga0070670_1000018405 | 250 |
| 216 | 3300005331 | Ga0070670_100037169 | Ga0070670_1000371696 | 250 |
| 217 | 3300005331 | Ga0070670_100118387 | Ga0070670_1001183874 | 250 |
| 218 | 3300005333 | Ga0070677_10013220 | Ga0070677_100132203 | 250 |
| 219 | 3300005334 | Ga0068869_100011954 | Ga0068869_1000119542 | 250 |
| 220 | 3300005337 | Ga0070682_100203526 | Ga0070682_1002035262 | 250 |
| 221 | 3300005338 | Ga0068868_100120077 | Ga0068868_1001200771 | 250 |
| 222 | 3300005338 | Ga0068868_100166965 | Ga0068868_1001669653 | 250 |
| 223 | 3300005338 | Ga0068868_100407332 | Ga0068868_1004073321 | 250 |
| 224 | 3300005338 | Ga0068868_100502158 | Ga0068868_1005021581 | 250 |
| 225 | 3300005339 | Ga0070660_100000004 | Ga0070660_10000000443 | 250 |
| 226 | 3300005344 | Ga0070661_100004818 | Ga0070661_1000048183 | 250 |
| 227 | 3300005347 | Ga0070668_100104988 | Ga0070668_1001049882 | 250 |
| 228 | 3300005353 | Ga0070669_100000378 | Ga0070669_1000003782 | 250 |
| 229 | 3300005354 | Ga0070675_100015079 | Ga0070675_1000150793 | 250 |
| 230 | 3300005354 | Ga0070675_100055653 | Ga0070675_1000556533 | 250 |
| 231 | 3300005355 | Ga0070671_100004335 | Ga0070671_1000043358 | 250 |
| 232 | 3300005355 | Ga0070671_100229851 | Ga0070671_1002298512 | 250 |
| 233 | 3300005355 | Ga0070671_100578654 | Ga0070671_1005786541 | 250 |
| 234 | 3300005356 | Ga0070674_100023729 | Ga0070674_1000237295 | 250 |
| 235 | 3300005364 | Ga0070673_100006343 | Ga0070673_1000063436 | 250 |
| 236 | 3300005364 | Ga0070673_100051998 | Ga0070673_1000519983 | 250 |
| 237 | 3300005366 | Ga0070659_100000023 | Ga0070659_10000002327 | 250 |
| 238 | 3300005366 | Ga0070659_100008933 | Ga0070659_1000089336 | 250 |
| 239 | 3300005366 | Ga0070659_100125002 | Ga0070659_1001250022 | 250 |
| 240 | 3300005366 | Ga0070659_100143402 | Ga0070659_1001434022 | 250 |
| 241 | 3300005438 | Ga0070701_10235995 | Ga0070701_102359951 | 250 |
| 242 | 3300005441 | Ga0070700_100140206 | Ga0070700_1001402062 | 250 |
| 243 | 3300005456 | Ga0070678_100020258 | Ga0070678_1000202583 | 250 |
| 244 | 3300005456 | Ga0070678_100031159 | Ga0070678_1000311592 | 250 |
| 245 | 3300005456 | Ga0070678_100207393 | Ga0070678_1002073932 | 250 |
| 246 | 3300005456 | Ga0070678_100798821 | Ga0070678_1007988211 | 250 |
| 247 | 3300005457 | Ga0070662_100054070 | Ga0070662_1000540702 | 250 |
| 248 | 3300005467 | Ga0070706_100000271 | Ga0070706_10000027128 | 250 |
| 249 | 3300005468 | Ga0070707_100053914 | Ga0070707_1000539141 | 250 |
| 250 | 3300005535 | Ga0070684_100008207 | Ga0070684_1000082072 | 250 |
| 251 | 3300005539 | Ga0068853_100227396 | Ga0068853_1002273962 | 250 |
| 252 | 3300005543 | Ga0070672_100130322 | Ga0070672_1001303223 | 250 |
| 253 | 3300005543 | Ga0070672_100139104 | Ga0070672_1001391043 | 250 |
| 254 | 3300005547 | Ga0070693_100016242 | Ga0070693_1000162425 | 250 |
| 255 | 3300005547 | Ga0070693_100111813 | Ga0070693_1001118132 | 250 |
| 256 | 3300005547 | Ga0070693_100114911 | Ga0070693_1001149112 | 250 |
| 257 | 3300005548 | Ga0070665_100092825 | Ga0070665_1000928252 | 250 |
| 258 | 3300005548 | Ga0070665_100415694 | Ga0070665_1004156942 | 250 |
| 259 | 3300005563 | Ga0068855_100007936 | Ga0068855_1000079363 | 250 |
| 260 | 3300005563 | Ga0068855_100071618 | Ga0068855_1000716184 | 250 |
| 261 | 3300005564 | Ga0070664_100004354 | Ga0070664_1000043546 | 250 |
| 262 | 3300005564 | Ga0070664_100181683 | Ga0070664_1001816832 | 250 |
| 263 | 3300005564 | Ga0070664_100409567 | Ga0070664_1004095672 | 250 |
| 264 | 3300005577 | Ga0068857_100015285 | Ga0068857_1000152856 | 250 |
| 265 | 3300005578 | Ga0068854_100006013 | Ga0068854_1000060135 | 250 |
| 266 | 3300005614 | Ga0068856_100219106 | Ga0068856_1002191062 | 250 |
| 267 | 3300005615 | Ga0070702_100410249 | Ga0070702_1004102491 | 250 |
| 268 | 3300005616 | Ga0068852_100012297 | Ga0068852_1000122976 | 250 |
| 269 | 3300005616 | Ga0068852_100020522 | Ga0068852_1000205222 | 250 |
| 270 | 3300005616 | Ga0068852_100049509 | Ga0068852_1000495092 | 250 |
| 271 | 3300005616 | Ga0068852_100128234 | Ga0068852_1001282343 | 250 |
| 272 | 3300005618 | Ga0068864_100049553 | Ga0068864_1000495532 | 250 |
| 273 | 3300005618 | Ga0068864_100131611 | Ga0068864_1001316112 | 250 |
| 274 | 3300005719 | Ga0068861_100001865 | Ga0068861_1000018659 | 250 |
| 275 | 3300005834 | Ga0068851_10004511 | Ga0068851_100045116 | 250 |
| 276 | 3300005834 | Ga0068851_10014115 | Ga0068851_100141152 | 250 |
| 277 | 3300005841 | Ga0068863_100152637 | Ga0068863_1001526373 | 250 |
| 278 | 3300005843 | Ga0068860_100087569 | Ga0068860_1000875693 | 250 |
| 279 | 3300005844 | Ga0068862_100072538 | Ga0068862_1000725384 | 250 |
| 280 | 3300006042 | Ga0075368_10030664 | Ga0075368_100306642 | 250 |
| 281 | 3300006042 | Ga0075368_10094152 | Ga0075368_100941521 | 250 |
| 282 | 3300006178 | Ga0075367_10003415 | Ga0075367_100034157 | 250 |
| 283 | 3300006186 | Ga0075369_10002321 | Ga0075369_100023216 | 250 |
| 284 | 3300006195 | Ga0075366_10001538 | Ga0075366_100015389 | 250 |
| 285 | 3300006195 | Ga0075366_10005093 | Ga0075366_100050935 | 250 |
| 286 | 3300006195 | Ga0075366_10063701 | Ga0075366_100637011 | 250 |
| 287 | 3300006237 | Ga0097621_100066610 | Ga0097621_1000666102 | 250 |
| 288 | 3300006237 | Ga0097621_100297117 | Ga0097621_1002971172 | 250 |
| 289 | 3300006237 | Ga0097621_100315399 | Ga0097621_1003153992 | 250 |
| 290 | 3300006353 | Ga0075370_10000157 | Ga0075370_100001576 | 250 |
| 291 | 3300006353 | Ga0075370_10001313 | Ga0075370_100013134 | 250 |
| 292 | 3300006353 | Ga0075370_10018871 | Ga0075370_100188714 | 250 |
| 293 | 3300006353 | Ga0075370_10024875 | Ga0075370_100248753 | 250 |
| 294 | 3300006358 | Ga0068871_100039522 | Ga0068871_1000395224 | 250 |
| 295 | 3300006358 | Ga0068871_100060131 | Ga0068871_1000601314 | 250 |
| 296 | 3300006358 | Ga0068871_100113834 | Ga0068871_1001138342 | 250 |
| 297 | 3300006358 | Ga0068871_100275849 | Ga0068871_1002758492 | 250 |
| 298 | 3300006871 | Ga0075434_100004654 | Ga0075434_1000046544 | 250 |
| 299 | 3300006871 | Ga0075434_100196325 | Ga0075434_1001963252 | 250 |
| 300 | 3300006871 | Ga0075434_100489308 | Ga0075434_1004893082 | 250 |
| 301 | 3300006880 | Ga0075429_100104985 | Ga0075429_1001049852 | 250 |
| 302 | 3300009011 | Ga0105251_10000816 | Ga0105251_100008167 | 250 |
| 303 | 3300009011 | Ga0105251_10099615 | Ga0105251_100996151 | 250 |
| 304 | 3300009036 | Ga0105244_10078900 | Ga0105244_100789002 | 250 |
| 305 | 3300009092 | Ga0105250_10004967 | Ga0105250_100049673 | 250 |
| 306 | 3300009093 | Ga0105240_10002938 | Ga0105240_1000293819 | 250 |
| 307 | 3300009093 | Ga0105240_10018434 | Ga0105240_100184343 | 250 |
| 308 | 3300009093 | Ga0105240_10099453 | Ga0105240_100994532 | 250 |
| 309 | 3300009093 | Ga0105240_10324987 | Ga0105240_103249871 | 250 |
| 310 | 3300009094 | Ga0111539_10001639 | Ga0111539_1000163914 | 250 |
| 311 | 3300009094 | Ga0111539_10193872 | Ga0111539_101938721 | 250 |
| 312 | 3300009094 | Ga0111539_10264131 | Ga0111539_102641312 | 250 |
| 313 | 3300009098 | Ga0105245_10156052 | Ga0105245_101560522 | 250 |
| 314 | 3300009101 | Ga0105247_10353627 | Ga0105247_103536271 | 250 |
| 315 | 3300009101 | Ga0105247_10493248 | Ga0105247_104932481 | 250 |
| 316 | 3300009174 | Ga0105241_10223857 | Ga0105241_102238572 | 250 |
| 317 | 3300009174 | Ga0105241_10237052 | Ga0105241_102370522 | 250 |
| 318 | 3300009177 | Ga0105248_10045951 | Ga0105248_100459511 | 250 |
| 319 | 3300009177 | Ga0105248_10060337 | Ga0105248_100603372 | 250 |
| 320 | 3300009177 | Ga0105248_10074722 | Ga0105248_100747222 | 250 |
| 321 | 3300009177 | Ga0105248_10203080 | Ga0105248_102030802 | 250 |
| 322 | 3300009177 | Ga0105248_10479972 | Ga0105248_104799722 | 250 |
| 323 | 3300009545 | Ga0105237_10006766 | Ga0105237_100067666 | 250 |
| 324 | 3300009545 | Ga0105237_10007760 | Ga0105237_100077608 | 250 |
| 325 | 3300009545 | Ga0105237_10024983 | Ga0105237_100249836 | 250 |
| 326 | 3300009545 | Ga0105237_10038836 | Ga0105237_100388364 | 250 |
| 327 | 3300009545 | Ga0105237_10181999 | Ga0105237_101819992 | 250 |
| 328 | 3300009545 | Ga0105237_10220013 | Ga0105237_102200132 | 250 |
| 329 | 3300009551 | Ga0105238_10006338 | Ga0105238_100063387 | 250 |
| 330 | 3300009551 | Ga0105238_10010968 | Ga0105238_100109682 | 250 |
| 331 | 3300009551 | Ga0105238_10032852 | Ga0105238_100328523 | 250 |
| 332 | 3300009551 | Ga0105238_10244530 | Ga0105238_102445302 | 250 |
| 333 | 3300009551 | Ga0105238_10319875 | Ga0105238_103198752 | 250 |
| 334 | 3300009551 | Ga0105238_10580783 | Ga0105238_105807831 | 250 |
| 335 | 3300009553 | Ga0105249_10023626 | Ga0105249_100236265 | 250 |
| 336 | 3300010375 | Ga0105239_10004145 | Ga0105239_1000414511 | 250 |
| 337 | 3300010375 | Ga0105239_10158799 | Ga0105239_101587992 | 250 |
| 338 | 3300013100 | Ga0157373_10076687 | Ga0157373_100766873 | 250 |
| 339 | 3300013104 | Ga0157370_10008953 | Ga0157370_100089537 | 250 |
| 340 | 3300013105 | Ga0157369_10008064 | Ga0157369_100080647 | 250 |
| 341 | 3300013105 | Ga0157369_10048315 | Ga0157369_100483155 | 250 |
| 342 | 3300013105 | Ga0157369_10398390 | Ga0157369_103983902 | 250 |
| 343 | 3300013306 | Ga0163162_10027756 | Ga0163162_100277562 | 250 |
| 344 | 3300013306 | Ga0163162_10147222 | Ga0163162_101472222 | 250 |
| 345 | 3300013306 | Ga0163162_10159032 | Ga0163162_101590322 | 250 |
| 346 | 3300013307 | Ga0157372_10018776 | Ga0157372_100187767 | 250 |
| 347 | 3300013307 | Ga0157372_10040036 | Ga0157372_100400363 | 250 |
| 348 | 3300013308 | Ga0157375_10008280 | Ga0157375_100082805 | 250 |
| 349 | 3300013308 | Ga0157375_10010581 | Ga0157375_100105817 | 250 |
| 350 | 3300013308 | Ga0157375_10379925 | Ga0157375_103799252 | 250 |
| 351 | 3300014325 | Ga0163163_10324860 | Ga0163163_103248602 | 250 |
| 352 | 3300014325 | Ga0163163_10599417 | Ga0163163_105994172 | 250 |
| 353 | 3300014325 | Ga0163163_10744869 | Ga0163163_107448691 | 250 |
| 354 | 3300014497 | Ga0182008_10035841 | Ga0182008_100358412 | 250 |
| 355 | 3300014497 | Ga0182008_10046294 | Ga0182008_100462943 | 250 |
| 356 | 3300015262 | Ga0182007_10001190 | Ga0182007_100011909 | 250 |
| 357 | 3300015262 | Ga0182007_10040498 | Ga0182007_100404982 | 250 |
| 358 | 3300015265 | Ga0182005_1016050 | Ga0182005_10160502 | 250 |
| 359 | 3300016635 | Ga0183361_10005 | Ga0183361_10005173 | 250 |
| 360 | 3300017792 | Ga0163161_10056646 | Ga0163161_100566462 | 250 |
| 361 | 3300017792 | Ga0163161_10378753 | Ga0163161_103787531 | 250 |
| 362 | 3300025206 | Ga0209435_104039 | Ga0209435_1040392 | 250 |
| 363 | 3300025226 | Ga0209674_100011 | Ga0209674_100011722 | 250 |
| 364 | 3300025226 | Ga0209674_100093 | Ga0209674_100093130 | 250 |
| 365 | 3300025228 | Ga0209672_100002 | Ga0209672_100002716 | 250 |
| 366 | 3300025228 | Ga0209672_101742 | Ga0209672_1017426 | 250 |
| 367 | 3300025229 | Ga0209147_100003 | Ga0209147_100003716 | 250 |
| 368 | 3300025230 | Ga0209563_101191 | Ga0209563_1011918 | 250 |
| 369 | 3300025231 | Ga0207427_101004 | Ga0207427_1010042 | 250 |
| 370 | 3300025242 | Ga0209258_100005 | Ga0209258_100005358 | 250 |
| 371 | 3300025254 | Ga0209148_1000006 | Ga0209148_1000006716 | 250 |
| 372 | 3300025256 | Ga0209759_1000006 | Ga0209759_1000006283 | 250 |
| 373 | 3300025256 | Ga0209759_1000039 | Ga0209759_100003929 | 250 |
| 374 | 3300025258 | Ga0209129_1000124 | Ga0209129_100012448 | 250 |
| 375 | 3300025261 | Ga0209233_1000018 | Ga0209233_1000018633 | 250 |
| 376 | 3300025261 | Ga0209233_1009841 | Ga0209233_10098412 | 250 |
| 377 | 3300025263 | Ga0209565_1008371 | Ga0209565_10083712 | 250 |
| 378 | 3300025272 | Ga0209455_1000003 | Ga0209455_1000003716 | 250 |
| 379 | 3300025273 | Ga0209673_1000586 | Ga0209673_100058624 | 250 |
| 380 | 3300025291 | Ga0209675_1000026 | Ga0209675_100002682 | 250 |
| 381 | 3300025291 | Ga0209675_1036722 | Ga0209675_10367222 | 250 |
| 382 | 3300025292 | Ga0209676_1000059 | Ga0209676_1000059240 | 250 |
| 383 | 3300025294 | Ga0209025_1000066 | Ga0209025_100006689 | 250 |
| 384 | 3300025295 | Ga0209564_1000057 | Ga0209564_100005773 | 250 |
| 385 | 3300025295 | Ga0209564_1000161 | Ga0209564_100016175 | 250 |
| 386 | 3300025295 | Ga0209564_1008977 | Ga0209564_10089775 | 250 |
| 387 | 3300025295 | Ga0209564_1015001 | Ga0209564_10150012 | 250 |
| 388 | 3300025297 | Ga0209758_1000214 | Ga0209758_100021443 | 250 |
| 389 | 3300025302 | Ga0207426_1000014 | Ga0207426_10000149 | 250 |
| 390 | 3300025302 | Ga0207426_1002337 | Ga0207426_10023371 | 250 |
| 391 | 3300025303 | Ga0209051_1002074 | Ga0209051_100207413 | 250 |
| 392 | 3300025303 | Ga0209051_1033002 | Ga0209051_10330022 | 250 |
| 393 | 3300025321 | Ga0207656_10004453 | Ga0207656_100044535 | 250 |
| 394 | 3300025904 | Ga0207647_10015441 | Ga0207647_100154413 | 250 |
| 395 | 3300025904 | Ga0207647_10017475 | Ga0207647_100174755 | 250 |
| 396 | 3300025904 | Ga0207647_10049311 | Ga0207647_100493112 | 250 |
| 397 | 3300025904 | Ga0207647_10196453 | Ga0207647_101964532 | 250 |
| 398 | 3300025907 | Ga0207645_10016293 | Ga0207645_100162935 | 250 |
| 399 | 3300025908 | Ga0207643_10022963 | Ga0207643_100229632 | 250 |
| 400 | 3300025909 | Ga0207705_10000481 | Ga0207705_1000048120 | 250 |
| 401 | 3300025909 | Ga0207705_10008567 | Ga0207705_100085674 | 250 |
| 402 | 3300025909 | Ga0207705_10380409 | Ga0207705_103804092 | 250 |
| 403 | 3300025910 | Ga0207684_10011762 | Ga0207684_100117623 | 250 |
| 404 | 3300025911 | Ga0207654_10145504 | Ga0207654_101455042 | 250 |
| 405 | 3300025913 | Ga0207695_10015843 | Ga0207695_100158436 | 250 |
| 406 | 3300025913 | Ga0207695_10022800 | Ga0207695_100228008 | 250 |
| 407 | 3300025914 | Ga0207671_10006346 | Ga0207671_100063467 | 250 |
| 408 | 3300025914 | Ga0207671_10007479 | Ga0207671_100074794 | 250 |
| 409 | 3300025914 | Ga0207671_10037912 | Ga0207671_100379123 | 250 |
| 410 | 3300025914 | Ga0207671_10058955 | Ga0207671_100589552 | 250 |
| 411 | 3300025914 | Ga0207671_10260891 | Ga0207671_102608911 | 250 |
| 412 | 3300025919 | Ga0207657_10000001 | Ga0207657_10000001113 | 250 |
| 413 | 3300025919 | Ga0207657_10046823 | Ga0207657_100468233 | 250 |
| 414 | 3300025919 | Ga0207657_10109383 | Ga0207657_101093833 | 250 |
| 415 | 3300025920 | Ga0207649_10044580 | Ga0207649_100445802 | 250 |
| 416 | 3300025920 | Ga0207649_10281780 | Ga0207649_102817802 | 250 |
| 417 | 3300025922 | Ga0207646_10469854 | Ga0207646_104698541 | 250 |
| 418 | 3300025923 | Ga0207681_10048400 | Ga0207681_100484002 | 250 |
| 419 | 3300025924 | Ga0207694_10005550 | Ga0207694_100055508 | 250 |
| 420 | 3300025924 | Ga0207694_10054135 | Ga0207694_100541353 | 250 |
| 421 | 3300025924 | Ga0207694_10530550 | Ga0207694_105305501 | 250 |
| 422 | 3300025925 | Ga0207650_10257656 | Ga0207650_102576561 | 250 |
| 423 | 3300025925 | Ga0207650_10476427 | Ga0207650_104764272 | 250 |
| 424 | 3300025926 | Ga0207659_10014234 | Ga0207659_100142342 | 250 |
| 425 | 3300025926 | Ga0207659_10346553 | Ga0207659_103465532 | 250 |
| 426 | 3300025931 | Ga0207644_10000392 | Ga0207644_100003922 | 250 |
| 427 | 3300025932 | Ga0207690_10000029 | Ga0207690_1000002932 | 250 |
| 428 | 3300025932 | Ga0207690_10008231 | Ga0207690_100082316 | 250 |
| 429 | 3300025932 | Ga0207690_10109320 | Ga0207690_101093202 | 250 |
| 430 | 3300025933 | Ga0207706_10010426 | Ga0207706_100104262 | 250 |
| 431 | 3300025940 | Ga0207691_10012083 | Ga0207691_100120835 | 250 |
| 432 | 3300025940 | Ga0207691_10026762 | Ga0207691_100267624 | 250 |
| 433 | 3300025940 | Ga0207691_10032575 | Ga0207691_100325756 | 250 |
| 434 | 3300025940 | Ga0207691_10151221 | Ga0207691_101512212 | 250 |
| 435 | 3300025940 | Ga0207691_10153293 | Ga0207691_101532932 | 250 |
| 436 | 3300025941 | Ga0207711_10003165 | Ga0207711_100031656 | 250 |
| 437 | 3300025941 | Ga0207711_10061080 | Ga0207711_100610802 | 250 |
| 438 | 3300025941 | Ga0207711_10129829 | Ga0207711_101298292 | 250 |
| 439 | 3300025942 | Ga0207689_10000550 | Ga0207689_100005507 | 250 |
| 440 | 3300025942 | Ga0207689_10109199 | Ga0207689_101091991 | 250 |
| 441 | 3300025945 | Ga0207679_10044751 | Ga0207679_100447514 | 250 |
| 442 | 3300025945 | Ga0207679_10501911 | Ga0207679_105019112 | 250 |
| 443 | 3300025949 | Ga0207667_10006345 | Ga0207667_100063455 | 250 |
| 444 | 3300025949 | Ga0207667_10055440 | Ga0207667_100554404 | 250 |
| 445 | 3300025960 | Ga0207651_10018745 | Ga0207651_100187454 | 250 |
| 446 | 3300025960 | Ga0207651_10390749 | Ga0207651_103907491 | 250 |
| 447 | 3300025961 | Ga0207712_10227369 | Ga0207712_102273692 | 250 |
| 448 | 3300025972 | Ga0207668_10079114 | Ga0207668_100791142 | 250 |
| 449 | 3300025981 | Ga0207640_10240210 | Ga0207640_102402102 | 250 |
| 450 | 3300025981 | Ga0207640_10501040 | Ga0207640_105010401 | 250 |
| 451 | 3300025986 | Ga0207658_10130856 | Ga0207658_101308562 | 250 |
| 452 | 3300026023 | Ga0207677_10068986 | Ga0207677_100689864 | 250 |
| 453 | 3300026023 | Ga0207677_10133597 | Ga0207677_101335972 | 250 |
| 454 | 3300026035 | Ga0207703_10141411 | Ga0207703_101414112 | 250 |
| 455 | 3300026041 | Ga0207639_10070327 | Ga0207639_100703273 | 250 |
| 456 | 3300026041 | Ga0207639_10170379 | Ga0207639_101703792 | 250 |
| 457 | 3300026067 | Ga0207678_10036125 | Ga0207678_100361252 | 250 |
| 458 | 3300026067 | Ga0207678_10170964 | Ga0207678_101709642 | 250 |
| 459 | 3300026067 | Ga0207678_10210428 | Ga0207678_102104282 | 250 |
| 460 | 3300026078 | Ga0207702_10008513 | Ga0207702_100085136 | 250 |
| 461 | 3300026088 | Ga0207641_10050151 | Ga0207641_100501512 | 250 |
| 462 | 3300026088 | Ga0207641_10138229 | Ga0207641_101382293 | 250 |
| 463 | 3300026089 | Ga0207648_10104753 | Ga0207648_101047532 | 250 |
| 464 | 3300026116 | Ga0207674_10031664 | Ga0207674_100316646 | 250 |
| 465 | 3300026116 | Ga0207674_10056720 | Ga0207674_100567204 | 250 |
| 466 | 3300026118 | Ga0207675_100000576 | Ga0207675_1000005767 | 250 |
| 467 | 3300026121 | Ga0207683_10017139 | Ga0207683_100171393 | 250 |
| 468 | 3300026121 | Ga0207683_10019815 | Ga0207683_100198153 | 250 |
| 469 | 3300026121 | Ga0207683_10042404 | Ga0207683_100424043 | 250 |
| 470 | 3300026121 | Ga0207683_10052369 | Ga0207683_100523694 | 250 |
| 471 | 3300026121 | Ga0207683_10071900 | Ga0207683_100719003 | 250 |
| 472 | 3300026121 | Ga0207683_10172797 | Ga0207683_101727972 | 250 |
| 473 | 3300026142 | Ga0207698_10039709 | Ga0207698_100397092 | 250 |
| 474 | 3300026142 | Ga0207698_10410848 | Ga0207698_104108481 | 250 |
| 475 | 3300027876 | Ga0209974_10035856 | Ga0209974_100358562 | 250 |
| 476 | 3300027907 | Ga0207428_10014971 | Ga0207428_100149714 | 250 |
| 477 | 3300028786 | Ga0307517_10007185 | Ga0307517_100071858 | 250 |
| 478 | 3300028800 | Ga0265338_10000191 | Ga0265338_1000019171 | 250 |
| 479 | 3300028800 | Ga0265338_10021618 | Ga0265338_100216186 | 250 |
| 480 | 3300030500 | Ga0268256_1003074 | Ga0268256_10030742 | 250 |
| 481 | 3300031247 | Ga0265340_10035668 | Ga0265340_100356682 | 250 |
| 482 | 3300031247 | Ga0265340_10076910 | Ga0265340_100769101 | 250 |
| 483 | 3300031456 | Ga0307513_10183020 | Ga0307513_101830202 | 250 |
| 484 | 3300031507 | Ga0307509_10106685 | Ga0307509_101066853 | 250 |
| 485 | 3300031507 | Ga0307509_10360711 | Ga0307509_103607111 | 250 |
| 486 | 3300031548 | Ga0307408_100022895 | Ga0307408_1000228952 | 250 |
| 487 | 3300031616 | Ga0307508_10159040 | Ga0307508_101590401 | 250 |
| 488 | 3300031730 | Ga0307516_10220884 | Ga0307516_102208842 | 250 |
| 489 | 3300031911 | Ga0307412_10000002 | Ga0307412_1000000286 | 250 |
| 490 | 3300031911 | Ga0307412_10442626 | Ga0307412_104426262 | 250 |
| 491 | 3300032004 | Ga0307414_10327325 | Ga0307414_103273251 | 250 |
| 492 | 3300033180 | Ga0307510_10010761 | Ga0307510_100107612 | 250 |
| 493 | 3300033180 | Ga0307510_10029893 | Ga0307510_100298933 | 250 |
| 494 | 3300035115 | Ga0373941_0085855 | Ga0373941_0085855_225_977 | 250 |
| 495 | 3300035207 | Ga0373942_0061684 | Ga0373942_0061684_89_841 | 250 |
| 496 | 3300035242 | Ga0373962_0026751 | Ga0373962_0026751_755_1507 | 250 |
| 497 | 3300035410 | Ga0373924_0097278 | Ga0373924_0097278_273_1025 | 250 |
| 498 | 3300035691 | Ga0373931_0002282 | Ga0373931_0002282_664_1416 | 250 |
| 499 | 3300035692 | Ga0373935_0035034 | Ga0373935_0035034_2132_2884 | 250 |
| 500 | 3300035725 | Ga0373947_0046995 | Ga0373947_0046995_42_794 | 250 |
| 501 | 3300037068 | Ga0373925_0050253 | Ga0373925_0050253_1544_2296 | 250 |
| 502 | 3300037312 | Ga0395899_0000203 | Ga0395899_0000203_61536_62288 | 250 |
| 503 | 3300037418 | Ga0395900_0000233 | Ga0395900_0000233_24961_25713 | 250 |
| 504 | 3300037418 | Ga0395900_0004885 | Ga0395900_0004885_3304_4056 | 250 |
| 505 | 3300037418 | Ga0395900_0157074 | Ga0395900_0157074_1226_1978 | 250 |
| 506 | 3300037466 | Ga0395898_0000722 | Ga0395898_0000722_32644_33396 | 250 |
| 507 | 3300037466 | Ga0395898_0005186 | Ga0395898_0005186_5864_6616 | 250 |
| 508 | 3300037466 | Ga0395898_0006940 | Ga0395898_0006940_7440_8192 | 250 |
| 509 | 3300037471 | Ga0395905_0000157 | Ga0395905_0000157_3959_4711 | 250 |
| 510 | 3300037471 | Ga0395905_0002320 | Ga0395905_0002320_19163_19915 | 250 |
| 511 | 3300037471 | Ga0395905_0019997 | Ga0395905_0019997_863_1624 | 250 |
| 512 | 3300037471 | Ga0395905_0692179 | Ga0395905_0692179_68_820 | 250 |
| 513 | 3300038443 | Ga0395901_0000144 | Ga0395901_0000144_62617_63369 | 250 |
| 514 | 3300038741 | Ga0400488_42310 | Ga0400488_42310_45_797 | 250 |
| 515 | 3300042007 | Ga0439449_0108508 | Ga0439449_0108508_40_792 | 250 |
| 516 | 3300044656 | Ga0466969_0000232 | Ga0466969_0000232_7314_8066 | 250 |
| 517 | 3300044656 | Ga0466969_0015812 | Ga0466969_0015812_687_1439 | 250 |
| 518 | 3300044659 | Ga0466973_0093852 | Ga0466973_0093852_1469_2221 | 250 |
| 519 | 3300044683 | Ga0466965_0000082 | Ga0466965_0000082_20936_21688 | 250 |
| 520 | 3300044683 | Ga0466965_0053780 | Ga0466965_0053780_1213_1965 | 250 |
| 521 | 3300044684 | Ga0466966_0036290 | Ga0466966_0036290_707_1459 | 250 |
| 522 | 3300044684 | Ga0466966_0044541 | Ga0466966_0044541_1274_2026 | 250 |
| 523 | 3300044693 | Ga0466961_0000229 | Ga0466961_0000229_29892_30644 | 250 |
| 524 | 3300044693 | Ga0466961_0086891 | Ga0466961_0086891_270_1022 | 250 |
| 525 | 3300044694 | Ga0466963_0005033 | Ga0466963_0005033_3828_4580 | 250 |
| 526 | 3300044719 | Ga0466971_0004861 | Ga0466971_0004861_4325_5077 | 250 |
| 527 | 3300044765 | Ga0466970_0087915 | Ga0466970_0087915_752_1504 | 250 |
| 528 | 3300044842 | Ga0466957_0005060 | Ga0466957_0005060_4198_4950 | 250 |
| 529 | 3300045049 | Ga0466959_0013955 | Ga0466959_0013955_2818_3570 | 250 |
| 530 | 3300045051 | Ga0451576_0139943 | Ga0451576_0139943_20_772 | 250 |
| 531 | 3300045051 | Ga0451576_0249911 | Ga0451576_0249911_627_1379 | 250 |
| 532 | 3300045836 | Ga0466958_0013651 | Ga0466958_0013651_165_917 | 250 |
| 533 | 3300046454 | Ga0495592_0000142 | Ga0495592_0000142_34058_34810 | 250 |
| 534 | 3300046454 | Ga0495592_0002963 | Ga0495592_0002963_3200_3952 | 250 |
| 535 | 3300046455 | Ga0495603_0067853 | Ga0495603_0067853_91_843 | 250 |
| 536 | 3300046457 | Ga0495590_0009231 | Ga0495590_0009231_2650_3411 | 250 |
| 537 | 3300046457 | Ga0495590_0105361 | Ga0495590_0105361_12_764 | 250 |
| 538 | 3300046458 | Ga0495591_004866 | Ga0495591_004866_867_1619 | 250 |
| 539 | 3300046459 | Ga0495629_0000662 | Ga0495629_0000662_15974_16726 | 250 |
| 540 | 3300046459 | Ga0495629_0008157 | Ga0495629_0008157_937_1689 | 250 |
| 541 | 3300046459 | Ga0495629_0210114 | Ga0495629_0210114_258_1010 | 250 |
| 542 | 3300046459 | Ga0495629_0363658 | Ga0495629_0363658_183_935 | 250 |
| 543 | 3300046460 | Ga0495638_0049446 | Ga0495638_0049446_385_1137 | 250 |
| 544 | 3300046461 | Ga0495641_0107956 | Ga0495641_0107956_423_1175 | 250 |
| 545 | 3300046462 | Ga0495651_0027843 | Ga0495651_0027843_2902_3654 | 250 |
| 546 | 3300046463 | Ga0495653_0006423 | Ga0495653_0006423_365_1117 | 250 |
| 547 | 3300046463 | Ga0495653_0121450 | Ga0495653_0121450_936_1688 | 250 |
| 548 | 3300046471 | Ga0495650_0000155 | Ga0495650_0000155_63378_64130 | 250 |
| 549 | 3300046471 | Ga0495650_0009077 | Ga0495650_0009077_2137_2889 | 250 |
| 550 | 3300046471 | Ga0495650_0013638 | Ga0495650_0013638_3055_3807 | 250 |
| 551 | 3300046471 | Ga0495650_0019517 | Ga0495650_0019517_1645_2397 | 250 |
| 552 | 3300046471 | Ga0495650_0028122 | Ga0495650_0028122_1344_2183 | 250 |
| 553 | 3300046472 | Ga0495580_0001817 | Ga0495580_0001817_9339_10091 | 250 |
| 554 | 3300046472 | Ga0495580_0002260 | Ga0495580_0002260_11061_11813 | 250 |
| 555 | 3300046472 | Ga0495580_0003220 | Ga0495580_0003220_1927_2679 | 250 |
| 556 | 3300046472 | Ga0495580_0005202 | Ga0495580_0005202_9616_10368 | 250 |
| 557 | 3300046472 | Ga0495580_0019602 | Ga0495580_0019602_1867_2622 | 250 |
| 558 | 3300046472 | Ga0495580_0065112 | Ga0495580_0065112_920_1672 | 250 |
| 559 | 3300046472 | Ga0495580_0171931 | Ga0495580_0171931_263_1015 | 250 |
| 560 | 3300046472 | Ga0495580_0251421 | Ga0495580_0251421_289_1041 | 250 |
| 561 | 3300046474 | Ga0495605_0003476 | Ga0495605_0003476_7808_8560 | 250 |
| 562 | 3300046474 | Ga0495605_0011742 | Ga0495605_0011742_1386_2138 | 250 |
| 563 | 3300046474 | Ga0495605_0080555 | Ga0495605_0080555_559_1332 | 250 |
| 564 | 3300046476 | Ga0495662_0014406 | Ga0495662_0014406_1955_2707 | 250 |
| 565 | 3300046477 | Ga0495664_0026141 | Ga0495664_0026141_2064_2816 | 250 |
| 566 | 3300046477 | Ga0495664_0042592 | Ga0495664_0042592_1860_2621 | 250 |
| 567 | 3300046477 | Ga0495664_0288974 | Ga0495664_0288974_156_908 | 250 |
| 568 | 3300046491 | Ga0495584_0067639 | Ga0495584_0067639_955_1716 | 250 |
| 569 | 3300046492 | Ga0495585_0078174 | Ga0495585_0078174_950_1702 | 250 |
| 570 | 3300046500 | Ga0495596_0002466 | Ga0495596_0002466_8830_9582 | 250 |
| 571 | 3300046500 | Ga0495596_0004389 | Ga0495596_0004389_1563_2315 | 250 |
| 572 | 3300046500 | Ga0495596_0104689 | Ga0495596_0104689_227_988 | 250 |
| 573 | 3300046501 | Ga0495607_0175307 | Ga0495607_0175307_68_820 | 250 |
| 574 | 3300046506 | Ga0495583_0015678 | Ga0495583_0015678_2508_3260 | 250 |
| 575 | 3300046506 | Ga0495583_0039756 | Ga0495583_0039756_909_1661 | 250 |
| 576 | 3300046507 | Ga0495606_0007997 | Ga0495606_0007997_4855_5607 | 250 |
| 577 | 3300046507 | Ga0495606_0089929 | Ga0495606_0089929_411_1163 | 250 |
| 578 | 3300046507 | Ga0495606_0134284 | Ga0495606_0134284_317_1069 | 250 |
| 579 | 3300046511 | Ga0495608_0047409 | Ga0495608_0047409_1930_2682 | 250 |
| 580 | 3300046511 | Ga0495608_0133633 | Ga0495608_0133633_110_862 | 250 |
| 581 | 3300046512 | Ga0495610_0003374 | Ga0495610_0003374_2459_3211 | 250 |
| 582 | 3300046512 | Ga0495610_0043589 | Ga0495610_0043589_785_1558 | 250 |
| 583 | 3300046513 | Ga0495616_0052034 | Ga0495616_0052034_1209_1961 | 250 |
| 584 | 3300046513 | Ga0495616_0058344 | Ga0495616_0058344_723_1475 | 250 |
| 585 | 3300046514 | Ga0495618_0001130 | Ga0495618_0001130_9616_10368 | 250 |
| 586 | 3300046515 | Ga0495620_0014380 | Ga0495620_0014380_1811_2572 | 250 |
| 587 | 3300046515 | Ga0495620_0044150 | Ga0495620_0044150_295_1047 | 250 |
| 588 | 3300046515 | Ga0495620_0082293 | Ga0495620_0082293_229_981 | 250 |
| 589 | 3300046515 | Ga0495620_0124961 | Ga0495620_0124961_200_952 | 250 |
| 590 | 3300046516 | Ga0495628_0005223 | Ga0495628_0005223_376_1128 | 250 |
| 591 | 3300046516 | Ga0495628_0085338 | Ga0495628_0085338_377_1129 | 250 |
| 592 | 3300046516 | Ga0495628_0095157 | Ga0495628_0095157_591_1343 | 250 |
| 593 | 3300046517 | Ga0495630_0013709 | Ga0495630_0013709_1601_2362 | 250 |
| 594 | 3300046517 | Ga0495630_0167455 | Ga0495630_0167455_319_1071 | 250 |
| 595 | 3300046522 | Ga0495643_0046130 | Ga0495643_0046130_844_1596 | 250 |
| 596 | 3300046522 | Ga0495643_0118131 | Ga0495643_0118131_304_1077 | 250 |
| 597 | 3300046523 | Ga0495644_0013611 | Ga0495644_0013611_1915_2667 | 250 |
| 598 | 3300046523 | Ga0495644_0082320 | Ga0495644_0082320_332_1084 | 250 |
| 599 | 3300046524 | Ga0495648_0006327 | Ga0495648_0006327_8558_9310 | 250 |
| 600 | 3300046524 | Ga0495648_0043992 | Ga0495648_0043992_1949_2704 | 250 |
| 601 | 3300046524 | Ga0495648_0063606 | Ga0495648_0063606_1284_2036 | 250 |
| 602 | 3300046524 | Ga0495648_0212006 | Ga0495648_0212006_172_924 | 250 |
| 603 | 3300046526 | Ga0495666_0000438 | Ga0495666_0000438_2950_3702 | 250 |
| 604 | 3300046526 | Ga0495666_0012255 | Ga0495666_0012255_3082_3834 | 250 |
| 605 | 3300046526 | Ga0495666_0168116 | Ga0495666_0168116_235_987 | 250 |
| 606 | 3300046528 | Ga0495642_0005060 | Ga0495642_0005060_1044_1796 | 250 |
| 607 | 3300046528 | Ga0495642_0031563 | Ga0495642_0031563_805_1557 | 250 |
| 608 | 3300046529 | Ga0495652_0001699 | Ga0495652_0001699_4887_5648 | 250 |
| 609 | 3300046529 | Ga0495652_0015047 | Ga0495652_0015047_5291_6043 | 250 |
| 610 | 3300046529 | Ga0495652_0044531 | Ga0495652_0044531_348_1100 | 250 |
| 611 | 3300046530 | Ga0495654_0006843 | Ga0495654_0006843_3898_4650 | 250 |
| 612 | 3300046531 | Ga0495665_0001450 | Ga0495665_0001450_1626_2387 | 250 |
| 613 | 3300046531 | Ga0495665_0011982 | Ga0495665_0011982_3469_4221 | 250 |
| 614 | 3300046533 | Ga0495640_0012116 | Ga0495640_0012116_3299_4051 | 250 |
| 615 | 3300046533 | Ga0495640_0032364 | Ga0495640_0032364_1033_1785 | 250 |
| 616 | 3300046536 | Ga0495587_0044503 | Ga0495587_0044503_788_1540 | 250 |
| 617 | 3300046542 | Ga0495597_0080253 | Ga0495597_0080253_559_1311 | 250 |
| 618 | 3300046543 | Ga0495645_0000045 | Ga0495645_0000045_63016_63768 | 250 |
| 619 | 3300046543 | Ga0495645_0011401 | Ga0495645_0011401_2110_2862 | 250 |
| 620 | 3300046543 | Ga0495645_0014740 | Ga0495645_0014740_3546_4298 | 250 |
| 621 | 3300046557 | Ga0495622_0169663 | Ga0495622_0169663_43_795 | 250 |
| 622 | 3300046642 | Ga0495634_0057254 | Ga0495634_0057254_681_1433 | 250 |
| 623 | 3300046660 | Ga0495625_0013439 | Ga0495625_0013439_2842_3615 | 250 |
| 624 | 3300046660 | Ga0495625_0080834 | Ga0495625_0080834_428_1180 | 250 |
| 625 | 3300046663 | Ga0495635_0008309 | Ga0495635_0008309_5446_6198 | 250 |
| 626 | 3300046663 | Ga0495635_0012101 | Ga0495635_0012101_632_1393 | 250 |
| 627 | 3300046663 | Ga0495635_0019842 | Ga0495635_0019842_816_1568 | 250 |
| 628 | 3300046678 | Ga0495599_0052079 | Ga0495599_0052079_1098_1850 | 250 |
| 629 | 3300046678 | Ga0495599_0165863 | Ga0495599_0165863_415_1167 | 250 |
| 630 | 3300046679 | Ga0495623_0002188 | Ga0495623_0002188_6375_7136 | 250 |
| 631 | 3300046680 | Ga0495646_0008890 | Ga0495646_0008890_1241_2002 | 250 |
| 632 | 3300046680 | Ga0495646_0011375 | Ga0495646_0011375_107_859 | 250 |
| 633 | 3300046680 | Ga0495646_0047204 | Ga0495646_0047204_1170_1922 | 250 |
| 634 | 3300046684 | Ga0495669_0007072 | Ga0495669_0007072_1405_2157 | 250 |
| 635 | 3300046684 | Ga0495669_0046922 | Ga0495669_0046922_185_937 | 250 |
| 636 | 3300046684 | Ga0495669_0053059 | Ga0495669_0053059_963_1715 | 250 |
| 637 | 3300046684 | Ga0495669_0220059 | Ga0495669_0220059_109_861 | 250 |
| 638 | 3300046689 | Ga0495613_0076974 | Ga0495613_0076974_506_1258 | 250 |
| 639 | 3300046690 | Ga0495624_0001622 | Ga0495624_0001622_1705_2457 | 250 |
| 640 | 3300046690 | Ga0495624_0002636 | Ga0495624_0002636_5191_5943 | 250 |
| 641 | 3300046690 | Ga0495624_0009333 | Ga0495624_0009333_2760_3521 | 250 |
| 642 | 3300046690 | Ga0495624_0402638 | Ga0495624_0402638_49_801 | 250 |
| 643 | 3300046692 | Ga0495671_0100248 | Ga0495671_0100248_46_798 | 250 |
| 644 | 3300046692 | Ga0495671_0197754 | Ga0495671_0197754_55_810 | 250 |
| 645 | 3300046694 | Ga0495649_0003998 | Ga0495649_0003998_3960_4712 | 250 |
| 646 | 3300046694 | Ga0495649_0024276 | Ga0495649_0024276_1859_2632 | 250 |
| 647 | 3300046694 | Ga0495649_0034384 | Ga0495649_0034384_910_1662 | 250 |
| 648 | 3300046694 | Ga0495649_0178311 | Ga0495649_0178311_45_797 | 250 |
| 649 | 3300046794 | Ga0495589_0002911 | Ga0495589_0002911_2423_3175 | 250 |
| 650 | 3300046794 | Ga0495589_0009528 | Ga0495589_0009528_1516_2268 | 250 |
| 651 | 3300046794 | Ga0495589_0038022 | Ga0495589_0038022_1295_2047 | 250 |
| 652 | 3300046794 | Ga0495589_0071419 | Ga0495589_0071419_529_1281 | 250 |
| 653 | 3300046809 | Ga0495600_0011428 | Ga0495600_0011428_1557_2309 | 250 |
| 654 | 3300046809 | Ga0495600_0035843 | Ga0495600_0035843_290_1042 | 250 |
| 655 | 3300046809 | Ga0495600_0072139 | Ga0495600_0072139_509_1270 | 250 |
| 656 | 3300046810 | Ga0495660_0030746 | Ga0495660_0030746_1493_2245 | 250 |
| 657 | 3300046810 | Ga0495660_0098835 | Ga0495660_0098835_267_1040 | 250 |
| 658 | 3300046810 | Ga0495660_0144117 | Ga0495660_0144117_58_819 | 250 |
| 659 | 3300046810 | Ga0495660_0150485 | Ga0495660_0150485_62_814 | 250 |
| 660 | 3300047315 | Ga0495581_0053089 | Ga0495581_0053089_826_1578 | 250 |
| 661 | 3300047315 | Ga0495581_0147953 | Ga0495581_0147953_342_1094 | 250 |
| 662 | 3300047317 | Ga0495604_0003834 | Ga0495604_0003834_180_932 | 250 |
| 663 | 3300047317 | Ga0495604_0004786 | Ga0495604_0004786_9163_9915 | 250 |
| 664 | 3300047317 | Ga0495604_0010331 | Ga0495604_0010331_637_1389 | 250 |
| 665 | 3300047318 | Ga0495636_0009936 | Ga0495636_0009936_2128_2880 | 250 |
| 666 | 3300047319 | Ga0495674_0006553 | Ga0495674_0006553_674_1426 | 250 |
| 667 | 3300047319 | Ga0495674_0020301 | Ga0495674_0020301_3690_4442 | 250 |
| 668 | 3300047319 | Ga0495674_0023154 | Ga0495674_0023154_2361_3122 | 250 |
| 669 | 3300047319 | Ga0495674_0029686 | Ga0495674_0029686_585_1337 | 250 |
| 670 | 3300047319 | Ga0495674_0041504 | Ga0495674_0041504_2107_2859 | 250 |
| 671 | 3300047319 | Ga0495674_0173458 | Ga0495674_0173458_467_1219 | 250 |
| 672 | 3300047319 | Ga0495674_0181558 | Ga0495674_0181558_320_1072 | 250 |
| 673 | 3300047319 | Ga0495674_0462206 | Ga0495674_0462206_21_773 | 250 |
| 674 | 3300047320 | Ga0495672_0045865 | Ga0495672_0045865_1009_1761 | 250 |
| 675 | 3300047321 | Ga0495676_0099354 | Ga0495676_0099354_1063_1815 | 250 |
| 676 | 3300047322 | Ga0495680_0005170 | Ga0495680_0005170_4615_5376 | 250 |
| 677 | 3300047322 | Ga0495680_0005562 | Ga0495680_0005562_9638_10390 | 250 |
| 678 | 3300047322 | Ga0495680_0010291 | Ga0495680_0010291_6143_6895 | 250 |
| 679 | 3300047323 | Ga0495683_0001115 | Ga0495683_0001115_8388_9140 | 250 |
| 680 | 3300047323 | Ga0495683_0001532 | Ga0495683_0001532_11212_11973 | 250 |
| 681 | 3300047323 | Ga0495683_0003052 | Ga0495683_0003052_2307_3059 | 250 |
| 682 | 3300047323 | Ga0495683_0007950 | Ga0495683_0007950_4199_4951 | 250 |
| 683 | 3300047323 | Ga0495683_0023725 | Ga0495683_0023725_875_1627 | 250 |
| 684 | 3300047323 | Ga0495683_0062477 | Ga0495683_0062477_728_1480 | 250 |
| 685 | 3300047443 | Ga0495687_000051 | Ga0495687_000051_79995_80756 | 250 |
| 686 | 3300047443 | Ga0495687_009807 | Ga0495687_009807_3512_4264 | 250 |
| 687 | 3300047443 | Ga0495687_010322 | Ga0495687_010322_1663_2436 | 250 |
| 688 | 3300047443 | Ga0495687_017693 | Ga0495687_017693_79_852 | 250 |
| 689 | 3300047443 | Ga0495687_022881 | Ga0495687_022881_431_1183 | 250 |
| 690 | 3300047443 | Ga0495687_040885 | Ga0495687_040885_1233_1985 | 250 |
| 691 | 3300047443 | Ga0495687_057441 | Ga0495687_057441_392_1144 | 250 |
| 692 | 3300047444 | Ga0495675_0001723 | Ga0495675_0001723_9497_10249 | 250 |
| 693 | 3300047444 | Ga0495675_0055987 | Ga0495675_0055987_1583_2335 | 250 |
| 694 | 3300047444 | Ga0495675_0196204 | Ga0495675_0196204_328_1080 | 250 |
| 695 | 3300047446 | Ga0495679_061355 | Ga0495679_061355_145_897 | 250 |
| 696 | 3300047469 | Ga0495673_0025699 | Ga0495673_0025699_790_1542 | 250 |
| 697 | 3300047471 | Ga0495684_0061781 | Ga0495684_0061781_1710_2462 | 250 |
| 698 | 3300047673 | Ga0495593_0001510 | Ga0495593_0001510_12259_13011 | 250 |
| 699 | 3300047673 | Ga0495593_0002335 | Ga0495593_0002335_1641_2402 | 250 |
| 700 | 3300047673 | Ga0495593_0025682 | Ga0495593_0025682_1035_1787 | 250 |
| 701 | 3300048088 | Ga0495602_0004008 | Ga0495602_0004008_13783_14544 | 250 |
| 702 | 3300048088 | Ga0495602_0006361 | Ga0495602_0006361_363_1115 | 250 |
| 703 | 3300048088 | Ga0495602_0034549 | Ga0495602_0034549_1152_1913 | 250 |
| 704 | 3300048088 | Ga0495602_0123052 | Ga0495602_0123052_417_1169 | 250 |
| 705 | 3300048088 | Ga0495602_0143567 | Ga0495602_0143567_451_1203 | 250 |
| 706 | 3300048091 | Ga0495626_0003050 | Ga0495626_0003050_10150_10902 | 250 |
| 707 | 3300048091 | Ga0495626_0035616 | Ga0495626_0035616_1326_2078 | 250 |
| 708 | 3300048091 | Ga0495626_0067804 | Ga0495626_0067804_384_1136 | 250 |
| 709 | 3300048903 | Ga0496100_0030789 | Ga0496100_0030789_1698_2450 | 250 |
| 710 | 3300048903 | Ga0496100_0045519 | Ga0496100_0045519_475_1227 | 250 |
| 711 | 3300048903 | Ga0496100_0071996 | Ga0496100_0071996_447_1199 | 250 |
| 712 | 3300048903 | Ga0496100_0075322 | Ga0496100_0075322_1339_2091 | 250 |
| 713 | 3300048903 | Ga0496100_0083907 | Ga0496100_0083907_624_1385 | 250 |
| 714 | 3300048904 | Ga0496101_0002488 | Ga0496101_0002488_2614_3375 | 250 |
| 715 | 3300048904 | Ga0496101_0040464 | Ga0496101_0040464_1586_2338 | 250 |
| 716 | 3300048904 | Ga0496101_0054637 | Ga0496101_0054637_453_1205 | 250 |
| 717 | 3300048904 | Ga0496101_0084234 | Ga0496101_0084234_879_1631 | 250 |
| 718 | 3300048904 | Ga0496101_0111543 | Ga0496101_0111543_841_1593 | 250 |
| 719 | 3300048905 | Ga0496102_0015576 | Ga0496102_0015576_5398_6150 | 250 |
| 720 | 3300048905 | Ga0496102_0028105 | Ga0496102_0028105_3985_4737 | 250 |
| 721 | 3300048905 | Ga0496102_0048665 | Ga0496102_0048665_511_1272 | 250 |
| 722 | 3300048905 | Ga0496102_0133926 | Ga0496102_0133926_415_1167 | 250 |
| 723 | 3300048906 | Ga0496103_0001364 | Ga0496103_0001364_5776_6528 | 250 |
| 724 | 3300048906 | Ga0496103_0007406 | Ga0496103_0007406_2171_2923 | 250 |
| 725 | 3300048907 | Ga0496104_0040881 | Ga0496104_0040881_1759_2511 | 250 |
| 726 | 3300048907 | Ga0496104_0078406 | Ga0496104_0078406_1049_1801 | 250 |
| 727 | 3300048907 | Ga0496104_0164534 | Ga0496104_0164534_385_1137 | 250 |
| 728 | 3300048907 | Ga0496104_0203008 | Ga0496104_0203008_1015_1767 | 250 |
| 729 | 3300048907 | Ga0496104_0240679 | Ga0496104_0240679_369_1121 | 250 |
| 730 | 3300048908 | Ga0496105_0014366 | Ga0496105_0014366_3303_4055 | 250 |
| 731 | 3300048908 | Ga0496105_0190781 | Ga0496105_0190781_206_958 | 250 |
| 732 | 3300048908 | Ga0496105_0267795 | Ga0496105_0267795_532_1284 | 250 |
| 733 | 3300048909 | Ga0496106_0000010 | Ga0496106_0000010_209660_210415 | 250 |
| 734 | 3300048909 | Ga0496106_0001335 | Ga0496106_0001335_12074_12835 | 250 |
| 735 | 3300048909 | Ga0496106_0007766 | Ga0496106_0007766_3966_4718 | 250 |
| 736 | 3300048909 | Ga0496106_0158591 | Ga0496106_0158591_28_780 | 250 |
| 737 | 3300048909 | Ga0496106_0262101 | Ga0496106_0262101_91_843 | 250 |
| 738 | 3300048910 | Ga0496107_0040403 | Ga0496107_0040403_590_1351 | 250 |
| 739 | 3300048910 | Ga0496107_0042712 | Ga0496107_0042712_655_1407 | 250 |
| 740 | 3300048910 | Ga0496107_0131393 | Ga0496107_0131393_668_1420 | 250 |
| 741 | 3300048911 | Ga0496108_0063235 | Ga0496108_0063235_638_1399 | 250 |
| 742 | 3300048911 | Ga0496108_0357990 | Ga0496108_0357990_43_795 | 250 |
| 743 | 3300048912 | Ga0496109_0020549 | Ga0496109_0020549_1646_2398 | 250 |
| 744 | 3300048913 | Ga0496110_0019939 | Ga0496110_0019939_2323_3075 | 250 |
| 745 | 3300048913 | Ga0496110_0095738 | Ga0496110_0095738_512_1273 | 250 |
| 746 | 3300048913 | Ga0496110_0315233 | Ga0496110_0315233_130_882 | 250 |
| 747 | 3300048914 | Ga0496111_0039607 | Ga0496111_0039607_274_1035 | 250 |
| 748 | 3300048914 | Ga0496111_0134034 | Ga0496111_0134034_394_1146 | 250 |
| 749 | 3300048915 | Ga0496112_0035917 | Ga0496112_0035917_428_1180 | 250 |
| 750 | 3300048915 | Ga0496112_0057459 | Ga0496112_0057459_210_971 | 250 |
| 751 | 3300048915 | Ga0496112_0169736 | Ga0496112_0169736_234_986 | 250 |
| 752 | 3300048916 | Ga0496113_0007496 | Ga0496113_0007496_2066_2827 | 250 |
| 753 | 3300048916 | Ga0496113_0362199 | Ga0496113_0362199_20_772 | 250 |
| 754 | 3300048917 | Ga0496114_0000403 | Ga0496114_0000403_15299_16051 | 250 |
| 755 | 3300048917 | Ga0496114_0067003 | Ga0496114_0067003_1330_2082 | 250 |
| 756 | 3300048918 | Ga0496115_0038592 | Ga0496115_0038592_1789_2541 | 250 |
| 757 | 3300048918 | Ga0496115_0047951 | Ga0496115_0047951_986_1738 | 250 |
| 758 | 3300048918 | Ga0496115_0136774 | Ga0496115_0136774_1248_2000 | 250 |
| 759 | 3300048919 | Ga0496116_0012547 | Ga0496116_0012547_3559_4320 | 250 |
| 760 | 3300048919 | Ga0496116_0026783 | Ga0496116_0026783_1960_2712 | 250 |
| 761 | 3300048919 | Ga0496116_0058750 | Ga0496116_0058750_388_1140 | 250 |
| 762 | 3300048920 | Ga0496117_0001592 | Ga0496117_0001592_15703_16455 | 250 |
| 763 | 3300048920 | Ga0496117_0004398 | Ga0496117_0004398_14369_15121 | 250 |
| 764 | 3300048920 | Ga0496117_0011858 | Ga0496117_0011858_5276_6028 | 250 |
| 765 | 3300048920 | Ga0496117_0019150 | Ga0496117_0019150_3154_3915 | 250 |
| 766 | 3300048920 | Ga0496117_0294637 | Ga0496117_0294637_63_815 | 250 |
| 767 | 3300048921 | Ga0496118_0001562 | Ga0496118_0001562_4449_5201 | 250 |
| 768 | 3300048921 | Ga0496118_0001704 | Ga0496118_0001704_15698_16450 | 250 |
| 769 | 3300048921 | Ga0496118_0001971 | Ga0496118_0001971_27908_28660 | 250 |
| 770 | 3300048921 | Ga0496118_0003290 | Ga0496118_0003290_169_921 | 250 |
| 771 | 3300048921 | Ga0496118_0019471 | Ga0496118_0019471_391_1143 | 250 |
| 772 | 3300048921 | Ga0496118_0021702 | Ga0496118_0021702_1559_2311 | 250 |
| 773 | 3300048921 | Ga0496118_0152458 | Ga0496118_0152458_336_1097 | 250 |
| 774 | 3300048922 | Ga0496119_0063981 | Ga0496119_0063981_253_1005 | 250 |
| 775 | 3300048922 | Ga0496119_0213985 | Ga0496119_0213985_133_894 | 250 |
| 776 | 3300048923 | Ga0496120_0105905 | Ga0496120_0105905_507_1259 | 250 |
| 777 | 3300048924 | Ga0496121_0002486 | Ga0496121_0002486_9864_10616 | 250 |
| 778 | 3300048924 | Ga0496121_0006106 | Ga0496121_0006106_5768_6523 | 250 |
| 779 | 3300048924 | Ga0496121_0024985 | Ga0496121_0024985_4501_5262 | 250 |
| 780 | 3300048924 | Ga0496121_0188038 | Ga0496121_0188038_199_951 | 250 |
| 781 | 3300048924 | Ga0496121_0208267 | Ga0496121_0208267_218_970 | 250 |
| 782 | 3300048925 | Ga0496122_0046426 | Ga0496122_0046426_1601_2353 | 250 |
| 783 | 3300048925 | Ga0496122_0183193 | Ga0496122_0183193_303_1055 | 250 |
| 784 | 3300048926 | Ga0496123_0028624 | Ga0496123_0028624_548_1300 | 250 |
| 785 | 3300048926 | Ga0496123_0126677 | Ga0496123_0126677_535_1287 | 250 |
| 786 | 3300048927 | Ga0496124_0050922 | Ga0496124_0050922_461_1213 | 250 |
| 787 | 3300048927 | Ga0496124_0152308 | Ga0496124_0152308_184_939 | 250 |
| 788 | 3300048928 | Ga0496125_0010341 | Ga0496125_0010341_6205_6957 | 250 |
| 789 | 3300048929 | Ga0496126_0000337 | Ga0496126_0000337_21136_21888 | 250 |
| 790 | 3300048929 | Ga0496126_0010301 | Ga0496126_0010301_5370_6122 | 250 |
| 791 | 3300049460 | Ga0495682_0024617 | Ga0495682_0024617_1112_1864 | 250 |
| 792 | 3300049569 | Ga0501032_0188592 | Ga0501032_0188592_139_891 | 250 |
| 793 | 3300049579 | Ga0501043_0009431 | Ga0501043_0009431_3816_4568 | 250 |
| 794 | 3300049581 | Ga0501047_0142826 | Ga0501047_0142826_327_1079 | 250 |
| 795 | 3300049586 | Ga0501070_0491625 | Ga0501070_0491625_149_916 | 250 |
| 796 | 3300049742 | Ga0501080_0018606 | Ga0501080_0018606_1757_2509 | 250 |
| 797 | 3300049823 | Ga0501044_0163507 | Ga0501044_0163507_720_1472 | 250 |
| 798 | 3300049823 | Ga0501044_0596606 | Ga0501044_0596606_39_791 | 250 |
| 799 | 3300050492 | nmdc:mga0yw44_114293_c1 | nmdc:mga0yw44_114293_c1_394_1167 | 250 |
| 800 | 3300050493 | nmdc:mga0k408_100319_c1 | nmdc:mga0k408_100319_c1_566_1318 | 250 |
| 801 | 3300050493 | nmdc:mga0k408_113322_c1 | nmdc:mga0k408_113322_c1_768_1541 | 250 |
| 802 | 3300050493 | nmdc:mga0k408_223927_c1 | nmdc:mga0k408_223927_c1_318_1070 | 250 |
| 803 | 3300050493 | nmdc:mga0k408_6516_c1 | nmdc:mga0k408_6516_c1_3362_4114 | 250 |
| 804 | 3300050494 | nmdc:mga06z11_19680_c1 | nmdc:mga06z11_19680_c1_1275_2048 | 250 |
| 805 | 3300050494 | nmdc:mga06z11_95428_c1 | nmdc:mga06z11_95428_c1_306_1079 | 250 |
| 806 | 3300050496 | nmdc:mga07m45_4464_c1 | nmdc:mga07m45_4464_c1_5409_6182 | 250 |
| 807 | 3300050496 | nmdc:mga07m45_919_c1 | nmdc:mga07m45_919_c1_3227_4000 | 250 |
| 808 | 3300050508 | nmdc:mga09592_85690_c1 | nmdc:mga09592_85690_c1_812_1564 | 250 |
| 809 | 3300050512 | nmdc:mga0n895_516677_c1 | nmdc:mga0n895_516677_c1_228_980 | 250 |
| 810 | 3300050512 | nmdc:mga0n895_592094_c1 | nmdc:mga0n895_592094_c1_215_967 | 250 |
| 811 | 3300050512 | nmdc:mga0n895_6971_c1 | nmdc:mga0n895_6971_c1_5365_6117 | 250 |
| 812 | 3300050515 | nmdc:mga0a205_742132_c1 | nmdc:mga0a205_742132_c1_33_785 | 250 |
| 813 | 3300050516 | nmdc:mga0sz30_11010_c1 | nmdc:mga0sz30_11010_c1_1227_2000 | 250 |
| 814 | 3300053084 | Ga0495595_0108287 | Ga0495595_0108287_273_1025 | 250 |
| 815 | 3300053085 | Ga0495619_0024042 | Ga0495619_0024042_668_1420 | 250 |
| 816 | 3300053091 | Ga0500647_0003099 | Ga0500647_0003099_5563_6363 | 250 |
| 817 | 3300053092 | Ga0500583_0004151 | Ga0500583_0004151_3241_3993 | 250 |
| 818 | 3300053111 | Ga0500572_000038 | Ga0500572_000038_3391_4188 | 250 |
| 819 | 3300053131 | Ga0500652_027187 | Ga0500652_027187_383_1135 | 250 |
| 820 | 3300053133 | Ga0500655_011291 | Ga0500655_011291_358_1110 | 250 |
| 821 | 3300053136 | Ga0500559_0000014 | Ga0500559_0000014_138764_139516 | 250 |
| 822 | 3300053139 | Ga0500568_0016410 | Ga0500568_0016410_2289_3062 | 250 |
| 823 | 3300053156 | Ga0500622_0002290 | Ga0500622_0002290_11248_12000 | 250 |
| 824 | 3300053156 | Ga0500622_0153216 | Ga0500622_0153216_243_995 | 250 |
| 825 | 3300053739 | Ga0500587_011104 | Ga0500587_011104_186_938 | 250 |
| 826 | 3300061719 | Ga0466962_0017319 | Ga0466962_0017319_1716_2468 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wk6-assembly1.cif.gz_D | crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph | 0.962 | 5 | 247 |
| 6d9y-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad | 0.9604 | 1 | 250 |
| 6d9y-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied nad | 0.9567 | 1 | 250 |
| 4nbv-assembly1.cif.gz_A | crystal structure of fabg from cupriavidus taiwanensis | 0.9536 | 4 | 246 |
| 1uls-assembly1.cif.gz_A | crystal structure of tt0140 from thermus thermophilus hb8 | 0.9514 | 4 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9647 | 6 | 88 | 3.40.50.720 |
| af_Q5BLE6_285_550_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9555 | 3 | 247 | 3.40.50.720 |
| 4urfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9504 | 6 | 250 | 3.40.50.720 |
| 6d9yB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9489 | 1 | 250 | 3.40.50.720 |
| 5h5xG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9459 | 3 | 250 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J5FS33-F1-model_v4 | 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)) (EC 1.1.1.401) | 0.9707 | 1 | 250 |
GO:0016491
|
| AF-A0A3N8I9Q9-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9691 | 1 | 250 |
GO:0016616
GO:0030497 |
| AF-A0A1X7M7R7-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.9685 | 1 | 250 |
GO:0016491
|
| AF-A0A1I3T2W7-F1-model_v4 | 3-oxoacyl-[acyl-carrier protein] reductase | 0.968 | 1 | 250 |
GO:0016491
|
| AF-A0A372JZD4-F1-model_v4 | SDR family oxidoreductase | 0.9679 | 1 | 250 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar