F482175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 351 | 815 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10081447|Ga0316576_100814471 |
| Length | 167 |
| Sequence | VPWGGVVGAWGRLRCMRALIQRVASASVRESGSGDLLGSIDAGVVALVGATHDDDEAKASRLASKLWNLRIFEDSDGAMNRSLAERSEQGESAGVLVVSQFTLYADTRKGRRPSFVPAARPEHAEPLVEAFVSALTALGAQVQTGRFRTDMAVSLVNDGPVTLMLEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 2 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 3 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 4 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 133 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 135 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 139 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 140 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 141 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 142 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 155 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 162 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 169 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 170 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 191 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 192 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 197 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 198 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 199 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 200 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 201 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 204 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 205 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 206 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 207 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 208 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 209 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 210 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 211 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 212 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 213 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 214 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 215 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 216 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 217 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 218 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 219 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 220 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 221 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 326 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 351 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 0.61 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 95.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10124853 | 3300001979 | Bacteria | 644 |
| 2 | JGI25406J46586_10029781 | 3300003203 | Bacteria | 2061 |
| 3 | JGI25406J46586_10046635 | 3300003203 | Bacteria | 1483 |
| 4 | rootH2_10141641 | 3300003320 | Bacteria | 2304 |
| 5 | Ga0065715_10481139 | 3300005293 | Unclassified | 797 |
| 6 | Ga0070658_10349104 | 3300005327 | Bacteria | 1266 |
| 7 | Ga0070683_100042967 | 3300005329 | Bacteria | 4164 |
| 8 | Ga0070683_100896515 | 3300005329 | Bacteria | 851 |
| 9 | Ga0070690_100114157 | 3300005330 | Bacteria | 1806 |
| 10 | Ga0068869_101981643 | 3300005334 | Bacteria | 522 |
| 11 | Ga0070680_100034038 | 3300005336 | Bacteria | 4108 |
| 12 | Ga0070680_100930835 | 3300005336 | Unclassified | 750 |
| 13 | Ga0070680_101451868 | 3300005336 | Bacteria | 594 |
| 14 | Ga0070682_100275204 | 3300005337 | Bacteria | 1225 |
| 15 | Ga0070682_100574345 | 3300005337 | Bacteria | 886 |
| 16 | Ga0070682_101127942 | 3300005337 | Bacteria | 658 |
| 17 | Ga0070682_101471162 | 3300005337 | Bacteria | 585 |
| 18 | Ga0070660_101112209 | 3300005339 | Bacteria | 669 |
| 19 | Ga0070660_101851610 | 3300005339 | Bacteria | 514 |
| 20 | Ga0070691_10640899 | 3300005341 | Bacteria | 632 |
| 21 | Ga0070661_100132789 | 3300005344 | Bacteria | 1871 |
| 22 | Ga0070692_10076856 | 3300005345 | Bacteria | 1790 |
| 23 | Ga0070668_100544746 | 3300005347 | Bacteria | 1009 |
| 24 | Ga0070675_101632480 | 3300005354 | Bacteria | 595 |
| 25 | Ga0070671_100200029 | 3300005355 | Bacteria | 1694 |
| 26 | Ga0070688_100869797 | 3300005365 | Bacteria | 709 |
| 27 | Ga0070688_101250772 | 3300005365 | Bacteria | 598 |
| 28 | Ga0070659_100269620 | 3300005366 | Bacteria | 1414 |
| 29 | Ga0070667_100991429 | 3300005367 | Bacteria | 784 |
| 30 | Ga0070709_10000243 | 3300005434 | Bacteria | 35120 |
| 31 | Ga0070709_10241624 | 3300005434 | Bacteria | 1297 |
| 32 | Ga0070714_100002623 | 3300005435 | Bacteria | 13242 |
| 33 | Ga0070714_100006186 | 3300005435 | Bacteria | 9204 |
| 34 | Ga0070714_100026307 | 3300005435 | Bacteria | 4808 |
| 35 | Ga0070714_100039755 | 3300005435 | Bacteria | 3961 |
| 36 | Ga0070714_100579121 | 3300005435 | Bacteria | 1076 |
| 37 | Ga0070714_100987465 | 3300005435 | Bacteria | 819 |
| 38 | Ga0070714_101562135 | 3300005435 | Bacteria | 644 |
| 39 | Ga0070713_100023116 | 3300005436 | Bacteria | 4817 |
| 40 | Ga0070713_100069794 | 3300005436 | Bacteria | 2964 |
| 41 | Ga0070713_100124001 | 3300005436 | Bacteria | 2269 |
| 42 | Ga0070713_100507849 | 3300005436 | Bacteria | 1138 |
| 43 | Ga0070713_101678389 | 3300005436 | Bacteria | 617 |
| 44 | Ga0070710_10647177 | 3300005437 | Bacteria | 740 |
| 45 | Ga0070711_100005834 | 3300005439 | Bacteria | 7392 |
| 46 | Ga0070711_100271825 | 3300005439 | Bacteria | 1338 |
| 47 | Ga0070694_100062776 | 3300005444 | Bacteria | 2539 |
| 48 | Ga0070694_100863703 | 3300005444 | Bacteria | 745 |
| 49 | Ga0070694_100996783 | 3300005444 | Bacteria | 695 |
| 50 | Ga0070708_100025166 | 3300005445 | Bacteria | 5086 |
| 51 | Ga0070708_100051868 | 3300005445 | Bacteria | 3635 |
| 52 | Ga0070708_100374682 | 3300005445 | Bacteria | 1342 |
| 53 | Ga0070708_100407210 | 3300005445 | Bacteria | 1283 |
| 54 | Ga0070663_100303868 | 3300005455 | Bacteria | 1278 |
| 55 | Ga0070663_100426467 | 3300005455 | Bacteria | 1089 |
| 56 | Ga0070678_100859280 | 3300005456 | Bacteria | 827 |
| 57 | Ga0070678_101331697 | 3300005456 | Bacteria | 669 |
| 58 | Ga0070678_101340062 | 3300005456 | Bacteria | 667 |
| 59 | Ga0070678_101356120 | 3300005456 | Bacteria | 663 |
| 60 | Ga0070678_101491892 | 3300005456 | Bacteria | 633 |
| 61 | Ga0070681_10013139 | 3300005458 | Bacteria | 8225 |
| 62 | Ga0068867_101089279 | 3300005459 | Unclassified | 729 |
| 63 | Ga0068867_101917561 | 3300005459 | Bacteria | 559 |
| 64 | Ga0070706_100000535 | 3300005467 | Bacteria | 44191 |
| 65 | Ga0070706_100008369 | 3300005467 | Bacteria | 9639 |
| 66 | Ga0070706_100023469 | 3300005467 | Bacteria | 5680 |
| 67 | Ga0070706_100039807 | 3300005467 | Bacteria | 4338 |
| 68 | Ga0070706_100044924 | 3300005467 | Bacteria | 4080 |
| 69 | Ga0070706_100914523 | 3300005467 | Unclassified | 810 |
| 70 | Ga0070706_101010954 | 3300005467 | Unclassified | 767 |
| 71 | Ga0070707_100001203 | 3300005468 | Bacteria | 25448 |
| 72 | Ga0070707_100004677 | 3300005468 | Bacteria | 12823 |
| 73 | Ga0070707_100115170 | 3300005468 | Bacteria | 2609 |
| 74 | Ga0070707_100334253 | 3300005468 | Bacteria | 1472 |
| 75 | Ga0070707_100792419 | 3300005468 | Bacteria | 911 |
| 76 | Ga0070707_100793967 | 3300005468 | Bacteria | 910 |
| 77 | Ga0070698_100001558 | 3300005471 | Bacteria | 25448 |
| 78 | Ga0070698_100008917 | 3300005471 | Bacteria | 10785 |
| 79 | Ga0070698_100010563 | 3300005471 | Bacteria | 9840 |
| 80 | Ga0070698_100030730 | 3300005471 | Bacteria | 5569 |
| 81 | Ga0070698_100061268 | 3300005471 | Bacteria | 3796 |
| 82 | Ga0070698_100321331 | 3300005471 | Bacteria | 1478 |
| 83 | Ga0070698_100553818 | 3300005471 | Bacteria | 1089 |
| 84 | Ga0070698_101168717 | 3300005471 | Bacteria | 718 |
| 85 | Ga0070699_100001765 | 3300005518 | Bacteria | 19725 |
| 86 | Ga0070699_100003085 | 3300005518 | Bacteria | 14766 |
| 87 | Ga0070699_100004916 | 3300005518 | Bacteria | 11787 |
| 88 | Ga0070699_100008312 | 3300005518 | Bacteria | 9001 |
| 89 | Ga0070699_100095998 | 3300005518 | Bacteria | 2596 |
| 90 | Ga0070699_100209039 | 3300005518 | Unclassified | 1737 |
| 91 | Ga0070679_100158938 | 3300005530 | Bacteria | 2234 |
| 92 | Ga0070679_101311381 | 3300005530 | Bacteria | 670 |
| 93 | Ga0070684_100133409 | 3300005535 | Bacteria | 2241 |
| 94 | Ga0070684_100292857 | 3300005535 | Bacteria | 1493 |
| 95 | Ga0070684_101607352 | 3300005535 | Bacteria | 613 |
| 96 | Ga0070697_100030499 | 3300005536 | Bacteria | 4332 |
| 97 | Ga0070697_100034485 | 3300005536 | Bacteria | 4081 |
| 98 | Ga0070697_100143288 | 3300005536 | Bacteria | 2010 |
| 99 | Ga0070697_100588699 | 3300005536 | Bacteria | 977 |
| 100 | Ga0070697_100794557 | 3300005536 | Bacteria | 837 |
| 101 | Ga0070695_100306455 | 3300005545 | Bacteria | 1176 |
| 102 | Ga0070696_100603098 | 3300005546 | Bacteria | 885 |
| 103 | Ga0070665_100278101 | 3300005548 | Bacteria | 1676 |
| 104 | Ga0070704_100117197 | 3300005549 | Unclassified | 2038 |
| 105 | Ga0070664_100769973 | 3300005564 | Bacteria | 899 |
| 106 | Ga0070664_100990462 | 3300005564 | Bacteria | 790 |
| 107 | Ga0068857_100055005 | 3300005577 | Bacteria | 3532 |
| 108 | Ga0068856_100147913 | 3300005614 | Bacteria | 2357 |
| 109 | Ga0068856_101140462 | 3300005614 | Bacteria | 797 |
| 110 | Ga0068852_100128461 | 3300005616 | Bacteria | 2331 |
| 111 | Ga0068861_100079687 | 3300005719 | Bacteria | 2561 |
| 112 | Ga0068861_101036755 | 3300005719 | Bacteria | 785 |
| 113 | Ga0068860_101840571 | 3300005843 | Bacteria | 627 |
| 114 | Ga0068862_101432361 | 3300005844 | Unclassified | 695 |
| 115 | Ga0081455_10000125 | 3300005937 | Bacteria | 89043 |
| 116 | Ga0081455_10003072 | 3300005937 | Bacteria | 19458 |
| 117 | Ga0081455_10021544 | 3300005937 | Bacteria | 6042 |
| 118 | Ga0081455_10031896 | 3300005937 | Bacteria | 4757 |
| 119 | Ga0081538_10131353 | 3300005981 | Bacteria | 1176 |
| 120 | Ga0081540_1000147 | 3300005983 | Bacteria | 72589 |
| 121 | Ga0081540_1040203 | 3300005983 | Bacteria | 2440 |
| 122 | Ga0081539_10022851 | 3300005985 | Bacteria | 4120 |
| 123 | Ga0081539_10050236 | 3300005985 | Bacteria | 2361 |
| 124 | Ga0081539_10301175 | 3300005985 | Bacteria | 689 |
| 125 | Ga0070717_10008469 | 3300006028 | Bacteria | 7683 |
| 126 | Ga0070717_10022387 | 3300006028 | Bacteria | 4993 |
| 127 | Ga0070717_10044905 | 3300006028 | Bacteria | 3611 |
| 128 | Ga0070717_10346818 | 3300006028 | Bacteria | 1327 |
| 129 | Ga0070715_10019535 | 3300006163 | Bacteria | 2601 |
| 130 | Ga0070716_100002854 | 3300006173 | Bacteria | 8048 |
| 131 | Ga0070716_100468628 | 3300006173 | Bacteria | 922 |
| 132 | Ga0070712_100114727 | 3300006175 | Bacteria | 2017 |
| 133 | Ga0070712_100144039 | 3300006175 | Bacteria | 1822 |
| 134 | Ga0070712_100144772 | 3300006175 | Bacteria | 1817 |
| 135 | Ga0070712_100429456 | 3300006175 | Bacteria | 1096 |
| 136 | Ga0075367_10175564 | 3300006178 | Bacteria | 1335 |
| 137 | Ga0068871_100389604 | 3300006358 | Bacteria | 1239 |
| 138 | Ga0075428_100011383 | 3300006844 | Bacteria | 9894 |
| 139 | Ga0075428_100035847 | 3300006844 | Bacteria | 5467 |
| 140 | Ga0075430_100007507 | 3300006846 | Bacteria | 9206 |
| 141 | Ga0075431_100032309 | 3300006847 | Bacteria | 5393 |
| 142 | Ga0075431_100199687 | 3300006847 | Bacteria | 2046 |
| 143 | Ga0075431_100304997 | 3300006847 | Bacteria | 1608 |
| 144 | Ga0075433_10012558 | 3300006852 | Bacteria | 6847 |
| 145 | Ga0075433_10402977 | 3300006852 | Unclassified | 1207 |
| 146 | Ga0075433_10854832 | 3300006852 | Bacteria | 794 |
| 147 | Ga0075433_11127855 | 3300006852 | Unclassified | 682 |
| 148 | Ga0075434_100093239 | 3300006871 | Bacteria | 3014 |
| 149 | Ga0075434_100205315 | 3300006871 | Bacteria | 1990 |
| 150 | Ga0075434_100792944 | 3300006871 | Bacteria | 964 |
| 151 | Ga0075434_101803745 | 3300006871 | Bacteria | 618 |
| 152 | Ga0075434_102504129 | 3300006871 | Unclassified | 517 |
| 153 | Ga0075429_101811210 | 3300006880 | Bacteria | 529 |
| 154 | Ga0075429_101811211 | 3300006880 | Bacteria | 529 |
| 155 | Ga0068865_100489785 | 3300006881 | Bacteria | 1023 |
| 156 | Ga0075436_100482023 | 3300006914 | Bacteria | 906 |
| 157 | Ga0075435_100013931 | 3300007076 | Bacteria | 5997 |
| 158 | Ga0075435_100033678 | 3300007076 | Bacteria | 4053 |
| 159 | Ga0075435_100346912 | 3300007076 | Bacteria | 1272 |
| 160 | Ga0075435_100514119 | 3300007076 | Bacteria | 1036 |
| 161 | Ga0105240_10702059 | 3300009093 | Bacteria | 1104 |
| 162 | Ga0111539_10041267 | 3300009094 | Bacteria | 5549 |
| 163 | Ga0105245_10038106 | 3300009098 | Bacteria | 4276 |
| 164 | Ga0105245_11356267 | 3300009098 | Bacteria | 761 |
| 165 | Ga0114129_10037145 | 3300009147 | Bacteria | 6877 |
| 166 | Ga0114129_10039371 | 3300009147 | Bacteria | 6664 |
| 167 | Ga0114129_10042088 | 3300009147 | Bacteria | 6432 |
| 168 | Ga0114129_10119005 | 3300009147 | Unclassified | 3638 |
| 169 | Ga0114129_10217100 | 3300009147 | Bacteria | 2582 |
| 170 | Ga0114129_10640313 | 3300009147 | Bacteria | 1373 |
| 171 | Ga0114129_12721635 | 3300009147 | Bacteria | 589 |
| 172 | Ga0105243_10049337 | 3300009148 | Bacteria | 3320 |
| 173 | Ga0105243_10064574 | 3300009148 | Bacteria | 2938 |
| 174 | Ga0105243_10354433 | 3300009148 | Bacteria | 1348 |
| 175 | Ga0105243_12082000 | 3300009148 | Bacteria | 603 |
| 176 | Ga0105242_11616189 | 3300009176 | Bacteria | 682 |
| 177 | Ga0105238_10210629 | 3300009551 | Bacteria | 1920 |
| 178 | Ga0105238_10677881 | 3300009551 | Bacteria | 1042 |
| 179 | Ga0105249_11544339 | 3300009553 | Bacteria | 736 |
| 180 | Ga0105249_12838535 | 3300009553 | Bacteria | 556 |
| 181 | Ga0105239_10167398 | 3300010375 | Bacteria | 2458 |
| 182 | Ga0105239_11552459 | 3300010375 | Bacteria | 765 |
| 183 | Ga0105246_10300029 | 3300011119 | Bacteria | 1296 |
| 184 | Ga0105246_10613460 | 3300011119 | Bacteria | 942 |
| 185 | Ga0157370_10027459 | 3300013104 | Bacteria | 5612 |
| 186 | Ga0157369_10040204 | 3300013105 | Bacteria | 5106 |
| 187 | Ga0157369_10527153 | 3300013105 | Bacteria | 1222 |
| 188 | Ga0157378_10758128 | 3300013297 | Bacteria | 994 |
| 189 | Ga0163162_10921625 | 3300013306 | Bacteria | 986 |
| 190 | Ga0157372_10617714 | 3300013307 | Bacteria | 1263 |
| 191 | Ga0157372_10912185 | 3300013307 | Bacteria | 1019 |
| 192 | Ga0157375_11282500 | 3300013308 | Bacteria | 861 |
| 193 | Ga0157375_11381547 | 3300013308 | Bacteria | 829 |
| 194 | Ga0157375_11666526 | 3300013308 | Bacteria | 755 |
| 195 | Ga0157375_11725945 | 3300013308 | Bacteria | 742 |
| 196 | Ga0163163_10430087 | 3300014325 | Bacteria | 1379 |
| 197 | Ga0163163_10458610 | 3300014325 | Bacteria | 1335 |
| 198 | Ga0163163_11018756 | 3300014325 | Bacteria | 891 |
| 199 | Ga0157377_11117914 | 3300014745 | Bacteria | 605 |
| 200 | Ga0206356_10158036 | 3300020070 | Bacteria | 1222 |
| 201 | Ga0206353_10512999 | 3300020082 | Bacteria | 904 |
| 202 | Ga0206353_10746153 | 3300020082 | Bacteria | 2012 |
| 203 | Ga0206353_10956333 | 3300020082 | Bacteria | 526 |
| 204 | Ga0207653_10169033 | 3300025885 | Unclassified | 813 |
| 205 | Ga0207653_10193739 | 3300025885 | Bacteria | 764 |
| 206 | Ga0207692_10005427 | 3300025898 | Bacteria | 5106 |
| 207 | Ga0207692_10014684 | 3300025898 | Bacteria | 3427 |
| 208 | Ga0207688_10094259 | 3300025901 | Bacteria | 1722 |
| 209 | Ga0207688_10528291 | 3300025901 | Bacteria | 740 |
| 210 | Ga0207685_10001778 | 3300025905 | Bacteria | 4690 |
| 211 | Ga0207699_10001799 | 3300025906 | Bacteria | 10073 |
| 212 | Ga0207699_10157181 | 3300025906 | Bacteria | 1510 |
| 213 | Ga0207699_10193973 | 3300025906 | Bacteria | 1372 |
| 214 | Ga0207705_10225348 | 3300025909 | Bacteria | 1425 |
| 215 | Ga0207705_10597153 | 3300025909 | Bacteria | 858 |
| 216 | Ga0207684_10000603 | 3300025910 | Bacteria | 42840 |
| 217 | Ga0207684_10001873 | 3300025910 | Bacteria | 21885 |
| 218 | Ga0207684_10005946 | 3300025910 | Bacteria | 11170 |
| 219 | Ga0207684_10051146 | 3300025910 | Bacteria | 3505 |
| 220 | Ga0207684_10077409 | 3300025910 | Bacteria | 2828 |
| 221 | Ga0207684_10477418 | 3300025910 | Bacteria | 1069 |
| 222 | Ga0207684_11191296 | 3300025910 | Bacteria | 631 |
| 223 | Ga0207684_11233635 | 3300025910 | Bacteria | 618 |
| 224 | Ga0207707_10016074 | 3300025912 | Bacteria | 6527 |
| 225 | Ga0207695_10525344 | 3300025913 | Bacteria | 1065 |
| 226 | Ga0207693_10070393 | 3300025915 | Bacteria | 2737 |
| 227 | Ga0207693_10095339 | 3300025915 | Bacteria | 2332 |
| 228 | Ga0207693_10142067 | 3300025915 | Bacteria | 1887 |
| 229 | Ga0207663_10003868 | 3300025916 | Bacteria | 7391 |
| 230 | Ga0207660_11024347 | 3300025917 | Bacteria | 673 |
| 231 | Ga0207652_10131563 | 3300025921 | Bacteria | 2232 |
| 232 | Ga0207652_10225671 | 3300025921 | Bacteria | 1688 |
| 233 | Ga0207652_10330545 | 3300025921 | Bacteria | 1376 |
| 234 | Ga0207652_11153544 | 3300025921 | Bacteria | 676 |
| 235 | Ga0207652_11686695 | 3300025921 | Bacteria | 538 |
| 236 | Ga0207646_10000810 | 3300025922 | Bacteria | 40719 |
| 237 | Ga0207646_10001784 | 3300025922 | Bacteria | 26072 |
| 238 | Ga0207646_10063291 | 3300025922 | Bacteria | 3303 |
| 239 | Ga0207646_10111890 | 3300025922 | Bacteria | 2451 |
| 240 | Ga0207646_10418482 | 3300025922 | Bacteria | 1210 |
| 241 | Ga0207646_10440238 | 3300025922 | Bacteria | 1176 |
| 242 | Ga0207646_10584035 | 3300025922 | Bacteria | 1003 |
| 243 | Ga0207646_10636349 | 3300025922 | Unclassified | 956 |
| 244 | Ga0207650_10350401 | 3300025925 | Bacteria | 1214 |
| 245 | Ga0207687_10081477 | 3300025927 | Bacteria | 2339 |
| 246 | Ga0207700_10002168 | 3300025928 | Bacteria | 11246 |
| 247 | Ga0207700_10018875 | 3300025928 | Bacteria | 4646 |
| 248 | Ga0207700_10216048 | 3300025928 | Bacteria | 1623 |
| 249 | Ga0207700_10301392 | 3300025928 | Bacteria | 1384 |
| 250 | Ga0207700_10304431 | 3300025928 | Bacteria | 1377 |
| 251 | Ga0207700_10408833 | 3300025928 | Bacteria | 1190 |
| 252 | Ga0207700_10645966 | 3300025928 | Bacteria | 943 |
| 253 | Ga0207664_10006685 | 3300025929 | Bacteria | 7954 |
| 254 | Ga0207664_10014599 | 3300025929 | Bacteria | 5679 |
| 255 | Ga0207664_10019092 | 3300025929 | Bacteria | 5060 |
| 256 | Ga0207664_10029998 | 3300025929 | Bacteria | 4149 |
| 257 | Ga0207664_10238440 | 3300025929 | Bacteria | 1583 |
| 258 | Ga0207664_10620916 | 3300025929 | Bacteria | 971 |
| 259 | Ga0207664_10720569 | 3300025929 | Bacteria | 897 |
| 260 | Ga0207644_10141049 | 3300025931 | Bacteria | 1856 |
| 261 | Ga0207709_10130065 | 3300025935 | Bacteria | 1714 |
| 262 | Ga0207709_10250128 | 3300025935 | Bacteria | 1294 |
| 263 | Ga0207669_10047195 | 3300025937 | Bacteria | 2550 |
| 264 | Ga0207669_10141065 | 3300025937 | Bacteria | 1673 |
| 265 | Ga0207665_10000276 | 3300025939 | Bacteria | 35590 |
| 266 | Ga0207665_10657974 | 3300025939 | Bacteria | 821 |
| 267 | Ga0207661_10067067 | 3300025944 | Bacteria | 2917 |
| 268 | Ga0207661_10113278 | 3300025944 | Bacteria | 2298 |
| 269 | Ga0207661_10373687 | 3300025944 | Bacteria | 1289 |
| 270 | Ga0207661_11243983 | 3300025944 | Bacteria | 685 |
| 271 | Ga0207679_11109779 | 3300025945 | Bacteria | 726 |
| 272 | Ga0207703_10367493 | 3300026035 | Bacteria | 1328 |
| 273 | Ga0207678_10005161 | 3300026067 | Bacteria | 11710 |
| 274 | Ga0207678_10051310 | 3300026067 | Bacteria | 3561 |
| 275 | Ga0207678_10358509 | 3300026067 | Unclassified | 1258 |
| 276 | Ga0207708_11150904 | 3300026075 | Bacteria | 677 |
| 277 | Ga0207702_10066800 | 3300026078 | Bacteria | 3084 |
| 278 | Ga0207702_10102902 | 3300026078 | Bacteria | 2525 |
| 279 | Ga0207702_10107551 | 3300026078 | Bacteria | 2474 |
| 280 | Ga0207702_10198183 | 3300026078 | Bacteria | 1860 |
| 281 | Ga0207641_10446132 | 3300026088 | Bacteria | 1250 |
| 282 | Ga0207676_10096184 | 3300026095 | Bacteria | 2444 |
| 283 | Ga0207674_10037488 | 3300026116 | Bacteria | 5041 |
| 284 | Ga0207674_10053026 | 3300026116 | Bacteria | 4134 |
| 285 | Ga0207674_10488082 | 3300026116 | Bacteria | 1191 |
| 286 | Ga0207675_100248903 | 3300026118 | Bacteria | 1719 |
| 287 | Ga0207675_100756800 | 3300026118 | Bacteria | 983 |
| 288 | Ga0207683_10015284 | 3300026121 | Bacteria | 6534 |
| 289 | Ga0207683_10184287 | 3300026121 | Bacteria | 1893 |
| 290 | Ga0207683_11704069 | 3300026121 | Bacteria | 580 |
| 291 | Ga0207698_10394870 | 3300026142 | Bacteria | 1320 |
| 292 | Ga0207428_10015077 | 3300027907 | Bacteria | 6693 |
| 293 | Ga0268265_10120711 | 3300028380 | Bacteria | 2159 |
| 294 | Ga0268265_11737672 | 3300028380 | Unclassified | 630 |
| 295 | Ga0268264_10783606 | 3300028381 | Bacteria | 952 |
| 296 | Ga0265337_1000651 | 3300028556 | Bacteria | 18325 |
| 297 | Ga0265337_1059181 | 3300028556 | Unclassified | 1064 |
| 298 | Ga0265326_10003278 | 3300028558 | Bacteria | 5334 |
| 299 | Ga0265326_10015114 | 3300028558 | Bacteria | 2244 |
| 300 | Ga0265334_10000598 | 3300028573 | Bacteria | 18227 |
| 301 | Ga0265334_10141287 | 3300028573 | Unclassified | 853 |
| 302 | Ga0265318_10032583 | 3300028577 | Bacteria | 2016 |
| 303 | Ga0265323_10010425 | 3300028653 | Bacteria | 3769 |
| 304 | Ga0265323_10033540 | 3300028653 | Unclassified | 1900 |
| 305 | Ga0265336_10019721 | 3300028666 | Bacteria | 2172 |
| 306 | Ga0265336_10185858 | 3300028666 | Bacteria | 618 |
| 307 | Ga0265338_10004244 | 3300028800 | Bacteria | 19497 |
| 308 | Ga0265338_10053940 | 3300028800 | Unclassified | 3590 |
| 309 | Ga0265338_10665133 | 3300028800 | Bacteria | 721 |
| 310 | Ga0265324_10002870 | 3300029957 | Bacteria | 8476 |
| 311 | Ga0316177_1042139 | 3300030731 | Bacteria | 1002 |
| 312 | Ga0316176_1121491 | 3300030732 | Bacteria | 699 |
| 313 | Ga0314311_1199186 | 3300030733 | Bacteria | 2087 |
| 314 | Ga0314311_1242111 | 3300030733 | Bacteria | 610 |
| 315 | Ga0316180_1157337 | 3300030736 | Bacteria | 797 |
| 316 | Ga0316181_1288931 | 3300030744 | Bacteria | 1260 |
| 317 | Ga0265332_10024023 | 3300031238 | Bacteria | 2685 |
| 318 | Ga0265320_10009656 | 3300031240 | Bacteria | 5800 |
| 319 | Ga0265320_10067437 | 3300031240 | Bacteria | 1693 |
| 320 | Ga0265325_10183799 | 3300031241 | Unclassified | 972 |
| 321 | Ga0265340_10395393 | 3300031247 | Unclassified | 610 |
| 322 | Ga0265327_10055580 | 3300031251 | Bacteria | 2043 |
| 323 | Ga0265327_10060576 | 3300031251 | Bacteria | 1934 |
| 324 | Ga0307513_10000007 | 3300031456 | Bacteria | 451043 |
| 325 | Ga0307408_100055316 | 3300031548 | Bacteria | 2873 |
| 326 | Ga0307408_100315152 | 3300031548 | Bacteria | 1316 |
| 327 | Ga0307408_100378934 | 3300031548 | Bacteria | 1209 |
| 328 | Ga0265313_10020326 | 3300031595 | Bacteria | 3666 |
| 329 | Ga0316575_10026583 | 3300031665 | Bacteria | 2249 |
| 330 | Ga0265314_10016682 | 3300031711 | Bacteria | 5791 |
| 331 | Ga0265314_10558013 | 3300031711 | Unclassified | 595 |
| 332 | Ga0265342_10001644 | 3300031712 | Bacteria | 20591 |
| 333 | Ga0316576_10011456 | 3300031727 | Bacteria | 5813 |
| 334 | Ga0316576_10076273 | 3300031727 | Bacteria | 2481 |
| 335 | Ga0316576_10081447 | 3300031727 | Bacteria | 2402 |
| 336 | Ga0316578_10001429 | 3300031728 | Bacteria | 9683 |
| 337 | Ga0316578_10049213 | 3300031728 | Bacteria | 2462 |
| 338 | Ga0316578_10100334 | 3300031728 | Bacteria | 1735 |
| 339 | Ga0316578_10129643 | 3300031728 | Bacteria | 1517 |
| 340 | Ga0316578_10249332 | 3300031728 | Bacteria | 1065 |
| 341 | Ga0307405_10087442 | 3300031731 | Bacteria | 2054 |
| 342 | Ga0316577_10100216 | 3300031733 | Unclassified | 1624 |
| 343 | Ga0316577_10169988 | 3300031733 | Bacteria | 1230 |
| 344 | Ga0307413_10072770 | 3300031824 | Bacteria | 2170 |
| 345 | Ga0307413_10121364 | 3300031824 | Bacteria | 1771 |
| 346 | Ga0307413_10279580 | 3300031824 | Bacteria | 1255 |
| 347 | Ga0307413_10633941 | 3300031824 | Unclassified | 879 |
| 348 | Ga0307413_11102817 | 3300031824 | Bacteria | 686 |
| 349 | Ga0307410_10063970 | 3300031852 | Bacteria | 2526 |
| 350 | Ga0307410_10072123 | 3300031852 | Bacteria | 2397 |
| 351 | Ga0307410_10083361 | 3300031852 | Bacteria | 2251 |
| 352 | Ga0307410_10105655 | 3300031852 | Bacteria | 2027 |
| 353 | Ga0307410_10175203 | 3300031852 | Bacteria | 1620 |
| 354 | Ga0307410_10921798 | 3300031852 | Bacteria | 749 |
| 355 | Ga0307410_11247686 | 3300031852 | Bacteria | 649 |
| 356 | Ga0307406_10157618 | 3300031901 | Bacteria | 1628 |
| 357 | Ga0307406_10252857 | 3300031901 | Bacteria | 1329 |
| 358 | Ga0307406_10441569 | 3300031901 | Bacteria | 1042 |
| 359 | Ga0307407_10100189 | 3300031903 | Unclassified | 1796 |
| 360 | Ga0307407_10126213 | 3300031903 | Bacteria | 1630 |
| 361 | Ga0307407_10206911 | 3300031903 | Bacteria | 1319 |
| 362 | Ga0307407_10302484 | 3300031903 | Bacteria | 1116 |
| 363 | Ga0307407_10783892 | 3300031903 | Bacteria | 724 |
| 364 | Ga0307407_10884968 | 3300031903 | Bacteria | 684 |
| 365 | Ga0307412_10207847 | 3300031911 | Bacteria | 1491 |
| 366 | Ga0307412_10679099 | 3300031911 | Bacteria | 882 |
| 367 | Ga0307409_100079320 | 3300031995 | Bacteria | 2645 |
| 368 | Ga0307409_100104357 | 3300031995 | Bacteria | 2360 |
| 369 | Ga0307409_100287800 | 3300031995 | Bacteria | 1522 |
| 370 | Ga0307409_100317354 | 3300031995 | Bacteria | 1457 |
| 371 | Ga0307409_100666561 | 3300031995 | Bacteria | 1036 |
| 372 | Ga0307409_101471037 | 3300031995 | Bacteria | 708 |
| 373 | Ga0307409_102133278 | 3300031995 | Bacteria | 590 |
| 374 | Ga0307416_100123173 | 3300032002 | Bacteria | 2316 |
| 375 | Ga0307416_100175852 | 3300032002 | Bacteria | 1999 |
| 376 | Ga0307416_100209363 | 3300032002 | Bacteria | 1858 |
| 377 | Ga0307416_100228086 | 3300032002 | Bacteria | 1793 |
| 378 | Ga0307416_100336810 | 3300032002 | Bacteria | 1519 |
| 379 | Ga0307416_100440328 | 3300032002 | Bacteria | 1353 |
| 380 | Ga0307416_100935533 | 3300032002 | Bacteria | 968 |
| 381 | Ga0307416_101062954 | 3300032002 | Bacteria | 913 |
| 382 | Ga0307414_10361052 | 3300032004 | Bacteria | 1250 |
| 383 | Ga0307414_10627941 | 3300032004 | Bacteria | 966 |
| 384 | Ga0307411_10119245 | 3300032005 | Bacteria | 1905 |
| 385 | Ga0307415_100060385 | 3300032126 | Bacteria | 2619 |
| 386 | Ga0307415_100064170 | 3300032126 | Bacteria | 2555 |
| 387 | Ga0307415_100134131 | 3300032126 | Bacteria | 1880 |
| 388 | Ga0307415_100156549 | 3300032126 | Bacteria | 1760 |
| 389 | Ga0307415_100181531 | 3300032126 | Bacteria | 1652 |
| 390 | Ga0316583_10031640 | 3300032133 | Bacteria | 1883 |
| 391 | Ga0316580_10047953 | 3300032139 | Bacteria | 1316 |
| 392 | Ga0373932_0087858 | 3300035112 | Bacteria | 993 |
| 393 | Ga0373936_0125741 | 3300035113 | Bacteria | 1099 |
| 394 | Ga0373939_0530907 | 3300035114 | Bacteria | 506 |
| 395 | Ga0373953_0234389 | 3300035117 | Bacteria | 796 |
| 396 | Ga0373946_0414083 | 3300035171 | Bacteria | 682 |
| 397 | Ga0373955_0126229 | 3300035172 | Bacteria | 1491 |
| 398 | Ga0373942_0321687 | 3300035207 | Unclassified | 541 |
| 399 | Ga0316574_0042242 | 3300035398 | Bacteria | 2812 |
| 400 | Ga0316574_0154709 | 3300035398 | Bacteria | 1477 |
| 401 | Ga0316574_0451534 | 3300035398 | Bacteria | 805 |
| 402 | Ga0316574_0482884 | 3300035398 | Bacteria | 774 |
| 403 | Ga0316574_0495370 | 3300035398 | Bacteria | 762 |
| 404 | Ga0373931_0088541 | 3300035691 | Bacteria | 1721 |
| 405 | Ga0373935_0123214 | 3300035692 | Bacteria | 1734 |
| 406 | Ga0373933_0311415 | 3300035724 | Bacteria | 1020 |
| 407 | Ga0373937_0373217 | 3300036401 | Bacteria | 1352 |
| 408 | Ga0373937_1403654 | 3300036401 | Bacteria | 646 |
| 409 | Ga0372808_065229 | 3300036459 | Bacteria | 524 |
| 410 | Ga0316582_0007103 | 3300036647 | Bacteria | 5947 |
| 411 | Ga0316582_0386636 | 3300036647 | Bacteria | 963 |
| 412 | Ga0316584_0008202 | 3300036712 | Bacteria | 7186 |
| 413 | Ga0316584_0069586 | 3300036712 | Bacteria | 2638 |
| 414 | Ga0316584_0079310 | 3300036712 | Bacteria | 2460 |
| 415 | Ga0316584_0098005 | 3300036712 | Bacteria | 2195 |
| 416 | Ga0316584_0155639 | 3300036712 | Bacteria | 1700 |
| 417 | Ga0316584_0220539 | 3300036712 | Bacteria | 1393 |
| 418 | Ga0316584_0225293 | 3300036712 | Bacteria | 1376 |
| 419 | Ga0316584_0265381 | 3300036712 | Bacteria | 1251 |
| 420 | Ga0316584_0309703 | 3300036712 | Bacteria | 1142 |
| 421 | Ga0316584_0908549 | 3300036712 | Unclassified | 592 |
| 422 | Ga0373925_0000030 | 3300037068 | Bacteria | 146196 |
| 423 | Ga0373925_0251630 | 3300037068 | Bacteria | 1417 |
| 424 | Ga0395900_0028223 | 3300037418 | Bacteria | 5749 |
| 425 | Ga0395900_0141015 | 3300037418 | Bacteria | 2468 |
| 426 | Ga0395898_0172182 | 3300037466 | Bacteria | 2069 |
| 427 | Ga0395898_0377321 | 3300037466 | Archaea | 1352 |
| 428 | Ga0316581_0120701 | 3300037588 | Unclassified | 808 |
| 429 | Ga0395901_0011481 | 3300038443 | Bacteria | 8976 |
| 430 | Ga0395901_0092832 | 3300038443 | Bacteria | 3160 |
| 431 | Ga0395901_0702551 | 3300038443 | Bacteria | 1009 |
| 432 | Ga0395901_1140885 | 3300038443 | Bacteria | 748 |
| 433 | Ga0400488_22546 | 3300038741 | Bacteria | 7428 |
| 434 | Ga0400486_06480 | 3300038742 | Bacteria | 1205 |
| 435 | Ga0400483_044090 | 3300039062 | Bacteria | 76499 |
| 436 | Ga0400483_075002 | 3300039062 | Bacteria | 3311 |
| 437 | Ga0400483_237049 | 3300039062 | Bacteria | 60745 |
| 438 | Ga0400483_247042 | 3300039062 | Bacteria | 22748 |
| 439 | Ga0400483_278156 | 3300039062 | Bacteria | 1230 |
| 440 | Ga0436365_0844020 | 3300039437 | Bacteria | 3384 |
| 441 | Ga0436360_0207103 | 3300039438 | Bacteria | 1762 |
| 442 | Ga0436363_0600429 | 3300039450 | Unclassified | 1299 |
| 443 | Ga0439436_0048764 | 3300041404 | Bacteria | 1200 |
| 444 | Ga0439438_010095 | 3300041405 | Bacteria | 3012 |
| 445 | Ga0439439_0004602 | 3300041406 | Bacteria | 3120 |
| 446 | Ga0439461_0002508 | 3300041410 | Bacteria | 2939 |
| 447 | Ga0439466_0008424 | 3300041411 | Bacteria | 3887 |
| 448 | Ga0439465_0207217 | 3300041413 | Bacteria | 716 |
| 449 | Ga0451853_0190429 | 3300041512 | Bacteria | 1601 |
| 450 | Ga0451853_3746540 | 3300041512 | Unclassified | 1835 |
| 451 | Ga0439433_0001043 | 3300041999 | Bacteria | 5618 |
| 452 | Ga0439433_0022172 | 3300041999 | Bacteria | 1423 |
| 453 | Ga0439442_001536 | 3300042002 | Bacteria | 4532 |
| 454 | Ga0439442_001802 | 3300042002 | Bacteria | 4188 |
| 455 | Ga0439442_002705 | 3300042002 | Bacteria | 3478 |
| 456 | Ga0439432_007408 | 3300042006 | Bacteria | 3890 |
| 457 | Ga0439432_024978 | 3300042006 | Bacteria | 1962 |
| 458 | Ga0439449_0021066 | 3300042007 | Bacteria | 2441 |
| 459 | Ga0439449_0021541 | 3300042007 | Bacteria | 2412 |
| 460 | Ga0439452_001551 | 3300042010 | Bacteria | 9214 |
| 461 | Ga0439455_0064631 | 3300042012 | Bacteria | 975 |
| 462 | Ga0439457_144270 | 3300042014 | Bacteria | 571 |
| 463 | Ga0439462_0036097 | 3300042015 | Bacteria | 1315 |
| 464 | Ga0450911_015832 | 3300042115 | Bacteria | 997 |
| 465 | Ga0450917_033036 | 3300042120 | Bacteria | 501 |
| 466 | Ga0450919_002392 | 3300042121 | Bacteria | 2434 |
| 467 | Ga0450920_000417 | 3300042122 | Bacteria | 6654 |
| 468 | Ga0450920_002134 | 3300042122 | Bacteria | 3345 |
| 469 | Ga0450923_095083 | 3300042125 | Bacteria | 683 |
| 470 | Ga0450923_103720 | 3300042125 | Bacteria | 658 |
| 471 | Ga0450907_001195 | 3300042146 | Bacteria | 5880 |
| 472 | Ga0439446_0101769 | 3300042156 | Bacteria | 909 |
| 473 | Ga0439434_0001257 | 3300042435 | Bacteria | 7298 |
| 474 | Ga0439434_0010414 | 3300042435 | Bacteria | 2740 |
| 475 | Ga0439435_0359065 | 3300042436 | Bacteria | 507 |
| 476 | Ga0439444_0045391 | 3300042437 | Bacteria | 877 |
| 477 | Ga0450918_005774 | 3300042531 | Bacteria | 2213 |
| 478 | Ga0450918_006214 | 3300042531 | Bacteria | 2132 |
| 479 | Ga0451577_0025875 | 3300042876 | Bacteria | 5321 |
| 480 | Ga0451577_0027239 | 3300042876 | Bacteria | 5172 |
| 481 | Ga0451577_0172109 | 3300042876 | Unclassified | 1951 |
| 482 | Ga0451577_0260292 | 3300042876 | Bacteria | 1571 |
| 483 | Ga0451577_0698573 | 3300042876 | Unclassified | 919 |
| 484 | Ga0451577_1878522 | 3300042876 | Unclassified | 525 |
| 485 | Ga0439440_0067327 | 3300042993 | Bacteria | 926 |
| 486 | Ga0466969_0001395 | 3300044656 | Bacteria | 13027 |
| 487 | Ga0466969_0062005 | 3300044656 | Bacteria | 1816 |
| 488 | Ga0453683_0424338 | 3300044673 | Unclassified | 858 |
| 489 | Ga0453683_1206635 | 3300044673 | Unclassified | 507 |
| 490 | Ga0466965_0028479 | 3300044683 | Bacteria | 2715 |
| 491 | Ga0466965_0202951 | 3300044683 | Bacteria | 1052 |
| 492 | Ga0466965_0217741 | 3300044683 | Bacteria | 1017 |
| 493 | Ga0466965_0282735 | 3300044683 | Bacteria | 896 |
| 494 | Ga0466965_0296119 | 3300044683 | Bacteria | 877 |
| 495 | Ga0466965_0297259 | 3300044683 | Bacteria | 875 |
| 496 | Ga0466965_0322388 | 3300044683 | Bacteria | 842 |
| 497 | Ga0466966_0001319 | 3300044684 | Bacteria | 15910 |
| 498 | Ga0466966_0113190 | 3300044684 | Bacteria | 1671 |
| 499 | Ga0466966_0337260 | 3300044684 | Bacteria | 906 |
| 500 | Ga0466966_0613633 | 3300044684 | Bacteria | 655 |
| 501 | Ga0466961_0052562 | 3300044693 | Bacteria | 2600 |
| 502 | Ga0466961_0066331 | 3300044693 | Bacteria | 2293 |
| 503 | Ga0466961_0268710 | 3300044693 | Bacteria | 1045 |
| 504 | Ga0466961_0330038 | 3300044693 | Bacteria | 930 |
| 505 | Ga0466961_0854944 | 3300044693 | Bacteria | 542 |
| 506 | Ga0466963_0071419 | 3300044694 | Bacteria | 2336 |
| 507 | Ga0466963_0080405 | 3300044694 | Bacteria | 2206 |
| 508 | Ga0466963_0186593 | 3300044694 | Bacteria | 1448 |
| 509 | Ga0466963_0469426 | 3300044694 | Bacteria | 888 |
| 510 | Ga0466963_0525640 | 3300044694 | Bacteria | 835 |
| 511 | Ga0466963_1005773 | 3300044694 | Bacteria | 587 |
| 512 | Ga0466964_0444641 | 3300044706 | Bacteria | 686 |
| 513 | Ga0466964_0658453 | 3300044706 | Bacteria | 580 |
| 514 | Ga0453684_0005761 | 3300044712 | Bacteria | 24193 |
| 515 | Ga0453684_0011592 | 3300044712 | Bacteria | 14735 |
| 516 | Ga0453684_0060992 | 3300044712 | Bacteria | 4844 |
| 517 | Ga0453684_0070272 | 3300044712 | Bacteria | 4435 |
| 518 | Ga0453684_0084179 | 3300044712 | Bacteria | 3957 |
| 519 | Ga0453684_0094715 | 3300044712 | Bacteria | 3672 |
| 520 | Ga0453684_0249637 | 3300044712 | Bacteria | 2038 |
| 521 | Ga0453684_0273005 | 3300044712 | Bacteria | 1931 |
| 522 | Ga0453684_0397145 | 3300044712 | Bacteria | 1545 |
| 523 | Ga0453684_0417903 | 3300044712 | Bacteria | 1498 |
| 524 | Ga0453684_0936446 | 3300044712 | Unclassified | 925 |
| 525 | Ga0453684_1116163 | 3300044712 | Unclassified | 832 |
| 526 | Ga0453684_1175856 | 3300044712 | Bacteria | 806 |
| 527 | Ga0453684_1653345 | 3300044712 | Bacteria | 656 |
| 528 | Ga0453684_1724368 | 3300044712 | Bacteria | 639 |
| 529 | Ga0453684_2216442 | 3300044712 | Unclassified | 548 |
| 530 | Ga0466971_0100204 | 3300044719 | Bacteria | 1331 |
| 531 | Ga0466971_0120029 | 3300044719 | Bacteria | 1216 |
| 532 | Ga0466971_0135545 | 3300044719 | Bacteria | 1145 |
| 533 | Ga0466971_0171065 | 3300044719 | Bacteria | 1020 |
| 534 | Ga0466971_0185512 | 3300044719 | Bacteria | 979 |
| 535 | Ga0466968_0000453 | 3300044735 | Bacteria | 13806 |
| 536 | Ga0466970_0052504 | 3300044765 | Bacteria | 2176 |
| 537 | Ga0466970_0115921 | 3300044765 | Bacteria | 1465 |
| 538 | Ga0466957_0069844 | 3300044842 | Bacteria | 2170 |
| 539 | Ga0466957_0082097 | 3300044842 | Bacteria | 2009 |
| 540 | Ga0466957_0137240 | 3300044842 | Bacteria | 1573 |
| 541 | Ga0466957_0540242 | 3300044842 | Bacteria | 811 |
| 542 | Ga0466957_1041702 | 3300044842 | Bacteria | 589 |
| 543 | Ga0466960_0055537 | 3300044901 | Bacteria | 1926 |
| 544 | Ga0466960_0094815 | 3300044901 | Bacteria | 1527 |
| 545 | Ga0466960_0353407 | 3300044901 | Bacteria | 839 |
| 546 | Ga0466960_0411077 | 3300044901 | Bacteria | 781 |
| 547 | Ga0466960_0998558 | 3300044901 | Bacteria | 514 |
| 548 | Ga0466959_0037787 | 3300045049 | Bacteria | 3568 |
| 549 | Ga0466959_0373429 | 3300045049 | Bacteria | 971 |
| 550 | Ga0466959_0397932 | 3300045049 | Bacteria | 936 |
| 551 | Ga0466959_0408537 | 3300045049 | Bacteria | 922 |
| 552 | Ga0466959_0677772 | 3300045049 | Bacteria | 691 |
| 553 | Ga0466959_0824203 | 3300045049 | Bacteria | 620 |
| 554 | Ga0451576_0032861 | 3300045051 | Bacteria | 5517 |
| 555 | Ga0451576_0043213 | 3300045051 | Bacteria | 4755 |
| 556 | Ga0451576_0082879 | 3300045051 | Bacteria | 3336 |
| 557 | Ga0451576_0366159 | 3300045051 | Bacteria | 1510 |
| 558 | Ga0451576_0518879 | 3300045051 | Bacteria | 1252 |
| 559 | Ga0451576_0570312 | 3300045051 | Unclassified | 1189 |
| 560 | Ga0466958_0080154 | 3300045836 | Bacteria | 2008 |
| 561 | Ga0466958_0104560 | 3300045836 | Bacteria | 1764 |
| 562 | Ga0466958_0438611 | 3300045836 | Bacteria | 845 |
| 563 | Ga0466958_0801588 | 3300045836 | Bacteria | 614 |
| 564 | Ga0466967_0007996 | 3300045976 | Bacteria | 7701 |
| 565 | Ga0466967_0078990 | 3300045976 | Bacteria | 2965 |
| 566 | Ga0466967_0088154 | 3300045976 | Bacteria | 2815 |
| 567 | Ga0466967_0100462 | 3300045976 | Bacteria | 2643 |
| 568 | Ga0466967_0135033 | 3300045976 | Bacteria | 2294 |
| 569 | Ga0466967_0137995 | 3300045976 | Bacteria | 2269 |
| 570 | Ga0466967_0178852 | 3300045976 | Bacteria | 2000 |
| 571 | Ga0466967_0204538 | 3300045976 | Bacteria | 1871 |
| 572 | Ga0466967_0300468 | 3300045976 | Bacteria | 1544 |
| 573 | Ga0466967_0371141 | 3300045976 | Bacteria | 1388 |
| 574 | Ga0466967_0591830 | 3300045976 | Bacteria | 1094 |
| 575 | Ga0466967_0833759 | 3300045976 | Bacteria | 916 |
| 576 | Ga0495603_0836788 | 3300046455 | Bacteria | 524 |
| 577 | Ga0495629_0081597 | 3300046459 | Unclassified | 2257 |
| 578 | Ga0495641_0412581 | 3300046461 | Unclassified | 613 |
| 579 | Ga0495653_0035942 | 3300046463 | Bacteria | 3906 |
| 580 | Ga0495653_0046282 | 3300046463 | Bacteria | 3369 |
| 581 | Ga0495582_0385902 | 3300046473 | Bacteria | 807 |
| 582 | Ga0495639_0144800 | 3300046475 | Bacteria | 1144 |
| 583 | Ga0495664_0056716 | 3300046477 | Bacteria | 2330 |
| 584 | Ga0495664_0147304 | 3300046477 | Bacteria | 1428 |
| 585 | Ga0495664_0212632 | 3300046477 | Bacteria | 1171 |
| 586 | Ga0495585_0054059 | 3300046492 | Bacteria | 2221 |
| 587 | Ga0495594_0480762 | 3300046499 | Bacteria | 706 |
| 588 | Ga0495596_0048204 | 3300046500 | Bacteria | 1671 |
| 589 | Ga0495596_0145478 | 3300046500 | Bacteria | 921 |
| 590 | Ga0495608_0368566 | 3300046511 | Bacteria | 882 |
| 591 | Ga0495618_0315468 | 3300046514 | Bacteria | 969 |
| 592 | Ga0495618_0419328 | 3300046514 | Bacteria | 816 |
| 593 | Ga0495628_0008040 | 3300046516 | Bacteria | 9081 |
| 594 | Ga0495628_0793273 | 3300046516 | Bacteria | 663 |
| 595 | Ga0495630_0005586 | 3300046517 | Bacteria | 8879 |
| 596 | Ga0495637_0160373 | 3300046520 | Bacteria | 844 |
| 597 | Ga0495644_0018012 | 3300046523 | Bacteria | 2697 |
| 598 | Ga0495666_0010115 | 3300046526 | Bacteria | 4706 |
| 599 | Ga0495642_0011034 | 3300046528 | Bacteria | 3466 |
| 600 | Ga0495652_0555184 | 3300046529 | Bacteria | 789 |
| 601 | Ga0495652_0556681 | 3300046529 | Bacteria | 788 |
| 602 | Ga0495640_0250099 | 3300046533 | Bacteria | 1110 |
| 603 | Ga0495598_0016243 | 3300046537 | Bacteria | 1896 |
| 604 | Ga0495598_0148262 | 3300046537 | Bacteria | 817 |
| 605 | Ga0495609_0013310 | 3300046538 | Bacteria | 3890 |
| 606 | Ga0495621_0188888 | 3300046539 | Bacteria | 825 |
| 607 | Ga0495645_0032474 | 3300046543 | Bacteria | 3808 |
| 608 | Ga0495645_0210273 | 3300046543 | Bacteria | 1314 |
| 609 | Ga0495633_0258544 | 3300046558 | Bacteria | 794 |
| 610 | Ga0495667_0063928 | 3300046559 | Bacteria | 2408 |
| 611 | Ga0495656_0003838 | 3300046615 | Bacteria | 5110 |
| 612 | Ga0495656_0037578 | 3300046615 | Bacteria | 2001 |
| 613 | Ga0495656_0428594 | 3300046615 | Unclassified | 695 |
| 614 | Ga0495656_0798743 | 3300046615 | Bacteria | 510 |
| 615 | Ga0495668_0383792 | 3300046616 | Bacteria | 772 |
| 616 | Ga0495611_0189667 | 3300046648 | Bacteria | 960 |
| 617 | Ga0495611_0306153 | 3300046648 | Bacteria | 732 |
| 618 | Ga0495625_0095005 | 3300046660 | Bacteria | 2056 |
| 619 | Ga0495659_0001304 | 3300046664 | Bacteria | 8567 |
| 620 | Ga0495599_0322818 | 3300046678 | Bacteria | 929 |
| 621 | Ga0495623_0124177 | 3300046679 | Bacteria | 1551 |
| 622 | Ga0495646_0252922 | 3300046680 | Bacteria | 943 |
| 623 | Ga0495647_0360829 | 3300046681 | Bacteria | 663 |
| 624 | Ga0495658_0120321 | 3300046683 | Bacteria | 1587 |
| 625 | Ga0495658_0436336 | 3300046683 | Bacteria | 836 |
| 626 | Ga0495658_0443908 | 3300046683 | Bacteria | 828 |
| 627 | Ga0495658_0962286 | 3300046683 | Bacteria | 545 |
| 628 | Ga0495669_0054248 | 3300046684 | Bacteria | 1804 |
| 629 | Ga0495670_0030538 | 3300046691 | Bacteria | 2676 |
| 630 | Ga0495670_0097227 | 3300046691 | Bacteria | 1513 |
| 631 | Ga0495589_0040145 | 3300046794 | Bacteria | 2338 |
| 632 | Ga0495674_0033624 | 3300047319 | Bacteria | 4642 |
| 633 | Ga0495674_0090813 | 3300047319 | Bacteria | 2609 |
| 634 | Ga0495674_0614254 | 3300047319 | Bacteria | 860 |
| 635 | Ga0495676_0062734 | 3300047321 | Bacteria | 2900 |
| 636 | Ga0495676_0137748 | 3300047321 | Bacteria | 1753 |
| 637 | Ga0495680_0244801 | 3300047322 | Bacteria | 1272 |
| 638 | Ga0495680_0328656 | 3300047322 | Bacteria | 1069 |
| 639 | Ga0495683_0335875 | 3300047323 | Bacteria | 641 |
| 640 | Ga0495679_106466 | 3300047446 | Bacteria | 775 |
| 641 | Ga0495684_0017695 | 3300047471 | Bacteria | 5489 |
| 642 | Ga0495684_0966574 | 3300047471 | Bacteria | 544 |
| 643 | Ga0495602_0214310 | 3300048088 | Bacteria | 1459 |
| 644 | Ga0495615_0030275 | 3300048090 | Bacteria | 1291 |
| 645 | Ga0496101_0021168 | 3300048904 | Bacteria | 4464 |
| 646 | Ga0496101_1262802 | 3300048904 | Bacteria | 578 |
| 647 | Ga0496102_0721390 | 3300048905 | Bacteria | 920 |
| 648 | Ga0496102_1732733 | 3300048905 | Bacteria | 542 |
| 649 | Ga0496107_0027403 | 3300048910 | Bacteria | 4046 |
| 650 | Ga0496108_0438707 | 3300048911 | Bacteria | 1141 |
| 651 | Ga0496109_0748394 | 3300048912 | Bacteria | 915 |
| 652 | Ga0496111_0117819 | 3300048914 | Bacteria | 1960 |
| 653 | Ga0496112_0482964 | 3300048915 | Bacteria | 1175 |
| 654 | Ga0496112_1098284 | 3300048915 | Bacteria | 714 |
| 655 | Ga0496114_0165868 | 3300048917 | Bacteria | 1923 |
| 656 | Ga0496114_0518778 | 3300048917 | Bacteria | 1054 |
| 657 | Ga0496114_0688244 | 3300048917 | Bacteria | 897 |
| 658 | Ga0496117_0299066 | 3300048920 | Bacteria | 853 |
| 659 | Ga0496118_0086946 | 3300048921 | Bacteria | 2170 |
| 660 | Ga0496126_0006325 | 3300048929 | Bacteria | 13219 |
| 661 | Ga0496126_1282181 | 3300048929 | Bacteria | 534 |
| 662 | Ga0501298_138911 | 3300049521 | Unclassified | 586 |
| 663 | Ga0501031_0000509 | 3300049568 | Bacteria | 22746 |
| 664 | Ga0501031_0191105 | 3300049568 | Bacteria | 1337 |
| 665 | Ga0501032_0000310 | 3300049569 | Bacteria | 41007 |
| 666 | Ga0501032_0587619 | 3300049569 | Bacteria | 709 |
| 667 | Ga0501033_0000835 | 3300049570 | Bacteria | 28103 |
| 668 | Ga0501033_0504403 | 3300049570 | Bacteria | 837 |
| 669 | Ga0501033_0711819 | 3300049570 | Bacteria | 683 |
| 670 | Ga0501034_0036667 | 3300049571 | Bacteria | 4965 |
| 671 | Ga0501034_0936063 | 3300049571 | Bacteria | 753 |
| 672 | Ga0501036_0000080 | 3300049572 | Bacteria | 59831 |
| 673 | Ga0501036_0522638 | 3300049572 | Bacteria | 987 |
| 674 | Ga0501036_0904065 | 3300049572 | Bacteria | 724 |
| 675 | Ga0501036_1342896 | 3300049572 | Bacteria | 580 |
| 676 | Ga0501037_0001757 | 3300049573 | Bacteria | 15743 |
| 677 | Ga0501038_0013323 | 3300049574 | Bacteria | 7499 |
| 678 | Ga0501038_0216725 | 3300049574 | Bacteria | 1529 |
| 679 | Ga0501039_0001383 | 3300049575 | Bacteria | 17796 |
| 680 | Ga0501039_0452725 | 3300049575 | Unclassified | 1008 |
| 681 | Ga0501039_0920092 | 3300049575 | Bacteria | 680 |
| 682 | Ga0501040_0026767 | 3300049576 | Bacteria | 3879 |
| 683 | Ga0501040_0029531 | 3300049576 | Bacteria | 3702 |
| 684 | Ga0501040_0034224 | 3300049576 | Unclassified | 3443 |
| 685 | Ga0501040_0281353 | 3300049576 | Bacteria | 1188 |
| 686 | Ga0501040_0338282 | 3300049576 | Bacteria | 1077 |
| 687 | Ga0501040_0566544 | 3300049576 | Bacteria | 820 |
| 688 | Ga0501041_0109185 | 3300049577 | Bacteria | 1716 |
| 689 | Ga0501041_0136052 | 3300049577 | Unclassified | 1531 |
| 690 | Ga0501041_0639051 | 3300049577 | Bacteria | 680 |
| 691 | Ga0501042_0263259 | 3300049578 | Bacteria | 1245 |
| 692 | Ga0501042_0336401 | 3300049578 | Bacteria | 1091 |
| 693 | Ga0501042_0431489 | 3300049578 | Bacteria | 955 |
| 694 | Ga0501042_1451182 | 3300049578 | Bacteria | 501 |
| 695 | Ga0501043_0001371 | 3300049579 | Bacteria | 21359 |
| 696 | Ga0501043_0077263 | 3300049579 | Bacteria | 2616 |
| 697 | Ga0501046_0007065 | 3300049580 | Bacteria | 9886 |
| 698 | Ga0501046_0050384 | 3300049580 | Unclassified | 3290 |
| 699 | Ga0501046_0150316 | 3300049580 | Bacteria | 1757 |
| 700 | Ga0501046_0444694 | 3300049580 | Bacteria | 932 |
| 701 | Ga0501046_0866652 | 3300049580 | Bacteria | 631 |
| 702 | Ga0501046_1141696 | 3300049580 | Bacteria | 537 |
| 703 | Ga0501047_0032375 | 3300049581 | Bacteria | 5046 |
| 704 | Ga0501047_0114499 | 3300049581 | Bacteria | 2579 |
| 705 | Ga0501048_0059325 | 3300049582 | Unclassified | 2712 |
| 706 | Ga0501048_0069827 | 3300049582 | Bacteria | 2481 |
| 707 | Ga0501048_0408742 | 3300049582 | Bacteria | 970 |
| 708 | Ga0501048_0424465 | 3300049582 | Unclassified | 951 |
| 709 | Ga0501048_0818873 | 3300049582 | Bacteria | 669 |
| 710 | Ga0501068_0090509 | 3300049584 | Bacteria | 1887 |
| 711 | Ga0501068_0099449 | 3300049584 | Bacteria | 1802 |
| 712 | Ga0501069_0000598 | 3300049585 | Bacteria | 16663 |
| 713 | Ga0501069_0519802 | 3300049585 | Bacteria | 711 |
| 714 | Ga0501070_0007557 | 3300049586 | Bacteria | 9236 |
| 715 | Ga0501070_0924090 | 3300049586 | Bacteria | 680 |
| 716 | Ga0501071_0045384 | 3300049587 | Bacteria | 3155 |
| 717 | Ga0501071_0154685 | 3300049587 | Bacteria | 1712 |
| 718 | Ga0501071_0385144 | 3300049587 | Bacteria | 1069 |
| 719 | Ga0501071_0543300 | 3300049587 | Bacteria | 892 |
| 720 | Ga0501071_0662961 | 3300049587 | Bacteria | 803 |
| 721 | Ga0501072_0023641 | 3300049588 | Bacteria | 4774 |
| 722 | Ga0501072_0058318 | 3300049588 | Bacteria | 3043 |
| 723 | Ga0501072_0059442 | 3300049588 | Bacteria | 3014 |
| 724 | Ga0501072_0099480 | 3300049588 | Bacteria | 2312 |
| 725 | Ga0501072_0202616 | 3300049588 | Bacteria | 1582 |
| 726 | Ga0501072_0239574 | 3300049588 | Bacteria | 1445 |
| 727 | Ga0501072_0853126 | 3300049588 | Bacteria | 712 |
| 728 | Ga0501073_0004179 | 3300049589 | Bacteria | 10831 |
| 729 | Ga0501073_0113612 | 3300049589 | Bacteria | 1878 |
| 730 | Ga0501074_0058490 | 3300049590 | Bacteria | 2777 |
| 731 | Ga0501074_0229138 | 3300049590 | Bacteria | 1323 |
| 732 | Ga0501074_0320885 | 3300049590 | Bacteria | 1100 |
| 733 | Ga0501074_0382645 | 3300049590 | Bacteria | 998 |
| 734 | Ga0501074_0530180 | 3300049590 | Bacteria | 834 |
| 735 | Ga0501075_0030185 | 3300049591 | Bacteria | 4014 |
| 736 | Ga0501075_0104614 | 3300049591 | Bacteria | 2151 |
| 737 | Ga0501075_0247582 | 3300049591 | Bacteria | 1358 |
| 738 | Ga0501075_0456036 | 3300049591 | Bacteria | 975 |
| 739 | Ga0501075_0852535 | 3300049591 | Bacteria | 693 |
| 740 | Ga0501075_0945410 | 3300049591 | Bacteria | 655 |
| 741 | Ga0501076_0045093 | 3300049592 | Bacteria | 3480 |
| 742 | Ga0501076_0053550 | 3300049592 | Bacteria | 3198 |
| 743 | Ga0501076_0069269 | 3300049592 | Unclassified | 2819 |
| 744 | Ga0501076_0076460 | 3300049592 | Bacteria | 2685 |
| 745 | Ga0501076_0162391 | 3300049592 | Bacteria | 1820 |
| 746 | Ga0501076_0215329 | 3300049592 | Unclassified | 1570 |
| 747 | Ga0501076_0416114 | 3300049592 | Bacteria | 1106 |
| 748 | Ga0501076_1078579 | 3300049592 | Bacteria | 661 |
| 749 | Ga0501077_0144309 | 3300049593 | Bacteria | 1510 |
| 750 | Ga0501077_0321970 | 3300049593 | Bacteria | 986 |
| 751 | Ga0501077_0716536 | 3300049593 | Bacteria | 643 |
| 752 | Ga0501250_011159 | 3300049680 | Bacteria | 1043 |
| 753 | Ga0501251_026455 | 3300049681 | Bacteria | 803 |
| 754 | Ga0501079_0024479 | 3300049741 | Bacteria | 4633 |
| 755 | Ga0501079_0136778 | 3300049741 | Bacteria | 1908 |
| 756 | Ga0501079_1520603 | 3300049741 | Bacteria | 526 |
| 757 | Ga0501080_0003245 | 3300049742 | Bacteria | 14351 |
| 758 | Ga0501080_0228513 | 3300049742 | Bacteria | 1701 |
| 759 | Ga0501080_1616947 | 3300049742 | Bacteria | 548 |
| 760 | Ga0501081_0046019 | 3300049743 | Unclassified | 2998 |
| 761 | Ga0501081_0224279 | 3300049743 | Bacteria | 1367 |
| 762 | Ga0501081_0331562 | 3300049743 | Bacteria | 1119 |
| 763 | Ga0501081_1104908 | 3300049743 | Bacteria | 600 |
| 764 | Ga0501081_1526504 | 3300049743 | Unclassified | 507 |
| 765 | Ga0501083_0266271 | 3300049744 | Bacteria | 1115 |
| 766 | Ga0501035_0354499 | 3300049822 | Bacteria | 1227 |
| 767 | Ga0501035_0668366 | 3300049822 | Bacteria | 841 |
| 768 | Ga0501035_0967919 | 3300049822 | Bacteria | 671 |
| 769 | Ga0501044_0002910 | 3300049823 | Bacteria | 19486 |
| 770 | Ga0501045_0052824 | 3300049824 | Bacteria | 2968 |
| 771 | Ga0501045_0147026 | 3300049824 | Bacteria | 1753 |
| 772 | Ga0501045_0160675 | 3300049824 | Bacteria | 1672 |
| 773 | Ga0501045_0354368 | 3300049824 | Bacteria | 1092 |
| 774 | nmdc:mga03n38_10923_c1 | 3300050490 | Bacteria | 3364 |
| 775 | nmdc:mga0yw44_677980_c1 | 3300050492 | Bacteria | 700 |
| 776 | nmdc:mga0yw44_740544_c1 | 3300050492 | Bacteria | 668 |
| 777 | nmdc:mga05p37_114059_c1 | 3300050507 | Bacteria | 3322 |
| 778 | nmdc:mga05p37_274869_c1 | 3300050507 | Bacteria | 2012 |
| 779 | nmdc:mga05p37_4595_c1 | 3300050507 | Bacteria | 16136 |
| 780 | nmdc:mga05p37_529690_c1 | 3300050507 | Unclassified | 1346 |
| 781 | nmdc:mga05p37_6470_c1 | 3300050507 | Bacteria | 13817 |
| 782 | nmdc:mga05p37_82474_c1 | 3300050507 | Bacteria | 3962 |
| 783 | nmdc:mga09592_666_c1 | 3300050508 | Bacteria | 26251 |
| 784 | nmdc:mga0qj67_10937_c1 | 3300050509 | Bacteria | 6792 |
| 785 | nmdc:mga06r32_619879_c1 | 3300050510 | Bacteria | 1052 |
| 786 | nmdc:mga06r32_68_c1 | 3300050510 | Bacteria | 67093 |
| 787 | nmdc:mga08y16_72389_c1 | 3300050511 | Bacteria | 3592 |
| 788 | nmdc:mga0n895_102465_c1 | 3300050512 | Unclassified | 2873 |
| 789 | nmdc:mga0n895_1046149_c1 | 3300050512 | Bacteria | 796 |
| 790 | nmdc:mga0n895_1167977_c1 | 3300050512 | Bacteria | 745 |
| 791 | nmdc:mga0rr50_1043611_c1 | 3300050513 | Bacteria | 696 |
| 792 | nmdc:mga0rr50_142762_c1 | 3300050513 | Bacteria | 1928 |
| 793 | nmdc:mga0rr50_233494_c1 | 3300050513 | Bacteria | 1522 |
| 794 | nmdc:mga0rr50_622009_c1 | 3300050513 | Bacteria | 921 |
| 795 | nmdc:mga08x19_513046_c1 | 3300050514 | Bacteria | 847 |
| 796 | nmdc:mga0a205_1195067_c1 | 3300050515 | Bacteria | 608 |
| 797 | nmdc:mga0a205_230167_c1 | 3300050515 | Unclassified | 1737 |
| 798 | nmdc:mga0a205_274469_c1 | 3300050515 | Unclassified | 1562 |
| 799 | nmdc:mga0a205_44922_c1 | 3300050515 | Bacteria | 4260 |
| 800 | Ga0495595_0743561 | 3300053084 | Bacteria | 503 |
| 801 | Ga0495619_0009347 | 3300053085 | Bacteria | 6188 |
| 802 | Ga0500573_0123818 | 3300053140 | Bacteria | 1437 |
| 803 | Ga0501084_0005553 | 3300054114 | Bacteria | 10350 |
| 804 | Ga0501084_0022038 | 3300054114 | Bacteria | 5314 |
| 805 | Ga0501084_0062020 | 3300054114 | Bacteria | 3130 |
| 806 | Ga0501084_0499816 | 3300054114 | Bacteria | 1028 |
| 807 | Ga0501082_0025733 | 3300060353 | Bacteria | 5071 |
| 808 | Ga0501082_0158262 | 3300060353 | Bacteria | 1968 |
| 809 | Ga0466962_0116482 | 3300061719 | Bacteria | 1287 |
| 810 | Ga0466962_0197625 | 3300061719 | Bacteria | 982 |
| 811 | Ga0530510_0000976 | 3300061734 | Bacteria | 18901 |
| 812 | Ga0530510_0064944 | 3300061734 | Bacteria | 2644 |
| 813 | Ga0530510_0066416 | 3300061734 | Bacteria | 2615 |
| 814 | Ga0530510_0219233 | 3300061734 | Bacteria | 1414 |
| 815 | Ga0530510_0787713 | 3300061734 | Bacteria | 725 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025937 | Ga0207669_10141065 | Ga0207669_101410652 | 110 |
| 2 | 3300049582 | Ga0501048_0818873 | Ga0501048_0818873_35_412 | 111 |
| 3 | 3300049568 | Ga0501031_0191105 | Ga0501031_0191105_11_373 | 112 |
| 4 | 3300049576 | Ga0501040_0034224 | Ga0501040_0034224_799_1161 | 112 |
| 5 | 3300049582 | Ga0501048_0059325 | Ga0501048_0059325_1584_1946 | 112 |
| 6 | 3300049588 | Ga0501072_0239574 | Ga0501072_0239574_123_485 | 112 |
| 7 | 3300049592 | Ga0501076_0069269 | Ga0501076_0069269_1577_1939 | 112 |
| 8 | 3300049742 | Ga0501080_1616947 | Ga0501080_1616947_110_472 | 112 |
| 9 | 3300060353 | Ga0501082_0025733 | Ga0501082_0025733_10_372 | 112 |
| 10 | 3300061734 | Ga0530510_0219233 | Ga0530510_0219233_834_1196 | 112 |
| 11 | 3300005983 | Ga0081540_1000147 | Ga0081540_100014720 | 113 |
| 12 | 3300041405 | Ga0439438_010095 | Ga0439438_010095_188_556 | 113 |
| 13 | 3300041406 | Ga0439439_0004602 | Ga0439439_0004602_370_738 | 113 |
| 14 | 3300041410 | Ga0439461_0002508 | Ga0439461_0002508_1654_2022 | 113 |
| 15 | 3300041411 | Ga0439466_0008424 | Ga0439466_0008424_23_391 | 113 |
| 16 | 3300041999 | Ga0439433_0001043 | Ga0439433_0001043_3809_4177 | 113 |
| 17 | 3300042002 | Ga0439442_002705 | Ga0439442_002705_2446_2814 | 113 |
| 18 | 3300042006 | Ga0439432_007408 | Ga0439432_007408_1445_1813 | 113 |
| 19 | 3300042007 | Ga0439449_0021541 | Ga0439449_0021541_1967_2335 | 113 |
| 20 | 3300042010 | Ga0439452_001551 | Ga0439452_001551_1755_2123 | 113 |
| 21 | 3300042015 | Ga0439462_0036097 | Ga0439462_0036097_562_930 | 113 |
| 22 | 3300042115 | Ga0450911_015832 | Ga0450911_015832_157_525 | 113 |
| 23 | 3300042122 | Ga0450920_002134 | Ga0450920_002134_23_391 | 113 |
| 24 | 3300042125 | Ga0450923_103720 | Ga0450923_103720_229_597 | 113 |
| 25 | 3300042156 | Ga0439446_0101769 | Ga0439446_0101769_497_865 | 113 |
| 26 | 3300042435 | Ga0439434_0010414 | Ga0439434_0010414_77_445 | 113 |
| 27 | 3300042531 | Ga0450918_006214 | Ga0450918_006214_1043_1411 | 113 |
| 28 | 3300044683 | Ga0466965_0322388 | Ga0466965_0322388_15_359 | 114 |
| 29 | 3300049580 | Ga0501046_1141696 | Ga0501046_1141696_94_474 | 120 |
| 30 | 3300005471 | Ga0070698_101168717 | Ga0070698_1011687171 | 121 |
| 31 | 3300005445 | Ga0070708_100051868 | Ga0070708_1000518683 | 122 |
| 32 | 3300005467 | Ga0070706_100044924 | Ga0070706_1000449244 | 122 |
| 33 | 3300005468 | Ga0070707_100334253 | Ga0070707_1003342532 | 122 |
| 34 | 3300005471 | Ga0070698_100010563 | Ga0070698_1000105634 | 122 |
| 35 | 3300025922 | Ga0207646_10418482 | Ga0207646_104184822 | 122 |
| 36 | 3300025928 | Ga0207700_10018875 | Ga0207700_100188753 | 122 |
| 37 | 3300042012 | Ga0439455_0064631 | Ga0439455_0064631_361_819 | 122 |
| 38 | 3300005467 | Ga0070706_100023469 | Ga0070706_1000234691 | 125 |
| 39 | 3300005468 | Ga0070707_100004677 | Ga0070707_10000467710 | 125 |
| 40 | 3300005471 | Ga0070698_100061268 | Ga0070698_1000612686 | 125 |
| 41 | 3300005518 | Ga0070699_100004916 | Ga0070699_10000491611 | 125 |
| 42 | 3300005536 | Ga0070697_100034485 | Ga0070697_1000344853 | 125 |
| 43 | 3300025885 | Ga0207653_10193739 | Ga0207653_101937392 | 125 |
| 44 | 3300025910 | Ga0207684_10005946 | Ga0207684_1000594610 | 125 |
| 45 | 3300025922 | Ga0207646_10000810 | Ga0207646_1000081018 | 125 |
| 46 | 3300046615 | Ga0495656_0798743 | Ga0495656_0798743_67_471 | 125 |
| 47 | 3300046648 | Ga0495611_0189667 | Ga0495611_0189667_221_625 | 125 |
| 48 | 3300046681 | Ga0495647_0360829 | Ga0495647_0360829_102_539 | 125 |
| 49 | 3300049578 | Ga0501042_1451182 | Ga0501042_1451182_20_424 | 125 |
| 50 | 3300035171 | Ga0373946_0414083 | Ga0373946_0414083_95_550 | 126 |
| 51 | 3300044656 | Ga0466969_0001395 | Ga0466969_0001395_8960_9406 | 126 |
| 52 | 3300044683 | Ga0466965_0028479 | Ga0466965_0028479_1727_2173 | 126 |
| 53 | 3300044684 | Ga0466966_0001319 | Ga0466966_0001319_8955_9401 | 126 |
| 54 | 3300044735 | Ga0466968_0000453 | Ga0466968_0000453_3707_4153 | 126 |
| 55 | 3300046529 | Ga0495652_0555184 | Ga0495652_0555184_355_768 | 126 |
| 56 | 3300048088 | Ga0495602_0214310 | Ga0495602_0214310_926_1339 | 126 |
| 57 | 3300049576 | Ga0501040_0281353 | Ga0501040_0281353_677_1075 | 126 |
| 58 | 3300049582 | Ga0501048_0424465 | Ga0501048_0424465_250_648 | 126 |
| 59 | 3300049588 | Ga0501072_0099480 | Ga0501072_0099480_353_751 | 126 |
| 60 | 3300049592 | Ga0501076_0045093 | Ga0501076_0045093_1181_1579 | 126 |
| 61 | 3300049741 | Ga0501079_1520603 | Ga0501079_1520603_105_500 | 126 |
| 62 | 3300049743 | Ga0501081_1526504 | Ga0501081_1526504_60_458 | 126 |
| 63 | 3300049824 | Ga0501045_0354368 | Ga0501045_0354368_98_496 | 126 |
| 64 | 3300005471 | Ga0070698_100321331 | Ga0070698_1003213312 | 127 |
| 65 | 3300005518 | Ga0070699_100008312 | Ga0070699_1000083125 | 127 |
| 66 | 3300005518 | Ga0070699_100095998 | Ga0070699_1000959982 | 127 |
| 67 | 3300005719 | Ga0068861_100079687 | Ga0068861_1000796874 | 127 |
| 68 | 3300005844 | Ga0068862_101432361 | Ga0068862_1014323612 | 127 |
| 69 | 3300006028 | Ga0070717_10044905 | Ga0070717_100449054 | 127 |
| 70 | 3300010375 | Ga0105239_11552459 | Ga0105239_115524592 | 127 |
| 71 | 3300025898 | Ga0207692_10005427 | Ga0207692_100054271 | 127 |
| 72 | 3300025929 | Ga0207664_10014599 | Ga0207664_100145994 | 127 |
| 73 | 3300026118 | Ga0207675_100248903 | Ga0207675_1002489032 | 127 |
| 74 | 3300028380 | Ga0268265_11737672 | Ga0268265_117376721 | 127 |
| 75 | 3300032002 | Ga0307416_100123173 | Ga0307416_1001231733 | 127 |
| 76 | 3300032126 | Ga0307415_100156549 | Ga0307415_1001565493 | 127 |
| 77 | 3300036712 | Ga0316584_0908549 | Ga0316584_0908549_116_559 | 127 |
| 78 | 3300037068 | Ga0373925_0000030 | Ga0373925_0000030_40620_41003 | 127 |
| 79 | 3300045976 | Ga0466967_0088154 | Ga0466967_0088154_2334_2717 | 127 |
| 80 | 3300046660 | Ga0495625_0095005 | Ga0495625_0095005_1391_1774 | 127 |
| 81 | 3300049575 | Ga0501039_0452725 | Ga0501039_0452725_597_998 | 127 |
| 82 | 3300049576 | Ga0501040_0566544 | Ga0501040_0566544_19_426 | 127 |
| 83 | 3300049591 | Ga0501075_0852535 | Ga0501075_0852535_11_418 | 127 |
| 84 | 3300031251 | Ga0265327_10055580 | Ga0265327_100555802 | 128 |
| 85 | 3300044683 | Ga0466965_0282735 | Ga0466965_0282735_478_873 | 128 |
| 86 | 3300044683 | Ga0466965_0296119 | Ga0466965_0296119_464_859 | 128 |
| 87 | 3300049572 | Ga0501036_0522638 | Ga0501036_0522638_239_670 | 128 |
| 88 | 3300049577 | Ga0501041_0639051 | Ga0501041_0639051_148_579 | 128 |
| 89 | 3300049743 | Ga0501081_1104908 | Ga0501081_1104908_68_508 | 128 |
| 90 | 3300049822 | Ga0501035_0967919 | Ga0501035_0967919_99_530 | 128 |
| 91 | 3300005435 | Ga0070714_101562135 | Ga0070714_1015621351 | 129 |
| 92 | 3300005439 | Ga0070711_100271825 | Ga0070711_1002718252 | 129 |
| 93 | 3300005459 | Ga0068867_101917561 | Ga0068867_1019175611 | 129 |
| 94 | 3300005564 | Ga0070664_100769973 | Ga0070664_1007699732 | 129 |
| 95 | 3300006175 | Ga0070712_100144772 | Ga0070712_1001447723 | 129 |
| 96 | 3300025906 | Ga0207699_10193973 | Ga0207699_101939732 | 129 |
| 97 | 3300025915 | Ga0207693_10070393 | Ga0207693_100703933 | 129 |
| 98 | 3300036647 | Ga0316582_0007103 | Ga0316582_0007103_4473_4862 | 129 |
| 99 | 3300036712 | Ga0316584_0008202 | Ga0316584_0008202_5993_6382 | 129 |
| 100 | 3300042014 | Ga0439457_144270 | Ga0439457_144270_143_532 | 129 |
| 101 | 3300046477 | Ga0495664_0056716 | Ga0495664_0056716_182_571 | 129 |
| 102 | 3300048929 | Ga0496126_1282181 | Ga0496126_1282181_107_511 | 129 |
| 103 | 3300049592 | Ga0501076_1078579 | Ga0501076_1078579_76_558 | 130 |
| 104 | 3300042876 | Ga0451577_0027239 | Ga0451577_0027239_1052_1510 | 131 |
| 105 | 3300045051 | Ga0451576_0082879 | Ga0451576_0082879_812_1270 | 131 |
| 106 | 3300005985 | Ga0081539_10022851 | Ga0081539_100228513 | 132 |
| 107 | 3300010375 | Ga0105239_10167398 | Ga0105239_101673982 | 132 |
| 108 | 3300049570 | Ga0501033_0711819 | Ga0501033_0711819_222_647 | 132 |
| 109 | 3300049572 | Ga0501036_1342896 | Ga0501036_1342896_36_461 | 132 |
| 110 | 3300049578 | Ga0501042_0336401 | Ga0501042_0336401_226_651 | 132 |
| 111 | 3300049587 | Ga0501071_0662961 | Ga0501071_0662961_50_475 | 132 |
| 112 | 3300049588 | Ga0501072_0853126 | Ga0501072_0853126_138_563 | 132 |
| 113 | 3300049591 | Ga0501075_0456036 | Ga0501075_0456036_180_611 | 132 |
| 114 | 3300049592 | Ga0501076_0416114 | Ga0501076_0416114_535_960 | 132 |
| 115 | 3300049593 | Ga0501077_0321970 | Ga0501077_0321970_217_642 | 132 |
| 116 | 3300054114 | Ga0501084_0499816 | Ga0501084_0499816_383_808 | 132 |
| 117 | 3300061734 | Ga0530510_0787713 | Ga0530510_0787713_44_469 | 132 |
| 118 | 3300005536 | Ga0070697_100794557 | Ga0070697_1007945571 | 133 |
| 119 | 3300006178 | Ga0075367_10175564 | Ga0075367_101755643 | 133 |
| 120 | 3300006847 | Ga0075431_100304997 | Ga0075431_1003049973 | 133 |
| 121 | 3300006852 | Ga0075433_10854832 | Ga0075433_108548322 | 133 |
| 122 | 3300006871 | Ga0075434_101803745 | Ga0075434_1018037451 | 133 |
| 123 | 3300007076 | Ga0075435_100013931 | Ga0075435_1000139314 | 133 |
| 124 | 3300009098 | Ga0105245_11356267 | Ga0105245_113562671 | 133 |
| 125 | 3300009147 | Ga0114129_10039371 | Ga0114129_100393712 | 133 |
| 126 | 3300009147 | Ga0114129_10640313 | Ga0114129_106403132 | 133 |
| 127 | 3300009148 | Ga0105243_10064574 | Ga0105243_100645742 | 133 |
| 128 | 3300025935 | Ga0207709_10130065 | Ga0207709_101300652 | 133 |
| 129 | 3300026121 | Ga0207683_11704069 | Ga0207683_117040692 | 133 |
| 130 | 3300028800 | Ga0265338_10665133 | Ga0265338_106651332 | 133 |
| 131 | 3300048910 | Ga0496107_0027403 | Ga0496107_0027403_3120_3536 | 133 |
| 132 | 3300050507 | nmdc:mga05p37_114059_c1 | nmdc:mga05p37_114059_c1_1113_1550 | 133 |
| 133 | 3300050512 | nmdc:mga0n895_1046149_c1 | nmdc:mga0n895_1046149_c1_35_451 | 133 |
| 134 | 3300050512 | nmdc:mga0n895_1167977_c1 | nmdc:mga0n895_1167977_c1_309_725 | 133 |
| 135 | 3300050513 | nmdc:mga0rr50_1043611_c1 | nmdc:mga0rr50_1043611_c1_214_630 | 133 |
| 136 | 3300050515 | nmdc:mga0a205_44922_c1 | nmdc:mga0a205_44922_c1_2505_2921 | 133 |
| 137 | 3300005329 | Ga0070683_100042967 | Ga0070683_1000429675 | 134 |
| 138 | 3300005336 | Ga0070680_100034038 | Ga0070680_1000340383 | 134 |
| 139 | 3300005341 | Ga0070691_10640899 | Ga0070691_106408991 | 134 |
| 140 | 3300005344 | Ga0070661_100132789 | Ga0070661_1001327892 | 134 |
| 141 | 3300005345 | Ga0070692_10076856 | Ga0070692_100768563 | 134 |
| 142 | 3300005435 | Ga0070714_100006186 | Ga0070714_1000061862 | 134 |
| 143 | 3300005436 | Ga0070713_100023116 | Ga0070713_1000231161 | 134 |
| 144 | 3300005436 | Ga0070713_101678389 | Ga0070713_1016783891 | 134 |
| 145 | 3300005455 | Ga0070663_100303868 | Ga0070663_1003038682 | 134 |
| 146 | 3300005458 | Ga0070681_10013139 | Ga0070681_100131398 | 134 |
| 147 | 3300005530 | Ga0070679_100158938 | Ga0070679_1001589382 | 134 |
| 148 | 3300005535 | Ga0070684_100133409 | Ga0070684_1001334092 | 134 |
| 149 | 3300005614 | Ga0068856_101140462 | Ga0068856_1011404622 | 134 |
| 150 | 3300005616 | Ga0068852_100128461 | Ga0068852_1001284612 | 134 |
| 151 | 3300007076 | Ga0075435_100346912 | Ga0075435_1003469122 | 134 |
| 152 | 3300009093 | Ga0105240_10702059 | Ga0105240_107020592 | 134 |
| 153 | 3300013104 | Ga0157370_10027459 | Ga0157370_100274596 | 134 |
| 154 | 3300013307 | Ga0157372_10617714 | Ga0157372_106177141 | 134 |
| 155 | 3300020070 | Ga0206356_10158036 | Ga0206356_101580362 | 134 |
| 156 | 3300020082 | Ga0206353_10746153 | Ga0206353_107461532 | 134 |
| 157 | 3300025909 | Ga0207705_10225348 | Ga0207705_102253481 | 134 |
| 158 | 3300025912 | Ga0207707_10016074 | Ga0207707_100160744 | 134 |
| 159 | 3300025913 | Ga0207695_10525344 | Ga0207695_105253442 | 134 |
| 160 | 3300025917 | Ga0207660_11024347 | Ga0207660_110243471 | 134 |
| 161 | 3300025921 | Ga0207652_10330545 | Ga0207652_103305452 | 134 |
| 162 | 3300025921 | Ga0207652_11686695 | Ga0207652_116866951 | 134 |
| 163 | 3300025929 | Ga0207664_10620916 | Ga0207664_106209162 | 134 |
| 164 | 3300025944 | Ga0207661_10373687 | Ga0207661_103736872 | 134 |
| 165 | 3300026067 | Ga0207678_10051310 | Ga0207678_100513104 | 134 |
| 166 | 3300026078 | Ga0207702_10102902 | Ga0207702_101029022 | 134 |
| 167 | 3300026116 | Ga0207674_10488082 | Ga0207674_104880822 | 134 |
| 168 | 3300026142 | Ga0207698_10394870 | Ga0207698_103948703 | 134 |
| 169 | 3300036459 | Ga0372808_065229 | Ga0372808_065229_90_494 | 134 |
| 170 | 3300039438 | Ga0436360_0207103 | Ga0436360_0207103_590_1021 | 134 |
| 171 | 3300044694 | Ga0466963_0071419 | Ga0466963_0071419_880_1284 | 134 |
| 172 | 3300045836 | Ga0466958_0801588 | Ga0466958_0801588_67_471 | 134 |
| 173 | 3300050513 | nmdc:mga0rr50_233494_c1 | nmdc:mga0rr50_233494_c1_317_721 | 134 |
| 174 | 3300053140 | Ga0500573_0123818 | Ga0500573_0123818_738_1154 | 134 |
| 175 | 3300044684 | Ga0466966_0337260 | Ga0466966_0337260_158_574 | 135 |
| 176 | 3300044684 | Ga0466966_0613633 | Ga0466966_0613633_63_479 | 135 |
| 177 | 3300044842 | Ga0466957_1041702 | Ga0466957_1041702_34_450 | 135 |
| 178 | 3300045836 | Ga0466958_0104560 | Ga0466958_0104560_804_1220 | 135 |
| 179 | 3300045976 | Ga0466967_0371141 | Ga0466967_0371141_129_545 | 135 |
| 180 | iso_pu_bacteria | 2884634485 | 2884636359 | 135 |
| 181 | 3300046678 | Ga0495599_0322818 | Ga0495599_0322818_427_867 | 136 |
| 182 | 3300005327 | Ga0070658_10349104 | Ga0070658_103491042 | 137 |
| 183 | 3300005329 | Ga0070683_100896515 | Ga0070683_1008965152 | 137 |
| 184 | 3300005336 | Ga0070680_101451868 | Ga0070680_1014518681 | 137 |
| 185 | 3300005339 | Ga0070660_101112209 | Ga0070660_1011122091 | 137 |
| 186 | 3300005365 | Ga0070688_100869797 | Ga0070688_1008697971 | 137 |
| 187 | 3300005367 | Ga0070667_100991429 | Ga0070667_1009914291 | 137 |
| 188 | 3300005435 | Ga0070714_100039755 | Ga0070714_1000397554 | 137 |
| 189 | 3300005535 | Ga0070684_100292857 | Ga0070684_1002928573 | 137 |
| 190 | 3300005577 | Ga0068857_100055005 | Ga0068857_1000550053 | 137 |
| 191 | 3300013105 | Ga0157369_10527153 | Ga0157369_105271532 | 137 |
| 192 | 3300020082 | Ga0206353_10512999 | Ga0206353_105129991 | 137 |
| 193 | 3300025906 | Ga0207699_10157181 | Ga0207699_101571813 | 137 |
| 194 | 3300025909 | Ga0207705_10597153 | Ga0207705_105971532 | 137 |
| 195 | 3300025921 | Ga0207652_10131563 | Ga0207652_101315631 | 137 |
| 196 | 3300025929 | Ga0207664_10006685 | Ga0207664_100066852 | 137 |
| 197 | 3300025944 | Ga0207661_10113278 | Ga0207661_101132781 | 137 |
| 198 | 3300026035 | Ga0207703_10367493 | Ga0207703_103674932 | 137 |
| 199 | 3300026067 | Ga0207678_10005161 | Ga0207678_100051619 | 137 |
| 200 | 3300026116 | Ga0207674_10037488 | Ga0207674_100374886 | 137 |
| 201 | 3300031728 | Ga0316578_10100334 | Ga0316578_101003342 | 137 |
| 202 | 3300036647 | Ga0316582_0386636 | Ga0316582_0386636_461_892 | 137 |
| 203 | 3300036712 | Ga0316584_0069586 | Ga0316584_0069586_2116_2541 | 137 |
| 204 | 3300042436 | Ga0439435_0359065 | Ga0439435_0359065_57_482 | 137 |
| 205 | 3300042437 | Ga0439444_0045391 | Ga0439444_0045391_131_556 | 137 |
| 206 | 3300042993 | Ga0439440_0067327 | Ga0439440_0067327_256_681 | 137 |
| 207 | 3300044694 | Ga0466963_1005773 | Ga0466963_1005773_76_492 | 137 |
| 208 | 3300048929 | Ga0496126_0006325 | Ga0496126_0006325_3284_3697 | 137 |
| 209 | iso_pu_bacteria | 2758568621 | 2760625697 | 137 |
| 210 | iso_pu_bacteria | 2932431166 | 2932434570 | 137 |
| 211 | 3300005445 | Ga0070708_100407210 | Ga0070708_1004072101 | 138 |
| 212 | 3300035117 | Ga0373953_0234389 | Ga0373953_0234389_98_514 | 138 |
| 213 | 3300035172 | Ga0373955_0126229 | Ga0373955_0126229_410_826 | 138 |
| 214 | 3300035692 | Ga0373935_0123214 | Ga0373935_0123214_682_1098 | 138 |
| 215 | 3300035724 | Ga0373933_0311415 | Ga0373933_0311415_424_840 | 138 |
| 216 | 3300036401 | Ga0373937_0373217 | Ga0373937_0373217_766_1182 | 138 |
| 217 | 3300037068 | Ga0373925_0251630 | Ga0373925_0251630_369_785 | 138 |
| 218 | 3300038443 | Ga0395901_1140885 | Ga0395901_1140885_274_690 | 138 |
| 219 | 3300038741 | Ga0400488_22546 | Ga0400488_22546_3523_3966 | 138 |
| 220 | 3300038742 | Ga0400486_06480 | Ga0400486_06480_596_1039 | 138 |
| 221 | 3300046477 | Ga0495664_0212632 | Ga0495664_0212632_666_1082 | 138 |
| 222 | 3300046533 | Ga0495640_0250099 | Ga0495640_0250099_318_734 | 138 |
| 223 | 3300046543 | Ga0495645_0210273 | Ga0495645_0210273_233_649 | 138 |
| 224 | 3300046679 | Ga0495623_0124177 | Ga0495623_0124177_371_787 | 138 |
| 225 | 3300046680 | Ga0495646_0252922 | Ga0495646_0252922_223_639 | 138 |
| 226 | 3300047319 | Ga0495674_0033624 | Ga0495674_0033624_3278_3694 | 138 |
| 227 | 3300047321 | Ga0495676_0062734 | Ga0495676_0062734_2303_2719 | 138 |
| 228 | 3300047471 | Ga0495684_0966574 | Ga0495684_0966574_77_493 | 138 |
| 229 | 3300049589 | Ga0501073_0113612 | Ga0501073_0113612_926_1390 | 138 |
| 230 | 3300050513 | nmdc:mga0rr50_142762_c1 | nmdc:mga0rr50_142762_c1_110_526 | 138 |
| 231 | 3300050514 | nmdc:mga08x19_513046_c1 | nmdc:mga08x19_513046_c1_136_552 | 138 |
| 232 | 3300003203 | JGI25406J46586_10029781 | JGI25406J46586_100297813 | 139 |
| 233 | 3300003320 | rootH2_10141641 | rootH2_101416412 | 139 |
| 234 | 3300005293 | Ga0065715_10481139 | Ga0065715_104811391 | 139 |
| 235 | 3300005336 | Ga0070680_100930835 | Ga0070680_1009308351 | 139 |
| 236 | 3300005347 | Ga0070668_100544746 | Ga0070668_1005447462 | 139 |
| 237 | 3300005434 | Ga0070709_10241624 | Ga0070709_102416242 | 139 |
| 238 | 3300005435 | Ga0070714_100579121 | Ga0070714_1005791212 | 139 |
| 239 | 3300005444 | Ga0070694_100062776 | Ga0070694_1000627763 | 139 |
| 240 | 3300005444 | Ga0070694_100863703 | Ga0070694_1008637032 | 139 |
| 241 | 3300005444 | Ga0070694_100996783 | Ga0070694_1009967831 | 139 |
| 242 | 3300005445 | Ga0070708_100025166 | Ga0070708_1000251663 | 139 |
| 243 | 3300005445 | Ga0070708_100374682 | Ga0070708_1003746822 | 139 |
| 244 | 3300005455 | Ga0070663_100426467 | Ga0070663_1004264672 | 139 |
| 245 | 3300005456 | Ga0070678_101491892 | Ga0070678_1014918921 | 139 |
| 246 | 3300005459 | Ga0068867_101089279 | Ga0068867_1010892791 | 139 |
| 247 | 3300005467 | Ga0070706_100008369 | Ga0070706_1000083694 | 139 |
| 248 | 3300005467 | Ga0070706_100039807 | Ga0070706_1000398072 | 139 |
| 249 | 3300005467 | Ga0070706_100914523 | Ga0070706_1009145232 | 139 |
| 250 | 3300005467 | Ga0070706_101010954 | Ga0070706_1010109542 | 139 |
| 251 | 3300005468 | Ga0070707_100115170 | Ga0070707_1001151704 | 139 |
| 252 | 3300005468 | Ga0070707_100792419 | Ga0070707_1007924191 | 139 |
| 253 | 3300005468 | Ga0070707_100793967 | Ga0070707_1007939671 | 139 |
| 254 | 3300005471 | Ga0070698_100008917 | Ga0070698_1000089173 | 139 |
| 255 | 3300005471 | Ga0070698_100030730 | Ga0070698_1000307304 | 139 |
| 256 | 3300005471 | Ga0070698_100553818 | Ga0070698_1005538182 | 139 |
| 257 | 3300005518 | Ga0070699_100001765 | Ga0070699_1000017654 | 139 |
| 258 | 3300005518 | Ga0070699_100003085 | Ga0070699_10000308510 | 139 |
| 259 | 3300005518 | Ga0070699_100209039 | Ga0070699_1002090393 | 139 |
| 260 | 3300005536 | Ga0070697_100030499 | Ga0070697_1000304994 | 139 |
| 261 | 3300005536 | Ga0070697_100143288 | Ga0070697_1001432884 | 139 |
| 262 | 3300005536 | Ga0070697_100588699 | Ga0070697_1005886992 | 139 |
| 263 | 3300005545 | Ga0070695_100306455 | Ga0070695_1003064551 | 139 |
| 264 | 3300005546 | Ga0070696_100603098 | Ga0070696_1006030981 | 139 |
| 265 | 3300005549 | Ga0070704_100117197 | Ga0070704_1001171972 | 139 |
| 266 | 3300005985 | Ga0081539_10050236 | Ga0081539_100502362 | 139 |
| 267 | 3300006358 | Ga0068871_100389604 | Ga0068871_1003896042 | 139 |
| 268 | 3300006844 | Ga0075428_100011383 | Ga0075428_1000113834 | 139 |
| 269 | 3300006847 | Ga0075431_100032309 | Ga0075431_1000323094 | 139 |
| 270 | 3300006852 | Ga0075433_10012558 | Ga0075433_1001255810 | 139 |
| 271 | 3300006852 | Ga0075433_10402977 | Ga0075433_104029772 | 139 |
| 272 | 3300006852 | Ga0075433_11127855 | Ga0075433_111278552 | 139 |
| 273 | 3300006871 | Ga0075434_100205315 | Ga0075434_1002053154 | 139 |
| 274 | 3300006871 | Ga0075434_100792944 | Ga0075434_1007929442 | 139 |
| 275 | 3300006871 | Ga0075434_102504129 | Ga0075434_1025041291 | 139 |
| 276 | 3300007076 | Ga0075435_100514119 | Ga0075435_1005141192 | 139 |
| 277 | 3300009098 | Ga0105245_10038106 | Ga0105245_100381065 | 139 |
| 278 | 3300009147 | Ga0114129_10037145 | Ga0114129_100371457 | 139 |
| 279 | 3300009147 | Ga0114129_10119005 | Ga0114129_101190055 | 139 |
| 280 | 3300009147 | Ga0114129_10217100 | Ga0114129_102171004 | 139 |
| 281 | 3300009148 | Ga0105243_10049337 | Ga0105243_100493375 | 139 |
| 282 | 3300009148 | Ga0105243_10354433 | Ga0105243_103544333 | 139 |
| 283 | 3300009553 | Ga0105249_11544339 | Ga0105249_115443392 | 139 |
| 284 | 3300013297 | Ga0157378_10758128 | Ga0157378_107581282 | 139 |
| 285 | 3300013308 | Ga0157375_11282500 | Ga0157375_112825002 | 139 |
| 286 | 3300013308 | Ga0157375_11381547 | Ga0157375_113815472 | 139 |
| 287 | 3300013308 | Ga0157375_11725945 | Ga0157375_117259452 | 139 |
| 288 | 3300025885 | Ga0207653_10169033 | Ga0207653_101690332 | 139 |
| 289 | 3300025910 | Ga0207684_10001873 | Ga0207684_100018735 | 139 |
| 290 | 3300025910 | Ga0207684_10051146 | Ga0207684_100511462 | 139 |
| 291 | 3300025910 | Ga0207684_10077409 | Ga0207684_100774092 | 139 |
| 292 | 3300025910 | Ga0207684_10477418 | Ga0207684_104774182 | 139 |
| 293 | 3300025910 | Ga0207684_11191296 | Ga0207684_111912962 | 139 |
| 294 | 3300025910 | Ga0207684_11233635 | Ga0207684_112336351 | 139 |
| 295 | 3300025922 | Ga0207646_10063291 | Ga0207646_100632912 | 139 |
| 296 | 3300025922 | Ga0207646_10111890 | Ga0207646_101118904 | 139 |
| 297 | 3300025922 | Ga0207646_10636349 | Ga0207646_106363492 | 139 |
| 298 | 3300025927 | Ga0207687_10081477 | Ga0207687_100814772 | 139 |
| 299 | 3300025935 | Ga0207709_10250128 | Ga0207709_102501282 | 139 |
| 300 | 3300025937 | Ga0207669_10047195 | Ga0207669_100471953 | 139 |
| 301 | 3300026067 | Ga0207678_10358509 | Ga0207678_103585093 | 139 |
| 302 | 3300026078 | Ga0207702_10198183 | Ga0207702_101981833 | 139 |
| 303 | 3300026088 | Ga0207641_10446132 | Ga0207641_104461321 | 139 |
| 304 | 3300028380 | Ga0268265_10120711 | Ga0268265_101207113 | 139 |
| 305 | 3300028556 | Ga0265337_1059181 | Ga0265337_10591812 | 139 |
| 306 | 3300028558 | Ga0265326_10003278 | Ga0265326_100032784 | 139 |
| 307 | 3300028573 | Ga0265334_10141287 | Ga0265334_101412872 | 139 |
| 308 | 3300028653 | Ga0265323_10033540 | Ga0265323_100335403 | 139 |
| 309 | 3300028666 | Ga0265336_10185858 | Ga0265336_101858581 | 139 |
| 310 | 3300028800 | Ga0265338_10053940 | Ga0265338_100539402 | 139 |
| 311 | 3300031240 | Ga0265320_10067437 | Ga0265320_100674373 | 139 |
| 312 | 3300031241 | Ga0265325_10183799 | Ga0265325_101837992 | 139 |
| 313 | 3300031247 | Ga0265340_10395393 | Ga0265340_103953931 | 139 |
| 314 | 3300031548 | Ga0307408_100055316 | Ga0307408_1000553162 | 139 |
| 315 | 3300031548 | Ga0307408_100378934 | Ga0307408_1003789342 | 139 |
| 316 | 3300031595 | Ga0265313_10020326 | Ga0265313_100203263 | 139 |
| 317 | 3300031711 | Ga0265314_10558013 | Ga0265314_105580131 | 139 |
| 318 | 3300031728 | Ga0316578_10001429 | Ga0316578_100014294 | 139 |
| 319 | 3300031728 | Ga0316578_10129643 | Ga0316578_101296432 | 139 |
| 320 | 3300031728 | Ga0316578_10249332 | Ga0316578_102493322 | 139 |
| 321 | 3300031731 | Ga0307405_10087442 | Ga0307405_100874424 | 139 |
| 322 | 3300031733 | Ga0316577_10100216 | Ga0316577_101002162 | 139 |
| 323 | 3300031733 | Ga0316577_10169988 | Ga0316577_101699882 | 139 |
| 324 | 3300031824 | Ga0307413_10633941 | Ga0307413_106339412 | 139 |
| 325 | 3300031852 | Ga0307410_10063970 | Ga0307410_100639702 | 139 |
| 326 | 3300031903 | Ga0307407_10100189 | Ga0307407_101001892 | 139 |
| 327 | 3300031903 | Ga0307407_10302484 | Ga0307407_103024842 | 139 |
| 328 | 3300032002 | Ga0307416_100440328 | Ga0307416_1004403282 | 139 |
| 329 | 3300032126 | Ga0307415_100134131 | Ga0307415_1001341313 | 139 |
| 330 | 3300032126 | Ga0307415_100181531 | Ga0307415_1001815312 | 139 |
| 331 | 3300035112 | Ga0373932_0087858 | Ga0373932_0087858_129_584 | 139 |
| 332 | 3300035207 | Ga0373942_0321687 | Ga0373942_0321687_43_498 | 139 |
| 333 | 3300035398 | Ga0316574_0451534 | Ga0316574_0451534_31_471 | 139 |
| 334 | 3300035691 | Ga0373931_0088541 | Ga0373931_0088541_652_1119 | 139 |
| 335 | 3300036401 | Ga0373937_1403654 | Ga0373937_1403654_179_628 | 139 |
| 336 | 3300036712 | Ga0316584_0079310 | Ga0316584_0079310_663_1115 | 139 |
| 337 | 3300036712 | Ga0316584_0220539 | Ga0316584_0220539_810_1247 | 139 |
| 338 | 3300036712 | Ga0316584_0265381 | Ga0316584_0265381_642_1079 | 139 |
| 339 | 3300037588 | Ga0316581_0120701 | Ga0316581_0120701_148_585 | 139 |
| 340 | 3300038443 | Ga0395901_0702551 | Ga0395901_0702551_107_580 | 139 |
| 341 | 3300039062 | Ga0400483_278156 | Ga0400483_278156_126_686 | 139 |
| 342 | 3300039437 | Ga0436365_0844020 | Ga0436365_0844020_239_676 | 139 |
| 343 | 3300039450 | Ga0436363_0600429 | Ga0436363_0600429_116_565 | 139 |
| 344 | 3300041512 | Ga0451853_3746540 | Ga0451853_3746540_502_948 | 139 |
| 345 | 3300042120 | Ga0450917_033036 | Ga0450917_033036_51_488 | 139 |
| 346 | 3300042876 | Ga0451577_0025875 | Ga0451577_0025875_3737_4186 | 139 |
| 347 | 3300042876 | Ga0451577_0172109 | Ga0451577_0172109_422_859 | 139 |
| 348 | 3300042876 | Ga0451577_0260292 | Ga0451577_0260292_960_1418 | 139 |
| 349 | 3300042876 | Ga0451577_0698573 | Ga0451577_0698573_122_592 | 139 |
| 350 | 3300042876 | Ga0451577_1878522 | Ga0451577_1878522_35_472 | 139 |
| 351 | 3300044673 | Ga0453683_0424338 | Ga0453683_0424338_335_772 | 139 |
| 352 | 3300044673 | Ga0453683_1206635 | Ga0453683_1206635_23_460 | 139 |
| 353 | 3300044712 | Ga0453684_0005761 | Ga0453684_0005761_566_1003 | 139 |
| 354 | 3300044712 | Ga0453684_0011592 | Ga0453684_0011592_2852_3289 | 139 |
| 355 | 3300044712 | Ga0453684_0060992 | Ga0453684_0060992_4345_4782 | 139 |
| 356 | 3300044712 | Ga0453684_0070272 | Ga0453684_0070272_2365_2841 | 139 |
| 357 | 3300044712 | Ga0453684_0084179 | Ga0453684_0084179_161_598 | 139 |
| 358 | 3300044712 | Ga0453684_0094715 | Ga0453684_0094715_413_850 | 139 |
| 359 | 3300044712 | Ga0453684_0249637 | Ga0453684_0249637_46_483 | 139 |
| 360 | 3300044712 | Ga0453684_0273005 | Ga0453684_0273005_535_972 | 139 |
| 361 | 3300044712 | Ga0453684_0397145 | Ga0453684_0397145_647_1084 | 139 |
| 362 | 3300044712 | Ga0453684_0417903 | Ga0453684_0417903_25_462 | 139 |
| 363 | 3300044712 | Ga0453684_0936446 | Ga0453684_0936446_50_487 | 139 |
| 364 | 3300044712 | Ga0453684_1116163 | Ga0453684_1116163_97_546 | 139 |
| 365 | 3300044712 | Ga0453684_1175856 | Ga0453684_1175856_294_731 | 139 |
| 366 | 3300044712 | Ga0453684_1653345 | Ga0453684_1653345_200_637 | 139 |
| 367 | 3300044712 | Ga0453684_1724368 | Ga0453684_1724368_88_525 | 139 |
| 368 | 3300044712 | Ga0453684_2216442 | Ga0453684_2216442_53_532 | 139 |
| 369 | 3300044719 | Ga0466971_0185512 | Ga0466971_0185512_258_704 | 139 |
| 370 | 3300045051 | Ga0451576_0032861 | Ga0451576_0032861_217_666 | 139 |
| 371 | 3300045051 | Ga0451576_0043213 | Ga0451576_0043213_3304_3741 | 139 |
| 372 | 3300045051 | Ga0451576_0366159 | Ga0451576_0366159_1000_1437 | 139 |
| 373 | 3300045051 | Ga0451576_0518879 | Ga0451576_0518879_67_504 | 139 |
| 374 | 3300045051 | Ga0451576_0570312 | Ga0451576_0570312_453_890 | 139 |
| 375 | 3300046492 | Ga0495585_0054059 | Ga0495585_0054059_1539_1985 | 139 |
| 376 | 3300046499 | Ga0495594_0480762 | Ga0495594_0480762_113_559 | 139 |
| 377 | 3300046500 | Ga0495596_0048204 | Ga0495596_0048204_234_680 | 139 |
| 378 | 3300046500 | Ga0495596_0145478 | Ga0495596_0145478_213_659 | 139 |
| 379 | 3300046520 | Ga0495637_0160373 | Ga0495637_0160373_42_488 | 139 |
| 380 | 3300046523 | Ga0495644_0018012 | Ga0495644_0018012_1489_1935 | 139 |
| 381 | 3300046528 | Ga0495642_0011034 | Ga0495642_0011034_2284_2730 | 139 |
| 382 | 3300046537 | Ga0495598_0016243 | Ga0495598_0016243_796_1242 | 139 |
| 383 | 3300046538 | Ga0495609_0013310 | Ga0495609_0013310_1074_1520 | 139 |
| 384 | 3300046539 | Ga0495621_0188888 | Ga0495621_0188888_13_459 | 139 |
| 385 | 3300046558 | Ga0495633_0258544 | Ga0495633_0258544_146_592 | 139 |
| 386 | 3300046615 | Ga0495656_0003838 | Ga0495656_0003838_1589_2035 | 139 |
| 387 | 3300046615 | Ga0495656_0037578 | Ga0495656_0037578_778_1224 | 139 |
| 388 | 3300046615 | Ga0495656_0428594 | Ga0495656_0428594_55_501 | 139 |
| 389 | 3300046616 | Ga0495668_0383792 | Ga0495668_0383792_279_725 | 139 |
| 390 | 3300046648 | Ga0495611_0306153 | Ga0495611_0306153_58_504 | 139 |
| 391 | 3300046664 | Ga0495659_0001304 | Ga0495659_0001304_1521_1967 | 139 |
| 392 | 3300046683 | Ga0495658_0962286 | Ga0495658_0962286_87_533 | 139 |
| 393 | 3300046684 | Ga0495669_0054248 | Ga0495669_0054248_389_835 | 139 |
| 394 | 3300046691 | Ga0495670_0030538 | Ga0495670_0030538_708_1154 | 139 |
| 395 | 3300046691 | Ga0495670_0097227 | Ga0495670_0097227_320_766 | 139 |
| 396 | 3300046794 | Ga0495589_0040145 | Ga0495589_0040145_28_474 | 139 |
| 397 | 3300047321 | Ga0495676_0137748 | Ga0495676_0137748_970_1416 | 139 |
| 398 | 3300047322 | Ga0495680_0328656 | Ga0495680_0328656_417_863 | 139 |
| 399 | 3300047446 | Ga0495679_106466 | Ga0495679_106466_119_565 | 139 |
| 400 | 3300048090 | Ga0495615_0030275 | Ga0495615_0030275_194_640 | 139 |
| 401 | 3300048904 | Ga0496101_0021168 | Ga0496101_0021168_269_715 | 139 |
| 402 | 3300048905 | Ga0496102_0721390 | Ga0496102_0721390_357_803 | 139 |
| 403 | 3300048915 | Ga0496112_1098284 | Ga0496112_1098284_91_537 | 139 |
| 404 | 3300048917 | Ga0496114_0165868 | Ga0496114_0165868_323_769 | 139 |
| 405 | 3300049521 | Ga0501298_138911 | Ga0501298_138911_97_534 | 139 |
| 406 | 3300049569 | Ga0501032_0587619 | Ga0501032_0587619_90_536 | 139 |
| 407 | 3300049570 | Ga0501033_0504403 | Ga0501033_0504403_164_601 | 139 |
| 408 | 3300049572 | Ga0501036_0904065 | Ga0501036_0904065_225_671 | 139 |
| 409 | 3300049574 | Ga0501038_0216725 | Ga0501038_0216725_12_458 | 139 |
| 410 | 3300049575 | Ga0501039_0920092 | Ga0501039_0920092_106_552 | 139 |
| 411 | 3300049576 | Ga0501040_0026767 | Ga0501040_0026767_1747_2220 | 139 |
| 412 | 3300049576 | Ga0501040_0029531 | Ga0501040_0029531_1673_2119 | 139 |
| 413 | 3300049576 | Ga0501040_0338282 | Ga0501040_0338282_405_851 | 139 |
| 414 | 3300049577 | Ga0501041_0109185 | Ga0501041_0109185_1030_1503 | 139 |
| 415 | 3300049577 | Ga0501041_0136052 | Ga0501041_0136052_27_470 | 139 |
| 416 | 3300049578 | Ga0501042_0431489 | Ga0501042_0431489_498_944 | 139 |
| 417 | 3300049579 | Ga0501043_0077263 | Ga0501043_0077263_686_1132 | 139 |
| 418 | 3300049580 | Ga0501046_0050384 | Ga0501046_0050384_1485_1928 | 139 |
| 419 | 3300049580 | Ga0501046_0150316 | Ga0501046_0150316_1125_1571 | 139 |
| 420 | 3300049580 | Ga0501046_0444694 | Ga0501046_0444694_405_842 | 139 |
| 421 | 3300049580 | Ga0501046_0866652 | Ga0501046_0866652_137_607 | 139 |
| 422 | 3300049582 | Ga0501048_0069827 | Ga0501048_0069827_988_1461 | 139 |
| 423 | 3300049584 | Ga0501068_0099449 | Ga0501068_0099449_1142_1588 | 139 |
| 424 | 3300049585 | Ga0501069_0519802 | Ga0501069_0519802_173_646 | 139 |
| 425 | 3300049586 | Ga0501070_0924090 | Ga0501070_0924090_147_593 | 139 |
| 426 | 3300049587 | Ga0501071_0045384 | Ga0501071_0045384_185_658 | 139 |
| 427 | 3300049587 | Ga0501071_0385144 | Ga0501071_0385144_270_716 | 139 |
| 428 | 3300049587 | Ga0501071_0543300 | Ga0501071_0543300_204_650 | 139 |
| 429 | 3300049588 | Ga0501072_0023641 | Ga0501072_0023641_3362_3799 | 139 |
| 430 | 3300049588 | Ga0501072_0058318 | Ga0501072_0058318_694_1140 | 139 |
| 431 | 3300049588 | Ga0501072_0059442 | Ga0501072_0059442_761_1207 | 139 |
| 432 | 3300049590 | Ga0501074_0320885 | Ga0501074_0320885_606_1052 | 139 |
| 433 | 3300049590 | Ga0501074_0382645 | Ga0501074_0382645_21_464 | 139 |
| 434 | 3300049590 | Ga0501074_0530180 | Ga0501074_0530180_324_761 | 139 |
| 435 | 3300049591 | Ga0501075_0030185 | Ga0501075_0030185_1535_2008 | 139 |
| 436 | 3300049591 | Ga0501075_0104614 | Ga0501075_0104614_458_904 | 139 |
| 437 | 3300049591 | Ga0501075_0247582 | Ga0501075_0247582_381_818 | 139 |
| 438 | 3300049591 | Ga0501075_0945410 | Ga0501075_0945410_172_618 | 139 |
| 439 | 3300049592 | Ga0501076_0053550 | Ga0501076_0053550_1420_1857 | 139 |
| 440 | 3300049592 | Ga0501076_0076460 | Ga0501076_0076460_1468_1914 | 139 |
| 441 | 3300049592 | Ga0501076_0162391 | Ga0501076_0162391_1119_1565 | 139 |
| 442 | 3300049592 | Ga0501076_0215329 | Ga0501076_0215329_453_899 | 139 |
| 443 | 3300049593 | Ga0501077_0144309 | Ga0501077_0144309_413_859 | 139 |
| 444 | 3300049593 | Ga0501077_0716536 | Ga0501077_0716536_171_608 | 139 |
| 445 | 3300049741 | Ga0501079_0024479 | Ga0501079_0024479_1614_2051 | 139 |
| 446 | 3300049742 | Ga0501080_0228513 | Ga0501080_0228513_334_807 | 139 |
| 447 | 3300049743 | Ga0501081_0046019 | Ga0501081_0046019_1684_2127 | 139 |
| 448 | 3300049743 | Ga0501081_0224279 | Ga0501081_0224279_399_845 | 139 |
| 449 | 3300049743 | Ga0501081_0331562 | Ga0501081_0331562_290_763 | 139 |
| 450 | 3300049744 | Ga0501083_0266271 | Ga0501083_0266271_462_935 | 139 |
| 451 | 3300049822 | Ga0501035_0354499 | Ga0501035_0354499_87_560 | 139 |
| 452 | 3300049822 | Ga0501035_0668366 | Ga0501035_0668366_100_546 | 139 |
| 453 | 3300049824 | Ga0501045_0052824 | Ga0501045_0052824_296_769 | 139 |
| 454 | 3300049824 | Ga0501045_0147026 | Ga0501045_0147026_249_692 | 139 |
| 455 | 3300049824 | Ga0501045_0160675 | Ga0501045_0160675_303_749 | 139 |
| 456 | 3300050507 | nmdc:mga05p37_274869_c1 | nmdc:mga05p37_274869_c1_360_797 | 139 |
| 457 | 3300050507 | nmdc:mga05p37_529690_c1 | nmdc:mga05p37_529690_c1_330_767 | 139 |
| 458 | 3300050507 | nmdc:mga05p37_6470_c1 | nmdc:mga05p37_6470_c1_3857_4294 | 139 |
| 459 | 3300050507 | nmdc:mga05p37_82474_c1 | nmdc:mga05p37_82474_c1_3416_3862 | 139 |
| 460 | 3300050510 | nmdc:mga06r32_619879_c1 | nmdc:mga06r32_619879_c1_529_966 | 139 |
| 461 | 3300050512 | nmdc:mga0n895_102465_c1 | nmdc:mga0n895_102465_c1_553_990 | 139 |
| 462 | 3300050513 | nmdc:mga0rr50_622009_c1 | nmdc:mga0rr50_622009_c1_278_727 | 139 |
| 463 | 3300050515 | nmdc:mga0a205_1195067_c1 | nmdc:mga0a205_1195067_c1_131_577 | 139 |
| 464 | 3300050515 | nmdc:mga0a205_230167_c1 | nmdc:mga0a205_230167_c1_131_580 | 139 |
| 465 | 3300050515 | nmdc:mga0a205_274469_c1 | nmdc:mga0a205_274469_c1_638_1075 | 139 |
| 466 | 3300054114 | Ga0501084_0022038 | Ga0501084_0022038_4498_4944 | 139 |
| 467 | 3300054114 | Ga0501084_0062020 | Ga0501084_0062020_1524_1997 | 139 |
| 468 | 3300060353 | Ga0501082_0158262 | Ga0501082_0158262_972_1409 | 139 |
| 469 | 3300061734 | Ga0530510_0000976 | Ga0530510_0000976_8668_9114 | 139 |
| 470 | 3300061734 | Ga0530510_0064944 | Ga0530510_0064944_332_805 | 139 |
| 471 | 3300061734 | Ga0530510_0066416 | Ga0530510_0066416_1349_1786 | 139 |
| 472 | 3300005334 | Ga0068869_101981643 | Ga0068869_1019816431 | 140 |
| 473 | 3300005337 | Ga0070682_101471162 | Ga0070682_1014711621 | 140 |
| 474 | 3300005339 | Ga0070660_101851610 | Ga0070660_1018516101 | 140 |
| 475 | 3300005354 | Ga0070675_101632480 | Ga0070675_1016324801 | 140 |
| 476 | 3300005365 | Ga0070688_101250772 | Ga0070688_1012507721 | 140 |
| 477 | 3300005435 | Ga0070714_100987465 | Ga0070714_1009874651 | 140 |
| 478 | 3300005436 | Ga0070713_100507849 | Ga0070713_1005078491 | 140 |
| 479 | 3300005456 | Ga0070678_101340062 | Ga0070678_1013400621 | 140 |
| 480 | 3300005530 | Ga0070679_101311381 | Ga0070679_1013113811 | 140 |
| 481 | 3300005564 | Ga0070664_100990462 | Ga0070664_1009904621 | 140 |
| 482 | 3300005843 | Ga0068860_101840571 | Ga0068860_1018405711 | 140 |
| 483 | 3300005937 | Ga0081455_10003072 | Ga0081455_1000307210 | 140 |
| 484 | 3300005937 | Ga0081455_10021544 | Ga0081455_100215442 | 140 |
| 485 | 3300005981 | Ga0081538_10131353 | Ga0081538_101313532 | 140 |
| 486 | 3300005983 | Ga0081540_1040203 | Ga0081540_10402032 | 140 |
| 487 | 3300006881 | Ga0068865_100489785 | Ga0068865_1004897851 | 140 |
| 488 | 3300009148 | Ga0105243_12082000 | Ga0105243_120820001 | 140 |
| 489 | 3300009176 | Ga0105242_11616189 | Ga0105242_116161891 | 140 |
| 490 | 3300009551 | Ga0105238_10677881 | Ga0105238_106778811 | 140 |
| 491 | 3300009553 | Ga0105249_12838535 | Ga0105249_128385351 | 140 |
| 492 | 3300011119 | Ga0105246_10613460 | Ga0105246_106134601 | 140 |
| 493 | 3300013307 | Ga0157372_10912185 | Ga0157372_109121852 | 140 |
| 494 | 3300013308 | Ga0157375_11666526 | Ga0157375_116665262 | 140 |
| 495 | 3300014325 | Ga0163163_10430087 | Ga0163163_104300872 | 140 |
| 496 | 3300020082 | Ga0206353_10956333 | Ga0206353_109563331 | 140 |
| 497 | 3300025901 | Ga0207688_10528291 | Ga0207688_105282912 | 140 |
| 498 | 3300025921 | Ga0207652_10225671 | Ga0207652_102256713 | 140 |
| 499 | 3300025921 | Ga0207652_11153544 | Ga0207652_111535441 | 140 |
| 500 | 3300025928 | Ga0207700_10301392 | Ga0207700_103013922 | 140 |
| 501 | 3300025945 | Ga0207679_11109779 | Ga0207679_111097792 | 140 |
| 502 | 3300026075 | Ga0207708_11150904 | Ga0207708_111509042 | 140 |
| 503 | 3300026095 | Ga0207676_10096184 | Ga0207676_100961842 | 140 |
| 504 | 3300026121 | Ga0207683_10184287 | Ga0207683_101842872 | 140 |
| 505 | 3300028381 | Ga0268264_10783606 | Ga0268264_107836062 | 140 |
| 506 | 3300031456 | Ga0307513_10000007 | Ga0307513_10000007194 | 140 |
| 507 | 3300031548 | Ga0307408_100315152 | Ga0307408_1003151522 | 140 |
| 508 | 3300031727 | Ga0316576_10081447 | Ga0316576_100814471 | 140 |
| 509 | 3300031824 | Ga0307413_10072770 | Ga0307413_100727702 | 140 |
| 510 | 3300031824 | Ga0307413_10121364 | Ga0307413_101213642 | 140 |
| 511 | 3300031852 | Ga0307410_10072123 | Ga0307410_100721232 | 140 |
| 512 | 3300031852 | Ga0307410_10083361 | Ga0307410_100833612 | 140 |
| 513 | 3300031852 | Ga0307410_10105655 | Ga0307410_101056551 | 140 |
| 514 | 3300031852 | Ga0307410_10175203 | Ga0307410_101752032 | 140 |
| 515 | 3300031852 | Ga0307410_10921798 | Ga0307410_109217982 | 140 |
| 516 | 3300031852 | Ga0307410_11247686 | Ga0307410_112476861 | 140 |
| 517 | 3300031901 | Ga0307406_10157618 | Ga0307406_101576183 | 140 |
| 518 | 3300031901 | Ga0307406_10252857 | Ga0307406_102528572 | 140 |
| 519 | 3300031901 | Ga0307406_10441569 | Ga0307406_104415692 | 140 |
| 520 | 3300031903 | Ga0307407_10126213 | Ga0307407_101262132 | 140 |
| 521 | 3300031903 | Ga0307407_10206911 | Ga0307407_102069112 | 140 |
| 522 | 3300031911 | Ga0307412_10207847 | Ga0307412_102078472 | 140 |
| 523 | 3300031911 | Ga0307412_10679099 | Ga0307412_106790992 | 140 |
| 524 | 3300031995 | Ga0307409_100079320 | Ga0307409_1000793204 | 140 |
| 525 | 3300031995 | Ga0307409_100104357 | Ga0307409_1001043572 | 140 |
| 526 | 3300031995 | Ga0307409_100287800 | Ga0307409_1002878002 | 140 |
| 527 | 3300031995 | Ga0307409_100317354 | Ga0307409_1003173542 | 140 |
| 528 | 3300031995 | Ga0307409_100666561 | Ga0307409_1006665612 | 140 |
| 529 | 3300031995 | Ga0307409_101471037 | Ga0307409_1014710371 | 140 |
| 530 | 3300031995 | Ga0307409_102133278 | Ga0307409_1021332782 | 140 |
| 531 | 3300032002 | Ga0307416_100175852 | Ga0307416_1001758521 | 140 |
| 532 | 3300032002 | Ga0307416_100209363 | Ga0307416_1002093632 | 140 |
| 533 | 3300032002 | Ga0307416_100228086 | Ga0307416_1002280863 | 140 |
| 534 | 3300032002 | Ga0307416_100336810 | Ga0307416_1003368102 | 140 |
| 535 | 3300032002 | Ga0307416_100935533 | Ga0307416_1009355331 | 140 |
| 536 | 3300032002 | Ga0307416_101062954 | Ga0307416_1010629541 | 140 |
| 537 | 3300032004 | Ga0307414_10361052 | Ga0307414_103610522 | 140 |
| 538 | 3300032004 | Ga0307414_10627941 | Ga0307414_106279412 | 140 |
| 539 | 3300032005 | Ga0307411_10119245 | Ga0307411_101192452 | 140 |
| 540 | 3300032126 | Ga0307415_100060385 | Ga0307415_1000603853 | 140 |
| 541 | 3300035114 | Ga0373939_0530907 | Ga0373939_0530907_26_493 | 140 |
| 542 | 3300035398 | Ga0316574_0495370 | Ga0316574_0495370_187_645 | 140 |
| 543 | 3300036712 | Ga0316584_0155639 | Ga0316584_0155639_600_1058 | 140 |
| 544 | 3300037418 | Ga0395900_0028223 | Ga0395900_0028223_3002_3433 | 140 |
| 545 | 3300037466 | Ga0395898_0377321 | Ga0395898_0377321_379_861 | 140 |
| 546 | 3300038443 | Ga0395901_0092832 | Ga0395901_0092832_1061_1492 | 140 |
| 547 | 3300039062 | Ga0400483_044090 | Ga0400483_044090_24374_24820 | 140 |
| 548 | 3300039062 | Ga0400483_075002 | Ga0400483_075002_173_616 | 140 |
| 549 | 3300039062 | Ga0400483_237049 | Ga0400483_237049_26564_27010 | 140 |
| 550 | 3300039062 | Ga0400483_247042 | Ga0400483_247042_20019_20459 | 140 |
| 551 | 3300041999 | Ga0439433_0022172 | Ga0439433_0022172_326_748 | 140 |
| 552 | 3300044656 | Ga0466969_0062005 | Ga0466969_0062005_690_1121 | 140 |
| 553 | 3300044683 | Ga0466965_0202951 | Ga0466965_0202951_579_1010 | 140 |
| 554 | 3300044683 | Ga0466965_0217741 | Ga0466965_0217741_343_774 | 140 |
| 555 | 3300044683 | Ga0466965_0297259 | Ga0466965_0297259_306_737 | 140 |
| 556 | 3300044684 | Ga0466966_0113190 | Ga0466966_0113190_1115_1546 | 140 |
| 557 | 3300044693 | Ga0466961_0052562 | Ga0466961_0052562_218_649 | 140 |
| 558 | 3300044693 | Ga0466961_0330038 | Ga0466961_0330038_28_459 | 140 |
| 559 | 3300044693 | Ga0466961_0854944 | Ga0466961_0854944_73_504 | 140 |
| 560 | 3300044694 | Ga0466963_0080405 | Ga0466963_0080405_1647_2072 | 140 |
| 561 | 3300044694 | Ga0466963_0186593 | Ga0466963_0186593_485_973 | 140 |
| 562 | 3300044694 | Ga0466963_0469426 | Ga0466963_0469426_368_799 | 140 |
| 563 | 3300044706 | Ga0466964_0444641 | Ga0466964_0444641_36_467 | 140 |
| 564 | 3300044719 | Ga0466971_0100204 | Ga0466971_0100204_158_583 | 140 |
| 565 | 3300044719 | Ga0466971_0120029 | Ga0466971_0120029_734_1165 | 140 |
| 566 | 3300044719 | Ga0466971_0135545 | Ga0466971_0135545_657_1088 | 140 |
| 567 | 3300044719 | Ga0466971_0171065 | Ga0466971_0171065_579_1010 | 140 |
| 568 | 3300044765 | Ga0466970_0052504 | Ga0466970_0052504_606_1037 | 140 |
| 569 | 3300044765 | Ga0466970_0115921 | Ga0466970_0115921_269_700 | 140 |
| 570 | 3300044842 | Ga0466957_0069844 | Ga0466957_0069844_337_768 | 140 |
| 571 | 3300044842 | Ga0466957_0082097 | Ga0466957_0082097_114_539 | 140 |
| 572 | 3300044842 | Ga0466957_0137240 | Ga0466957_0137240_1080_1505 | 140 |
| 573 | 3300044842 | Ga0466957_0540242 | Ga0466957_0540242_13_444 | 140 |
| 574 | 3300044901 | Ga0466960_0055537 | Ga0466960_0055537_558_989 | 140 |
| 575 | 3300044901 | Ga0466960_0094815 | Ga0466960_0094815_805_1236 | 140 |
| 576 | 3300044901 | Ga0466960_0353407 | Ga0466960_0353407_318_749 | 140 |
| 577 | 3300044901 | Ga0466960_0998558 | Ga0466960_0998558_18_449 | 140 |
| 578 | 3300045049 | Ga0466959_0037787 | Ga0466959_0037787_1115_1546 | 140 |
| 579 | 3300045049 | Ga0466959_0373429 | Ga0466959_0373429_513_944 | 140 |
| 580 | 3300045049 | Ga0466959_0397932 | Ga0466959_0397932_24_455 | 140 |
| 581 | 3300045049 | Ga0466959_0408537 | Ga0466959_0408537_347_778 | 140 |
| 582 | 3300045049 | Ga0466959_0677772 | Ga0466959_0677772_200_631 | 140 |
| 583 | 3300045049 | Ga0466959_0824203 | Ga0466959_0824203_154_576 | 140 |
| 584 | 3300045836 | Ga0466958_0080154 | Ga0466958_0080154_276_707 | 140 |
| 585 | 3300045836 | Ga0466958_0438611 | Ga0466958_0438611_156_644 | 140 |
| 586 | 3300045976 | Ga0466967_0007996 | Ga0466967_0007996_4653_5114 | 140 |
| 587 | 3300045976 | Ga0466967_0078990 | Ga0466967_0078990_476_901 | 140 |
| 588 | 3300045976 | Ga0466967_0100462 | Ga0466967_0100462_1400_1831 | 140 |
| 589 | 3300045976 | Ga0466967_0137995 | Ga0466967_0137995_612_1043 | 140 |
| 590 | 3300045976 | Ga0466967_0300468 | Ga0466967_0300468_371_802 | 140 |
| 591 | 3300045976 | Ga0466967_0591830 | Ga0466967_0591830_70_501 | 140 |
| 592 | 3300045976 | Ga0466967_0833759 | Ga0466967_0833759_147_584 | 140 |
| 593 | 3300046459 | Ga0495629_0081597 | Ga0495629_0081597_750_1196 | 140 |
| 594 | 3300046461 | Ga0495641_0412581 | Ga0495641_0412581_97_543 | 140 |
| 595 | 3300046463 | Ga0495653_0035942 | Ga0495653_0035942_2502_2954 | 140 |
| 596 | 3300046473 | Ga0495582_0385902 | Ga0495582_0385902_93_545 | 140 |
| 597 | 3300046475 | Ga0495639_0144800 | Ga0495639_0144800_69_515 | 140 |
| 598 | 3300046514 | Ga0495618_0419328 | Ga0495618_0419328_243_695 | 140 |
| 599 | 3300046516 | Ga0495628_0008040 | Ga0495628_0008040_6491_6943 | 140 |
| 600 | 3300046517 | Ga0495630_0005586 | Ga0495630_0005586_3586_4038 | 140 |
| 601 | 3300046526 | Ga0495666_0010115 | Ga0495666_0010115_2595_3047 | 140 |
| 602 | 3300046537 | Ga0495598_0148262 | Ga0495598_0148262_71_496 | 140 |
| 603 | 3300046559 | Ga0495667_0063928 | Ga0495667_0063928_230_682 | 140 |
| 604 | 3300046683 | Ga0495658_0120321 | Ga0495658_0120321_724_1170 | 140 |
| 605 | 3300046683 | Ga0495658_0436336 | Ga0495658_0436336_367_813 | 140 |
| 606 | 3300046683 | Ga0495658_0443908 | Ga0495658_0443908_98_550 | 140 |
| 607 | 3300047319 | Ga0495674_0614254 | Ga0495674_0614254_315_767 | 140 |
| 608 | 3300047322 | Ga0495680_0244801 | Ga0495680_0244801_765_1217 | 140 |
| 609 | 3300047323 | Ga0495683_0335875 | Ga0495683_0335875_31_465 | 140 |
| 610 | 3300047471 | Ga0495684_0017695 | Ga0495684_0017695_4208_4660 | 140 |
| 611 | 3300048904 | Ga0496101_1262802 | Ga0496101_1262802_13_450 | 140 |
| 612 | 3300048917 | Ga0496114_0518778 | Ga0496114_0518778_145_591 | 140 |
| 613 | 3300048917 | Ga0496114_0688244 | Ga0496114_0688244_128_598 | 140 |
| 614 | 3300049571 | Ga0501034_0936063 | Ga0501034_0936063_149_574 | 140 |
| 615 | 3300049590 | Ga0501074_0229138 | Ga0501074_0229138_69_512 | 140 |
| 616 | 3300049680 | Ga0501250_011159 | Ga0501250_011159_465_911 | 140 |
| 617 | 3300049681 | Ga0501251_026455 | Ga0501251_026455_301_747 | 140 |
| 618 | 3300050490 | nmdc:mga03n38_10923_c1 | nmdc:mga03n38_10923_c1_810_1247 | 140 |
| 619 | 3300053085 | Ga0495619_0009347 | Ga0495619_0009347_4146_4598 | 140 |
| 620 | 3300061719 | Ga0466962_0116482 | Ga0466962_0116482_512_943 | 140 |
| 621 | 3300061719 | Ga0466962_0197625 | Ga0466962_0197625_233_664 | 140 |
| 622 | iso_pu_bacteria | 2731639228 | 2731905904 | 140 |
| 623 | 3300001979 | JGI24740J21852_10124853 | JGI24740J21852_101248531 | 141 |
| 624 | 3300003203 | JGI25406J46586_10046635 | JGI25406J46586_100466352 | 141 |
| 625 | 3300005330 | Ga0070690_100114157 | Ga0070690_1001141573 | 141 |
| 626 | 3300005337 | Ga0070682_100275204 | Ga0070682_1002752042 | 141 |
| 627 | 3300005337 | Ga0070682_100574345 | Ga0070682_1005743451 | 141 |
| 628 | 3300005337 | Ga0070682_101127942 | Ga0070682_1011279421 | 141 |
| 629 | 3300005355 | Ga0070671_100200029 | Ga0070671_1002000292 | 141 |
| 630 | 3300005366 | Ga0070659_100269620 | Ga0070659_1002696202 | 141 |
| 631 | 3300005434 | Ga0070709_10000243 | Ga0070709_1000024332 | 141 |
| 632 | 3300005435 | Ga0070714_100002623 | Ga0070714_10000262314 | 141 |
| 633 | 3300005435 | Ga0070714_100026307 | Ga0070714_1000263072 | 141 |
| 634 | 3300005436 | Ga0070713_100069794 | Ga0070713_1000697945 | 141 |
| 635 | 3300005436 | Ga0070713_100124001 | Ga0070713_1001240012 | 141 |
| 636 | 3300005437 | Ga0070710_10647177 | Ga0070710_106471771 | 141 |
| 637 | 3300005439 | Ga0070711_100005834 | Ga0070711_1000058346 | 141 |
| 638 | 3300005456 | Ga0070678_100859280 | Ga0070678_1008592801 | 141 |
| 639 | 3300005456 | Ga0070678_101331697 | Ga0070678_1013316971 | 141 |
| 640 | 3300005456 | Ga0070678_101356120 | Ga0070678_1013561201 | 141 |
| 641 | 3300005467 | Ga0070706_100000535 | Ga0070706_10000053510 | 141 |
| 642 | 3300005468 | Ga0070707_100001203 | Ga0070707_10000120310 | 141 |
| 643 | 3300005471 | Ga0070698_100001558 | Ga0070698_10000155810 | 141 |
| 644 | 3300005535 | Ga0070684_101607352 | Ga0070684_1016073521 | 141 |
| 645 | 3300005548 | Ga0070665_100278101 | Ga0070665_1002781013 | 141 |
| 646 | 3300005614 | Ga0068856_100147913 | Ga0068856_1001479132 | 141 |
| 647 | 3300005719 | Ga0068861_101036755 | Ga0068861_1010367552 | 141 |
| 648 | 3300005937 | Ga0081455_10000125 | Ga0081455_1000012557 | 141 |
| 649 | 3300005937 | Ga0081455_10031896 | Ga0081455_100318962 | 141 |
| 650 | 3300005985 | Ga0081539_10301175 | Ga0081539_103011751 | 141 |
| 651 | 3300006028 | Ga0070717_10008469 | Ga0070717_100084697 | 141 |
| 652 | 3300006028 | Ga0070717_10022387 | Ga0070717_100223871 | 141 |
| 653 | 3300006028 | Ga0070717_10346818 | Ga0070717_103468182 | 141 |
| 654 | 3300006163 | Ga0070715_10019535 | Ga0070715_100195353 | 141 |
| 655 | 3300006173 | Ga0070716_100002854 | Ga0070716_1000028544 | 141 |
| 656 | 3300006173 | Ga0070716_100468628 | Ga0070716_1004686282 | 141 |
| 657 | 3300006175 | Ga0070712_100114727 | Ga0070712_1001147272 | 141 |
| 658 | 3300006175 | Ga0070712_100144039 | Ga0070712_1001440392 | 141 |
| 659 | 3300006175 | Ga0070712_100429456 | Ga0070712_1004294562 | 141 |
| 660 | 3300006844 | Ga0075428_100035847 | Ga0075428_1000358476 | 141 |
| 661 | 3300006846 | Ga0075430_100007507 | Ga0075430_1000075078 | 141 |
| 662 | 3300006847 | Ga0075431_100199687 | Ga0075431_1001996874 | 141 |
| 663 | 3300006871 | Ga0075434_100093239 | Ga0075434_1000932392 | 141 |
| 664 | 3300006880 | Ga0075429_101811210 | Ga0075429_1018112101 | 141 |
| 665 | 3300006880 | Ga0075429_101811211 | Ga0075429_1018112111 | 141 |
| 666 | 3300006914 | Ga0075436_100482023 | Ga0075436_1004820232 | 141 |
| 667 | 3300007076 | Ga0075435_100033678 | Ga0075435_1000336784 | 141 |
| 668 | 3300009094 | Ga0111539_10041267 | Ga0111539_100412674 | 141 |
| 669 | 3300009147 | Ga0114129_10042088 | Ga0114129_100420889 | 141 |
| 670 | 3300009147 | Ga0114129_12721635 | Ga0114129_127216351 | 141 |
| 671 | 3300009551 | Ga0105238_10210629 | Ga0105238_102106292 | 141 |
| 672 | 3300011119 | Ga0105246_10300029 | Ga0105246_103000292 | 141 |
| 673 | 3300013105 | Ga0157369_10040204 | Ga0157369_100402043 | 141 |
| 674 | 3300013306 | Ga0163162_10921625 | Ga0163162_109216252 | 141 |
| 675 | 3300014325 | Ga0163163_10458610 | Ga0163163_104586102 | 141 |
| 676 | 3300014325 | Ga0163163_11018756 | Ga0163163_110187562 | 141 |
| 677 | 3300014745 | Ga0157377_11117914 | Ga0157377_111179141 | 141 |
| 678 | 3300025898 | Ga0207692_10014684 | Ga0207692_100146846 | 141 |
| 679 | 3300025901 | Ga0207688_10094259 | Ga0207688_100942592 | 141 |
| 680 | 3300025905 | Ga0207685_10001778 | Ga0207685_100017782 | 141 |
| 681 | 3300025906 | Ga0207699_10001799 | Ga0207699_100017996 | 141 |
| 682 | 3300025910 | Ga0207684_10000603 | Ga0207684_1000060337 | 141 |
| 683 | 3300025915 | Ga0207693_10095339 | Ga0207693_100953391 | 141 |
| 684 | 3300025915 | Ga0207693_10142067 | Ga0207693_101420672 | 141 |
| 685 | 3300025916 | Ga0207663_10003868 | Ga0207663_100038687 | 141 |
| 686 | 3300025922 | Ga0207646_10001784 | Ga0207646_1000178419 | 141 |
| 687 | 3300025922 | Ga0207646_10440238 | Ga0207646_104402381 | 141 |
| 688 | 3300025922 | Ga0207646_10584035 | Ga0207646_105840352 | 141 |
| 689 | 3300025925 | Ga0207650_10350401 | Ga0207650_103504012 | 141 |
| 690 | 3300025928 | Ga0207700_10002168 | Ga0207700_100021682 | 141 |
| 691 | 3300025928 | Ga0207700_10216048 | Ga0207700_102160483 | 141 |
| 692 | 3300025928 | Ga0207700_10304431 | Ga0207700_103044311 | 141 |
| 693 | 3300025928 | Ga0207700_10408833 | Ga0207700_104088333 | 141 |
| 694 | 3300025928 | Ga0207700_10645966 | Ga0207700_106459662 | 141 |
| 695 | 3300025929 | Ga0207664_10019092 | Ga0207664_100190925 | 141 |
| 696 | 3300025929 | Ga0207664_10029998 | Ga0207664_100299984 | 141 |
| 697 | 3300025929 | Ga0207664_10238440 | Ga0207664_102384402 | 141 |
| 698 | 3300025929 | Ga0207664_10720569 | Ga0207664_107205691 | 141 |
| 699 | 3300025931 | Ga0207644_10141049 | Ga0207644_101410492 | 141 |
| 700 | 3300025939 | Ga0207665_10000276 | Ga0207665_1000027612 | 141 |
| 701 | 3300025939 | Ga0207665_10657974 | Ga0207665_106579741 | 141 |
| 702 | 3300025944 | Ga0207661_10067067 | Ga0207661_100670672 | 141 |
| 703 | 3300025944 | Ga0207661_11243983 | Ga0207661_112439832 | 141 |
| 704 | 3300026078 | Ga0207702_10066800 | Ga0207702_100668004 | 141 |
| 705 | 3300026078 | Ga0207702_10107551 | Ga0207702_101075512 | 141 |
| 706 | 3300026116 | Ga0207674_10053026 | Ga0207674_100530265 | 141 |
| 707 | 3300026118 | Ga0207675_100756800 | Ga0207675_1007568002 | 141 |
| 708 | 3300026121 | Ga0207683_10015284 | Ga0207683_100152842 | 141 |
| 709 | 3300027907 | Ga0207428_10015077 | Ga0207428_100150773 | 141 |
| 710 | 3300028556 | Ga0265337_1000651 | Ga0265337_100065110 | 141 |
| 711 | 3300028558 | Ga0265326_10015114 | Ga0265326_100151143 | 141 |
| 712 | 3300028573 | Ga0265334_10000598 | Ga0265334_100005986 | 141 |
| 713 | 3300028577 | Ga0265318_10032583 | Ga0265318_100325831 | 141 |
| 714 | 3300028653 | Ga0265323_10010425 | Ga0265323_100104252 | 141 |
| 715 | 3300028666 | Ga0265336_10019721 | Ga0265336_100197213 | 141 |
| 716 | 3300028800 | Ga0265338_10004244 | Ga0265338_100042446 | 141 |
| 717 | 3300029957 | Ga0265324_10002870 | Ga0265324_100028703 | 141 |
| 718 | 3300030731 | Ga0316177_1042139 | Ga0316177_10421392 | 141 |
| 719 | 3300030732 | Ga0316176_1121491 | Ga0316176_11214911 | 141 |
| 720 | 3300030733 | Ga0314311_1199186 | Ga0314311_11991862 | 141 |
| 721 | 3300030733 | Ga0314311_1242111 | Ga0314311_12421112 | 141 |
| 722 | 3300030736 | Ga0316180_1157337 | Ga0316180_11573372 | 141 |
| 723 | 3300030744 | Ga0316181_1288931 | Ga0316181_12889312 | 141 |
| 724 | 3300031238 | Ga0265332_10024023 | Ga0265332_100240232 | 141 |
| 725 | 3300031240 | Ga0265320_10009656 | Ga0265320_100096566 | 141 |
| 726 | 3300031251 | Ga0265327_10060576 | Ga0265327_100605763 | 141 |
| 727 | 3300031665 | Ga0316575_10026583 | Ga0316575_100265834 | 141 |
| 728 | 3300031711 | Ga0265314_10016682 | Ga0265314_100166821 | 141 |
| 729 | 3300031712 | Ga0265342_10001644 | Ga0265342_100016449 | 141 |
| 730 | 3300031727 | Ga0316576_10011456 | Ga0316576_100114566 | 141 |
| 731 | 3300031727 | Ga0316576_10076273 | Ga0316576_100762731 | 141 |
| 732 | 3300031728 | Ga0316578_10049213 | Ga0316578_100492133 | 141 |
| 733 | 3300031824 | Ga0307413_10279580 | Ga0307413_102795802 | 141 |
| 734 | 3300031824 | Ga0307413_11102817 | Ga0307413_111028172 | 141 |
| 735 | 3300031903 | Ga0307407_10783892 | Ga0307407_107838922 | 141 |
| 736 | 3300031903 | Ga0307407_10884968 | Ga0307407_108849682 | 141 |
| 737 | 3300032126 | Ga0307415_100064170 | Ga0307415_1000641704 | 141 |
| 738 | 3300032133 | Ga0316583_10031640 | Ga0316583_100316402 | 141 |
| 739 | 3300032139 | Ga0316580_10047953 | Ga0316580_100479532 | 141 |
| 740 | 3300035113 | Ga0373936_0125741 | Ga0373936_0125741_207_632 | 141 |
| 741 | 3300035398 | Ga0316574_0042242 | Ga0316574_0042242_1870_2295 | 141 |
| 742 | 3300035398 | Ga0316574_0154709 | Ga0316574_0154709_749_1174 | 141 |
| 743 | 3300035398 | Ga0316574_0482884 | Ga0316574_0482884_36_503 | 141 |
| 744 | 3300036712 | Ga0316584_0098005 | Ga0316584_0098005_1292_1723 | 141 |
| 745 | 3300036712 | Ga0316584_0225293 | Ga0316584_0225293_222_680 | 141 |
| 746 | 3300036712 | Ga0316584_0309703 | Ga0316584_0309703_700_1125 | 141 |
| 747 | 3300037418 | Ga0395900_0141015 | Ga0395900_0141015_1152_1577 | 141 |
| 748 | 3300037466 | Ga0395898_0172182 | Ga0395898_0172182_488_913 | 141 |
| 749 | 3300038443 | Ga0395901_0011481 | Ga0395901_0011481_3915_4340 | 141 |
| 750 | 3300041404 | Ga0439436_0048764 | Ga0439436_0048764_104_556 | 141 |
| 751 | 3300041413 | Ga0439465_0207217 | Ga0439465_0207217_234_659 | 141 |
| 752 | 3300041512 | Ga0451853_0190429 | Ga0451853_0190429_1082_1543 | 141 |
| 753 | 3300042002 | Ga0439442_001536 | Ga0439442_001536_730_1182 | 141 |
| 754 | 3300042002 | Ga0439442_001802 | Ga0439442_001802_990_1442 | 141 |
| 755 | 3300042006 | Ga0439432_024978 | Ga0439432_024978_429_881 | 141 |
| 756 | 3300042007 | Ga0439449_0021066 | Ga0439449_0021066_451_903 | 141 |
| 757 | 3300042121 | Ga0450919_002392 | Ga0450919_002392_1583_2035 | 141 |
| 758 | 3300042122 | Ga0450920_000417 | Ga0450920_000417_3351_3803 | 141 |
| 759 | 3300042125 | Ga0450923_095083 | Ga0450923_095083_89_562 | 141 |
| 760 | 3300042146 | Ga0450907_001195 | Ga0450907_001195_2037_2489 | 141 |
| 761 | 3300042435 | Ga0439434_0001257 | Ga0439434_0001257_1402_1854 | 141 |
| 762 | 3300042531 | Ga0450918_005774 | Ga0450918_005774_460_912 | 141 |
| 763 | 3300044693 | Ga0466961_0066331 | Ga0466961_0066331_1740_2165 | 141 |
| 764 | 3300044693 | Ga0466961_0268710 | Ga0466961_0268710_568_1014 | 141 |
| 765 | 3300044694 | Ga0466963_0525640 | Ga0466963_0525640_167_592 | 141 |
| 766 | 3300044706 | Ga0466964_0658453 | Ga0466964_0658453_101_547 | 141 |
| 767 | 3300044901 | Ga0466960_0411077 | Ga0466960_0411077_272_724 | 141 |
| 768 | 3300045976 | Ga0466967_0135033 | Ga0466967_0135033_240_692 | 141 |
| 769 | 3300045976 | Ga0466967_0178852 | Ga0466967_0178852_68_493 | 141 |
| 770 | 3300045976 | Ga0466967_0204538 | Ga0466967_0204538_185_610 | 141 |
| 771 | 3300046455 | Ga0495603_0836788 | Ga0495603_0836788_47_472 | 141 |
| 772 | 3300046463 | Ga0495653_0046282 | Ga0495653_0046282_1353_1778 | 141 |
| 773 | 3300046477 | Ga0495664_0147304 | Ga0495664_0147304_856_1281 | 141 |
| 774 | 3300046511 | Ga0495608_0368566 | Ga0495608_0368566_349_783 | 141 |
| 775 | 3300046514 | Ga0495618_0315468 | Ga0495618_0315468_59_484 | 141 |
| 776 | 3300046516 | Ga0495628_0793273 | Ga0495628_0793273_95_520 | 141 |
| 777 | 3300046529 | Ga0495652_0556681 | Ga0495652_0556681_327_752 | 141 |
| 778 | 3300046543 | Ga0495645_0032474 | Ga0495645_0032474_3129_3554 | 141 |
| 779 | 3300047319 | Ga0495674_0090813 | Ga0495674_0090813_1071_1496 | 141 |
| 780 | 3300048905 | Ga0496102_1732733 | Ga0496102_1732733_32_457 | 141 |
| 781 | 3300048911 | Ga0496108_0438707 | Ga0496108_0438707_448_873 | 141 |
| 782 | 3300048912 | Ga0496109_0748394 | Ga0496109_0748394_221_646 | 141 |
| 783 | 3300048914 | Ga0496111_0117819 | Ga0496111_0117819_935_1360 | 141 |
| 784 | 3300048915 | Ga0496112_0482964 | Ga0496112_0482964_89_514 | 141 |
| 785 | 3300048920 | Ga0496117_0299066 | Ga0496117_0299066_57_491 | 141 |
| 786 | 3300048921 | Ga0496118_0086946 | Ga0496118_0086946_1491_1928 | 141 |
| 787 | 3300049568 | Ga0501031_0000509 | Ga0501031_0000509_21455_21880 | 141 |
| 788 | 3300049569 | Ga0501032_0000310 | Ga0501032_0000310_1993_2418 | 141 |
| 789 | 3300049570 | Ga0501033_0000835 | Ga0501033_0000835_13193_13618 | 141 |
| 790 | 3300049571 | Ga0501034_0036667 | Ga0501034_0036667_312_737 | 141 |
| 791 | 3300049572 | Ga0501036_0000080 | Ga0501036_0000080_41156_41581 | 141 |
| 792 | 3300049573 | Ga0501037_0001757 | Ga0501037_0001757_12841_13266 | 141 |
| 793 | 3300049574 | Ga0501038_0013323 | Ga0501038_0013323_1238_1663 | 141 |
| 794 | 3300049575 | Ga0501039_0001383 | Ga0501039_0001383_16375_16800 | 141 |
| 795 | 3300049578 | Ga0501042_0263259 | Ga0501042_0263259_462_887 | 141 |
| 796 | 3300049579 | Ga0501043_0001371 | Ga0501043_0001371_14651_15076 | 141 |
| 797 | 3300049580 | Ga0501046_0007065 | Ga0501046_0007065_1377_1802 | 141 |
| 798 | 3300049581 | Ga0501047_0032375 | Ga0501047_0032375_4101_4526 | 141 |
| 799 | 3300049581 | Ga0501047_0114499 | Ga0501047_0114499_54_479 | 141 |
| 800 | 3300049582 | Ga0501048_0408742 | Ga0501048_0408742_200_625 | 141 |
| 801 | 3300049584 | Ga0501068_0090509 | Ga0501068_0090509_1435_1860 | 141 |
| 802 | 3300049585 | Ga0501069_0000598 | Ga0501069_0000598_1870_2295 | 141 |
| 803 | 3300049586 | Ga0501070_0007557 | Ga0501070_0007557_1117_1542 | 141 |
| 804 | 3300049587 | Ga0501071_0154685 | Ga0501071_0154685_1194_1619 | 141 |
| 805 | 3300049588 | Ga0501072_0202616 | Ga0501072_0202616_365_790 | 141 |
| 806 | 3300049589 | Ga0501073_0004179 | Ga0501073_0004179_311_736 | 141 |
| 807 | 3300049590 | Ga0501074_0058490 | Ga0501074_0058490_2014_2439 | 141 |
| 808 | 3300049741 | Ga0501079_0136778 | Ga0501079_0136778_321_746 | 141 |
| 809 | 3300049742 | Ga0501080_0003245 | Ga0501080_0003245_874_1299 | 141 |
| 810 | 3300049823 | Ga0501044_0002910 | Ga0501044_0002910_12523_12948 | 141 |
| 811 | 3300050492 | nmdc:mga0yw44_677980_c1 | nmdc:mga0yw44_677980_c1_29_454 | 141 |
| 812 | 3300050492 | nmdc:mga0yw44_740544_c1 | nmdc:mga0yw44_740544_c1_102_530 | 141 |
| 813 | 3300050507 | nmdc:mga05p37_4595_c1 | nmdc:mga05p37_4595_c1_6694_7119 | 141 |
| 814 | 3300050508 | nmdc:mga09592_666_c1 | nmdc:mga09592_666_c1_23856_24281 | 141 |
| 815 | 3300050509 | nmdc:mga0qj67_10937_c1 | nmdc:mga0qj67_10937_c1_2700_3125 | 141 |
| 816 | 3300050510 | nmdc:mga06r32_68_c1 | nmdc:mga06r32_68_c1_10110_10535 | 141 |
| 817 | 3300050511 | nmdc:mga08y16_72389_c1 | nmdc:mga08y16_72389_c1_467_892 | 141 |
| 818 | 3300053084 | Ga0495595_0743561 | Ga0495595_0743561_14_448 | 141 |
| 819 | 3300054114 | Ga0501084_0005553 | Ga0501084_0005553_7567_7992 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dbo-assembly1.cif.gz_A-2 | crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus | 0.9651 | 1 | 140 |
| 3ko7-assembly2.cif.gz_D | dtd from plasmodium falciparum in complex with d-lysine | 0.9581 | 1 | 140 |
| 3knf-assembly2.cif.gz_D | crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum | 0.9553 | 1 | 140 |
| 3lmv-assembly2.cif.gz_D | d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes | 0.9547 | 1 | 140 |
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9522 | 1 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNS9_1_143_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9908 | 1 | 141 | 3.50.80.10 |
| af_P9WNS9_1_143_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9838 | 1 | 141 | 3.50.80.10 |
| 2dboA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9651 | 1 | 140 | 3.50.80.10 |
| af_Q07648_1_150_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9593 | 1 | 140 | 3.50.80.10 |
| af_Q2FXU2_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9579 | 1 | 141 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R2IFD2-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 1.004 | 2 | 141 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A852Z478-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 1.003 | 1 | 141 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A641AQP8-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9995 | 1 | 141 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A6I4MPF9-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9991 | 1 | 141 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A847KJW6-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9984 | 1 | 141 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar