F482200

General Info

Members Datasets Scaffolds Average Seq Length
820 283 1640 98

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100184626|Ga0070689_1001846262
Length 102
Sequence MPATPKSITVECPCCQAKLTIDPELAAVVAHEPPPAKRTVGDLGAAFDVLTKKSAEREERFRQQMAAEAGGQKGKVLDRKFQEGLKKAKDSPDPPKRPFDYE

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
235 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
236 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
261 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
280 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
281 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0.12
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 15.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100184626 3300005340 Bacteria 1695
2 Ga0065707_10681769 3300005295 Bacteria 648
3 Ga0070676_10135040 3300005328 Bacteria 1564
4 Ga0070690_100817707 3300005330 Unclassified 724
5 Ga0070670_101451752 3300005331 Bacteria 629
6 Ga0068869_100980097 3300005334 Unclassified 735
7 Ga0068869_101555325 3300005334 Bacteria 588
8 Ga0070680_100017467 3300005336 Bacteria 5658
9 Ga0070689_100117494 3300005340 Bacteria 2121
10 Ga0070692_11026173 3300005345 Bacteria 578
11 Ga0070692_11270497 3300005345 Unclassified 527
12 Ga0070668_100532702 3300005347 Bacteria 1020
13 Ga0070669_100017271 3300005353 Bacteria 5147
14 Ga0070669_100375236 3300005353 Bacteria 1159
15 Ga0070674_100137404 3300005356 Bacteria 1830
16 Ga0070659_100305219 3300005366 Bacteria 1328
17 Ga0070667_100365045 3300005367 Bacteria 1309
18 Ga0070714_100464447 3300005435 Bacteria 1204
19 Ga0070713_100011214 3300005436 Bacteria 6517
20 Ga0070701_10300346 3300005438 Bacteria 987
21 Ga0070711_101395774 3300005439 Unclassified 609
22 Ga0070700_100926424 3300005441 Bacteria 711
23 Ga0070694_100116874 3300005444 Bacteria 1908
24 Ga0070694_100137757 3300005444 Bacteria 1770
25 Ga0070694_101219326 3300005444 Bacteria 631
26 Ga0070694_101731340 3300005444 Bacteria 532
27 Ga0070708_100004263 3300005445 Bacteria 11240
28 Ga0070708_100007769 3300005445 Bacteria 8593
29 Ga0070708_100049610 3300005445 Bacteria 3714
30 Ga0070708_100928943 3300005445 Unclassified 816
31 Ga0070708_101945735 3300005445 Unclassified 545
32 Ga0070662_100090563 3300005457 Bacteria 2296
33 Ga0070681_10039404 3300005458 Bacteria 4737
34 Ga0068867_100446653 3300005459 Bacteria 1101
35 Ga0068867_101385058 3300005459 Bacteria 652
36 Ga0070706_100020274 3300005467 Bacteria 6128
37 Ga0070706_100021306 3300005467 Bacteria 5970
38 Ga0070706_100052650 3300005467 Bacteria 3756
39 Ga0070706_100095676 3300005467 Bacteria 2757
40 Ga0070706_100350854 3300005467 Bacteria 1375
41 Ga0070706_100377210 3300005467 Unclassified 1321
42 Ga0070706_100663697 3300005467 Bacteria 968
43 Ga0070706_100864364 3300005467 Bacteria 836
44 Ga0070707_100007068 3300005468 Bacteria 10409
45 Ga0070707_100025806 3300005468 Bacteria 5577
46 Ga0070707_100142937 3300005468 Bacteria 2329
47 Ga0070707_100211423 3300005468 Bacteria 1890
48 Ga0070707_100878942 3300005468 Unclassified 861
49 Ga0070707_101177556 3300005468 Unclassified 732
50 Ga0070707_101840923 3300005468 Unclassified 573
51 Ga0070698_100036902 3300005471 Bacteria 5043
52 Ga0070698_100461999 3300005471 Bacteria 1205
53 Ga0070699_100001522 3300005518 Bacteria 21187
54 Ga0070699_100002189 3300005518 Bacteria 17680
55 Ga0070699_100084305 3300005518 Bacteria 2773
56 Ga0070699_100172303 3300005518 Bacteria 1918
57 Ga0070699_100204194 3300005518 Bacteria 1758
58 Ga0070699_100404762 3300005518 Bacteria 1234
59 Ga0070699_100573495 3300005518 Unclassified 1028
60 Ga0070699_100755051 3300005518 Unclassified 890
61 Ga0070699_100786365 3300005518 Unclassified 871
62 Ga0070699_100799805 3300005518 Bacteria 863
63 Ga0070699_101973268 3300005518 Unclassified 534
64 Ga0070679_100069507 3300005530 Bacteria 3512
65 Ga0070679_101035259 3300005530 Bacteria 765
66 Ga0070697_100036525 3300005536 Bacteria 3969
67 Ga0070697_100208429 3300005536 Bacteria 1663
68 Ga0070697_100216303 3300005536 Bacteria 1632
69 Ga0070697_100246906 3300005536 Bacteria 1526
70 Ga0070697_100597529 3300005536 Bacteria 970
71 Ga0070697_100893538 3300005536 Bacteria 788
72 Ga0070697_101416686 3300005536 Unclassified 621
73 Ga0070672_100008144 3300005543 Bacteria 7164
74 Ga0070686_100394970 3300005544 Unclassified 1050
75 Ga0070686_101869608 3300005544 Bacteria 512
76 Ga0070695_100081385 3300005545 Bacteria 2143
77 Ga0070695_100092712 3300005545 Bacteria 2020
78 Ga0070696_100031380 3300005546 Bacteria 3641
79 Ga0070696_100059419 3300005546 Bacteria 2672
80 Ga0070696_100436652 3300005546 Bacteria 1031
81 Ga0070696_100539739 3300005546 Bacteria 933
82 Ga0070696_101228288 3300005546 Unclassified 634
83 Ga0070693_100467690 3300005547 Bacteria 888
84 Ga0070704_100002007 3300005549 Bacteria 11276
85 Ga0070704_100004548 3300005549 Bacteria 8015
86 Ga0070704_100193720 3300005549 Bacteria 1636
87 Ga0070704_100401514 3300005549 Bacteria 1170
88 Ga0068857_100390097 3300005577 Bacteria 1294
89 Ga0068856_100578712 3300005614 Unclassified 1144
90 Ga0068856_100856045 3300005614 Bacteria 928
91 Ga0070702_101003837 3300005615 Bacteria 661
92 Ga0068852_102450518 3300005616 Bacteria 542
93 Ga0068859_100195322 3300005617 Bacteria 2108
94 Ga0068859_100340856 3300005617 Bacteria 1593
95 Ga0068866_10061437 3300005718 Bacteria 1951
96 Ga0068866_10578597 3300005718 Bacteria 755
97 Ga0068861_100119499 3300005719 Bacteria 2124
98 Ga0068861_100600851 3300005719 Bacteria 1010
99 Ga0068861_102340812 3300005719 Bacteria 536
100 Ga0068863_102576952 3300005841 Bacteria 518
101 Ga0068858_101744556 3300005842 Unclassified 615
102 Ga0068860_100024034 3300005843 Bacteria 5891
103 Ga0068860_100440010 3300005843 Bacteria 1295
104 Ga0068860_100520173 3300005843 Bacteria 1190
105 Ga0068860_100762183 3300005843 Unclassified 980
106 Ga0068862_100554390 3300005844 Bacteria 1098
107 Ga0068862_100903882 3300005844 Bacteria 868
108 Ga0068862_101226687 3300005844 Bacteria 749
109 Ga0068862_101915375 3300005844 Bacteria 603
110 Ga0081538_10215659 3300005981 Bacteria 768
111 Ga0070717_10691060 3300006028 Unclassified 927
112 Ga0075432_10295596 3300006058 Bacteria 671
113 Ga0070716_100401954 3300006173 Bacteria 985
114 Ga0068871_100496186 3300006358 Bacteria 1100
115 Ga0075428_100000123 3300006844 Bacteria 66826
116 Ga0075428_100001197 3300006844 Bacteria 27767
117 Ga0075428_100002086 3300006844 Bacteria 21561
118 Ga0075428_100051940 3300006844 Bacteria 4495
119 Ga0075428_100072140 3300006844 Bacteria 3773
120 Ga0075428_100166522 3300006844 Bacteria 2391
121 Ga0075428_100208139 3300006844 Bacteria 2114
122 Ga0075428_100307484 3300006844 Bacteria 1704
123 Ga0075428_100800377 3300006844 Bacteria 1002
124 Ga0075430_100001228 3300006846 Bacteria 20620
125 Ga0075430_100011349 3300006846 Bacteria 7560
126 Ga0075430_100013054 3300006846 Bacteria 7078
127 Ga0075430_100019223 3300006846 Bacteria 5808
128 Ga0075430_100035815 3300006846 Bacteria 4209
129 Ga0075430_100287605 3300006846 Bacteria 1360
130 Ga0075430_100638747 3300006846 Bacteria 878
131 Ga0075430_101733449 3300006846 Bacteria 512
132 Ga0075431_100001438 3300006847 Bacteria 21928
133 Ga0075431_100001903 3300006847 Bacteria 19814
134 Ga0075431_100003721 3300006847 Bacteria 14820
135 Ga0075431_100004913 3300006847 Bacteria 13167
136 Ga0075431_100012924 3300006847 Bacteria 8428
137 Ga0075431_100024018 3300006847 Bacteria 6242
138 Ga0075431_100084312 3300006847 Bacteria 3281
139 Ga0075431_100090800 3300006847 Bacteria 3153
140 Ga0075431_100090975 3300006847 Bacteria 3149
141 Ga0075431_100115243 3300006847 Bacteria 2774
142 Ga0075431_100351869 3300006847 Bacteria 1481
143 Ga0075431_100490658 3300006847 Bacteria 1220
144 Ga0075431_100559969 3300006847 Bacteria 1130
145 Ga0075431_100869040 3300006847 Bacteria 872
146 Ga0075431_101925817 3300006847 Bacteria 547
147 Ga0075433_10005655 3300006852 Bacteria 9823
148 Ga0075433_10016755 3300006852 Bacteria 6051
149 Ga0075433_10019360 3300006852 Bacteria 5670
150 Ga0075433_10045505 3300006852 Bacteria 3815
151 Ga0075433_10050209 3300006852 Bacteria 3631
152 Ga0075433_10119850 3300006852 Bacteria 2336
153 Ga0075433_10218416 3300006852 Bacteria 1693
154 Ga0075433_10328464 3300006852 Unclassified 1353
155 Ga0075433_10549876 3300006852 Bacteria 1015
156 Ga0075433_11457890 3300006852 Bacteria 591
157 Ga0075433_11462252 3300006852 Bacteria 590
158 Ga0075433_11616747 3300006852 Unclassified 559
159 Ga0075434_100015025 3300006871 Bacteria 7414
160 Ga0075434_100061268 3300006871 Bacteria 3743
161 Ga0075434_100129495 3300006871 Bacteria 2542
162 Ga0075434_100138977 3300006871 Bacteria 2449
163 Ga0075434_100139183 3300006871 Bacteria 2447
164 Ga0075434_100143695 3300006871 Bacteria 2406
165 Ga0075434_100424661 3300006871 Bacteria 1350
166 Ga0075434_100537410 3300006871 Unclassified 1189
167 Ga0075434_100701534 3300006871 Unclassified 1029
168 Ga0075434_100847694 3300006871 Bacteria 929
169 Ga0075434_101488620 3300006871 Unclassified 686
170 Ga0075429_100005499 3300006880 Bacteria 10908
171 Ga0075429_100006893 3300006880 Bacteria 9866
172 Ga0075429_100021371 3300006880 Bacteria 5610
173 Ga0075429_100044716 3300006880 Bacteria 3852
174 Ga0075429_100051758 3300006880 Bacteria 3572
175 Ga0075429_100150478 3300006880 Bacteria 2038
176 Ga0075429_100158220 3300006880 Bacteria 1984
177 Ga0075429_100192883 3300006880 Bacteria 1784
178 Ga0075429_100493633 3300006880 Bacteria 1073
179 Ga0075429_101009042 3300006880 Bacteria 728
180 Ga0068865_100087806 3300006881 Bacteria 2248
181 Ga0068865_100607623 3300006881 Bacteria 925
182 Ga0068865_100899691 3300006881 Bacteria 770
183 Ga0068865_101027249 3300006881 Bacteria 723
184 Ga0075436_100002807 3300006914 Bacteria 11938
185 Ga0075436_100042287 3300006914 Bacteria 3143
186 Ga0075436_100093051 3300006914 Bacteria 2096
187 Ga0075436_100118880 3300006914 Bacteria 1848
188 Ga0075436_100149403 3300006914 Bacteria 1644
189 Ga0075436_100500719 3300006914 Bacteria 889
190 Ga0075436_100841319 3300006914 Bacteria 685
191 Ga0097620_100195329 3300006931 Bacteria 2108
192 Ga0097620_100340856 3300006931 Bacteria 1593
193 Ga0075435_100028177 3300007076 Bacteria 4403
194 Ga0075435_100044539 3300007076 Bacteria 3554
195 Ga0075435_100047863 3300007076 Bacteria 3434
196 Ga0075435_100063351 3300007076 Bacteria 3002
197 Ga0075435_100080077 3300007076 Bacteria 2681
198 Ga0075435_100211499 3300007076 Bacteria 1646
199 Ga0075435_100354112 3300007076 Bacteria 1258
200 Ga0075435_100408943 3300007076 Bacteria 1168
201 Ga0075435_100494881 3300007076 Bacteria 1057
202 Ga0075435_101120088 3300007076 Bacteria 688
203 Ga0099794_10065172 3300007265 Bacteria 1776
204 Ga0099794_10344965 3300007265 Unclassified 774
205 Ga0099794_10491733 3300007265 Unclassified 645
206 Ga0099794_10766377 3300007265 Bacteria 516
207 Ga0099795_10145827 3300007788 Unclassified 966
208 Ga0105240_10024064 3300009093 Bacteria 8041
209 Ga0105240_10102889 3300009093 Bacteria 3470
210 Ga0111539_10002302 3300009094 Bacteria 25379
211 Ga0111539_10003984 3300009094 Bacteria 19400
212 Ga0111539_10033344 3300009094 Bacteria 6251
213 Ga0111539_10500982 3300009094 Bacteria 1414
214 Ga0111539_10515617 3300009094 Bacteria 1393
215 Ga0111539_12517011 3300009094 Unclassified 597
216 Ga0105245_10024210 3300009098 Bacteria 5330
217 Ga0105247_10274031 3300009101 Bacteria 1162
218 Ga0114129_10000003 3300009147 Bacteria 183186
219 Ga0114129_10002359 3300009147 Bacteria 26209
220 Ga0114129_10002470 3300009147 Bacteria 25675
221 Ga0114129_10002850 3300009147 Bacteria 24174
222 Ga0114129_10014253 3300009147 Bacteria 11328
223 Ga0114129_10015694 3300009147 Bacteria 10771
224 Ga0114129_10033250 3300009147 Bacteria 7288
225 Ga0114129_10035676 3300009147 Bacteria 7025
226 Ga0114129_10055681 3300009147 Bacteria 5542
227 Ga0114129_10060203 3300009147 Bacteria 5309
228 Ga0114129_10071461 3300009147 Bacteria 4839
229 Ga0114129_10092162 3300009147 Bacteria 4198
230 Ga0114129_10146496 3300009147 Bacteria 3234
231 Ga0114129_10162237 3300009147 Bacteria 3052
232 Ga0114129_10422979 3300009147 Bacteria 1752
233 Ga0114129_10670089 3300009147 Bacteria 1337
234 Ga0114129_10701543 3300009147 Unclassified 1300
235 Ga0114129_10724346 3300009147 Unclassified 1276
236 Ga0114129_11046980 3300009147 Bacteria 1025
237 Ga0114129_11664063 3300009147 Bacteria 780
238 Ga0105243_10526396 3300009148 Unclassified 1125
239 Ga0105243_10944222 3300009148 Bacteria 861
240 Ga0105241_10050822 3300009174 Bacteria 3160
241 Ga0105242_10316283 3300009176 Bacteria 1430
242 Ga0105242_10347238 3300009176 Bacteria 1369
243 Ga0105237_10141340 3300009545 Bacteria 2401
244 Ga0105249_10234215 3300009553 Bacteria 1812
245 Ga0105249_10442470 3300009553 Unclassified 1337
246 Ga0105249_11033492 3300009553 Bacteria 891
247 Ga0105249_11497830 3300009553 Bacteria 747
248 Ga0099796_10034042 3300010159 Unclassified 1680
249 Ga0099796_10367945 3300010159 Unclassified 623
250 Ga0105239_11151531 3300010375 Bacteria 893
251 Ga0157370_11580519 3300013104 Unclassified 589
252 Ga0157374_11498513 3300013296 Unclassified 698
253 Ga0157378_10044374 3300013297 Bacteria 3948
254 Ga0157378_10060245 3300013297 Bacteria 3387
255 Ga0157378_10078719 3300013297 Bacteria 2974
256 Ga0157378_12257565 3300013297 Bacteria 596
257 Ga0157378_13063462 3300013297 Bacteria 519
258 Ga0163162_10328837 3300013306 Bacteria 1661
259 Ga0163162_11427284 3300013306 Bacteria 788
260 Ga0163162_12682287 3300013306 Bacteria 573
261 Ga0157375_10973278 3300013308 Bacteria 989
262 Ga0163163_10892092 3300014325 Unclassified 952
263 Ga0157380_10408402 3300014326 Bacteria 1291
264 Ga0157380_10860021 3300014326 Bacteria 929
265 Ga0157380_13530307 3300014326 Unclassified 501
266 Ga0157379_10642787 3300014968 Bacteria 993
267 Ga0224572_1054713 3300024225 Unclassified 742
268 Ga0228598_1005373 3300024227 Bacteria 2677
269 Ga0207642_10118375 3300025899 Bacteria 1362
270 Ga0207642_10155664 3300025899 Bacteria 1222
271 Ga0207710_10775202 3300025900 Bacteria 504
272 Ga0207688_10135518 3300025901 Bacteria 1446
273 Ga0207699_10121544 3300025906 Bacteria 1689
274 Ga0207684_10009034 3300025910 Bacteria 8830
275 Ga0207684_10153332 3300025910 Bacteria 1983
276 Ga0207684_10256445 3300025910 Bacteria 1509
277 Ga0207684_10303833 3300025910 Bacteria 1376
278 Ga0207684_10334556 3300025910 Bacteria 1304
279 Ga0207654_10067803 3300025911 Bacteria 2109
280 Ga0207707_10027215 3300025912 Bacteria 5000
281 Ga0207695_10168290 3300025913 Bacteria 2118
282 Ga0207660_10048915 3300025917 Bacteria 2994
283 Ga0207660_10141458 3300025917 Bacteria 1840
284 Ga0207660_10287772 3300025917 Bacteria 1306
285 Ga0207662_10406863 3300025918 Unclassified 924
286 Ga0207662_10451245 3300025918 Bacteria 879
287 Ga0207652_10130659 3300025921 Bacteria 2240
288 Ga0207646_10011308 3300025922 Bacteria 8663
289 Ga0207646_10022728 3300025922 Bacteria 5769
290 Ga0207646_10055168 3300025922 Bacteria 3553
291 Ga0207646_10081442 3300025922 Bacteria 2894
292 Ga0207646_10267204 3300025922 Bacteria 1546
293 Ga0207681_10021776 3300025923 Bacteria 4080
294 Ga0207681_10027765 3300025923 Bacteria 3663
295 Ga0207681_10292188 3300025923 Bacteria 1287
296 Ga0207687_10243682 3300025927 Unclassified 1426
297 Ga0207700_10032487 3300025928 Bacteria 3723
298 Ga0207690_10319030 3300025932 Bacteria 1221
299 Ga0207686_10098744 3300025934 Bacteria 1945
300 Ga0207686_10222786 3300025934 Bacteria 1363
301 Ga0207709_10344513 3300025935 Unclassified 1123
302 Ga0207670_10420760 3300025936 Bacteria 1072
303 Ga0207669_11801545 3300025937 Bacteria 523
304 Ga0207704_10182989 3300025938 Bacteria 1516
305 Ga0207704_10516598 3300025938 Bacteria 965
306 Ga0207704_10672949 3300025938 Bacteria 854
307 Ga0207665_10288397 3300025939 Bacteria 1223
308 Ga0207691_10015570 3300025940 Bacteria 7230
309 Ga0207689_10563927 3300025942 Bacteria 957
310 Ga0207651_11572922 3300025960 Bacteria 592
311 Ga0207712_10645463 3300025961 Bacteria 919
312 Ga0207712_11470683 3300025961 Bacteria 610
313 Ga0207668_10182901 3300025972 Bacteria 1655
314 Ga0207668_10431857 3300025972 Bacteria 1120
315 Ga0207658_11199591 3300025986 Bacteria 694
316 Ga0207677_12146550 3300026023 Bacteria 520
317 Ga0207703_11876045 3300026035 Unclassified 575
318 Ga0207708_10383511 3300026075 Bacteria 1159
319 Ga0207702_10650753 3300026078 Unclassified 1036
320 Ga0207648_11138602 3300026089 Bacteria 732
321 Ga0207674_10839305 3300026116 Unclassified 886
322 Ga0207675_100085919 3300026118 Bacteria 2953
323 Ga0207675_100099572 3300026118 Bacteria 2738
324 Ga0207675_100684922 3300026118 Bacteria 1033
325 Ga0209588_1032281 3300027671 Bacteria 1677
326 Ga0209588_1074830 3300027671 Unclassified 1094
327 Ga0209998_10028112 3300027717 Bacteria 1235
328 Ga0209974_10062681 3300027876 Bacteria 1260
329 Ga0207428_10000035 3300027907 Bacteria 229100
330 Ga0207428_10023017 3300027907 Bacteria 5246
331 Ga0207428_10024316 3300027907 Bacteria 5088
332 Ga0268265_10117053 3300028380 Bacteria 2188
333 Ga0268265_10350575 3300028380 Bacteria 1348
334 Ga0268265_10578153 3300028380 Bacteria 1070
335 Ga0268265_10786597 3300028380 Bacteria 926
336 Ga0268264_10034176 3300028381 Bacteria 4180
337 Ga0268264_10295382 3300028381 Unclassified 1523
338 Ga0268264_10446707 3300028381 Bacteria 1252
339 Ga0268264_10650877 3300028381 Bacteria 1043
340 Ga0268264_10889732 3300028381 Bacteria 893
341 Ga0265325_10011967 3300031241 Bacteria 4972
342 Ga0265331_10005789 3300031250 Bacteria 7405
343 Ga0265316_10001389 3300031344 Bacteria 26087
344 Ga0265316_10211557 3300031344 Bacteria 1434
345 Ga0307408_100033652 3300031548 Bacteria 3583
346 Ga0307408_100075552 3300031548 Unclassified 2504
347 Ga0307408_100146517 3300031548 Bacteria 1859
348 Ga0307408_101029096 3300031548 Bacteria 760
349 Ga0265313_10052522 3300031595 Unclassified 1945
350 Ga0265313_10146951 3300031595 Unclassified 1010
351 Ga0307405_10219385 3300031731 Bacteria 1394
352 Ga0307405_10331588 3300031731 Unclassified 1166
353 Ga0307413_10618593 3300031824 Unclassified 889
354 Ga0307410_10279549 3300031852 Bacteria 1309
355 Ga0307410_10633286 3300031852 Bacteria 895
356 Ga0307407_10553041 3300031903 Unclassified 851
357 Ga0307412_10008480 3300031911 Bacteria 5871
358 Ga0307412_11199772 3300031911 Bacteria 679
359 Ga0307412_12162793 3300031911 Unclassified 517
360 Ga0307409_100131933 3300031995 Bacteria 2137
361 Ga0307409_100297684 3300031995 Bacteria 1499
362 Ga0307409_100666830 3300031995 Bacteria 1036
363 Ga0307409_101984560 3300031995 Bacteria 611
364 Ga0307409_102938356 3300031995 Unclassified 503
365 Ga0307416_100151050 3300032002 Bacteria 2130
366 Ga0307416_102300024 3300032002 Bacteria 639
367 Ga0307411_10199533 3300032005 Bacteria 1535
368 Ga0307411_10394518 3300032005 Bacteria 1142
369 Ga0307411_10759711 3300032005 Unclassified 850
370 Ga0373930_0190286 3300034816 Bacteria 530
371 Ga0373948_0143949 3300034817 Bacteria 591
372 Ga0373959_0207302 3300034820 Bacteria 520
373 Ga0373929_0119500 3300035085 Bacteria 681
374 Ga0373934_0158092 3300035086 Bacteria 930
375 Ga0373940_0003491 3300035088 Bacteria 3217
376 Ga0373940_0004640 3300035088 Bacteria 2917
377 Ga0373940_0342530 3300035088 Bacteria 523
378 Ga0373949_0094568 3300035090 Bacteria 812
379 Ga0373951_0136205 3300035091 Bacteria 679
380 Ga0373952_0178011 3300035092 Bacteria 612
381 Ga0373923_0480491 3300035111 Bacteria 604
382 Ga0373932_0007393 3300035112 Bacteria 2615
383 Ga0373932_0078580 3300035112 Bacteria 1038
384 Ga0373932_0367390 3300035112 Bacteria 550
385 Ga0373939_0023274 3300035114 Bacteria 1715
386 Ga0373941_0027022 3300035115 Bacteria 1672
387 Ga0373953_0244752 3300035117 Bacteria 779
388 Ga0373954_0140827 3300035118 Bacteria 1176
389 Ga0373954_0230652 3300035118 Archaea 911
390 Ga0373960_0063956 3300035121 Bacteria 1122
391 Ga0373943_0502396 3300035170 Bacteria 709
392 Ga0373955_0137276 3300035172 Bacteria 1431
393 Ga0373955_0426563 3300035172 Unclassified 807
394 Ga0373942_0320557 3300035207 Unclassified 542
395 Ga0373962_0016851 3300035242 Bacteria 1888
396 Ga0373962_0342909 3300035242 Bacteria 538
397 Ga0373931_0005637 3300035691 Bacteria 5809
398 Ga0373931_0475134 3300035691 Bacteria 803
399 Ga0373931_0781480 3300035691 Bacteria 635
400 Ga0373935_0044416 3300035692 Bacteria 2800
401 Ga0373927_0014322 3300035695 Bacteria 5251
402 Ga0373947_0002800 3300035725 Bacteria 10424
403 Ga0373937_0148483 3300036401 Unclassified 2195
404 Ga0372808_064489 3300036459 Unclassified 527
405 Ga0373925_0267676 3300037068 Bacteria 1374
406 Ga0395899_0286326 3300037312 Bacteria 1119
407 Ga0395900_0064583 3300037418 Bacteria 3761
408 Ga0395900_1458410 3300037418 Bacteria 597
409 Ga0395898_0110921 3300037466 Bacteria 2629
410 Ga0395901_0011071 3300038443 Bacteria 9141
411 Ga0395901_1637969 3300038443 Unclassified 596
412 Ga0242419_025698 3300038698 Unclassified 506
413 Ga0242420_018598 3300038996 Bacteria 1225
414 Ga0242420_020221 3300038996 Bacteria 1183
415 Ga0439439_0248246 3300041406 Unclassified 527
416 Ga0439434_0107791 3300042435 Unclassified 901
417 Ga0439435_0021627 3300042436 Bacteria 1672
418 Ga0439444_0058061 3300042437 Bacteria 802
419 Ga0451577_0160370 3300042876 Bacteria 2025
420 Ga0453683_1116797 3300044673 Bacteria 526
421 Ga0453684_1120024 3300044712 Bacteria 831
422 Ga0451576_0295192 3300045051 Bacteria 1694
423 Ga0451576_0348544 3300045051 Bacteria 1550
424 Ga0451576_0911232 3300045051 Bacteria 922
425 Ga0451576_1200086 3300045051 Bacteria 792
426 Ga0451576_2579930 3300045051 Unclassified 518
427 Ga0495592_0013644 3300046454 Bacteria 6179
428 Ga0495592_0095278 3300046454 Bacteria 2129
429 Ga0495592_0377124 3300046454 Bacteria 903
430 Ga0495603_0068926 3300046455 Bacteria 2081
431 Ga0495651_0046609 3300046462 Bacteria 3354
432 Ga0495651_0101707 3300046462 Bacteria 2138
433 Ga0495653_0003848 3300046463 Bacteria 12135
434 Ga0495580_0003744 3300046472 Bacteria 12876
435 Ga0495580_0007726 3300046472 Bacteria 8619
436 Ga0495580_0208306 3300046472 Bacteria 1346
437 Ga0495582_0121508 3300046473 Bacteria 1472
438 Ga0495582_0422474 3300046473 Unclassified 769
439 Ga0495664_0029906 3300046477 Bacteria 3188
440 Ga0495664_0633294 3300046477 Bacteria 634
441 Ga0495585_0405672 3300046492 Bacteria 656
442 Ga0495594_0035236 3300046499 Bacteria 2726
443 Ga0495594_0183668 3300046499 Bacteria 1191
444 Ga0495608_0004290 3300046511 Bacteria 10208
445 Ga0495608_0029128 3300046511 Unclassified 3749
446 Ga0495608_0833993 3300046511 Bacteria 543
447 Ga0495618_0014299 3300046514 Unclassified 4833
448 Ga0495628_0007050 3300046516 Bacteria 9733
449 Ga0495628_0017739 3300046516 Bacteria 5912
450 Ga0495628_0027714 3300046516 Bacteria 4605
451 Ga0495628_0163807 3300046516 Bacteria 1689
452 Ga0495630_0001259 3300046517 Bacteria 17480
453 Ga0495630_0020601 3300046517 Bacteria 4863
454 Ga0495630_0086413 3300046517 Unclassified 2368
455 Ga0495630_0227565 3300046517 Bacteria 1424
456 Ga0495630_0567298 3300046517 Unclassified 870
457 Ga0495666_0019141 3300046526 Bacteria 3401
458 Ga0495642_0033101 3300046528 Bacteria 2077
459 Ga0495642_0109868 3300046528 Bacteria 1178
460 Ga0495652_0004476 3300046529 Bacteria 13347
461 Ga0495652_0746580 3300046529 Bacteria 655
462 Ga0495665_0024520 3300046531 Bacteria 3240
463 Ga0495640_0193641 3300046533 Bacteria 1291
464 Ga0495640_0478951 3300046533 Unclassified 758
465 Ga0495586_0017171 3300046535 Bacteria 3847
466 Ga0495586_0040695 3300046535 Bacteria 2501
467 Ga0495587_0097886 3300046536 Bacteria 1691
468 Ga0495587_0098115 3300046536 Unclassified 1689
469 Ga0495621_0225540 3300046539 Bacteria 760
470 Ga0495645_0187263 3300046543 Bacteria 1413
471 Ga0495667_0029378 3300046559 Unclassified 3700
472 Ga0495667_0047913 3300046559 Bacteria 2822
473 Ga0495667_0123131 3300046559 Bacteria 1674
474 Ga0495667_0667241 3300046559 Bacteria 645
475 Ga0495656_0136226 3300046615 Unclassified 1173
476 Ga0495634_0041610 3300046642 Unclassified 3120
477 Ga0495634_0447827 3300046642 Unclassified 762
478 Ga0495635_0063950 3300046663 Bacteria 2526
479 Ga0495635_0089101 3300046663 Bacteria 2111
480 Ga0495659_0056985 3300046664 Bacteria 1435
481 Ga0495659_0071501 3300046664 Bacteria 1300
482 Ga0495659_0151635 3300046664 Bacteria 931
483 Ga0495657_0042741 3300046675 Bacteria 3092
484 Ga0495657_0086520 3300046675 Bacteria 2018
485 Ga0495599_0001234 3300046678 Bacteria 14503
486 Ga0495623_0044812 3300046679 Unclassified 2811
487 Ga0495623_0067710 3300046679 Bacteria 2228
488 Ga0495623_0488212 3300046679 Bacteria 652
489 Ga0495646_0004591 3300046680 Bacteria 8705
490 Ga0495646_0047430 3300046680 Unclassified 2615
491 Ga0495646_0247018 3300046680 Bacteria 957
492 Ga0495658_0651871 3300046683 Unclassified 674
493 Ga0495669_0034949 3300046684 Bacteria 2217
494 Ga0495669_0132272 3300046684 Bacteria 1174
495 Ga0495669_0524457 3300046684 Bacteria 576
496 Ga0495613_0013685 3300046689 Bacteria 6019
497 Ga0495613_0216338 3300046689 Unclassified 1346
498 Ga0495613_0475836 3300046689 Unclassified 844
499 Ga0495624_0012771 3300046690 Bacteria 5734
500 Ga0495624_0292442 3300046690 Unclassified 983
501 Ga0495670_0392163 3300046691 Bacteria 750
502 Ga0495600_0003524 3300046809 Bacteria 9203
503 Ga0495600_0720389 3300046809 Unclassified 599
504 Ga0495581_0410513 3300047315 Unclassified 790
505 Ga0495604_0013351 3300047317 Bacteria 6542
506 Ga0495604_0090436 3300047317 Unclassified 2273
507 Ga0495604_0187256 3300047317 Bacteria 1444
508 Ga0495604_0277719 3300047317 Bacteria 1133
509 Ga0495636_0319469 3300047318 Bacteria 729
510 Ga0495636_0373887 3300047318 Bacteria 675
511 Ga0495674_0001602 3300047319 Bacteria 22204
512 Ga0495674_0011291 3300047319 Bacteria 8432
513 Ga0495674_0035458 3300047319 Bacteria 4501
514 Ga0495674_0040276 3300047319 Bacteria 4180
515 Ga0495674_0189975 3300047319 Bacteria 1707
516 Ga0495674_0248819 3300047319 Bacteria 1463
517 Ga0495680_0038866 3300047322 Unclassified 3800
518 Ga0495680_0087320 3300047322 Bacteria 2346
519 Ga0495680_0940321 3300047322 Bacteria 556
520 Ga0495675_0006096 3300047444 Bacteria 7379
521 Ga0495675_0007762 3300047444 Bacteria 6620
522 Ga0495675_0027407 3300047444 Bacteria 3629
523 Ga0495675_0073138 3300047444 Bacteria 2162
524 Ga0495684_0000714 3300047471 Bacteria 26732
525 Ga0495684_0017728 3300047471 Bacteria 5484
526 Ga0495684_0686246 3300047471 Unclassified 681
527 Ga0495593_0010520 3300047673 Bacteria 5339
528 Ga0495602_0223239 3300048088 Bacteria 1420
529 Ga0495602_0362823 3300048088 Unclassified 1042
530 Ga0495602_0441808 3300048088 Bacteria 919
531 Ga0496100_0922564 3300048903 Bacteria 686
532 Ga0496102_0006841 3300048905 Bacteria 9734
533 Ga0496102_1492697 3300048905 Bacteria 595
534 Ga0496103_0231614 3300048906 Bacteria 1188
535 Ga0496106_0069956 3300048909 Bacteria 2680
536 Ga0496108_0520319 3300048911 Bacteria 1039
537 Ga0496110_1003607 3300048913 Bacteria 742
538 Ga0496112_0235589 3300048915 Bacteria 1784
539 Ga0501290_097143 3300049513 Unclassified 520
540 Ga0501298_049971 3300049521 Bacteria 866
541 Ga0501299_092334 3300049522 Unclassified 690
542 Ga0501032_0659411 3300049569 Bacteria 664
543 Ga0501033_0030594 3300049570 Bacteria 4045
544 Ga0501033_0259389 3300049570 Bacteria 1230
545 Ga0501033_0936374 3300049570 Bacteria 581
546 Ga0501033_1188434 3300049570 Unclassified 505
547 Ga0501036_0080872 3300049572 Bacteria 2746
548 Ga0501036_0190261 3300049572 Bacteria 1727
549 Ga0501036_0323085 3300049572 Bacteria 1289
550 Ga0501036_1556139 3300049572 Unclassified 534
551 Ga0501037_0198465 3300049573 Bacteria 1419
552 Ga0501037_0880598 3300049573 Unclassified 588
553 Ga0501037_1143264 3300049573 Bacteria 503
554 Ga0501038_0088100 3300049574 Bacteria 2606
555 Ga0501038_1068113 3300049574 Unclassified 590
556 Ga0501039_0077603 3300049575 Bacteria 2583
557 Ga0501039_0308346 3300049575 Bacteria 1244
558 Ga0501039_0315816 3300049575 Bacteria 1228
559 Ga0501039_0537350 3300049575 Bacteria 917
560 Ga0501039_1112333 3300049575 Unclassified 612
561 Ga0501039_1553003 3300049575 Bacteria 508
562 Ga0501040_0004861 3300049576 Bacteria 8700
563 Ga0501040_0086871 3300049576 Bacteria 2171
564 Ga0501040_0090000 3300049576 Bacteria 2133
565 Ga0501040_0092780 3300049576 Bacteria 2100
566 Ga0501040_0114627 3300049576 Bacteria 1887
567 Ga0501040_0115160 3300049576 Bacteria 1882
568 Ga0501040_0126039 3300049576 Bacteria 1799
569 Ga0501040_0497787 3300049576 Bacteria 878
570 Ga0501040_0746581 3300049576 Bacteria 708
571 Ga0501041_0025930 3300049577 Bacteria 3524
572 Ga0501041_0028297 3300049577 Bacteria 3381
573 Ga0501041_0105036 3300049577 Bacteria 1750
574 Ga0501041_0162731 3300049577 Bacteria 1395
575 Ga0501041_0196928 3300049577 Bacteria 1263
576 Ga0501041_0709075 3300049577 Bacteria 644
577 Ga0501042_0050588 3300049578 Bacteria 2964
578 Ga0501042_0105300 3300049578 Bacteria 2030
579 Ga0501042_0233791 3300049578 Bacteria 1326
580 Ga0501042_0260786 3300049578 Bacteria 1251
581 Ga0501043_0763377 3300049579 Unclassified 702
582 Ga0501046_0079975 3300049580 Bacteria 2527
583 Ga0501046_0086128 3300049580 Bacteria 2422
584 Ga0501046_1092136 3300049580 Bacteria 551
585 Ga0501048_0174119 3300049582 Bacteria 1525
586 Ga0501048_0231523 3300049582 Bacteria 1311
587 Ga0501048_0441989 3300049582 Bacteria 931
588 Ga0501048_0739507 3300049582 Bacteria 706
589 Ga0501048_0796044 3300049582 Unclassified 679
590 Ga0501067_0006353 3300049583 Bacteria 6552
591 Ga0501067_0742301 3300049583 Unclassified 552
592 Ga0501068_0028137 3300049584 Bacteria 3322
593 Ga0501068_0093224 3300049584 Bacteria 1860
594 Ga0501068_0183999 3300049584 Bacteria 1322
595 Ga0501068_0242547 3300049584 Bacteria 1147
596 Ga0501068_0880290 3300049584 Bacteria 589
597 Ga0501069_0013985 3300049585 Bacteria 4287
598 Ga0501070_0386708 3300049586 Bacteria 1133
599 Ga0501070_0690150 3300049586 Unclassified 808
600 Ga0501070_0752737 3300049586 Bacteria 768
601 Ga0501071_0038809 3300049587 Bacteria 3404
602 Ga0501071_0050132 3300049587 Bacteria 3007
603 Ga0501071_1359789 3300049587 Unclassified 548
604 Ga0501071_1364363 3300049587 Bacteria 547
605 Ga0501072_0006598 3300049588 Bacteria 8837
606 Ga0501072_0018113 3300049588 Bacteria 5415
607 Ga0501072_0045333 3300049588 Bacteria 3457
608 Ga0501072_0111337 3300049588 Bacteria 2179
609 Ga0501072_0130021 3300049588 Bacteria 2007
610 Ga0501072_0215303 3300049588 Bacteria 1531
611 Ga0501072_0330844 3300049588 Bacteria 1210
612 Ga0501072_0357959 3300049588 Bacteria 1158
613 Ga0501072_0455450 3300049588 Bacteria 1013
614 Ga0501073_0248493 3300049589 Bacteria 1228
615 Ga0501073_0458766 3300049589 Bacteria 881
616 Ga0501074_0027524 3300049590 Bacteria 4122
617 Ga0501074_0237345 3300049590 Bacteria 1297
618 Ga0501074_0267808 3300049590 Bacteria 1214
619 Ga0501074_0417640 3300049590 Bacteria 951
620 Ga0501074_0858024 3300049590 Bacteria 639
621 Ga0501075_0004262 3300049591 Bacteria 9664
622 Ga0501075_0007908 3300049591 Bacteria 7385
623 Ga0501075_0093094 3300049591 Bacteria 2288
624 Ga0501075_0095869 3300049591 Bacteria 2251
625 Ga0501075_0098922 3300049591 Bacteria 2215
626 Ga0501075_0242698 3300049591 Bacteria 1373
627 Ga0501075_0316186 3300049591 Unclassified 1190
628 Ga0501075_0335162 3300049591 Bacteria 1153
629 Ga0501075_0388083 3300049591 Bacteria 1064
630 Ga0501076_0001232 3300049592 Bacteria 17028
631 Ga0501076_0024139 3300049592 Bacteria 4696
632 Ga0501076_0025706 3300049592 Bacteria 4558
633 Ga0501076_0068379 3300049592 Bacteria 2837
634 Ga0501076_0122237 3300049592 Bacteria 2108
635 Ga0501076_0492958 3300049592 Bacteria 1010
636 Ga0501076_1004261 3300049592 Bacteria 687
637 Ga0501076_1476041 3300049592 Unclassified 558
638 Ga0501076_1663545 3300049592 Bacteria 524
639 Ga0501077_0006362 3300049593 Bacteria 7240
640 Ga0501077_0012866 3300049593 Bacteria 5242
641 Ga0501077_0046988 3300049593 Bacteria 2742
642 Ga0501077_0134357 3300049593 Bacteria 1569
643 Ga0501077_0243906 3300049593 Bacteria 1142
644 Ga0501077_0249153 3300049593 Bacteria 1129
645 Ga0501077_0407936 3300049593 Bacteria 869
646 Ga0501077_0886528 3300049593 Unclassified 574
647 Ga0501077_0953227 3300049593 Bacteria 552
648 Ga0501217_294444 3300049661 Unclassified 534
649 Ga0501236_117173 3300049670 Unclassified 538
650 Ga0501079_0003420 3300049741 Bacteria 11659
651 Ga0501079_0042284 3300049741 Bacteria 3520
652 Ga0501079_0045376 3300049741 Bacteria 3391
653 Ga0501079_0177730 3300049741 Bacteria 1660
654 Ga0501079_0286254 3300049741 Bacteria 1288
655 Ga0501079_0407257 3300049741 Bacteria 1067
656 Ga0501079_0615776 3300049741 Bacteria 854
657 Ga0501079_0836757 3300049741 Bacteria 725
658 Ga0501079_1361964 3300049741 Unclassified 558
659 Ga0501080_0060630 3300049742 Bacteria 3522
660 Ga0501080_0258426 3300049742 Bacteria 1587
661 Ga0501080_0604649 3300049742 Bacteria 973
662 Ga0501080_1220589 3300049742 Bacteria 646
663 Ga0501081_0039352 3300049743 Bacteria 3235
664 Ga0501081_0046387 3300049743 Bacteria 2987
665 Ga0501081_0057487 3300049743 Bacteria 2689
666 Ga0501081_0081228 3300049743 Bacteria 2270
667 Ga0501081_0200368 3300049743 Bacteria 1447
668 Ga0501081_0231086 3300049743 Bacteria 1347
669 Ga0501081_0546539 3300049743 Bacteria 865
670 Ga0501081_0585812 3300049743 Bacteria 834
671 Ga0501081_0992657 3300049743 Bacteria 634
672 Ga0501083_0154916 3300049744 Bacteria 1500
673 Ga0501083_0753514 3300049744 Unclassified 633
674 Ga0501083_0953395 3300049744 Bacteria 558
675 Ga0501279_091471 3300049775 Unclassified 537
676 Ga0501035_0800635 3300049822 Bacteria 753
677 Ga0501035_0856041 3300049822 Unclassified 723
678 Ga0501035_1327039 3300049822 Bacteria 554
679 Ga0501045_0003045 3300049824 Bacteria 11466
680 Ga0501045_0033522 3300049824 Bacteria 3724
681 Ga0501045_0234545 3300049824 Bacteria 1366
682 Ga0501045_0244109 3300049824 Bacteria 1337
683 Ga0501045_0251262 3300049824 Bacteria 1316
684 Ga0501045_0694377 3300049824 Bacteria 751
685 Ga0501045_1265213 3300049824 Bacteria 537
686 nmdc:mga05p37_1338570_c1 3300050507 Bacteria 727
687 nmdc:mga05p37_1391951_c1 3300050507 Unclassified 707
688 nmdc:mga05p37_1456397_c1 3300050507 Unclassified 685
689 nmdc:mga05p37_152701_c1 3300050507 Bacteria 2823
690 nmdc:mga05p37_18338_c1 3300050507 Bacteria 8452
691 nmdc:mga05p37_1962776_c1 3300050507 Unclassified 556
692 nmdc:mga05p37_198756_c1 3300050507 Bacteria 2430
693 nmdc:mga05p37_2095_c1 3300050507 Bacteria 23279
694 nmdc:mga05p37_238248_c1 3300050507 Bacteria 2189
695 nmdc:mga05p37_247609_c1 3300050507 Bacteria 2139
696 nmdc:mga05p37_279_c1 3300050507 Bacteria 53447
697 nmdc:mga05p37_33739_c1 3300050507 Bacteria 6268
698 nmdc:mga05p37_446049_c1 3300050507 Bacteria 1499
699 nmdc:mga05p37_46008_c1 3300050507 Bacteria 5367
700 nmdc:mga05p37_5712_c1 3300050507 Bacteria 14632
701 nmdc:mga05p37_63490_c1 3300050507 Bacteria 4545
702 nmdc:mga05p37_651_c1 3300050507 Bacteria 38411
703 nmdc:mga05p37_693039_c1 3300050507 Bacteria 1133
704 nmdc:mga05p37_73813_c1 3300050507 Bacteria 4198
705 nmdc:mga05p37_743365_c1 3300050507 Unclassified 1082
706 nmdc:mga05p37_9679_c1 3300050507 Bacteria 11425
707 nmdc:mga09592_10628_c1 3300050508 Bacteria 7496
708 nmdc:mga09592_19053_c1 3300050508 Bacteria 5632
709 nmdc:mga09592_23811_c1 3300050508 Bacteria 5059
710 nmdc:mga09592_2619_c1 3300050508 Bacteria 14569
711 nmdc:mga09592_49968_c1 3300050508 Bacteria 3527
712 nmdc:mga09592_617119_c1 3300050508 Unclassified 928
713 nmdc:mga09592_677506_c1 3300050508 Bacteria 879
714 nmdc:mga09592_81961_c1 3300050508 Bacteria 2749
715 nmdc:mga09592_824106_c1 3300050508 Bacteria 784
716 nmdc:mga0qj67_104174_c1 3300050509 Bacteria 2289
717 nmdc:mga0qj67_1126971_c1 3300050509 Bacteria 612
718 nmdc:mga0qj67_1134693_c1 3300050509 Unclassified 610
719 nmdc:mga0qj67_1872_c1 3300050509 Bacteria 14922
720 nmdc:mga0qj67_319_c1 3300050509 Bacteria 33276
721 nmdc:mga0qj67_32464_c1 3300050509 Bacteria 4071
722 nmdc:mga0qj67_753991_c1 3300050509 Bacteria 772
723 nmdc:mga0qj67_96397_c1 3300050509 Bacteria 2381
724 nmdc:mga0qj67_988082_c1 3300050509 Bacteria 661
725 nmdc:mga06r32_1355701_c1 3300050510 Unclassified 654
726 nmdc:mga06r32_1588531_c1 3300050510 Unclassified 593
727 nmdc:mga06r32_16216_c1 3300050510 Bacteria 6786
728 nmdc:mga06r32_1755471_c1 3300050510 Bacteria 557
729 nmdc:mga06r32_1760_c1 3300050510 Bacteria 19429
730 nmdc:mga06r32_25082_c1 3300050510 Bacteria 5541
731 nmdc:mga06r32_2844_c1 3300050510 Bacteria 15537
732 nmdc:mga06r32_361846_c1 3300050510 Bacteria 1435
733 nmdc:mga06r32_368_c1 3300050510 Bacteria 37943
734 nmdc:mga06r32_39921_c1 3300050510 Bacteria 4455
735 nmdc:mga06r32_423955_c1 3300050510 Bacteria 1312
736 nmdc:mga06r32_438449_c1 3300050510 Bacteria 1286
737 nmdc:mga06r32_456924_c1 3300050510 Bacteria 1256
738 nmdc:mga06r32_50452_c1 3300050510 Bacteria 3980
739 nmdc:mga06r32_90204_c1 3300050510 Bacteria 2994
740 nmdc:mga06r32_97306_c1 3300050510 Bacteria 2883
741 nmdc:mga08y16_1477_c1 3300050511 Bacteria 23610
742 nmdc:mga08y16_176335_c1 3300050511 Bacteria 2220
743 nmdc:mga08y16_2091172_c1 3300050511 Unclassified 514
744 nmdc:mga08y16_34110_c1 3300050511 Bacteria 5346
745 nmdc:mga08y16_764465_c1 3300050511 Bacteria 961
746 nmdc:mga08y16_89111_c1 3300050511 Bacteria 3215
747 nmdc:mga0n895_1136390_c1 3300050512 Bacteria 757
748 nmdc:mga0n895_1217_c1 3300050512 Bacteria 19007
749 nmdc:mga0n895_1239498_c1 3300050512 Bacteria 719
750 nmdc:mga0n895_157486_c1 3300050512 Bacteria 2302
751 nmdc:mga0n895_18258_c1 3300050512 Bacteria 6486
752 nmdc:mga0n895_238609_c1 3300050512 Bacteria 1845
753 nmdc:mga0n895_2604_c1 3300050512 Bacteria 14184
754 nmdc:mga0n895_29404_c1 3300050512 Bacteria 5241
755 nmdc:mga0n895_311804_c1 3300050512 Unclassified 1594
756 nmdc:mga0n895_3798_c1 3300050512 Bacteria 4403
757 nmdc:mga0n895_431028_c1 3300050512 Bacteria 1332
758 nmdc:mga0n895_501723_c1 3300050512 Bacteria 1222
759 nmdc:mga0n895_541257_c1 3300050512 Bacteria 1171
760 nmdc:mga0n895_89931_c1 3300050512 Bacteria 3071
761 nmdc:mga0rr50_208893_c1 3300050513 Bacteria 1608
762 nmdc:mga0rr50_28441_c1 3300050513 Bacteria 3930
763 nmdc:mga0rr50_32355_c1 3300050513 Bacteria 3726
764 nmdc:mga0rr50_419646_c1 3300050513 Bacteria 1132
765 nmdc:mga0rr50_448349_c1 3300050513 Bacteria 1094
766 nmdc:mga0rr50_59144_c1 3300050513 Bacteria 2876
767 nmdc:mga0rr50_7363_c1 3300050513 Bacteria 6783
768 nmdc:mga0rr50_764950_c1 3300050513 Unclassified 824
769 nmdc:mga08x19_105862_c1 3300050514 Bacteria 1871
770 nmdc:mga08x19_137607_c1 3300050514 Bacteria 1647
771 nmdc:mga08x19_145265_c1 3300050514 Bacteria 1604
772 nmdc:mga08x19_32401_c1 3300050514 Bacteria 3293
773 nmdc:mga08x19_464272_c1 3300050514 Bacteria 892
774 nmdc:mga08x19_4848_c1 3300050514 Bacteria 7957
775 nmdc:mga0a205_113621_c1 3300050515 Bacteria 2607
776 nmdc:mga0a205_1333_c1 3300050515 Bacteria 20823
777 nmdc:mga0a205_2148_c1 3300050515 Bacteria 17315
778 nmdc:mga0a205_28352_c1 3300050515 Bacteria 5354
779 nmdc:mga0a205_3266_c1 3300050515 Bacteria 14421
780 nmdc:mga0a205_362960_c1 3300050515 Bacteria 1315
781 nmdc:mga0a205_388453_c1 3300050515 Unclassified 1260
782 nmdc:mga0a205_44802_c1 3300050515 Bacteria 4266
783 nmdc:mga0a205_481762_c2 3300050515 Bacteria 751
784 nmdc:mga0a205_54566_c1 3300050515 Bacteria 3859
785 nmdc:mga0a205_609997_c1 3300050515 Bacteria 944
786 nmdc:mga0a205_70371_c1 3300050515 Bacteria 3378
787 Ga0501084_0005790 3300054114 Bacteria 10166
788 Ga0501084_0051706 3300054114 Bacteria 3439
789 Ga0501084_0054940 3300054114 Bacteria 3331
790 Ga0501084_0056830 3300054114 Bacteria 3274
791 Ga0501084_0157628 3300054114 Bacteria 1915
792 Ga0501084_0162821 3300054114 Bacteria 1882
793 Ga0501084_0191222 3300054114 Bacteria 1727
794 Ga0501084_0482346 3300054114 Bacteria 1048
795 Ga0501084_0818923 3300054114 Bacteria 784
796 Ga0501084_1762290 3300054114 Bacteria 517
797 Ga0590074_043477 3300059423 Bacteria 812
798 Ga0590075_203071 3300059424 Bacteria 525
799 Ga0590077_028694 3300059426 Bacteria 1210
800 Ga0501082_0018864 3300060353 Bacteria 5942
801 Ga0501082_0111480 3300060353 Bacteria 2368
802 Ga0501082_0163514 3300060353 Bacteria 1934
803 Ga0501082_0170592 3300060353 Bacteria 1891
804 Ga0501082_0221213 3300060353 Bacteria 1647
805 Ga0501082_1174139 3300060353 Unclassified 671
806 Ga0501082_1294896 3300060353 Bacteria 637
807 Ga0501082_1704690 3300060353 Unclassified 550
808 Ga0530510_0004597 3300061734 Bacteria 9543
809 Ga0530510_0014625 3300061734 Bacteria 5539
810 Ga0530510_0023322 3300061734 Bacteria 4409
811 Ga0530510_0033757 3300061734 Bacteria 3684
812 Ga0530510_0055728 3300061734 Bacteria 2856
813 Ga0530510_0302127 3300061734 Bacteria 1198
814 Ga0530510_0349801 3300061734 Bacteria 1110
815 Ga0530510_0534681 3300061734 Unclassified 890
816 Ga0530510_0548138 3300061734 Bacteria 878
817 Ga0530510_0690657 3300061734 Bacteria 777
818 Ga0530510_0978421 3300061734 Bacteria 647
819 Ga0530510_1046704 3300061734 Unclassified 625
820 Ga0530510_1099613 3300061734 Bacteria 609
821 Ga0070689_100184626
822 Ga0065707_10681769
823 Ga0070676_10135040
824 Ga0070690_100817707
825 Ga0070670_101451752
826 Ga0068869_100980097
827 Ga0068869_101555325
828 Ga0070680_100017467
829 Ga0070689_100117494
830 Ga0070692_11026173
831 Ga0070692_11270497
832 Ga0070668_100532702
833 Ga0070669_100017271
834 Ga0070669_100375236
835 Ga0070674_100137404
836 Ga0070659_100305219
837 Ga0070667_100365045
838 Ga0070714_100464447
839 Ga0070713_100011214
840 Ga0070701_10300346
841 Ga0070711_101395774
842 Ga0070700_100926424
843 Ga0070694_100116874
844 Ga0070694_100137757
845 Ga0070694_101219326
846 Ga0070694_101731340
847 Ga0070708_100004263
848 Ga0070708_100007769
849 Ga0070708_100049610
850 Ga0070708_100928943
851 Ga0070708_101945735
852 Ga0070662_100090563
853 Ga0070681_10039404
854 Ga0068867_100446653
855 Ga0068867_101385058
856 Ga0070706_100020274
857 Ga0070706_100021306
858 Ga0070706_100052650
859 Ga0070706_100095676
860 Ga0070706_100350854
861 Ga0070706_100377210
862 Ga0070706_100663697
863 Ga0070706_100864364
864 Ga0070707_100007068
865 Ga0070707_100025806
866 Ga0070707_100142937
867 Ga0070707_100211423
868 Ga0070707_100878942
869 Ga0070707_101177556
870 Ga0070707_101840923
871 Ga0070698_100036902
872 Ga0070698_100461999
873 Ga0070699_100001522
874 Ga0070699_100002189
875 Ga0070699_100084305
876 Ga0070699_100172303
877 Ga0070699_100204194
878 Ga0070699_100404762
879 Ga0070699_100573495
880 Ga0070699_100755051
881 Ga0070699_100786365
882 Ga0070699_100799805
883 Ga0070699_101973268
884 Ga0070679_100069507
885 Ga0070679_101035259
886 Ga0070697_100036525
887 Ga0070697_100208429
888 Ga0070697_100216303
889 Ga0070697_100246906
890 Ga0070697_100597529
891 Ga0070697_100893538
892 Ga0070697_101416686
893 Ga0070672_100008144
894 Ga0070686_100394970
895 Ga0070686_101869608
896 Ga0070695_100081385
897 Ga0070695_100092712
898 Ga0070696_100031380
899 Ga0070696_100059419
900 Ga0070696_100436652
901 Ga0070696_100539739
902 Ga0070696_101228288
903 Ga0070693_100467690
904 Ga0070704_100002007
905 Ga0070704_100004548
906 Ga0070704_100193720
907 Ga0070704_100401514
908 Ga0068857_100390097
909 Ga0068856_100578712
910 Ga0068856_100856045
911 Ga0070702_101003837
912 Ga0068852_102450518
913 Ga0068859_100195322
914 Ga0068859_100340856
915 Ga0068866_10061437
916 Ga0068866_10578597
917 Ga0068861_100119499
918 Ga0068861_100600851
919 Ga0068861_102340812
920 Ga0068863_102576952
921 Ga0068858_101744556
922 Ga0068860_100024034
923 Ga0068860_100440010
924 Ga0068860_100520173
925 Ga0068860_100762183
926 Ga0068862_100554390
927 Ga0068862_100903882
928 Ga0068862_101226687
929 Ga0068862_101915375
930 Ga0081538_10215659
931 Ga0070717_10691060
932 Ga0075432_10295596
933 Ga0070716_100401954
934 Ga0068871_100496186
935 Ga0075428_100000123
936 Ga0075428_100001197
937 Ga0075428_100002086
938 Ga0075428_100051940
939 Ga0075428_100072140
940 Ga0075428_100166522
941 Ga0075428_100208139
942 Ga0075428_100307484
943 Ga0075428_100800377
944 Ga0075430_100001228
945 Ga0075430_100011349
946 Ga0075430_100013054
947 Ga0075430_100019223
948 Ga0075430_100035815
949 Ga0075430_100287605
950 Ga0075430_100638747
951 Ga0075430_101733449
952 Ga0075431_100001438
953 Ga0075431_100001903
954 Ga0075431_100003721
955 Ga0075431_100004913
956 Ga0075431_100012924
957 Ga0075431_100024018
958 Ga0075431_100084312
959 Ga0075431_100090800
960 Ga0075431_100090975
961 Ga0075431_100115243
962 Ga0075431_100351869
963 Ga0075431_100490658
964 Ga0075431_100559969
965 Ga0075431_100869040
966 Ga0075431_101925817
967 Ga0075433_10005655
968 Ga0075433_10016755
969 Ga0075433_10019360
970 Ga0075433_10045505
971 Ga0075433_10050209
972 Ga0075433_10119850
973 Ga0075433_10218416
974 Ga0075433_10328464
975 Ga0075433_10549876
976 Ga0075433_11457890
977 Ga0075433_11462252
978 Ga0075433_11616747
979 Ga0075434_100015025
980 Ga0075434_100061268
981 Ga0075434_100129495
982 Ga0075434_100138977
983 Ga0075434_100139183
984 Ga0075434_100143695
985 Ga0075434_100424661
986 Ga0075434_100537410
987 Ga0075434_100701534
988 Ga0075434_100847694
989 Ga0075434_101488620
990 Ga0075429_100005499
991 Ga0075429_100006893
992 Ga0075429_100021371
993 Ga0075429_100044716
994 Ga0075429_100051758
995 Ga0075429_100150478
996 Ga0075429_100158220
997 Ga0075429_100192883
998 Ga0075429_100493633
999 Ga0075429_101009042
1000 Ga0068865_100087806
1001 Ga0068865_100607623
1002 Ga0068865_100899691
1003 Ga0068865_101027249
1004 Ga0075436_100002807
1005 Ga0075436_100042287
1006 Ga0075436_100093051
1007 Ga0075436_100118880
1008 Ga0075436_100149403
1009 Ga0075436_100500719
1010 Ga0075436_100841319
1011 Ga0097620_100195329
1012 Ga0097620_100340856
1013 Ga0075435_100028177
1014 Ga0075435_100044539
1015 Ga0075435_100047863
1016 Ga0075435_100063351
1017 Ga0075435_100080077
1018 Ga0075435_100211499
1019 Ga0075435_100354112
1020 Ga0075435_100408943
1021 Ga0075435_100494881
1022 Ga0075435_101120088
1023 Ga0099794_10065172
1024 Ga0099794_10344965
1025 Ga0099794_10491733
1026 Ga0099794_10766377
1027 Ga0099795_10145827
1028 Ga0105240_10024064
1029 Ga0105240_10102889
1030 Ga0111539_10002302
1031 Ga0111539_10003984
1032 Ga0111539_10033344
1033 Ga0111539_10500982
1034 Ga0111539_10515617
1035 Ga0111539_12517011
1036 Ga0105245_10024210
1037 Ga0105247_10274031
1038 Ga0114129_10000003
1039 Ga0114129_10002359
1040 Ga0114129_10002470
1041 Ga0114129_10002850
1042 Ga0114129_10014253
1043 Ga0114129_10015694
1044 Ga0114129_10033250
1045 Ga0114129_10035676
1046 Ga0114129_10055681
1047 Ga0114129_10060203
1048 Ga0114129_10071461
1049 Ga0114129_10092162
1050 Ga0114129_10146496
1051 Ga0114129_10162237
1052 Ga0114129_10422979
1053 Ga0114129_10670089
1054 Ga0114129_10701543
1055 Ga0114129_10724346
1056 Ga0114129_11046980
1057 Ga0114129_11664063
1058 Ga0105243_10526396
1059 Ga0105243_10944222
1060 Ga0105241_10050822
1061 Ga0105242_10316283
1062 Ga0105242_10347238
1063 Ga0105237_10141340
1064 Ga0105249_10234215
1065 Ga0105249_10442470
1066 Ga0105249_11033492
1067 Ga0105249_11497830
1068 Ga0099796_10034042
1069 Ga0099796_10367945
1070 Ga0105239_11151531
1071 Ga0157370_11580519
1072 Ga0157374_11498513
1073 Ga0157378_10044374
1074 Ga0157378_10060245
1075 Ga0157378_10078719
1076 Ga0157378_12257565
1077 Ga0157378_13063462
1078 Ga0163162_10328837
1079 Ga0163162_11427284
1080 Ga0163162_12682287
1081 Ga0157375_10973278
1082 Ga0163163_10892092
1083 Ga0157380_10408402
1084 Ga0157380_10860021
1085 Ga0157380_13530307
1086 Ga0157379_10642787
1087 Ga0224572_1054713
1088 Ga0228598_1005373
1089 Ga0207642_10118375
1090 Ga0207642_10155664
1091 Ga0207710_10775202
1092 Ga0207688_10135518
1093 Ga0207699_10121544
1094 Ga0207684_10009034
1095 Ga0207684_10153332
1096 Ga0207684_10256445
1097 Ga0207684_10303833
1098 Ga0207684_10334556
1099 Ga0207654_10067803
1100 Ga0207707_10027215
1101 Ga0207695_10168290
1102 Ga0207660_10048915
1103 Ga0207660_10141458
1104 Ga0207660_10287772
1105 Ga0207662_10406863
1106 Ga0207662_10451245
1107 Ga0207652_10130659
1108 Ga0207646_10011308
1109 Ga0207646_10022728
1110 Ga0207646_10055168
1111 Ga0207646_10081442
1112 Ga0207646_10267204
1113 Ga0207681_10021776
1114 Ga0207681_10027765
1115 Ga0207681_10292188
1116 Ga0207687_10243682
1117 Ga0207700_10032487
1118 Ga0207690_10319030
1119 Ga0207686_10098744
1120 Ga0207686_10222786
1121 Ga0207709_10344513
1122 Ga0207670_10420760
1123 Ga0207669_11801545
1124 Ga0207704_10182989
1125 Ga0207704_10516598
1126 Ga0207704_10672949
1127 Ga0207665_10288397
1128 Ga0207691_10015570
1129 Ga0207689_10563927
1130 Ga0207651_11572922
1131 Ga0207712_10645463
1132 Ga0207712_11470683
1133 Ga0207668_10182901
1134 Ga0207668_10431857
1135 Ga0207658_11199591
1136 Ga0207677_12146550
1137 Ga0207703_11876045
1138 Ga0207708_10383511
1139 Ga0207702_10650753
1140 Ga0207648_11138602
1141 Ga0207674_10839305
1142 Ga0207675_100085919
1143 Ga0207675_100099572
1144 Ga0207675_100684922
1145 Ga0209588_1032281
1146 Ga0209588_1074830
1147 Ga0209998_10028112
1148 Ga0209974_10062681
1149 Ga0207428_10000035
1150 Ga0207428_10023017
1151 Ga0207428_10024316
1152 Ga0268265_10117053
1153 Ga0268265_10350575
1154 Ga0268265_10578153
1155 Ga0268265_10786597
1156 Ga0268264_10034176
1157 Ga0268264_10295382
1158 Ga0268264_10446707
1159 Ga0268264_10650877
1160 Ga0268264_10889732
1161 Ga0265325_10011967
1162 Ga0265331_10005789
1163 Ga0265316_10001389
1164 Ga0265316_10211557
1165 Ga0307408_100033652
1166 Ga0307408_100075552
1167 Ga0307408_100146517
1168 Ga0307408_101029096
1169 Ga0265313_10052522
1170 Ga0265313_10146951
1171 Ga0307405_10219385
1172 Ga0307405_10331588
1173 Ga0307413_10618593
1174 Ga0307410_10279549
1175 Ga0307410_10633286
1176 Ga0307407_10553041
1177 Ga0307412_10008480
1178 Ga0307412_11199772
1179 Ga0307412_12162793
1180 Ga0307409_100131933
1181 Ga0307409_100297684
1182 Ga0307409_100666830
1183 Ga0307409_101984560
1184 Ga0307409_102938356
1185 Ga0307416_100151050
1186 Ga0307416_102300024
1187 Ga0307411_10199533
1188 Ga0307411_10394518
1189 Ga0307411_10759711
1190 Ga0373930_0190286
1191 Ga0373948_0143949
1192 Ga0373959_0207302
1193 Ga0373929_0119500
1194 Ga0373934_0158092
1195 Ga0373940_0003491
1196 Ga0373940_0004640
1197 Ga0373940_0342530
1198 Ga0373949_0094568
1199 Ga0373951_0136205
1200 Ga0373952_0178011
1201 Ga0373923_0480491
1202 Ga0373932_0007393
1203 Ga0373932_0078580
1204 Ga0373932_0367390
1205 Ga0373939_0023274
1206 Ga0373941_0027022
1207 Ga0373953_0244752
1208 Ga0373954_0140827
1209 Ga0373954_0230652
1210 Ga0373960_0063956
1211 Ga0373943_0502396
1212 Ga0373955_0137276
1213 Ga0373955_0426563
1214 Ga0373942_0320557
1215 Ga0373962_0016851
1216 Ga0373962_0342909
1217 Ga0373931_0005637
1218 Ga0373931_0475134
1219 Ga0373931_0781480
1220 Ga0373935_0044416
1221 Ga0373927_0014322
1222 Ga0373947_0002800
1223 Ga0373937_0148483
1224 Ga0372808_064489
1225 Ga0373925_0267676
1226 Ga0395899_0286326
1227 Ga0395900_0064583
1228 Ga0395900_1458410
1229 Ga0395898_0110921
1230 Ga0395901_0011071
1231 Ga0395901_1637969
1232 Ga0242419_025698
1233 Ga0242420_018598
1234 Ga0242420_020221
1235 Ga0439439_0248246
1236 Ga0439434_0107791
1237 Ga0439435_0021627
1238 Ga0439444_0058061
1239 Ga0451577_0160370
1240 Ga0453683_1116797
1241 Ga0453684_1120024
1242 Ga0451576_0295192
1243 Ga0451576_0348544
1244 Ga0451576_0911232
1245 Ga0451576_1200086
1246 Ga0451576_2579930
1247 Ga0495592_0013644
1248 Ga0495592_0095278
1249 Ga0495592_0377124
1250 Ga0495603_0068926
1251 Ga0495651_0046609
1252 Ga0495651_0101707
1253 Ga0495653_0003848
1254 Ga0495580_0003744
1255 Ga0495580_0007726
1256 Ga0495580_0208306
1257 Ga0495582_0121508
1258 Ga0495582_0422474
1259 Ga0495664_0029906
1260 Ga0495664_0633294
1261 Ga0495585_0405672
1262 Ga0495594_0035236
1263 Ga0495594_0183668
1264 Ga0495608_0004290
1265 Ga0495608_0029128
1266 Ga0495608_0833993
1267 Ga0495618_0014299
1268 Ga0495628_0007050
1269 Ga0495628_0017739
1270 Ga0495628_0027714
1271 Ga0495628_0163807
1272 Ga0495630_0001259
1273 Ga0495630_0020601
1274 Ga0495630_0086413
1275 Ga0495630_0227565
1276 Ga0495630_0567298
1277 Ga0495666_0019141
1278 Ga0495642_0033101
1279 Ga0495642_0109868
1280 Ga0495652_0004476
1281 Ga0495652_0746580
1282 Ga0495665_0024520
1283 Ga0495640_0193641
1284 Ga0495640_0478951
1285 Ga0495586_0017171
1286 Ga0495586_0040695
1287 Ga0495587_0097886
1288 Ga0495587_0098115
1289 Ga0495621_0225540
1290 Ga0495645_0187263
1291 Ga0495667_0029378
1292 Ga0495667_0047913
1293 Ga0495667_0123131
1294 Ga0495667_0667241
1295 Ga0495656_0136226
1296 Ga0495634_0041610
1297 Ga0495634_0447827
1298 Ga0495635_0063950
1299 Ga0495635_0089101
1300 Ga0495659_0056985
1301 Ga0495659_0071501
1302 Ga0495659_0151635
1303 Ga0495657_0042741
1304 Ga0495657_0086520
1305 Ga0495599_0001234
1306 Ga0495623_0044812
1307 Ga0495623_0067710
1308 Ga0495623_0488212
1309 Ga0495646_0004591
1310 Ga0495646_0047430
1311 Ga0495646_0247018
1312 Ga0495658_0651871
1313 Ga0495669_0034949
1314 Ga0495669_0132272
1315 Ga0495669_0524457
1316 Ga0495613_0013685
1317 Ga0495613_0216338
1318 Ga0495613_0475836
1319 Ga0495624_0012771
1320 Ga0495624_0292442
1321 Ga0495670_0392163
1322 Ga0495600_0003524
1323 Ga0495600_0720389
1324 Ga0495581_0410513
1325 Ga0495604_0013351
1326 Ga0495604_0090436
1327 Ga0495604_0187256
1328 Ga0495604_0277719
1329 Ga0495636_0319469
1330 Ga0495636_0373887
1331 Ga0495674_0001602
1332 Ga0495674_0011291
1333 Ga0495674_0035458
1334 Ga0495674_0040276
1335 Ga0495674_0189975
1336 Ga0495674_0248819
1337 Ga0495680_0038866
1338 Ga0495680_0087320
1339 Ga0495680_0940321
1340 Ga0495675_0006096
1341 Ga0495675_0007762
1342 Ga0495675_0027407
1343 Ga0495675_0073138
1344 Ga0495684_0000714
1345 Ga0495684_0017728
1346 Ga0495684_0686246
1347 Ga0495593_0010520
1348 Ga0495602_0223239
1349 Ga0495602_0362823
1350 Ga0495602_0441808
1351 Ga0496100_0922564
1352 Ga0496102_0006841
1353 Ga0496102_1492697
1354 Ga0496103_0231614
1355 Ga0496106_0069956
1356 Ga0496108_0520319
1357 Ga0496110_1003607
1358 Ga0496112_0235589
1359 Ga0501290_097143
1360 Ga0501298_049971
1361 Ga0501299_092334
1362 Ga0501032_0659411
1363 Ga0501033_0030594
1364 Ga0501033_0259389
1365 Ga0501033_0936374
1366 Ga0501033_1188434
1367 Ga0501036_0080872
1368 Ga0501036_0190261
1369 Ga0501036_0323085
1370 Ga0501036_1556139
1371 Ga0501037_0198465
1372 Ga0501037_0880598
1373 Ga0501037_1143264
1374 Ga0501038_0088100
1375 Ga0501038_1068113
1376 Ga0501039_0077603
1377 Ga0501039_0308346
1378 Ga0501039_0315816
1379 Ga0501039_0537350
1380 Ga0501039_1112333
1381 Ga0501039_1553003
1382 Ga0501040_0004861
1383 Ga0501040_0086871
1384 Ga0501040_0090000
1385 Ga0501040_0092780
1386 Ga0501040_0114627
1387 Ga0501040_0115160
1388 Ga0501040_0126039
1389 Ga0501040_0497787
1390 Ga0501040_0746581
1391 Ga0501041_0025930
1392 Ga0501041_0028297
1393 Ga0501041_0105036
1394 Ga0501041_0162731
1395 Ga0501041_0196928
1396 Ga0501041_0709075
1397 Ga0501042_0050588
1398 Ga0501042_0105300
1399 Ga0501042_0233791
1400 Ga0501042_0260786
1401 Ga0501043_0763377
1402 Ga0501046_0079975
1403 Ga0501046_0086128
1404 Ga0501046_1092136
1405 Ga0501048_0174119
1406 Ga0501048_0231523
1407 Ga0501048_0441989
1408 Ga0501048_0739507
1409 Ga0501048_0796044
1410 Ga0501067_0006353
1411 Ga0501067_0742301
1412 Ga0501068_0028137
1413 Ga0501068_0093224
1414 Ga0501068_0183999
1415 Ga0501068_0242547
1416 Ga0501068_0880290
1417 Ga0501069_0013985
1418 Ga0501070_0386708
1419 Ga0501070_0690150
1420 Ga0501070_0752737
1421 Ga0501071_0038809
1422 Ga0501071_0050132
1423 Ga0501071_1359789
1424 Ga0501071_1364363
1425 Ga0501072_0006598
1426 Ga0501072_0018113
1427 Ga0501072_0045333
1428 Ga0501072_0111337
1429 Ga0501072_0130021
1430 Ga0501072_0215303
1431 Ga0501072_0330844
1432 Ga0501072_0357959
1433 Ga0501072_0455450
1434 Ga0501073_0248493
1435 Ga0501073_0458766
1436 Ga0501074_0027524
1437 Ga0501074_0237345
1438 Ga0501074_0267808
1439 Ga0501074_0417640
1440 Ga0501074_0858024
1441 Ga0501075_0004262
1442 Ga0501075_0007908
1443 Ga0501075_0093094
1444 Ga0501075_0095869
1445 Ga0501075_0098922
1446 Ga0501075_0242698
1447 Ga0501075_0316186
1448 Ga0501075_0335162
1449 Ga0501075_0388083
1450 Ga0501076_0001232
1451 Ga0501076_0024139
1452 Ga0501076_0025706
1453 Ga0501076_0068379
1454 Ga0501076_0122237
1455 Ga0501076_0492958
1456 Ga0501076_1004261
1457 Ga0501076_1476041
1458 Ga0501076_1663545
1459 Ga0501077_0006362
1460 Ga0501077_0012866
1461 Ga0501077_0046988
1462 Ga0501077_0134357
1463 Ga0501077_0243906
1464 Ga0501077_0249153
1465 Ga0501077_0407936
1466 Ga0501077_0886528
1467 Ga0501077_0953227
1468 Ga0501217_294444
1469 Ga0501236_117173
1470 Ga0501079_0003420
1471 Ga0501079_0042284
1472 Ga0501079_0045376
1473 Ga0501079_0177730
1474 Ga0501079_0286254
1475 Ga0501079_0407257
1476 Ga0501079_0615776
1477 Ga0501079_0836757
1478 Ga0501079_1361964
1479 Ga0501080_0060630
1480 Ga0501080_0258426
1481 Ga0501080_0604649
1482 Ga0501080_1220589
1483 Ga0501081_0039352
1484 Ga0501081_0046387
1485 Ga0501081_0057487
1486 Ga0501081_0081228
1487 Ga0501081_0200368
1488 Ga0501081_0231086
1489 Ga0501081_0546539
1490 Ga0501081_0585812
1491 Ga0501081_0992657
1492 Ga0501083_0154916
1493 Ga0501083_0753514
1494 Ga0501083_0953395
1495 Ga0501279_091471
1496 Ga0501035_0800635
1497 Ga0501035_0856041
1498 Ga0501035_1327039
1499 Ga0501045_0003045
1500 Ga0501045_0033522
1501 Ga0501045_0234545
1502 Ga0501045_0244109
1503 Ga0501045_0251262
1504 Ga0501045_0694377
1505 Ga0501045_1265213
1506 nmdc:mga05p37_1338570_c1
1507 nmdc:mga05p37_1391951_c1
1508 nmdc:mga05p37_1456397_c1
1509 nmdc:mga05p37_152701_c1
1510 nmdc:mga05p37_18338_c1
1511 nmdc:mga05p37_1962776_c1
1512 nmdc:mga05p37_198756_c1
1513 nmdc:mga05p37_2095_c1
1514 nmdc:mga05p37_238248_c1
1515 nmdc:mga05p37_247609_c1
1516 nmdc:mga05p37_279_c1
1517 nmdc:mga05p37_33739_c1
1518 nmdc:mga05p37_446049_c1
1519 nmdc:mga05p37_46008_c1
1520 nmdc:mga05p37_5712_c1
1521 nmdc:mga05p37_63490_c1
1522 nmdc:mga05p37_651_c1
1523 nmdc:mga05p37_693039_c1
1524 nmdc:mga05p37_73813_c1
1525 nmdc:mga05p37_743365_c1
1526 nmdc:mga05p37_9679_c1
1527 nmdc:mga09592_10628_c1
1528 nmdc:mga09592_19053_c1
1529 nmdc:mga09592_23811_c1
1530 nmdc:mga09592_2619_c1
1531 nmdc:mga09592_49968_c1
1532 nmdc:mga09592_617119_c1
1533 nmdc:mga09592_677506_c1
1534 nmdc:mga09592_81961_c1
1535 nmdc:mga09592_824106_c1
1536 nmdc:mga0qj67_104174_c1
1537 nmdc:mga0qj67_1126971_c1
1538 nmdc:mga0qj67_1134693_c1
1539 nmdc:mga0qj67_1872_c1
1540 nmdc:mga0qj67_319_c1
1541 nmdc:mga0qj67_32464_c1
1542 nmdc:mga0qj67_753991_c1
1543 nmdc:mga0qj67_96397_c1
1544 nmdc:mga0qj67_988082_c1
1545 nmdc:mga06r32_1355701_c1
1546 nmdc:mga06r32_1588531_c1
1547 nmdc:mga06r32_16216_c1
1548 nmdc:mga06r32_1755471_c1
1549 nmdc:mga06r32_1760_c1
1550 nmdc:mga06r32_25082_c1
1551 nmdc:mga06r32_2844_c1
1552 nmdc:mga06r32_361846_c1
1553 nmdc:mga06r32_368_c1
1554 nmdc:mga06r32_39921_c1
1555 nmdc:mga06r32_423955_c1
1556 nmdc:mga06r32_438449_c1
1557 nmdc:mga06r32_456924_c1
1558 nmdc:mga06r32_50452_c1
1559 nmdc:mga06r32_90204_c1
1560 nmdc:mga06r32_97306_c1
1561 nmdc:mga08y16_1477_c1
1562 nmdc:mga08y16_176335_c1
1563 nmdc:mga08y16_2091172_c1
1564 nmdc:mga08y16_34110_c1
1565 nmdc:mga08y16_764465_c1
1566 nmdc:mga08y16_89111_c1
1567 nmdc:mga0n895_1136390_c1
1568 nmdc:mga0n895_1217_c1
1569 nmdc:mga0n895_1239498_c1
1570 nmdc:mga0n895_157486_c1
1571 nmdc:mga0n895_18258_c1
1572 nmdc:mga0n895_238609_c1
1573 nmdc:mga0n895_2604_c1
1574 nmdc:mga0n895_29404_c1
1575 nmdc:mga0n895_311804_c1
1576 nmdc:mga0n895_3798_c1
1577 nmdc:mga0n895_431028_c1
1578 nmdc:mga0n895_501723_c1
1579 nmdc:mga0n895_541257_c1
1580 nmdc:mga0n895_89931_c1
1581 nmdc:mga0rr50_208893_c1
1582 nmdc:mga0rr50_28441_c1
1583 nmdc:mga0rr50_32355_c1
1584 nmdc:mga0rr50_419646_c1
1585 nmdc:mga0rr50_448349_c1
1586 nmdc:mga0rr50_59144_c1
1587 nmdc:mga0rr50_7363_c1
1588 nmdc:mga0rr50_764950_c1
1589 nmdc:mga08x19_105862_c1
1590 nmdc:mga08x19_137607_c1
1591 nmdc:mga08x19_145265_c1
1592 nmdc:mga08x19_32401_c1
1593 nmdc:mga08x19_464272_c1
1594 nmdc:mga08x19_4848_c1
1595 nmdc:mga0a205_113621_c1
1596 nmdc:mga0a205_1333_c1
1597 nmdc:mga0a205_2148_c1
1598 nmdc:mga0a205_28352_c1
1599 nmdc:mga0a205_3266_c1
1600 nmdc:mga0a205_362960_c1
1601 nmdc:mga0a205_388453_c1
1602 nmdc:mga0a205_44802_c1
1603 nmdc:mga0a205_481762_c2
1604 nmdc:mga0a205_54566_c1
1605 nmdc:mga0a205_609997_c1
1606 nmdc:mga0a205_70371_c1
1607 Ga0501084_0005790
1608 Ga0501084_0051706
1609 Ga0501084_0054940
1610 Ga0501084_0056830
1611 Ga0501084_0157628
1612 Ga0501084_0162821
1613 Ga0501084_0191222
1614 Ga0501084_0482346
1615 Ga0501084_0818923
1616 Ga0501084_1762290
1617 Ga0590074_043477
1618 Ga0590075_203071
1619 Ga0590077_028694
1620 Ga0501082_0018864
1621 Ga0501082_0111480
1622 Ga0501082_0163514
1623 Ga0501082_0170592
1624 Ga0501082_0221213
1625 Ga0501082_1174139
1626 Ga0501082_1294896
1627 Ga0501082_1704690
1628 Ga0530510_0004597
1629 Ga0530510_0014625
1630 Ga0530510_0023322
1631 Ga0530510_0033757
1632 Ga0530510_0055728
1633 Ga0530510_0302127
1634 Ga0530510_0349801
1635 Ga0530510_0534681
1636 Ga0530510_0548138
1637 Ga0530510_0690657
1638 Ga0530510_0978421
1639 Ga0530510_1046704
1640 Ga0530510_1099613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map