F482175

General Info

Members Datasets Scaffolds Average Seq Length
819 351 815 142

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10081447|Ga0316576_100814471
Length 167
Sequence VPWGGVVGAWGRLRCMRALIQRVASASVRESGSGDLLGSIDAGVVALVGATHDDDEAKASRLASKLWNLRIFEDSDGAMNRSLAERSEQGESAGVLVVSQFTLYADTRKGRRPSFVPAARPEHAEPLVEAFVSALTALGAQVQTGRFRTDMAVSLVNDGPVTLMLEV

Samples

Sample ID Description Type Environment
1 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
2 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
3 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
4 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
139 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
140 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
141 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
142 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
169 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
191 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
192 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
197 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
200 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
204 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
205 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
208 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
209 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
210 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
211 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
212 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
213 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
214 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
217 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
220 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
221 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
234 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
325 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
326 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.61
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.59
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10124853 3300001979 Bacteria 644
2 JGI25406J46586_10029781 3300003203 Bacteria 2061
3 JGI25406J46586_10046635 3300003203 Bacteria 1483
4 rootH2_10141641 3300003320 Bacteria 2304
5 Ga0065715_10481139 3300005293 Unclassified 797
6 Ga0070658_10349104 3300005327 Bacteria 1266
7 Ga0070683_100042967 3300005329 Bacteria 4164
8 Ga0070683_100896515 3300005329 Bacteria 851
9 Ga0070690_100114157 3300005330 Bacteria 1806
10 Ga0068869_101981643 3300005334 Bacteria 522
11 Ga0070680_100034038 3300005336 Bacteria 4108
12 Ga0070680_100930835 3300005336 Unclassified 750
13 Ga0070680_101451868 3300005336 Bacteria 594
14 Ga0070682_100275204 3300005337 Bacteria 1225
15 Ga0070682_100574345 3300005337 Bacteria 886
16 Ga0070682_101127942 3300005337 Bacteria 658
17 Ga0070682_101471162 3300005337 Bacteria 585
18 Ga0070660_101112209 3300005339 Bacteria 669
19 Ga0070660_101851610 3300005339 Bacteria 514
20 Ga0070691_10640899 3300005341 Bacteria 632
21 Ga0070661_100132789 3300005344 Bacteria 1871
22 Ga0070692_10076856 3300005345 Bacteria 1790
23 Ga0070668_100544746 3300005347 Bacteria 1009
24 Ga0070675_101632480 3300005354 Bacteria 595
25 Ga0070671_100200029 3300005355 Bacteria 1694
26 Ga0070688_100869797 3300005365 Bacteria 709
27 Ga0070688_101250772 3300005365 Bacteria 598
28 Ga0070659_100269620 3300005366 Bacteria 1414
29 Ga0070667_100991429 3300005367 Bacteria 784
30 Ga0070709_10000243 3300005434 Bacteria 35120
31 Ga0070709_10241624 3300005434 Bacteria 1297
32 Ga0070714_100002623 3300005435 Bacteria 13242
33 Ga0070714_100006186 3300005435 Bacteria 9204
34 Ga0070714_100026307 3300005435 Bacteria 4808
35 Ga0070714_100039755 3300005435 Bacteria 3961
36 Ga0070714_100579121 3300005435 Bacteria 1076
37 Ga0070714_100987465 3300005435 Bacteria 819
38 Ga0070714_101562135 3300005435 Bacteria 644
39 Ga0070713_100023116 3300005436 Bacteria 4817
40 Ga0070713_100069794 3300005436 Bacteria 2964
41 Ga0070713_100124001 3300005436 Bacteria 2269
42 Ga0070713_100507849 3300005436 Bacteria 1138
43 Ga0070713_101678389 3300005436 Bacteria 617
44 Ga0070710_10647177 3300005437 Bacteria 740
45 Ga0070711_100005834 3300005439 Bacteria 7392
46 Ga0070711_100271825 3300005439 Bacteria 1338
47 Ga0070694_100062776 3300005444 Bacteria 2539
48 Ga0070694_100863703 3300005444 Bacteria 745
49 Ga0070694_100996783 3300005444 Bacteria 695
50 Ga0070708_100025166 3300005445 Bacteria 5086
51 Ga0070708_100051868 3300005445 Bacteria 3635
52 Ga0070708_100374682 3300005445 Bacteria 1342
53 Ga0070708_100407210 3300005445 Bacteria 1283
54 Ga0070663_100303868 3300005455 Bacteria 1278
55 Ga0070663_100426467 3300005455 Bacteria 1089
56 Ga0070678_100859280 3300005456 Bacteria 827
57 Ga0070678_101331697 3300005456 Bacteria 669
58 Ga0070678_101340062 3300005456 Bacteria 667
59 Ga0070678_101356120 3300005456 Bacteria 663
60 Ga0070678_101491892 3300005456 Bacteria 633
61 Ga0070681_10013139 3300005458 Bacteria 8225
62 Ga0068867_101089279 3300005459 Unclassified 729
63 Ga0068867_101917561 3300005459 Bacteria 559
64 Ga0070706_100000535 3300005467 Bacteria 44191
65 Ga0070706_100008369 3300005467 Bacteria 9639
66 Ga0070706_100023469 3300005467 Bacteria 5680
67 Ga0070706_100039807 3300005467 Bacteria 4338
68 Ga0070706_100044924 3300005467 Bacteria 4080
69 Ga0070706_100914523 3300005467 Unclassified 810
70 Ga0070706_101010954 3300005467 Unclassified 767
71 Ga0070707_100001203 3300005468 Bacteria 25448
72 Ga0070707_100004677 3300005468 Bacteria 12823
73 Ga0070707_100115170 3300005468 Bacteria 2609
74 Ga0070707_100334253 3300005468 Bacteria 1472
75 Ga0070707_100792419 3300005468 Bacteria 911
76 Ga0070707_100793967 3300005468 Bacteria 910
77 Ga0070698_100001558 3300005471 Bacteria 25448
78 Ga0070698_100008917 3300005471 Bacteria 10785
79 Ga0070698_100010563 3300005471 Bacteria 9840
80 Ga0070698_100030730 3300005471 Bacteria 5569
81 Ga0070698_100061268 3300005471 Bacteria 3796
82 Ga0070698_100321331 3300005471 Bacteria 1478
83 Ga0070698_100553818 3300005471 Bacteria 1089
84 Ga0070698_101168717 3300005471 Bacteria 718
85 Ga0070699_100001765 3300005518 Bacteria 19725
86 Ga0070699_100003085 3300005518 Bacteria 14766
87 Ga0070699_100004916 3300005518 Bacteria 11787
88 Ga0070699_100008312 3300005518 Bacteria 9001
89 Ga0070699_100095998 3300005518 Bacteria 2596
90 Ga0070699_100209039 3300005518 Unclassified 1737
91 Ga0070679_100158938 3300005530 Bacteria 2234
92 Ga0070679_101311381 3300005530 Bacteria 670
93 Ga0070684_100133409 3300005535 Bacteria 2241
94 Ga0070684_100292857 3300005535 Bacteria 1493
95 Ga0070684_101607352 3300005535 Bacteria 613
96 Ga0070697_100030499 3300005536 Bacteria 4332
97 Ga0070697_100034485 3300005536 Bacteria 4081
98 Ga0070697_100143288 3300005536 Bacteria 2010
99 Ga0070697_100588699 3300005536 Bacteria 977
100 Ga0070697_100794557 3300005536 Bacteria 837
101 Ga0070695_100306455 3300005545 Bacteria 1176
102 Ga0070696_100603098 3300005546 Bacteria 885
103 Ga0070665_100278101 3300005548 Bacteria 1676
104 Ga0070704_100117197 3300005549 Unclassified 2038
105 Ga0070664_100769973 3300005564 Bacteria 899
106 Ga0070664_100990462 3300005564 Bacteria 790
107 Ga0068857_100055005 3300005577 Bacteria 3532
108 Ga0068856_100147913 3300005614 Bacteria 2357
109 Ga0068856_101140462 3300005614 Bacteria 797
110 Ga0068852_100128461 3300005616 Bacteria 2331
111 Ga0068861_100079687 3300005719 Bacteria 2561
112 Ga0068861_101036755 3300005719 Bacteria 785
113 Ga0068860_101840571 3300005843 Bacteria 627
114 Ga0068862_101432361 3300005844 Unclassified 695
115 Ga0081455_10000125 3300005937 Bacteria 89043
116 Ga0081455_10003072 3300005937 Bacteria 19458
117 Ga0081455_10021544 3300005937 Bacteria 6042
118 Ga0081455_10031896 3300005937 Bacteria 4757
119 Ga0081538_10131353 3300005981 Bacteria 1176
120 Ga0081540_1000147 3300005983 Bacteria 72589
121 Ga0081540_1040203 3300005983 Bacteria 2440
122 Ga0081539_10022851 3300005985 Bacteria 4120
123 Ga0081539_10050236 3300005985 Bacteria 2361
124 Ga0081539_10301175 3300005985 Bacteria 689
125 Ga0070717_10008469 3300006028 Bacteria 7683
126 Ga0070717_10022387 3300006028 Bacteria 4993
127 Ga0070717_10044905 3300006028 Bacteria 3611
128 Ga0070717_10346818 3300006028 Bacteria 1327
129 Ga0070715_10019535 3300006163 Bacteria 2601
130 Ga0070716_100002854 3300006173 Bacteria 8048
131 Ga0070716_100468628 3300006173 Bacteria 922
132 Ga0070712_100114727 3300006175 Bacteria 2017
133 Ga0070712_100144039 3300006175 Bacteria 1822
134 Ga0070712_100144772 3300006175 Bacteria 1817
135 Ga0070712_100429456 3300006175 Bacteria 1096
136 Ga0075367_10175564 3300006178 Bacteria 1335
137 Ga0068871_100389604 3300006358 Bacteria 1239
138 Ga0075428_100011383 3300006844 Bacteria 9894
139 Ga0075428_100035847 3300006844 Bacteria 5467
140 Ga0075430_100007507 3300006846 Bacteria 9206
141 Ga0075431_100032309 3300006847 Bacteria 5393
142 Ga0075431_100199687 3300006847 Bacteria 2046
143 Ga0075431_100304997 3300006847 Bacteria 1608
144 Ga0075433_10012558 3300006852 Bacteria 6847
145 Ga0075433_10402977 3300006852 Unclassified 1207
146 Ga0075433_10854832 3300006852 Bacteria 794
147 Ga0075433_11127855 3300006852 Unclassified 682
148 Ga0075434_100093239 3300006871 Bacteria 3014
149 Ga0075434_100205315 3300006871 Bacteria 1990
150 Ga0075434_100792944 3300006871 Bacteria 964
151 Ga0075434_101803745 3300006871 Bacteria 618
152 Ga0075434_102504129 3300006871 Unclassified 517
153 Ga0075429_101811210 3300006880 Bacteria 529
154 Ga0075429_101811211 3300006880 Bacteria 529
155 Ga0068865_100489785 3300006881 Bacteria 1023
156 Ga0075436_100482023 3300006914 Bacteria 906
157 Ga0075435_100013931 3300007076 Bacteria 5997
158 Ga0075435_100033678 3300007076 Bacteria 4053
159 Ga0075435_100346912 3300007076 Bacteria 1272
160 Ga0075435_100514119 3300007076 Bacteria 1036
161 Ga0105240_10702059 3300009093 Bacteria 1104
162 Ga0111539_10041267 3300009094 Bacteria 5549
163 Ga0105245_10038106 3300009098 Bacteria 4276
164 Ga0105245_11356267 3300009098 Bacteria 761
165 Ga0114129_10037145 3300009147 Bacteria 6877
166 Ga0114129_10039371 3300009147 Bacteria 6664
167 Ga0114129_10042088 3300009147 Bacteria 6432
168 Ga0114129_10119005 3300009147 Unclassified 3638
169 Ga0114129_10217100 3300009147 Bacteria 2582
170 Ga0114129_10640313 3300009147 Bacteria 1373
171 Ga0114129_12721635 3300009147 Bacteria 589
172 Ga0105243_10049337 3300009148 Bacteria 3320
173 Ga0105243_10064574 3300009148 Bacteria 2938
174 Ga0105243_10354433 3300009148 Bacteria 1348
175 Ga0105243_12082000 3300009148 Bacteria 603
176 Ga0105242_11616189 3300009176 Bacteria 682
177 Ga0105238_10210629 3300009551 Bacteria 1920
178 Ga0105238_10677881 3300009551 Bacteria 1042
179 Ga0105249_11544339 3300009553 Bacteria 736
180 Ga0105249_12838535 3300009553 Bacteria 556
181 Ga0105239_10167398 3300010375 Bacteria 2458
182 Ga0105239_11552459 3300010375 Bacteria 765
183 Ga0105246_10300029 3300011119 Bacteria 1296
184 Ga0105246_10613460 3300011119 Bacteria 942
185 Ga0157370_10027459 3300013104 Bacteria 5612
186 Ga0157369_10040204 3300013105 Bacteria 5106
187 Ga0157369_10527153 3300013105 Bacteria 1222
188 Ga0157378_10758128 3300013297 Bacteria 994
189 Ga0163162_10921625 3300013306 Bacteria 986
190 Ga0157372_10617714 3300013307 Bacteria 1263
191 Ga0157372_10912185 3300013307 Bacteria 1019
192 Ga0157375_11282500 3300013308 Bacteria 861
193 Ga0157375_11381547 3300013308 Bacteria 829
194 Ga0157375_11666526 3300013308 Bacteria 755
195 Ga0157375_11725945 3300013308 Bacteria 742
196 Ga0163163_10430087 3300014325 Bacteria 1379
197 Ga0163163_10458610 3300014325 Bacteria 1335
198 Ga0163163_11018756 3300014325 Bacteria 891
199 Ga0157377_11117914 3300014745 Bacteria 605
200 Ga0206356_10158036 3300020070 Bacteria 1222
201 Ga0206353_10512999 3300020082 Bacteria 904
202 Ga0206353_10746153 3300020082 Bacteria 2012
203 Ga0206353_10956333 3300020082 Bacteria 526
204 Ga0207653_10169033 3300025885 Unclassified 813
205 Ga0207653_10193739 3300025885 Bacteria 764
206 Ga0207692_10005427 3300025898 Bacteria 5106
207 Ga0207692_10014684 3300025898 Bacteria 3427
208 Ga0207688_10094259 3300025901 Bacteria 1722
209 Ga0207688_10528291 3300025901 Bacteria 740
210 Ga0207685_10001778 3300025905 Bacteria 4690
211 Ga0207699_10001799 3300025906 Bacteria 10073
212 Ga0207699_10157181 3300025906 Bacteria 1510
213 Ga0207699_10193973 3300025906 Bacteria 1372
214 Ga0207705_10225348 3300025909 Bacteria 1425
215 Ga0207705_10597153 3300025909 Bacteria 858
216 Ga0207684_10000603 3300025910 Bacteria 42840
217 Ga0207684_10001873 3300025910 Bacteria 21885
218 Ga0207684_10005946 3300025910 Bacteria 11170
219 Ga0207684_10051146 3300025910 Bacteria 3505
220 Ga0207684_10077409 3300025910 Bacteria 2828
221 Ga0207684_10477418 3300025910 Bacteria 1069
222 Ga0207684_11191296 3300025910 Bacteria 631
223 Ga0207684_11233635 3300025910 Bacteria 618
224 Ga0207707_10016074 3300025912 Bacteria 6527
225 Ga0207695_10525344 3300025913 Bacteria 1065
226 Ga0207693_10070393 3300025915 Bacteria 2737
227 Ga0207693_10095339 3300025915 Bacteria 2332
228 Ga0207693_10142067 3300025915 Bacteria 1887
229 Ga0207663_10003868 3300025916 Bacteria 7391
230 Ga0207660_11024347 3300025917 Bacteria 673
231 Ga0207652_10131563 3300025921 Bacteria 2232
232 Ga0207652_10225671 3300025921 Bacteria 1688
233 Ga0207652_10330545 3300025921 Bacteria 1376
234 Ga0207652_11153544 3300025921 Bacteria 676
235 Ga0207652_11686695 3300025921 Bacteria 538
236 Ga0207646_10000810 3300025922 Bacteria 40719
237 Ga0207646_10001784 3300025922 Bacteria 26072
238 Ga0207646_10063291 3300025922 Bacteria 3303
239 Ga0207646_10111890 3300025922 Bacteria 2451
240 Ga0207646_10418482 3300025922 Bacteria 1210
241 Ga0207646_10440238 3300025922 Bacteria 1176
242 Ga0207646_10584035 3300025922 Bacteria 1003
243 Ga0207646_10636349 3300025922 Unclassified 956
244 Ga0207650_10350401 3300025925 Bacteria 1214
245 Ga0207687_10081477 3300025927 Bacteria 2339
246 Ga0207700_10002168 3300025928 Bacteria 11246
247 Ga0207700_10018875 3300025928 Bacteria 4646
248 Ga0207700_10216048 3300025928 Bacteria 1623
249 Ga0207700_10301392 3300025928 Bacteria 1384
250 Ga0207700_10304431 3300025928 Bacteria 1377
251 Ga0207700_10408833 3300025928 Bacteria 1190
252 Ga0207700_10645966 3300025928 Bacteria 943
253 Ga0207664_10006685 3300025929 Bacteria 7954
254 Ga0207664_10014599 3300025929 Bacteria 5679
255 Ga0207664_10019092 3300025929 Bacteria 5060
256 Ga0207664_10029998 3300025929 Bacteria 4149
257 Ga0207664_10238440 3300025929 Bacteria 1583
258 Ga0207664_10620916 3300025929 Bacteria 971
259 Ga0207664_10720569 3300025929 Bacteria 897
260 Ga0207644_10141049 3300025931 Bacteria 1856
261 Ga0207709_10130065 3300025935 Bacteria 1714
262 Ga0207709_10250128 3300025935 Bacteria 1294
263 Ga0207669_10047195 3300025937 Bacteria 2550
264 Ga0207669_10141065 3300025937 Bacteria 1673
265 Ga0207665_10000276 3300025939 Bacteria 35590
266 Ga0207665_10657974 3300025939 Bacteria 821
267 Ga0207661_10067067 3300025944 Bacteria 2917
268 Ga0207661_10113278 3300025944 Bacteria 2298
269 Ga0207661_10373687 3300025944 Bacteria 1289
270 Ga0207661_11243983 3300025944 Bacteria 685
271 Ga0207679_11109779 3300025945 Bacteria 726
272 Ga0207703_10367493 3300026035 Bacteria 1328
273 Ga0207678_10005161 3300026067 Bacteria 11710
274 Ga0207678_10051310 3300026067 Bacteria 3561
275 Ga0207678_10358509 3300026067 Unclassified 1258
276 Ga0207708_11150904 3300026075 Bacteria 677
277 Ga0207702_10066800 3300026078 Bacteria 3084
278 Ga0207702_10102902 3300026078 Bacteria 2525
279 Ga0207702_10107551 3300026078 Bacteria 2474
280 Ga0207702_10198183 3300026078 Bacteria 1860
281 Ga0207641_10446132 3300026088 Bacteria 1250
282 Ga0207676_10096184 3300026095 Bacteria 2444
283 Ga0207674_10037488 3300026116 Bacteria 5041
284 Ga0207674_10053026 3300026116 Bacteria 4134
285 Ga0207674_10488082 3300026116 Bacteria 1191
286 Ga0207675_100248903 3300026118 Bacteria 1719
287 Ga0207675_100756800 3300026118 Bacteria 983
288 Ga0207683_10015284 3300026121 Bacteria 6534
289 Ga0207683_10184287 3300026121 Bacteria 1893
290 Ga0207683_11704069 3300026121 Bacteria 580
291 Ga0207698_10394870 3300026142 Bacteria 1320
292 Ga0207428_10015077 3300027907 Bacteria 6693
293 Ga0268265_10120711 3300028380 Bacteria 2159
294 Ga0268265_11737672 3300028380 Unclassified 630
295 Ga0268264_10783606 3300028381 Bacteria 952
296 Ga0265337_1000651 3300028556 Bacteria 18325
297 Ga0265337_1059181 3300028556 Unclassified 1064
298 Ga0265326_10003278 3300028558 Bacteria 5334
299 Ga0265326_10015114 3300028558 Bacteria 2244
300 Ga0265334_10000598 3300028573 Bacteria 18227
301 Ga0265334_10141287 3300028573 Unclassified 853
302 Ga0265318_10032583 3300028577 Bacteria 2016
303 Ga0265323_10010425 3300028653 Bacteria 3769
304 Ga0265323_10033540 3300028653 Unclassified 1900
305 Ga0265336_10019721 3300028666 Bacteria 2172
306 Ga0265336_10185858 3300028666 Bacteria 618
307 Ga0265338_10004244 3300028800 Bacteria 19497
308 Ga0265338_10053940 3300028800 Unclassified 3590
309 Ga0265338_10665133 3300028800 Bacteria 721
310 Ga0265324_10002870 3300029957 Bacteria 8476
311 Ga0316177_1042139 3300030731 Bacteria 1002
312 Ga0316176_1121491 3300030732 Bacteria 699
313 Ga0314311_1199186 3300030733 Bacteria 2087
314 Ga0314311_1242111 3300030733 Bacteria 610
315 Ga0316180_1157337 3300030736 Bacteria 797
316 Ga0316181_1288931 3300030744 Bacteria 1260
317 Ga0265332_10024023 3300031238 Bacteria 2685
318 Ga0265320_10009656 3300031240 Bacteria 5800
319 Ga0265320_10067437 3300031240 Bacteria 1693
320 Ga0265325_10183799 3300031241 Unclassified 972
321 Ga0265340_10395393 3300031247 Unclassified 610
322 Ga0265327_10055580 3300031251 Bacteria 2043
323 Ga0265327_10060576 3300031251 Bacteria 1934
324 Ga0307513_10000007 3300031456 Bacteria 451043
325 Ga0307408_100055316 3300031548 Bacteria 2873
326 Ga0307408_100315152 3300031548 Bacteria 1316
327 Ga0307408_100378934 3300031548 Bacteria 1209
328 Ga0265313_10020326 3300031595 Bacteria 3666
329 Ga0316575_10026583 3300031665 Bacteria 2249
330 Ga0265314_10016682 3300031711 Bacteria 5791
331 Ga0265314_10558013 3300031711 Unclassified 595
332 Ga0265342_10001644 3300031712 Bacteria 20591
333 Ga0316576_10011456 3300031727 Bacteria 5813
334 Ga0316576_10076273 3300031727 Bacteria 2481
335 Ga0316576_10081447 3300031727 Bacteria 2402
336 Ga0316578_10001429 3300031728 Bacteria 9683
337 Ga0316578_10049213 3300031728 Bacteria 2462
338 Ga0316578_10100334 3300031728 Bacteria 1735
339 Ga0316578_10129643 3300031728 Bacteria 1517
340 Ga0316578_10249332 3300031728 Bacteria 1065
341 Ga0307405_10087442 3300031731 Bacteria 2054
342 Ga0316577_10100216 3300031733 Unclassified 1624
343 Ga0316577_10169988 3300031733 Bacteria 1230
344 Ga0307413_10072770 3300031824 Bacteria 2170
345 Ga0307413_10121364 3300031824 Bacteria 1771
346 Ga0307413_10279580 3300031824 Bacteria 1255
347 Ga0307413_10633941 3300031824 Unclassified 879
348 Ga0307413_11102817 3300031824 Bacteria 686
349 Ga0307410_10063970 3300031852 Bacteria 2526
350 Ga0307410_10072123 3300031852 Bacteria 2397
351 Ga0307410_10083361 3300031852 Bacteria 2251
352 Ga0307410_10105655 3300031852 Bacteria 2027
353 Ga0307410_10175203 3300031852 Bacteria 1620
354 Ga0307410_10921798 3300031852 Bacteria 749
355 Ga0307410_11247686 3300031852 Bacteria 649
356 Ga0307406_10157618 3300031901 Bacteria 1628
357 Ga0307406_10252857 3300031901 Bacteria 1329
358 Ga0307406_10441569 3300031901 Bacteria 1042
359 Ga0307407_10100189 3300031903 Unclassified 1796
360 Ga0307407_10126213 3300031903 Bacteria 1630
361 Ga0307407_10206911 3300031903 Bacteria 1319
362 Ga0307407_10302484 3300031903 Bacteria 1116
363 Ga0307407_10783892 3300031903 Bacteria 724
364 Ga0307407_10884968 3300031903 Bacteria 684
365 Ga0307412_10207847 3300031911 Bacteria 1491
366 Ga0307412_10679099 3300031911 Bacteria 882
367 Ga0307409_100079320 3300031995 Bacteria 2645
368 Ga0307409_100104357 3300031995 Bacteria 2360
369 Ga0307409_100287800 3300031995 Bacteria 1522
370 Ga0307409_100317354 3300031995 Bacteria 1457
371 Ga0307409_100666561 3300031995 Bacteria 1036
372 Ga0307409_101471037 3300031995 Bacteria 708
373 Ga0307409_102133278 3300031995 Bacteria 590
374 Ga0307416_100123173 3300032002 Bacteria 2316
375 Ga0307416_100175852 3300032002 Bacteria 1999
376 Ga0307416_100209363 3300032002 Bacteria 1858
377 Ga0307416_100228086 3300032002 Bacteria 1793
378 Ga0307416_100336810 3300032002 Bacteria 1519
379 Ga0307416_100440328 3300032002 Bacteria 1353
380 Ga0307416_100935533 3300032002 Bacteria 968
381 Ga0307416_101062954 3300032002 Bacteria 913
382 Ga0307414_10361052 3300032004 Bacteria 1250
383 Ga0307414_10627941 3300032004 Bacteria 966
384 Ga0307411_10119245 3300032005 Bacteria 1905
385 Ga0307415_100060385 3300032126 Bacteria 2619
386 Ga0307415_100064170 3300032126 Bacteria 2555
387 Ga0307415_100134131 3300032126 Bacteria 1880
388 Ga0307415_100156549 3300032126 Bacteria 1760
389 Ga0307415_100181531 3300032126 Bacteria 1652
390 Ga0316583_10031640 3300032133 Bacteria 1883
391 Ga0316580_10047953 3300032139 Bacteria 1316
392 Ga0373932_0087858 3300035112 Bacteria 993
393 Ga0373936_0125741 3300035113 Bacteria 1099
394 Ga0373939_0530907 3300035114 Bacteria 506
395 Ga0373953_0234389 3300035117 Bacteria 796
396 Ga0373946_0414083 3300035171 Bacteria 682
397 Ga0373955_0126229 3300035172 Bacteria 1491
398 Ga0373942_0321687 3300035207 Unclassified 541
399 Ga0316574_0042242 3300035398 Bacteria 2812
400 Ga0316574_0154709 3300035398 Bacteria 1477
401 Ga0316574_0451534 3300035398 Bacteria 805
402 Ga0316574_0482884 3300035398 Bacteria 774
403 Ga0316574_0495370 3300035398 Bacteria 762
404 Ga0373931_0088541 3300035691 Bacteria 1721
405 Ga0373935_0123214 3300035692 Bacteria 1734
406 Ga0373933_0311415 3300035724 Bacteria 1020
407 Ga0373937_0373217 3300036401 Bacteria 1352
408 Ga0373937_1403654 3300036401 Bacteria 646
409 Ga0372808_065229 3300036459 Bacteria 524
410 Ga0316582_0007103 3300036647 Bacteria 5947
411 Ga0316582_0386636 3300036647 Bacteria 963
412 Ga0316584_0008202 3300036712 Bacteria 7186
413 Ga0316584_0069586 3300036712 Bacteria 2638
414 Ga0316584_0079310 3300036712 Bacteria 2460
415 Ga0316584_0098005 3300036712 Bacteria 2195
416 Ga0316584_0155639 3300036712 Bacteria 1700
417 Ga0316584_0220539 3300036712 Bacteria 1393
418 Ga0316584_0225293 3300036712 Bacteria 1376
419 Ga0316584_0265381 3300036712 Bacteria 1251
420 Ga0316584_0309703 3300036712 Bacteria 1142
421 Ga0316584_0908549 3300036712 Unclassified 592
422 Ga0373925_0000030 3300037068 Bacteria 146196
423 Ga0373925_0251630 3300037068 Bacteria 1417
424 Ga0395900_0028223 3300037418 Bacteria 5749
425 Ga0395900_0141015 3300037418 Bacteria 2468
426 Ga0395898_0172182 3300037466 Bacteria 2069
427 Ga0395898_0377321 3300037466 Archaea 1352
428 Ga0316581_0120701 3300037588 Unclassified 808
429 Ga0395901_0011481 3300038443 Bacteria 8976
430 Ga0395901_0092832 3300038443 Bacteria 3160
431 Ga0395901_0702551 3300038443 Bacteria 1009
432 Ga0395901_1140885 3300038443 Bacteria 748
433 Ga0400488_22546 3300038741 Bacteria 7428
434 Ga0400486_06480 3300038742 Bacteria 1205
435 Ga0400483_044090 3300039062 Bacteria 76499
436 Ga0400483_075002 3300039062 Bacteria 3311
437 Ga0400483_237049 3300039062 Bacteria 60745
438 Ga0400483_247042 3300039062 Bacteria 22748
439 Ga0400483_278156 3300039062 Bacteria 1230
440 Ga0436365_0844020 3300039437 Bacteria 3384
441 Ga0436360_0207103 3300039438 Bacteria 1762
442 Ga0436363_0600429 3300039450 Unclassified 1299
443 Ga0439436_0048764 3300041404 Bacteria 1200
444 Ga0439438_010095 3300041405 Bacteria 3012
445 Ga0439439_0004602 3300041406 Bacteria 3120
446 Ga0439461_0002508 3300041410 Bacteria 2939
447 Ga0439466_0008424 3300041411 Bacteria 3887
448 Ga0439465_0207217 3300041413 Bacteria 716
449 Ga0451853_0190429 3300041512 Bacteria 1601
450 Ga0451853_3746540 3300041512 Unclassified 1835
451 Ga0439433_0001043 3300041999 Bacteria 5618
452 Ga0439433_0022172 3300041999 Bacteria 1423
453 Ga0439442_001536 3300042002 Bacteria 4532
454 Ga0439442_001802 3300042002 Bacteria 4188
455 Ga0439442_002705 3300042002 Bacteria 3478
456 Ga0439432_007408 3300042006 Bacteria 3890
457 Ga0439432_024978 3300042006 Bacteria 1962
458 Ga0439449_0021066 3300042007 Bacteria 2441
459 Ga0439449_0021541 3300042007 Bacteria 2412
460 Ga0439452_001551 3300042010 Bacteria 9214
461 Ga0439455_0064631 3300042012 Bacteria 975
462 Ga0439457_144270 3300042014 Bacteria 571
463 Ga0439462_0036097 3300042015 Bacteria 1315
464 Ga0450911_015832 3300042115 Bacteria 997
465 Ga0450917_033036 3300042120 Bacteria 501
466 Ga0450919_002392 3300042121 Bacteria 2434
467 Ga0450920_000417 3300042122 Bacteria 6654
468 Ga0450920_002134 3300042122 Bacteria 3345
469 Ga0450923_095083 3300042125 Bacteria 683
470 Ga0450923_103720 3300042125 Bacteria 658
471 Ga0450907_001195 3300042146 Bacteria 5880
472 Ga0439446_0101769 3300042156 Bacteria 909
473 Ga0439434_0001257 3300042435 Bacteria 7298
474 Ga0439434_0010414 3300042435 Bacteria 2740
475 Ga0439435_0359065 3300042436 Bacteria 507
476 Ga0439444_0045391 3300042437 Bacteria 877
477 Ga0450918_005774 3300042531 Bacteria 2213
478 Ga0450918_006214 3300042531 Bacteria 2132
479 Ga0451577_0025875 3300042876 Bacteria 5321
480 Ga0451577_0027239 3300042876 Bacteria 5172
481 Ga0451577_0172109 3300042876 Unclassified 1951
482 Ga0451577_0260292 3300042876 Bacteria 1571
483 Ga0451577_0698573 3300042876 Unclassified 919
484 Ga0451577_1878522 3300042876 Unclassified 525
485 Ga0439440_0067327 3300042993 Bacteria 926
486 Ga0466969_0001395 3300044656 Bacteria 13027
487 Ga0466969_0062005 3300044656 Bacteria 1816
488 Ga0453683_0424338 3300044673 Unclassified 858
489 Ga0453683_1206635 3300044673 Unclassified 507
490 Ga0466965_0028479 3300044683 Bacteria 2715
491 Ga0466965_0202951 3300044683 Bacteria 1052
492 Ga0466965_0217741 3300044683 Bacteria 1017
493 Ga0466965_0282735 3300044683 Bacteria 896
494 Ga0466965_0296119 3300044683 Bacteria 877
495 Ga0466965_0297259 3300044683 Bacteria 875
496 Ga0466965_0322388 3300044683 Bacteria 842
497 Ga0466966_0001319 3300044684 Bacteria 15910
498 Ga0466966_0113190 3300044684 Bacteria 1671
499 Ga0466966_0337260 3300044684 Bacteria 906
500 Ga0466966_0613633 3300044684 Bacteria 655
501 Ga0466961_0052562 3300044693 Bacteria 2600
502 Ga0466961_0066331 3300044693 Bacteria 2293
503 Ga0466961_0268710 3300044693 Bacteria 1045
504 Ga0466961_0330038 3300044693 Bacteria 930
505 Ga0466961_0854944 3300044693 Bacteria 542
506 Ga0466963_0071419 3300044694 Bacteria 2336
507 Ga0466963_0080405 3300044694 Bacteria 2206
508 Ga0466963_0186593 3300044694 Bacteria 1448
509 Ga0466963_0469426 3300044694 Bacteria 888
510 Ga0466963_0525640 3300044694 Bacteria 835
511 Ga0466963_1005773 3300044694 Bacteria 587
512 Ga0466964_0444641 3300044706 Bacteria 686
513 Ga0466964_0658453 3300044706 Bacteria 580
514 Ga0453684_0005761 3300044712 Bacteria 24193
515 Ga0453684_0011592 3300044712 Bacteria 14735
516 Ga0453684_0060992 3300044712 Bacteria 4844
517 Ga0453684_0070272 3300044712 Bacteria 4435
518 Ga0453684_0084179 3300044712 Bacteria 3957
519 Ga0453684_0094715 3300044712 Bacteria 3672
520 Ga0453684_0249637 3300044712 Bacteria 2038
521 Ga0453684_0273005 3300044712 Bacteria 1931
522 Ga0453684_0397145 3300044712 Bacteria 1545
523 Ga0453684_0417903 3300044712 Bacteria 1498
524 Ga0453684_0936446 3300044712 Unclassified 925
525 Ga0453684_1116163 3300044712 Unclassified 832
526 Ga0453684_1175856 3300044712 Bacteria 806
527 Ga0453684_1653345 3300044712 Bacteria 656
528 Ga0453684_1724368 3300044712 Bacteria 639
529 Ga0453684_2216442 3300044712 Unclassified 548
530 Ga0466971_0100204 3300044719 Bacteria 1331
531 Ga0466971_0120029 3300044719 Bacteria 1216
532 Ga0466971_0135545 3300044719 Bacteria 1145
533 Ga0466971_0171065 3300044719 Bacteria 1020
534 Ga0466971_0185512 3300044719 Bacteria 979
535 Ga0466968_0000453 3300044735 Bacteria 13806
536 Ga0466970_0052504 3300044765 Bacteria 2176
537 Ga0466970_0115921 3300044765 Bacteria 1465
538 Ga0466957_0069844 3300044842 Bacteria 2170
539 Ga0466957_0082097 3300044842 Bacteria 2009
540 Ga0466957_0137240 3300044842 Bacteria 1573
541 Ga0466957_0540242 3300044842 Bacteria 811
542 Ga0466957_1041702 3300044842 Bacteria 589
543 Ga0466960_0055537 3300044901 Bacteria 1926
544 Ga0466960_0094815 3300044901 Bacteria 1527
545 Ga0466960_0353407 3300044901 Bacteria 839
546 Ga0466960_0411077 3300044901 Bacteria 781
547 Ga0466960_0998558 3300044901 Bacteria 514
548 Ga0466959_0037787 3300045049 Bacteria 3568
549 Ga0466959_0373429 3300045049 Bacteria 971
550 Ga0466959_0397932 3300045049 Bacteria 936
551 Ga0466959_0408537 3300045049 Bacteria 922
552 Ga0466959_0677772 3300045049 Bacteria 691
553 Ga0466959_0824203 3300045049 Bacteria 620
554 Ga0451576_0032861 3300045051 Bacteria 5517
555 Ga0451576_0043213 3300045051 Bacteria 4755
556 Ga0451576_0082879 3300045051 Bacteria 3336
557 Ga0451576_0366159 3300045051 Bacteria 1510
558 Ga0451576_0518879 3300045051 Bacteria 1252
559 Ga0451576_0570312 3300045051 Unclassified 1189
560 Ga0466958_0080154 3300045836 Bacteria 2008
561 Ga0466958_0104560 3300045836 Bacteria 1764
562 Ga0466958_0438611 3300045836 Bacteria 845
563 Ga0466958_0801588 3300045836 Bacteria 614
564 Ga0466967_0007996 3300045976 Bacteria 7701
565 Ga0466967_0078990 3300045976 Bacteria 2965
566 Ga0466967_0088154 3300045976 Bacteria 2815
567 Ga0466967_0100462 3300045976 Bacteria 2643
568 Ga0466967_0135033 3300045976 Bacteria 2294
569 Ga0466967_0137995 3300045976 Bacteria 2269
570 Ga0466967_0178852 3300045976 Bacteria 2000
571 Ga0466967_0204538 3300045976 Bacteria 1871
572 Ga0466967_0300468 3300045976 Bacteria 1544
573 Ga0466967_0371141 3300045976 Bacteria 1388
574 Ga0466967_0591830 3300045976 Bacteria 1094
575 Ga0466967_0833759 3300045976 Bacteria 916
576 Ga0495603_0836788 3300046455 Bacteria 524
577 Ga0495629_0081597 3300046459 Unclassified 2257
578 Ga0495641_0412581 3300046461 Unclassified 613
579 Ga0495653_0035942 3300046463 Bacteria 3906
580 Ga0495653_0046282 3300046463 Bacteria 3369
581 Ga0495582_0385902 3300046473 Bacteria 807
582 Ga0495639_0144800 3300046475 Bacteria 1144
583 Ga0495664_0056716 3300046477 Bacteria 2330
584 Ga0495664_0147304 3300046477 Bacteria 1428
585 Ga0495664_0212632 3300046477 Bacteria 1171
586 Ga0495585_0054059 3300046492 Bacteria 2221
587 Ga0495594_0480762 3300046499 Bacteria 706
588 Ga0495596_0048204 3300046500 Bacteria 1671
589 Ga0495596_0145478 3300046500 Bacteria 921
590 Ga0495608_0368566 3300046511 Bacteria 882
591 Ga0495618_0315468 3300046514 Bacteria 969
592 Ga0495618_0419328 3300046514 Bacteria 816
593 Ga0495628_0008040 3300046516 Bacteria 9081
594 Ga0495628_0793273 3300046516 Bacteria 663
595 Ga0495630_0005586 3300046517 Bacteria 8879
596 Ga0495637_0160373 3300046520 Bacteria 844
597 Ga0495644_0018012 3300046523 Bacteria 2697
598 Ga0495666_0010115 3300046526 Bacteria 4706
599 Ga0495642_0011034 3300046528 Bacteria 3466
600 Ga0495652_0555184 3300046529 Bacteria 789
601 Ga0495652_0556681 3300046529 Bacteria 788
602 Ga0495640_0250099 3300046533 Bacteria 1110
603 Ga0495598_0016243 3300046537 Bacteria 1896
604 Ga0495598_0148262 3300046537 Bacteria 817
605 Ga0495609_0013310 3300046538 Bacteria 3890
606 Ga0495621_0188888 3300046539 Bacteria 825
607 Ga0495645_0032474 3300046543 Bacteria 3808
608 Ga0495645_0210273 3300046543 Bacteria 1314
609 Ga0495633_0258544 3300046558 Bacteria 794
610 Ga0495667_0063928 3300046559 Bacteria 2408
611 Ga0495656_0003838 3300046615 Bacteria 5110
612 Ga0495656_0037578 3300046615 Bacteria 2001
613 Ga0495656_0428594 3300046615 Unclassified 695
614 Ga0495656_0798743 3300046615 Bacteria 510
615 Ga0495668_0383792 3300046616 Bacteria 772
616 Ga0495611_0189667 3300046648 Bacteria 960
617 Ga0495611_0306153 3300046648 Bacteria 732
618 Ga0495625_0095005 3300046660 Bacteria 2056
619 Ga0495659_0001304 3300046664 Bacteria 8567
620 Ga0495599_0322818 3300046678 Bacteria 929
621 Ga0495623_0124177 3300046679 Bacteria 1551
622 Ga0495646_0252922 3300046680 Bacteria 943
623 Ga0495647_0360829 3300046681 Bacteria 663
624 Ga0495658_0120321 3300046683 Bacteria 1587
625 Ga0495658_0436336 3300046683 Bacteria 836
626 Ga0495658_0443908 3300046683 Bacteria 828
627 Ga0495658_0962286 3300046683 Bacteria 545
628 Ga0495669_0054248 3300046684 Bacteria 1804
629 Ga0495670_0030538 3300046691 Bacteria 2676
630 Ga0495670_0097227 3300046691 Bacteria 1513
631 Ga0495589_0040145 3300046794 Bacteria 2338
632 Ga0495674_0033624 3300047319 Bacteria 4642
633 Ga0495674_0090813 3300047319 Bacteria 2609
634 Ga0495674_0614254 3300047319 Bacteria 860
635 Ga0495676_0062734 3300047321 Bacteria 2900
636 Ga0495676_0137748 3300047321 Bacteria 1753
637 Ga0495680_0244801 3300047322 Bacteria 1272
638 Ga0495680_0328656 3300047322 Bacteria 1069
639 Ga0495683_0335875 3300047323 Bacteria 641
640 Ga0495679_106466 3300047446 Bacteria 775
641 Ga0495684_0017695 3300047471 Bacteria 5489
642 Ga0495684_0966574 3300047471 Bacteria 544
643 Ga0495602_0214310 3300048088 Bacteria 1459
644 Ga0495615_0030275 3300048090 Bacteria 1291
645 Ga0496101_0021168 3300048904 Bacteria 4464
646 Ga0496101_1262802 3300048904 Bacteria 578
647 Ga0496102_0721390 3300048905 Bacteria 920
648 Ga0496102_1732733 3300048905 Bacteria 542
649 Ga0496107_0027403 3300048910 Bacteria 4046
650 Ga0496108_0438707 3300048911 Bacteria 1141
651 Ga0496109_0748394 3300048912 Bacteria 915
652 Ga0496111_0117819 3300048914 Bacteria 1960
653 Ga0496112_0482964 3300048915 Bacteria 1175
654 Ga0496112_1098284 3300048915 Bacteria 714
655 Ga0496114_0165868 3300048917 Bacteria 1923
656 Ga0496114_0518778 3300048917 Bacteria 1054
657 Ga0496114_0688244 3300048917 Bacteria 897
658 Ga0496117_0299066 3300048920 Bacteria 853
659 Ga0496118_0086946 3300048921 Bacteria 2170
660 Ga0496126_0006325 3300048929 Bacteria 13219
661 Ga0496126_1282181 3300048929 Bacteria 534
662 Ga0501298_138911 3300049521 Unclassified 586
663 Ga0501031_0000509 3300049568 Bacteria 22746
664 Ga0501031_0191105 3300049568 Bacteria 1337
665 Ga0501032_0000310 3300049569 Bacteria 41007
666 Ga0501032_0587619 3300049569 Bacteria 709
667 Ga0501033_0000835 3300049570 Bacteria 28103
668 Ga0501033_0504403 3300049570 Bacteria 837
669 Ga0501033_0711819 3300049570 Bacteria 683
670 Ga0501034_0036667 3300049571 Bacteria 4965
671 Ga0501034_0936063 3300049571 Bacteria 753
672 Ga0501036_0000080 3300049572 Bacteria 59831
673 Ga0501036_0522638 3300049572 Bacteria 987
674 Ga0501036_0904065 3300049572 Bacteria 724
675 Ga0501036_1342896 3300049572 Bacteria 580
676 Ga0501037_0001757 3300049573 Bacteria 15743
677 Ga0501038_0013323 3300049574 Bacteria 7499
678 Ga0501038_0216725 3300049574 Bacteria 1529
679 Ga0501039_0001383 3300049575 Bacteria 17796
680 Ga0501039_0452725 3300049575 Unclassified 1008
681 Ga0501039_0920092 3300049575 Bacteria 680
682 Ga0501040_0026767 3300049576 Bacteria 3879
683 Ga0501040_0029531 3300049576 Bacteria 3702
684 Ga0501040_0034224 3300049576 Unclassified 3443
685 Ga0501040_0281353 3300049576 Bacteria 1188
686 Ga0501040_0338282 3300049576 Bacteria 1077
687 Ga0501040_0566544 3300049576 Bacteria 820
688 Ga0501041_0109185 3300049577 Bacteria 1716
689 Ga0501041_0136052 3300049577 Unclassified 1531
690 Ga0501041_0639051 3300049577 Bacteria 680
691 Ga0501042_0263259 3300049578 Bacteria 1245
692 Ga0501042_0336401 3300049578 Bacteria 1091
693 Ga0501042_0431489 3300049578 Bacteria 955
694 Ga0501042_1451182 3300049578 Bacteria 501
695 Ga0501043_0001371 3300049579 Bacteria 21359
696 Ga0501043_0077263 3300049579 Bacteria 2616
697 Ga0501046_0007065 3300049580 Bacteria 9886
698 Ga0501046_0050384 3300049580 Unclassified 3290
699 Ga0501046_0150316 3300049580 Bacteria 1757
700 Ga0501046_0444694 3300049580 Bacteria 932
701 Ga0501046_0866652 3300049580 Bacteria 631
702 Ga0501046_1141696 3300049580 Bacteria 537
703 Ga0501047_0032375 3300049581 Bacteria 5046
704 Ga0501047_0114499 3300049581 Bacteria 2579
705 Ga0501048_0059325 3300049582 Unclassified 2712
706 Ga0501048_0069827 3300049582 Bacteria 2481
707 Ga0501048_0408742 3300049582 Bacteria 970
708 Ga0501048_0424465 3300049582 Unclassified 951
709 Ga0501048_0818873 3300049582 Bacteria 669
710 Ga0501068_0090509 3300049584 Bacteria 1887
711 Ga0501068_0099449 3300049584 Bacteria 1802
712 Ga0501069_0000598 3300049585 Bacteria 16663
713 Ga0501069_0519802 3300049585 Bacteria 711
714 Ga0501070_0007557 3300049586 Bacteria 9236
715 Ga0501070_0924090 3300049586 Bacteria 680
716 Ga0501071_0045384 3300049587 Bacteria 3155
717 Ga0501071_0154685 3300049587 Bacteria 1712
718 Ga0501071_0385144 3300049587 Bacteria 1069
719 Ga0501071_0543300 3300049587 Bacteria 892
720 Ga0501071_0662961 3300049587 Bacteria 803
721 Ga0501072_0023641 3300049588 Bacteria 4774
722 Ga0501072_0058318 3300049588 Bacteria 3043
723 Ga0501072_0059442 3300049588 Bacteria 3014
724 Ga0501072_0099480 3300049588 Bacteria 2312
725 Ga0501072_0202616 3300049588 Bacteria 1582
726 Ga0501072_0239574 3300049588 Bacteria 1445
727 Ga0501072_0853126 3300049588 Bacteria 712
728 Ga0501073_0004179 3300049589 Bacteria 10831
729 Ga0501073_0113612 3300049589 Bacteria 1878
730 Ga0501074_0058490 3300049590 Bacteria 2777
731 Ga0501074_0229138 3300049590 Bacteria 1323
732 Ga0501074_0320885 3300049590 Bacteria 1100
733 Ga0501074_0382645 3300049590 Bacteria 998
734 Ga0501074_0530180 3300049590 Bacteria 834
735 Ga0501075_0030185 3300049591 Bacteria 4014
736 Ga0501075_0104614 3300049591 Bacteria 2151
737 Ga0501075_0247582 3300049591 Bacteria 1358
738 Ga0501075_0456036 3300049591 Bacteria 975
739 Ga0501075_0852535 3300049591 Bacteria 693
740 Ga0501075_0945410 3300049591 Bacteria 655
741 Ga0501076_0045093 3300049592 Bacteria 3480
742 Ga0501076_0053550 3300049592 Bacteria 3198
743 Ga0501076_0069269 3300049592 Unclassified 2819
744 Ga0501076_0076460 3300049592 Bacteria 2685
745 Ga0501076_0162391 3300049592 Bacteria 1820
746 Ga0501076_0215329 3300049592 Unclassified 1570
747 Ga0501076_0416114 3300049592 Bacteria 1106
748 Ga0501076_1078579 3300049592 Bacteria 661
749 Ga0501077_0144309 3300049593 Bacteria 1510
750 Ga0501077_0321970 3300049593 Bacteria 986
751 Ga0501077_0716536 3300049593 Bacteria 643
752 Ga0501250_011159 3300049680 Bacteria 1043
753 Ga0501251_026455 3300049681 Bacteria 803
754 Ga0501079_0024479 3300049741 Bacteria 4633
755 Ga0501079_0136778 3300049741 Bacteria 1908
756 Ga0501079_1520603 3300049741 Bacteria 526
757 Ga0501080_0003245 3300049742 Bacteria 14351
758 Ga0501080_0228513 3300049742 Bacteria 1701
759 Ga0501080_1616947 3300049742 Bacteria 548
760 Ga0501081_0046019 3300049743 Unclassified 2998
761 Ga0501081_0224279 3300049743 Bacteria 1367
762 Ga0501081_0331562 3300049743 Bacteria 1119
763 Ga0501081_1104908 3300049743 Bacteria 600
764 Ga0501081_1526504 3300049743 Unclassified 507
765 Ga0501083_0266271 3300049744 Bacteria 1115
766 Ga0501035_0354499 3300049822 Bacteria 1227
767 Ga0501035_0668366 3300049822 Bacteria 841
768 Ga0501035_0967919 3300049822 Bacteria 671
769 Ga0501044_0002910 3300049823 Bacteria 19486
770 Ga0501045_0052824 3300049824 Bacteria 2968
771 Ga0501045_0147026 3300049824 Bacteria 1753
772 Ga0501045_0160675 3300049824 Bacteria 1672
773 Ga0501045_0354368 3300049824 Bacteria 1092
774 nmdc:mga03n38_10923_c1 3300050490 Bacteria 3364
775 nmdc:mga0yw44_677980_c1 3300050492 Bacteria 700
776 nmdc:mga0yw44_740544_c1 3300050492 Bacteria 668
777 nmdc:mga05p37_114059_c1 3300050507 Bacteria 3322
778 nmdc:mga05p37_274869_c1 3300050507 Bacteria 2012
779 nmdc:mga05p37_4595_c1 3300050507 Bacteria 16136
780 nmdc:mga05p37_529690_c1 3300050507 Unclassified 1346
781 nmdc:mga05p37_6470_c1 3300050507 Bacteria 13817
782 nmdc:mga05p37_82474_c1 3300050507 Bacteria 3962
783 nmdc:mga09592_666_c1 3300050508 Bacteria 26251
784 nmdc:mga0qj67_10937_c1 3300050509 Bacteria 6792
785 nmdc:mga06r32_619879_c1 3300050510 Bacteria 1052
786 nmdc:mga06r32_68_c1 3300050510 Bacteria 67093
787 nmdc:mga08y16_72389_c1 3300050511 Bacteria 3592
788 nmdc:mga0n895_102465_c1 3300050512 Unclassified 2873
789 nmdc:mga0n895_1046149_c1 3300050512 Bacteria 796
790 nmdc:mga0n895_1167977_c1 3300050512 Bacteria 745
791 nmdc:mga0rr50_1043611_c1 3300050513 Bacteria 696
792 nmdc:mga0rr50_142762_c1 3300050513 Bacteria 1928
793 nmdc:mga0rr50_233494_c1 3300050513 Bacteria 1522
794 nmdc:mga0rr50_622009_c1 3300050513 Bacteria 921
795 nmdc:mga08x19_513046_c1 3300050514 Bacteria 847
796 nmdc:mga0a205_1195067_c1 3300050515 Bacteria 608
797 nmdc:mga0a205_230167_c1 3300050515 Unclassified 1737
798 nmdc:mga0a205_274469_c1 3300050515 Unclassified 1562
799 nmdc:mga0a205_44922_c1 3300050515 Bacteria 4260
800 Ga0495595_0743561 3300053084 Bacteria 503
801 Ga0495619_0009347 3300053085 Bacteria 6188
802 Ga0500573_0123818 3300053140 Bacteria 1437
803 Ga0501084_0005553 3300054114 Bacteria 10350
804 Ga0501084_0022038 3300054114 Bacteria 5314
805 Ga0501084_0062020 3300054114 Bacteria 3130
806 Ga0501084_0499816 3300054114 Bacteria 1028
807 Ga0501082_0025733 3300060353 Bacteria 5071
808 Ga0501082_0158262 3300060353 Bacteria 1968
809 Ga0466962_0116482 3300061719 Bacteria 1287
810 Ga0466962_0197625 3300061719 Bacteria 982
811 Ga0530510_0000976 3300061734 Bacteria 18901
812 Ga0530510_0064944 3300061734 Bacteria 2644
813 Ga0530510_0066416 3300061734 Bacteria 2615
814 Ga0530510_0219233 3300061734 Bacteria 1414
815 Ga0530510_0787713 3300061734 Bacteria 725

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10141065 Ga0207669_101410652 110
2 3300049582 Ga0501048_0818873 Ga0501048_0818873_35_412 111
3 3300049568 Ga0501031_0191105 Ga0501031_0191105_11_373 112
4 3300049576 Ga0501040_0034224 Ga0501040_0034224_799_1161 112
5 3300049582 Ga0501048_0059325 Ga0501048_0059325_1584_1946 112
6 3300049588 Ga0501072_0239574 Ga0501072_0239574_123_485 112
7 3300049592 Ga0501076_0069269 Ga0501076_0069269_1577_1939 112
8 3300049742 Ga0501080_1616947 Ga0501080_1616947_110_472 112
9 3300060353 Ga0501082_0025733 Ga0501082_0025733_10_372 112
10 3300061734 Ga0530510_0219233 Ga0530510_0219233_834_1196 112
11 3300005983 Ga0081540_1000147 Ga0081540_100014720 113
12 3300041405 Ga0439438_010095 Ga0439438_010095_188_556 113
13 3300041406 Ga0439439_0004602 Ga0439439_0004602_370_738 113
14 3300041410 Ga0439461_0002508 Ga0439461_0002508_1654_2022 113
15 3300041411 Ga0439466_0008424 Ga0439466_0008424_23_391 113
16 3300041999 Ga0439433_0001043 Ga0439433_0001043_3809_4177 113
17 3300042002 Ga0439442_002705 Ga0439442_002705_2446_2814 113
18 3300042006 Ga0439432_007408 Ga0439432_007408_1445_1813 113
19 3300042007 Ga0439449_0021541 Ga0439449_0021541_1967_2335 113
20 3300042010 Ga0439452_001551 Ga0439452_001551_1755_2123 113
21 3300042015 Ga0439462_0036097 Ga0439462_0036097_562_930 113
22 3300042115 Ga0450911_015832 Ga0450911_015832_157_525 113
23 3300042122 Ga0450920_002134 Ga0450920_002134_23_391 113
24 3300042125 Ga0450923_103720 Ga0450923_103720_229_597 113
25 3300042156 Ga0439446_0101769 Ga0439446_0101769_497_865 113
26 3300042435 Ga0439434_0010414 Ga0439434_0010414_77_445 113
27 3300042531 Ga0450918_006214 Ga0450918_006214_1043_1411 113
28 3300044683 Ga0466965_0322388 Ga0466965_0322388_15_359 114
29 3300049580 Ga0501046_1141696 Ga0501046_1141696_94_474 120
30 3300005471 Ga0070698_101168717 Ga0070698_1011687171 121
31 3300005445 Ga0070708_100051868 Ga0070708_1000518683 122
32 3300005467 Ga0070706_100044924 Ga0070706_1000449244 122
33 3300005468 Ga0070707_100334253 Ga0070707_1003342532 122
34 3300005471 Ga0070698_100010563 Ga0070698_1000105634 122
35 3300025922 Ga0207646_10418482 Ga0207646_104184822 122
36 3300025928 Ga0207700_10018875 Ga0207700_100188753 122
37 3300042012 Ga0439455_0064631 Ga0439455_0064631_361_819 122
38 3300005467 Ga0070706_100023469 Ga0070706_1000234691 125
39 3300005468 Ga0070707_100004677 Ga0070707_10000467710 125
40 3300005471 Ga0070698_100061268 Ga0070698_1000612686 125
41 3300005518 Ga0070699_100004916 Ga0070699_10000491611 125
42 3300005536 Ga0070697_100034485 Ga0070697_1000344853 125
43 3300025885 Ga0207653_10193739 Ga0207653_101937392 125
44 3300025910 Ga0207684_10005946 Ga0207684_1000594610 125
45 3300025922 Ga0207646_10000810 Ga0207646_1000081018 125
46 3300046615 Ga0495656_0798743 Ga0495656_0798743_67_471 125
47 3300046648 Ga0495611_0189667 Ga0495611_0189667_221_625 125
48 3300046681 Ga0495647_0360829 Ga0495647_0360829_102_539 125
49 3300049578 Ga0501042_1451182 Ga0501042_1451182_20_424 125
50 3300035171 Ga0373946_0414083 Ga0373946_0414083_95_550 126
51 3300044656 Ga0466969_0001395 Ga0466969_0001395_8960_9406 126
52 3300044683 Ga0466965_0028479 Ga0466965_0028479_1727_2173 126
53 3300044684 Ga0466966_0001319 Ga0466966_0001319_8955_9401 126
54 3300044735 Ga0466968_0000453 Ga0466968_0000453_3707_4153 126
55 3300046529 Ga0495652_0555184 Ga0495652_0555184_355_768 126
56 3300048088 Ga0495602_0214310 Ga0495602_0214310_926_1339 126
57 3300049576 Ga0501040_0281353 Ga0501040_0281353_677_1075 126
58 3300049582 Ga0501048_0424465 Ga0501048_0424465_250_648 126
59 3300049588 Ga0501072_0099480 Ga0501072_0099480_353_751 126
60 3300049592 Ga0501076_0045093 Ga0501076_0045093_1181_1579 126
61 3300049741 Ga0501079_1520603 Ga0501079_1520603_105_500 126
62 3300049743 Ga0501081_1526504 Ga0501081_1526504_60_458 126
63 3300049824 Ga0501045_0354368 Ga0501045_0354368_98_496 126
64 3300005471 Ga0070698_100321331 Ga0070698_1003213312 127
65 3300005518 Ga0070699_100008312 Ga0070699_1000083125 127
66 3300005518 Ga0070699_100095998 Ga0070699_1000959982 127
67 3300005719 Ga0068861_100079687 Ga0068861_1000796874 127
68 3300005844 Ga0068862_101432361 Ga0068862_1014323612 127
69 3300006028 Ga0070717_10044905 Ga0070717_100449054 127
70 3300010375 Ga0105239_11552459 Ga0105239_115524592 127
71 3300025898 Ga0207692_10005427 Ga0207692_100054271 127
72 3300025929 Ga0207664_10014599 Ga0207664_100145994 127
73 3300026118 Ga0207675_100248903 Ga0207675_1002489032 127
74 3300028380 Ga0268265_11737672 Ga0268265_117376721 127
75 3300032002 Ga0307416_100123173 Ga0307416_1001231733 127
76 3300032126 Ga0307415_100156549 Ga0307415_1001565493 127
77 3300036712 Ga0316584_0908549 Ga0316584_0908549_116_559 127
78 3300037068 Ga0373925_0000030 Ga0373925_0000030_40620_41003 127
79 3300045976 Ga0466967_0088154 Ga0466967_0088154_2334_2717 127
80 3300046660 Ga0495625_0095005 Ga0495625_0095005_1391_1774 127
81 3300049575 Ga0501039_0452725 Ga0501039_0452725_597_998 127
82 3300049576 Ga0501040_0566544 Ga0501040_0566544_19_426 127
83 3300049591 Ga0501075_0852535 Ga0501075_0852535_11_418 127
84 3300031251 Ga0265327_10055580 Ga0265327_100555802 128
85 3300044683 Ga0466965_0282735 Ga0466965_0282735_478_873 128
86 3300044683 Ga0466965_0296119 Ga0466965_0296119_464_859 128
87 3300049572 Ga0501036_0522638 Ga0501036_0522638_239_670 128
88 3300049577 Ga0501041_0639051 Ga0501041_0639051_148_579 128
89 3300049743 Ga0501081_1104908 Ga0501081_1104908_68_508 128
90 3300049822 Ga0501035_0967919 Ga0501035_0967919_99_530 128
91 3300005435 Ga0070714_101562135 Ga0070714_1015621351 129
92 3300005439 Ga0070711_100271825 Ga0070711_1002718252 129
93 3300005459 Ga0068867_101917561 Ga0068867_1019175611 129
94 3300005564 Ga0070664_100769973 Ga0070664_1007699732 129
95 3300006175 Ga0070712_100144772 Ga0070712_1001447723 129
96 3300025906 Ga0207699_10193973 Ga0207699_101939732 129
97 3300025915 Ga0207693_10070393 Ga0207693_100703933 129
98 3300036647 Ga0316582_0007103 Ga0316582_0007103_4473_4862 129
99 3300036712 Ga0316584_0008202 Ga0316584_0008202_5993_6382 129
100 3300042014 Ga0439457_144270 Ga0439457_144270_143_532 129
101 3300046477 Ga0495664_0056716 Ga0495664_0056716_182_571 129
102 3300048929 Ga0496126_1282181 Ga0496126_1282181_107_511 129
103 3300049592 Ga0501076_1078579 Ga0501076_1078579_76_558 130
104 3300042876 Ga0451577_0027239 Ga0451577_0027239_1052_1510 131
105 3300045051 Ga0451576_0082879 Ga0451576_0082879_812_1270 131
106 3300005985 Ga0081539_10022851 Ga0081539_100228513 132
107 3300010375 Ga0105239_10167398 Ga0105239_101673982 132
108 3300049570 Ga0501033_0711819 Ga0501033_0711819_222_647 132
109 3300049572 Ga0501036_1342896 Ga0501036_1342896_36_461 132
110 3300049578 Ga0501042_0336401 Ga0501042_0336401_226_651 132
111 3300049587 Ga0501071_0662961 Ga0501071_0662961_50_475 132
112 3300049588 Ga0501072_0853126 Ga0501072_0853126_138_563 132
113 3300049591 Ga0501075_0456036 Ga0501075_0456036_180_611 132
114 3300049592 Ga0501076_0416114 Ga0501076_0416114_535_960 132
115 3300049593 Ga0501077_0321970 Ga0501077_0321970_217_642 132
116 3300054114 Ga0501084_0499816 Ga0501084_0499816_383_808 132
117 3300061734 Ga0530510_0787713 Ga0530510_0787713_44_469 132
118 3300005536 Ga0070697_100794557 Ga0070697_1007945571 133
119 3300006178 Ga0075367_10175564 Ga0075367_101755643 133
120 3300006847 Ga0075431_100304997 Ga0075431_1003049973 133
121 3300006852 Ga0075433_10854832 Ga0075433_108548322 133
122 3300006871 Ga0075434_101803745 Ga0075434_1018037451 133
123 3300007076 Ga0075435_100013931 Ga0075435_1000139314 133
124 3300009098 Ga0105245_11356267 Ga0105245_113562671 133
125 3300009147 Ga0114129_10039371 Ga0114129_100393712 133
126 3300009147 Ga0114129_10640313 Ga0114129_106403132 133
127 3300009148 Ga0105243_10064574 Ga0105243_100645742 133
128 3300025935 Ga0207709_10130065 Ga0207709_101300652 133
129 3300026121 Ga0207683_11704069 Ga0207683_117040692 133
130 3300028800 Ga0265338_10665133 Ga0265338_106651332 133
131 3300048910 Ga0496107_0027403 Ga0496107_0027403_3120_3536 133
132 3300050507 nmdc:mga05p37_114059_c1 nmdc:mga05p37_114059_c1_1113_1550 133
133 3300050512 nmdc:mga0n895_1046149_c1 nmdc:mga0n895_1046149_c1_35_451 133
134 3300050512 nmdc:mga0n895_1167977_c1 nmdc:mga0n895_1167977_c1_309_725 133
135 3300050513 nmdc:mga0rr50_1043611_c1 nmdc:mga0rr50_1043611_c1_214_630 133
136 3300050515 nmdc:mga0a205_44922_c1 nmdc:mga0a205_44922_c1_2505_2921 133
137 3300005329 Ga0070683_100042967 Ga0070683_1000429675 134
138 3300005336 Ga0070680_100034038 Ga0070680_1000340383 134
139 3300005341 Ga0070691_10640899 Ga0070691_106408991 134
140 3300005344 Ga0070661_100132789 Ga0070661_1001327892 134
141 3300005345 Ga0070692_10076856 Ga0070692_100768563 134
142 3300005435 Ga0070714_100006186 Ga0070714_1000061862 134
143 3300005436 Ga0070713_100023116 Ga0070713_1000231161 134
144 3300005436 Ga0070713_101678389 Ga0070713_1016783891 134
145 3300005455 Ga0070663_100303868 Ga0070663_1003038682 134
146 3300005458 Ga0070681_10013139 Ga0070681_100131398 134
147 3300005530 Ga0070679_100158938 Ga0070679_1001589382 134
148 3300005535 Ga0070684_100133409 Ga0070684_1001334092 134
149 3300005614 Ga0068856_101140462 Ga0068856_1011404622 134
150 3300005616 Ga0068852_100128461 Ga0068852_1001284612 134
151 3300007076 Ga0075435_100346912 Ga0075435_1003469122 134
152 3300009093 Ga0105240_10702059 Ga0105240_107020592 134
153 3300013104 Ga0157370_10027459 Ga0157370_100274596 134
154 3300013307 Ga0157372_10617714 Ga0157372_106177141 134
155 3300020070 Ga0206356_10158036 Ga0206356_101580362 134
156 3300020082 Ga0206353_10746153 Ga0206353_107461532 134
157 3300025909 Ga0207705_10225348 Ga0207705_102253481 134
158 3300025912 Ga0207707_10016074 Ga0207707_100160744 134
159 3300025913 Ga0207695_10525344 Ga0207695_105253442 134
160 3300025917 Ga0207660_11024347 Ga0207660_110243471 134
161 3300025921 Ga0207652_10330545 Ga0207652_103305452 134
162 3300025921 Ga0207652_11686695 Ga0207652_116866951 134
163 3300025929 Ga0207664_10620916 Ga0207664_106209162 134
164 3300025944 Ga0207661_10373687 Ga0207661_103736872 134
165 3300026067 Ga0207678_10051310 Ga0207678_100513104 134
166 3300026078 Ga0207702_10102902 Ga0207702_101029022 134
167 3300026116 Ga0207674_10488082 Ga0207674_104880822 134
168 3300026142 Ga0207698_10394870 Ga0207698_103948703 134
169 3300036459 Ga0372808_065229 Ga0372808_065229_90_494 134
170 3300039438 Ga0436360_0207103 Ga0436360_0207103_590_1021 134
171 3300044694 Ga0466963_0071419 Ga0466963_0071419_880_1284 134
172 3300045836 Ga0466958_0801588 Ga0466958_0801588_67_471 134
173 3300050513 nmdc:mga0rr50_233494_c1 nmdc:mga0rr50_233494_c1_317_721 134
174 3300053140 Ga0500573_0123818 Ga0500573_0123818_738_1154 134
175 3300044684 Ga0466966_0337260 Ga0466966_0337260_158_574 135
176 3300044684 Ga0466966_0613633 Ga0466966_0613633_63_479 135
177 3300044842 Ga0466957_1041702 Ga0466957_1041702_34_450 135
178 3300045836 Ga0466958_0104560 Ga0466958_0104560_804_1220 135
179 3300045976 Ga0466967_0371141 Ga0466967_0371141_129_545 135
180 iso_pu_bacteria 2884634485 2884636359 135
181 3300046678 Ga0495599_0322818 Ga0495599_0322818_427_867 136
182 3300005327 Ga0070658_10349104 Ga0070658_103491042 137
183 3300005329 Ga0070683_100896515 Ga0070683_1008965152 137
184 3300005336 Ga0070680_101451868 Ga0070680_1014518681 137
185 3300005339 Ga0070660_101112209 Ga0070660_1011122091 137
186 3300005365 Ga0070688_100869797 Ga0070688_1008697971 137
187 3300005367 Ga0070667_100991429 Ga0070667_1009914291 137
188 3300005435 Ga0070714_100039755 Ga0070714_1000397554 137
189 3300005535 Ga0070684_100292857 Ga0070684_1002928573 137
190 3300005577 Ga0068857_100055005 Ga0068857_1000550053 137
191 3300013105 Ga0157369_10527153 Ga0157369_105271532 137
192 3300020082 Ga0206353_10512999 Ga0206353_105129991 137
193 3300025906 Ga0207699_10157181 Ga0207699_101571813 137
194 3300025909 Ga0207705_10597153 Ga0207705_105971532 137
195 3300025921 Ga0207652_10131563 Ga0207652_101315631 137
196 3300025929 Ga0207664_10006685 Ga0207664_100066852 137
197 3300025944 Ga0207661_10113278 Ga0207661_101132781 137
198 3300026035 Ga0207703_10367493 Ga0207703_103674932 137
199 3300026067 Ga0207678_10005161 Ga0207678_100051619 137
200 3300026116 Ga0207674_10037488 Ga0207674_100374886 137
201 3300031728 Ga0316578_10100334 Ga0316578_101003342 137
202 3300036647 Ga0316582_0386636 Ga0316582_0386636_461_892 137
203 3300036712 Ga0316584_0069586 Ga0316584_0069586_2116_2541 137
204 3300042436 Ga0439435_0359065 Ga0439435_0359065_57_482 137
205 3300042437 Ga0439444_0045391 Ga0439444_0045391_131_556 137
206 3300042993 Ga0439440_0067327 Ga0439440_0067327_256_681 137
207 3300044694 Ga0466963_1005773 Ga0466963_1005773_76_492 137
208 3300048929 Ga0496126_0006325 Ga0496126_0006325_3284_3697 137
209 iso_pu_bacteria 2758568621 2760625697 137
210 iso_pu_bacteria 2932431166 2932434570 137
211 3300005445 Ga0070708_100407210 Ga0070708_1004072101 138
212 3300035117 Ga0373953_0234389 Ga0373953_0234389_98_514 138
213 3300035172 Ga0373955_0126229 Ga0373955_0126229_410_826 138
214 3300035692 Ga0373935_0123214 Ga0373935_0123214_682_1098 138
215 3300035724 Ga0373933_0311415 Ga0373933_0311415_424_840 138
216 3300036401 Ga0373937_0373217 Ga0373937_0373217_766_1182 138
217 3300037068 Ga0373925_0251630 Ga0373925_0251630_369_785 138
218 3300038443 Ga0395901_1140885 Ga0395901_1140885_274_690 138
219 3300038741 Ga0400488_22546 Ga0400488_22546_3523_3966 138
220 3300038742 Ga0400486_06480 Ga0400486_06480_596_1039 138
221 3300046477 Ga0495664_0212632 Ga0495664_0212632_666_1082 138
222 3300046533 Ga0495640_0250099 Ga0495640_0250099_318_734 138
223 3300046543 Ga0495645_0210273 Ga0495645_0210273_233_649 138
224 3300046679 Ga0495623_0124177 Ga0495623_0124177_371_787 138
225 3300046680 Ga0495646_0252922 Ga0495646_0252922_223_639 138
226 3300047319 Ga0495674_0033624 Ga0495674_0033624_3278_3694 138
227 3300047321 Ga0495676_0062734 Ga0495676_0062734_2303_2719 138
228 3300047471 Ga0495684_0966574 Ga0495684_0966574_77_493 138
229 3300049589 Ga0501073_0113612 Ga0501073_0113612_926_1390 138
230 3300050513 nmdc:mga0rr50_142762_c1 nmdc:mga0rr50_142762_c1_110_526 138
231 3300050514 nmdc:mga08x19_513046_c1 nmdc:mga08x19_513046_c1_136_552 138
232 3300003203 JGI25406J46586_10029781 JGI25406J46586_100297813 139
233 3300003320 rootH2_10141641 rootH2_101416412 139
234 3300005293 Ga0065715_10481139 Ga0065715_104811391 139
235 3300005336 Ga0070680_100930835 Ga0070680_1009308351 139
236 3300005347 Ga0070668_100544746 Ga0070668_1005447462 139
237 3300005434 Ga0070709_10241624 Ga0070709_102416242 139
238 3300005435 Ga0070714_100579121 Ga0070714_1005791212 139
239 3300005444 Ga0070694_100062776 Ga0070694_1000627763 139
240 3300005444 Ga0070694_100863703 Ga0070694_1008637032 139
241 3300005444 Ga0070694_100996783 Ga0070694_1009967831 139
242 3300005445 Ga0070708_100025166 Ga0070708_1000251663 139
243 3300005445 Ga0070708_100374682 Ga0070708_1003746822 139
244 3300005455 Ga0070663_100426467 Ga0070663_1004264672 139
245 3300005456 Ga0070678_101491892 Ga0070678_1014918921 139
246 3300005459 Ga0068867_101089279 Ga0068867_1010892791 139
247 3300005467 Ga0070706_100008369 Ga0070706_1000083694 139
248 3300005467 Ga0070706_100039807 Ga0070706_1000398072 139
249 3300005467 Ga0070706_100914523 Ga0070706_1009145232 139
250 3300005467 Ga0070706_101010954 Ga0070706_1010109542 139
251 3300005468 Ga0070707_100115170 Ga0070707_1001151704 139
252 3300005468 Ga0070707_100792419 Ga0070707_1007924191 139
253 3300005468 Ga0070707_100793967 Ga0070707_1007939671 139
254 3300005471 Ga0070698_100008917 Ga0070698_1000089173 139
255 3300005471 Ga0070698_100030730 Ga0070698_1000307304 139
256 3300005471 Ga0070698_100553818 Ga0070698_1005538182 139
257 3300005518 Ga0070699_100001765 Ga0070699_1000017654 139
258 3300005518 Ga0070699_100003085 Ga0070699_10000308510 139
259 3300005518 Ga0070699_100209039 Ga0070699_1002090393 139
260 3300005536 Ga0070697_100030499 Ga0070697_1000304994 139
261 3300005536 Ga0070697_100143288 Ga0070697_1001432884 139
262 3300005536 Ga0070697_100588699 Ga0070697_1005886992 139
263 3300005545 Ga0070695_100306455 Ga0070695_1003064551 139
264 3300005546 Ga0070696_100603098 Ga0070696_1006030981 139
265 3300005549 Ga0070704_100117197 Ga0070704_1001171972 139
266 3300005985 Ga0081539_10050236 Ga0081539_100502362 139
267 3300006358 Ga0068871_100389604 Ga0068871_1003896042 139
268 3300006844 Ga0075428_100011383 Ga0075428_1000113834 139
269 3300006847 Ga0075431_100032309 Ga0075431_1000323094 139
270 3300006852 Ga0075433_10012558 Ga0075433_1001255810 139
271 3300006852 Ga0075433_10402977 Ga0075433_104029772 139
272 3300006852 Ga0075433_11127855 Ga0075433_111278552 139
273 3300006871 Ga0075434_100205315 Ga0075434_1002053154 139
274 3300006871 Ga0075434_100792944 Ga0075434_1007929442 139
275 3300006871 Ga0075434_102504129 Ga0075434_1025041291 139
276 3300007076 Ga0075435_100514119 Ga0075435_1005141192 139
277 3300009098 Ga0105245_10038106 Ga0105245_100381065 139
278 3300009147 Ga0114129_10037145 Ga0114129_100371457 139
279 3300009147 Ga0114129_10119005 Ga0114129_101190055 139
280 3300009147 Ga0114129_10217100 Ga0114129_102171004 139
281 3300009148 Ga0105243_10049337 Ga0105243_100493375 139
282 3300009148 Ga0105243_10354433 Ga0105243_103544333 139
283 3300009553 Ga0105249_11544339 Ga0105249_115443392 139
284 3300013297 Ga0157378_10758128 Ga0157378_107581282 139
285 3300013308 Ga0157375_11282500 Ga0157375_112825002 139
286 3300013308 Ga0157375_11381547 Ga0157375_113815472 139
287 3300013308 Ga0157375_11725945 Ga0157375_117259452 139
288 3300025885 Ga0207653_10169033 Ga0207653_101690332 139
289 3300025910 Ga0207684_10001873 Ga0207684_100018735 139
290 3300025910 Ga0207684_10051146 Ga0207684_100511462 139
291 3300025910 Ga0207684_10077409 Ga0207684_100774092 139
292 3300025910 Ga0207684_10477418 Ga0207684_104774182 139
293 3300025910 Ga0207684_11191296 Ga0207684_111912962 139
294 3300025910 Ga0207684_11233635 Ga0207684_112336351 139
295 3300025922 Ga0207646_10063291 Ga0207646_100632912 139
296 3300025922 Ga0207646_10111890 Ga0207646_101118904 139
297 3300025922 Ga0207646_10636349 Ga0207646_106363492 139
298 3300025927 Ga0207687_10081477 Ga0207687_100814772 139
299 3300025935 Ga0207709_10250128 Ga0207709_102501282 139
300 3300025937 Ga0207669_10047195 Ga0207669_100471953 139
301 3300026067 Ga0207678_10358509 Ga0207678_103585093 139
302 3300026078 Ga0207702_10198183 Ga0207702_101981833 139
303 3300026088 Ga0207641_10446132 Ga0207641_104461321 139
304 3300028380 Ga0268265_10120711 Ga0268265_101207113 139
305 3300028556 Ga0265337_1059181 Ga0265337_10591812 139
306 3300028558 Ga0265326_10003278 Ga0265326_100032784 139
307 3300028573 Ga0265334_10141287 Ga0265334_101412872 139
308 3300028653 Ga0265323_10033540 Ga0265323_100335403 139
309 3300028666 Ga0265336_10185858 Ga0265336_101858581 139
310 3300028800 Ga0265338_10053940 Ga0265338_100539402 139
311 3300031240 Ga0265320_10067437 Ga0265320_100674373 139
312 3300031241 Ga0265325_10183799 Ga0265325_101837992 139
313 3300031247 Ga0265340_10395393 Ga0265340_103953931 139
314 3300031548 Ga0307408_100055316 Ga0307408_1000553162 139
315 3300031548 Ga0307408_100378934 Ga0307408_1003789342 139
316 3300031595 Ga0265313_10020326 Ga0265313_100203263 139
317 3300031711 Ga0265314_10558013 Ga0265314_105580131 139
318 3300031728 Ga0316578_10001429 Ga0316578_100014294 139
319 3300031728 Ga0316578_10129643 Ga0316578_101296432 139
320 3300031728 Ga0316578_10249332 Ga0316578_102493322 139
321 3300031731 Ga0307405_10087442 Ga0307405_100874424 139
322 3300031733 Ga0316577_10100216 Ga0316577_101002162 139
323 3300031733 Ga0316577_10169988 Ga0316577_101699882 139
324 3300031824 Ga0307413_10633941 Ga0307413_106339412 139
325 3300031852 Ga0307410_10063970 Ga0307410_100639702 139
326 3300031903 Ga0307407_10100189 Ga0307407_101001892 139
327 3300031903 Ga0307407_10302484 Ga0307407_103024842 139
328 3300032002 Ga0307416_100440328 Ga0307416_1004403282 139
329 3300032126 Ga0307415_100134131 Ga0307415_1001341313 139
330 3300032126 Ga0307415_100181531 Ga0307415_1001815312 139
331 3300035112 Ga0373932_0087858 Ga0373932_0087858_129_584 139
332 3300035207 Ga0373942_0321687 Ga0373942_0321687_43_498 139
333 3300035398 Ga0316574_0451534 Ga0316574_0451534_31_471 139
334 3300035691 Ga0373931_0088541 Ga0373931_0088541_652_1119 139
335 3300036401 Ga0373937_1403654 Ga0373937_1403654_179_628 139
336 3300036712 Ga0316584_0079310 Ga0316584_0079310_663_1115 139
337 3300036712 Ga0316584_0220539 Ga0316584_0220539_810_1247 139
338 3300036712 Ga0316584_0265381 Ga0316584_0265381_642_1079 139
339 3300037588 Ga0316581_0120701 Ga0316581_0120701_148_585 139
340 3300038443 Ga0395901_0702551 Ga0395901_0702551_107_580 139
341 3300039062 Ga0400483_278156 Ga0400483_278156_126_686 139
342 3300039437 Ga0436365_0844020 Ga0436365_0844020_239_676 139
343 3300039450 Ga0436363_0600429 Ga0436363_0600429_116_565 139
344 3300041512 Ga0451853_3746540 Ga0451853_3746540_502_948 139
345 3300042120 Ga0450917_033036 Ga0450917_033036_51_488 139
346 3300042876 Ga0451577_0025875 Ga0451577_0025875_3737_4186 139
347 3300042876 Ga0451577_0172109 Ga0451577_0172109_422_859 139
348 3300042876 Ga0451577_0260292 Ga0451577_0260292_960_1418 139
349 3300042876 Ga0451577_0698573 Ga0451577_0698573_122_592 139
350 3300042876 Ga0451577_1878522 Ga0451577_1878522_35_472 139
351 3300044673 Ga0453683_0424338 Ga0453683_0424338_335_772 139
352 3300044673 Ga0453683_1206635 Ga0453683_1206635_23_460 139
353 3300044712 Ga0453684_0005761 Ga0453684_0005761_566_1003 139
354 3300044712 Ga0453684_0011592 Ga0453684_0011592_2852_3289 139
355 3300044712 Ga0453684_0060992 Ga0453684_0060992_4345_4782 139
356 3300044712 Ga0453684_0070272 Ga0453684_0070272_2365_2841 139
357 3300044712 Ga0453684_0084179 Ga0453684_0084179_161_598 139
358 3300044712 Ga0453684_0094715 Ga0453684_0094715_413_850 139
359 3300044712 Ga0453684_0249637 Ga0453684_0249637_46_483 139
360 3300044712 Ga0453684_0273005 Ga0453684_0273005_535_972 139
361 3300044712 Ga0453684_0397145 Ga0453684_0397145_647_1084 139
362 3300044712 Ga0453684_0417903 Ga0453684_0417903_25_462 139
363 3300044712 Ga0453684_0936446 Ga0453684_0936446_50_487 139
364 3300044712 Ga0453684_1116163 Ga0453684_1116163_97_546 139
365 3300044712 Ga0453684_1175856 Ga0453684_1175856_294_731 139
366 3300044712 Ga0453684_1653345 Ga0453684_1653345_200_637 139
367 3300044712 Ga0453684_1724368 Ga0453684_1724368_88_525 139
368 3300044712 Ga0453684_2216442 Ga0453684_2216442_53_532 139
369 3300044719 Ga0466971_0185512 Ga0466971_0185512_258_704 139
370 3300045051 Ga0451576_0032861 Ga0451576_0032861_217_666 139
371 3300045051 Ga0451576_0043213 Ga0451576_0043213_3304_3741 139
372 3300045051 Ga0451576_0366159 Ga0451576_0366159_1000_1437 139
373 3300045051 Ga0451576_0518879 Ga0451576_0518879_67_504 139
374 3300045051 Ga0451576_0570312 Ga0451576_0570312_453_890 139
375 3300046492 Ga0495585_0054059 Ga0495585_0054059_1539_1985 139
376 3300046499 Ga0495594_0480762 Ga0495594_0480762_113_559 139
377 3300046500 Ga0495596_0048204 Ga0495596_0048204_234_680 139
378 3300046500 Ga0495596_0145478 Ga0495596_0145478_213_659 139
379 3300046520 Ga0495637_0160373 Ga0495637_0160373_42_488 139
380 3300046523 Ga0495644_0018012 Ga0495644_0018012_1489_1935 139
381 3300046528 Ga0495642_0011034 Ga0495642_0011034_2284_2730 139
382 3300046537 Ga0495598_0016243 Ga0495598_0016243_796_1242 139
383 3300046538 Ga0495609_0013310 Ga0495609_0013310_1074_1520 139
384 3300046539 Ga0495621_0188888 Ga0495621_0188888_13_459 139
385 3300046558 Ga0495633_0258544 Ga0495633_0258544_146_592 139
386 3300046615 Ga0495656_0003838 Ga0495656_0003838_1589_2035 139
387 3300046615 Ga0495656_0037578 Ga0495656_0037578_778_1224 139
388 3300046615 Ga0495656_0428594 Ga0495656_0428594_55_501 139
389 3300046616 Ga0495668_0383792 Ga0495668_0383792_279_725 139
390 3300046648 Ga0495611_0306153 Ga0495611_0306153_58_504 139
391 3300046664 Ga0495659_0001304 Ga0495659_0001304_1521_1967 139
392 3300046683 Ga0495658_0962286 Ga0495658_0962286_87_533 139
393 3300046684 Ga0495669_0054248 Ga0495669_0054248_389_835 139
394 3300046691 Ga0495670_0030538 Ga0495670_0030538_708_1154 139
395 3300046691 Ga0495670_0097227 Ga0495670_0097227_320_766 139
396 3300046794 Ga0495589_0040145 Ga0495589_0040145_28_474 139
397 3300047321 Ga0495676_0137748 Ga0495676_0137748_970_1416 139
398 3300047322 Ga0495680_0328656 Ga0495680_0328656_417_863 139
399 3300047446 Ga0495679_106466 Ga0495679_106466_119_565 139
400 3300048090 Ga0495615_0030275 Ga0495615_0030275_194_640 139
401 3300048904 Ga0496101_0021168 Ga0496101_0021168_269_715 139
402 3300048905 Ga0496102_0721390 Ga0496102_0721390_357_803 139
403 3300048915 Ga0496112_1098284 Ga0496112_1098284_91_537 139
404 3300048917 Ga0496114_0165868 Ga0496114_0165868_323_769 139
405 3300049521 Ga0501298_138911 Ga0501298_138911_97_534 139
406 3300049569 Ga0501032_0587619 Ga0501032_0587619_90_536 139
407 3300049570 Ga0501033_0504403 Ga0501033_0504403_164_601 139
408 3300049572 Ga0501036_0904065 Ga0501036_0904065_225_671 139
409 3300049574 Ga0501038_0216725 Ga0501038_0216725_12_458 139
410 3300049575 Ga0501039_0920092 Ga0501039_0920092_106_552 139
411 3300049576 Ga0501040_0026767 Ga0501040_0026767_1747_2220 139
412 3300049576 Ga0501040_0029531 Ga0501040_0029531_1673_2119 139
413 3300049576 Ga0501040_0338282 Ga0501040_0338282_405_851 139
414 3300049577 Ga0501041_0109185 Ga0501041_0109185_1030_1503 139
415 3300049577 Ga0501041_0136052 Ga0501041_0136052_27_470 139
416 3300049578 Ga0501042_0431489 Ga0501042_0431489_498_944 139
417 3300049579 Ga0501043_0077263 Ga0501043_0077263_686_1132 139
418 3300049580 Ga0501046_0050384 Ga0501046_0050384_1485_1928 139
419 3300049580 Ga0501046_0150316 Ga0501046_0150316_1125_1571 139
420 3300049580 Ga0501046_0444694 Ga0501046_0444694_405_842 139
421 3300049580 Ga0501046_0866652 Ga0501046_0866652_137_607 139
422 3300049582 Ga0501048_0069827 Ga0501048_0069827_988_1461 139
423 3300049584 Ga0501068_0099449 Ga0501068_0099449_1142_1588 139
424 3300049585 Ga0501069_0519802 Ga0501069_0519802_173_646 139
425 3300049586 Ga0501070_0924090 Ga0501070_0924090_147_593 139
426 3300049587 Ga0501071_0045384 Ga0501071_0045384_185_658 139
427 3300049587 Ga0501071_0385144 Ga0501071_0385144_270_716 139
428 3300049587 Ga0501071_0543300 Ga0501071_0543300_204_650 139
429 3300049588 Ga0501072_0023641 Ga0501072_0023641_3362_3799 139
430 3300049588 Ga0501072_0058318 Ga0501072_0058318_694_1140 139
431 3300049588 Ga0501072_0059442 Ga0501072_0059442_761_1207 139
432 3300049590 Ga0501074_0320885 Ga0501074_0320885_606_1052 139
433 3300049590 Ga0501074_0382645 Ga0501074_0382645_21_464 139
434 3300049590 Ga0501074_0530180 Ga0501074_0530180_324_761 139
435 3300049591 Ga0501075_0030185 Ga0501075_0030185_1535_2008 139
436 3300049591 Ga0501075_0104614 Ga0501075_0104614_458_904 139
437 3300049591 Ga0501075_0247582 Ga0501075_0247582_381_818 139
438 3300049591 Ga0501075_0945410 Ga0501075_0945410_172_618 139
439 3300049592 Ga0501076_0053550 Ga0501076_0053550_1420_1857 139
440 3300049592 Ga0501076_0076460 Ga0501076_0076460_1468_1914 139
441 3300049592 Ga0501076_0162391 Ga0501076_0162391_1119_1565 139
442 3300049592 Ga0501076_0215329 Ga0501076_0215329_453_899 139
443 3300049593 Ga0501077_0144309 Ga0501077_0144309_413_859 139
444 3300049593 Ga0501077_0716536 Ga0501077_0716536_171_608 139
445 3300049741 Ga0501079_0024479 Ga0501079_0024479_1614_2051 139
446 3300049742 Ga0501080_0228513 Ga0501080_0228513_334_807 139
447 3300049743 Ga0501081_0046019 Ga0501081_0046019_1684_2127 139
448 3300049743 Ga0501081_0224279 Ga0501081_0224279_399_845 139
449 3300049743 Ga0501081_0331562 Ga0501081_0331562_290_763 139
450 3300049744 Ga0501083_0266271 Ga0501083_0266271_462_935 139
451 3300049822 Ga0501035_0354499 Ga0501035_0354499_87_560 139
452 3300049822 Ga0501035_0668366 Ga0501035_0668366_100_546 139
453 3300049824 Ga0501045_0052824 Ga0501045_0052824_296_769 139
454 3300049824 Ga0501045_0147026 Ga0501045_0147026_249_692 139
455 3300049824 Ga0501045_0160675 Ga0501045_0160675_303_749 139
456 3300050507 nmdc:mga05p37_274869_c1 nmdc:mga05p37_274869_c1_360_797 139
457 3300050507 nmdc:mga05p37_529690_c1 nmdc:mga05p37_529690_c1_330_767 139
458 3300050507 nmdc:mga05p37_6470_c1 nmdc:mga05p37_6470_c1_3857_4294 139
459 3300050507 nmdc:mga05p37_82474_c1 nmdc:mga05p37_82474_c1_3416_3862 139
460 3300050510 nmdc:mga06r32_619879_c1 nmdc:mga06r32_619879_c1_529_966 139
461 3300050512 nmdc:mga0n895_102465_c1 nmdc:mga0n895_102465_c1_553_990 139
462 3300050513 nmdc:mga0rr50_622009_c1 nmdc:mga0rr50_622009_c1_278_727 139
463 3300050515 nmdc:mga0a205_1195067_c1 nmdc:mga0a205_1195067_c1_131_577 139
464 3300050515 nmdc:mga0a205_230167_c1 nmdc:mga0a205_230167_c1_131_580 139
465 3300050515 nmdc:mga0a205_274469_c1 nmdc:mga0a205_274469_c1_638_1075 139
466 3300054114 Ga0501084_0022038 Ga0501084_0022038_4498_4944 139
467 3300054114 Ga0501084_0062020 Ga0501084_0062020_1524_1997 139
468 3300060353 Ga0501082_0158262 Ga0501082_0158262_972_1409 139
469 3300061734 Ga0530510_0000976 Ga0530510_0000976_8668_9114 139
470 3300061734 Ga0530510_0064944 Ga0530510_0064944_332_805 139
471 3300061734 Ga0530510_0066416 Ga0530510_0066416_1349_1786 139
472 3300005334 Ga0068869_101981643 Ga0068869_1019816431 140
473 3300005337 Ga0070682_101471162 Ga0070682_1014711621 140
474 3300005339 Ga0070660_101851610 Ga0070660_1018516101 140
475 3300005354 Ga0070675_101632480 Ga0070675_1016324801 140
476 3300005365 Ga0070688_101250772 Ga0070688_1012507721 140
477 3300005435 Ga0070714_100987465 Ga0070714_1009874651 140
478 3300005436 Ga0070713_100507849 Ga0070713_1005078491 140
479 3300005456 Ga0070678_101340062 Ga0070678_1013400621 140
480 3300005530 Ga0070679_101311381 Ga0070679_1013113811 140
481 3300005564 Ga0070664_100990462 Ga0070664_1009904621 140
482 3300005843 Ga0068860_101840571 Ga0068860_1018405711 140
483 3300005937 Ga0081455_10003072 Ga0081455_1000307210 140
484 3300005937 Ga0081455_10021544 Ga0081455_100215442 140
485 3300005981 Ga0081538_10131353 Ga0081538_101313532 140
486 3300005983 Ga0081540_1040203 Ga0081540_10402032 140
487 3300006881 Ga0068865_100489785 Ga0068865_1004897851 140
488 3300009148 Ga0105243_12082000 Ga0105243_120820001 140
489 3300009176 Ga0105242_11616189 Ga0105242_116161891 140
490 3300009551 Ga0105238_10677881 Ga0105238_106778811 140
491 3300009553 Ga0105249_12838535 Ga0105249_128385351 140
492 3300011119 Ga0105246_10613460 Ga0105246_106134601 140
493 3300013307 Ga0157372_10912185 Ga0157372_109121852 140
494 3300013308 Ga0157375_11666526 Ga0157375_116665262 140
495 3300014325 Ga0163163_10430087 Ga0163163_104300872 140
496 3300020082 Ga0206353_10956333 Ga0206353_109563331 140
497 3300025901 Ga0207688_10528291 Ga0207688_105282912 140
498 3300025921 Ga0207652_10225671 Ga0207652_102256713 140
499 3300025921 Ga0207652_11153544 Ga0207652_111535441 140
500 3300025928 Ga0207700_10301392 Ga0207700_103013922 140
501 3300025945 Ga0207679_11109779 Ga0207679_111097792 140
502 3300026075 Ga0207708_11150904 Ga0207708_111509042 140
503 3300026095 Ga0207676_10096184 Ga0207676_100961842 140
504 3300026121 Ga0207683_10184287 Ga0207683_101842872 140
505 3300028381 Ga0268264_10783606 Ga0268264_107836062 140
506 3300031456 Ga0307513_10000007 Ga0307513_10000007194 140
507 3300031548 Ga0307408_100315152 Ga0307408_1003151522 140
508 3300031727 Ga0316576_10081447 Ga0316576_100814471 140
509 3300031824 Ga0307413_10072770 Ga0307413_100727702 140
510 3300031824 Ga0307413_10121364 Ga0307413_101213642 140
511 3300031852 Ga0307410_10072123 Ga0307410_100721232 140
512 3300031852 Ga0307410_10083361 Ga0307410_100833612 140
513 3300031852 Ga0307410_10105655 Ga0307410_101056551 140
514 3300031852 Ga0307410_10175203 Ga0307410_101752032 140
515 3300031852 Ga0307410_10921798 Ga0307410_109217982 140
516 3300031852 Ga0307410_11247686 Ga0307410_112476861 140
517 3300031901 Ga0307406_10157618 Ga0307406_101576183 140
518 3300031901 Ga0307406_10252857 Ga0307406_102528572 140
519 3300031901 Ga0307406_10441569 Ga0307406_104415692 140
520 3300031903 Ga0307407_10126213 Ga0307407_101262132 140
521 3300031903 Ga0307407_10206911 Ga0307407_102069112 140
522 3300031911 Ga0307412_10207847 Ga0307412_102078472 140
523 3300031911 Ga0307412_10679099 Ga0307412_106790992 140
524 3300031995 Ga0307409_100079320 Ga0307409_1000793204 140
525 3300031995 Ga0307409_100104357 Ga0307409_1001043572 140
526 3300031995 Ga0307409_100287800 Ga0307409_1002878002 140
527 3300031995 Ga0307409_100317354 Ga0307409_1003173542 140
528 3300031995 Ga0307409_100666561 Ga0307409_1006665612 140
529 3300031995 Ga0307409_101471037 Ga0307409_1014710371 140
530 3300031995 Ga0307409_102133278 Ga0307409_1021332782 140
531 3300032002 Ga0307416_100175852 Ga0307416_1001758521 140
532 3300032002 Ga0307416_100209363 Ga0307416_1002093632 140
533 3300032002 Ga0307416_100228086 Ga0307416_1002280863 140
534 3300032002 Ga0307416_100336810 Ga0307416_1003368102 140
535 3300032002 Ga0307416_100935533 Ga0307416_1009355331 140
536 3300032002 Ga0307416_101062954 Ga0307416_1010629541 140
537 3300032004 Ga0307414_10361052 Ga0307414_103610522 140
538 3300032004 Ga0307414_10627941 Ga0307414_106279412 140
539 3300032005 Ga0307411_10119245 Ga0307411_101192452 140
540 3300032126 Ga0307415_100060385 Ga0307415_1000603853 140
541 3300035114 Ga0373939_0530907 Ga0373939_0530907_26_493 140
542 3300035398 Ga0316574_0495370 Ga0316574_0495370_187_645 140
543 3300036712 Ga0316584_0155639 Ga0316584_0155639_600_1058 140
544 3300037418 Ga0395900_0028223 Ga0395900_0028223_3002_3433 140
545 3300037466 Ga0395898_0377321 Ga0395898_0377321_379_861 140
546 3300038443 Ga0395901_0092832 Ga0395901_0092832_1061_1492 140
547 3300039062 Ga0400483_044090 Ga0400483_044090_24374_24820 140
548 3300039062 Ga0400483_075002 Ga0400483_075002_173_616 140
549 3300039062 Ga0400483_237049 Ga0400483_237049_26564_27010 140
550 3300039062 Ga0400483_247042 Ga0400483_247042_20019_20459 140
551 3300041999 Ga0439433_0022172 Ga0439433_0022172_326_748 140
552 3300044656 Ga0466969_0062005 Ga0466969_0062005_690_1121 140
553 3300044683 Ga0466965_0202951 Ga0466965_0202951_579_1010 140
554 3300044683 Ga0466965_0217741 Ga0466965_0217741_343_774 140
555 3300044683 Ga0466965_0297259 Ga0466965_0297259_306_737 140
556 3300044684 Ga0466966_0113190 Ga0466966_0113190_1115_1546 140
557 3300044693 Ga0466961_0052562 Ga0466961_0052562_218_649 140
558 3300044693 Ga0466961_0330038 Ga0466961_0330038_28_459 140
559 3300044693 Ga0466961_0854944 Ga0466961_0854944_73_504 140
560 3300044694 Ga0466963_0080405 Ga0466963_0080405_1647_2072 140
561 3300044694 Ga0466963_0186593 Ga0466963_0186593_485_973 140
562 3300044694 Ga0466963_0469426 Ga0466963_0469426_368_799 140
563 3300044706 Ga0466964_0444641 Ga0466964_0444641_36_467 140
564 3300044719 Ga0466971_0100204 Ga0466971_0100204_158_583 140
565 3300044719 Ga0466971_0120029 Ga0466971_0120029_734_1165 140
566 3300044719 Ga0466971_0135545 Ga0466971_0135545_657_1088 140
567 3300044719 Ga0466971_0171065 Ga0466971_0171065_579_1010 140
568 3300044765 Ga0466970_0052504 Ga0466970_0052504_606_1037 140
569 3300044765 Ga0466970_0115921 Ga0466970_0115921_269_700 140
570 3300044842 Ga0466957_0069844 Ga0466957_0069844_337_768 140
571 3300044842 Ga0466957_0082097 Ga0466957_0082097_114_539 140
572 3300044842 Ga0466957_0137240 Ga0466957_0137240_1080_1505 140
573 3300044842 Ga0466957_0540242 Ga0466957_0540242_13_444 140
574 3300044901 Ga0466960_0055537 Ga0466960_0055537_558_989 140
575 3300044901 Ga0466960_0094815 Ga0466960_0094815_805_1236 140
576 3300044901 Ga0466960_0353407 Ga0466960_0353407_318_749 140
577 3300044901 Ga0466960_0998558 Ga0466960_0998558_18_449 140
578 3300045049 Ga0466959_0037787 Ga0466959_0037787_1115_1546 140
579 3300045049 Ga0466959_0373429 Ga0466959_0373429_513_944 140
580 3300045049 Ga0466959_0397932 Ga0466959_0397932_24_455 140
581 3300045049 Ga0466959_0408537 Ga0466959_0408537_347_778 140
582 3300045049 Ga0466959_0677772 Ga0466959_0677772_200_631 140
583 3300045049 Ga0466959_0824203 Ga0466959_0824203_154_576 140
584 3300045836 Ga0466958_0080154 Ga0466958_0080154_276_707 140
585 3300045836 Ga0466958_0438611 Ga0466958_0438611_156_644 140
586 3300045976 Ga0466967_0007996 Ga0466967_0007996_4653_5114 140
587 3300045976 Ga0466967_0078990 Ga0466967_0078990_476_901 140
588 3300045976 Ga0466967_0100462 Ga0466967_0100462_1400_1831 140
589 3300045976 Ga0466967_0137995 Ga0466967_0137995_612_1043 140
590 3300045976 Ga0466967_0300468 Ga0466967_0300468_371_802 140
591 3300045976 Ga0466967_0591830 Ga0466967_0591830_70_501 140
592 3300045976 Ga0466967_0833759 Ga0466967_0833759_147_584 140
593 3300046459 Ga0495629_0081597 Ga0495629_0081597_750_1196 140
594 3300046461 Ga0495641_0412581 Ga0495641_0412581_97_543 140
595 3300046463 Ga0495653_0035942 Ga0495653_0035942_2502_2954 140
596 3300046473 Ga0495582_0385902 Ga0495582_0385902_93_545 140
597 3300046475 Ga0495639_0144800 Ga0495639_0144800_69_515 140
598 3300046514 Ga0495618_0419328 Ga0495618_0419328_243_695 140
599 3300046516 Ga0495628_0008040 Ga0495628_0008040_6491_6943 140
600 3300046517 Ga0495630_0005586 Ga0495630_0005586_3586_4038 140
601 3300046526 Ga0495666_0010115 Ga0495666_0010115_2595_3047 140
602 3300046537 Ga0495598_0148262 Ga0495598_0148262_71_496 140
603 3300046559 Ga0495667_0063928 Ga0495667_0063928_230_682 140
604 3300046683 Ga0495658_0120321 Ga0495658_0120321_724_1170 140
605 3300046683 Ga0495658_0436336 Ga0495658_0436336_367_813 140
606 3300046683 Ga0495658_0443908 Ga0495658_0443908_98_550 140
607 3300047319 Ga0495674_0614254 Ga0495674_0614254_315_767 140
608 3300047322 Ga0495680_0244801 Ga0495680_0244801_765_1217 140
609 3300047323 Ga0495683_0335875 Ga0495683_0335875_31_465 140
610 3300047471 Ga0495684_0017695 Ga0495684_0017695_4208_4660 140
611 3300048904 Ga0496101_1262802 Ga0496101_1262802_13_450 140
612 3300048917 Ga0496114_0518778 Ga0496114_0518778_145_591 140
613 3300048917 Ga0496114_0688244 Ga0496114_0688244_128_598 140
614 3300049571 Ga0501034_0936063 Ga0501034_0936063_149_574 140
615 3300049590 Ga0501074_0229138 Ga0501074_0229138_69_512 140
616 3300049680 Ga0501250_011159 Ga0501250_011159_465_911 140
617 3300049681 Ga0501251_026455 Ga0501251_026455_301_747 140
618 3300050490 nmdc:mga03n38_10923_c1 nmdc:mga03n38_10923_c1_810_1247 140
619 3300053085 Ga0495619_0009347 Ga0495619_0009347_4146_4598 140
620 3300061719 Ga0466962_0116482 Ga0466962_0116482_512_943 140
621 3300061719 Ga0466962_0197625 Ga0466962_0197625_233_664 140
622 iso_pu_bacteria 2731639228 2731905904 140
623 3300001979 JGI24740J21852_10124853 JGI24740J21852_101248531 141
624 3300003203 JGI25406J46586_10046635 JGI25406J46586_100466352 141
625 3300005330 Ga0070690_100114157 Ga0070690_1001141573 141
626 3300005337 Ga0070682_100275204 Ga0070682_1002752042 141
627 3300005337 Ga0070682_100574345 Ga0070682_1005743451 141
628 3300005337 Ga0070682_101127942 Ga0070682_1011279421 141
629 3300005355 Ga0070671_100200029 Ga0070671_1002000292 141
630 3300005366 Ga0070659_100269620 Ga0070659_1002696202 141
631 3300005434 Ga0070709_10000243 Ga0070709_1000024332 141
632 3300005435 Ga0070714_100002623 Ga0070714_10000262314 141
633 3300005435 Ga0070714_100026307 Ga0070714_1000263072 141
634 3300005436 Ga0070713_100069794 Ga0070713_1000697945 141
635 3300005436 Ga0070713_100124001 Ga0070713_1001240012 141
636 3300005437 Ga0070710_10647177 Ga0070710_106471771 141
637 3300005439 Ga0070711_100005834 Ga0070711_1000058346 141
638 3300005456 Ga0070678_100859280 Ga0070678_1008592801 141
639 3300005456 Ga0070678_101331697 Ga0070678_1013316971 141
640 3300005456 Ga0070678_101356120 Ga0070678_1013561201 141
641 3300005467 Ga0070706_100000535 Ga0070706_10000053510 141
642 3300005468 Ga0070707_100001203 Ga0070707_10000120310 141
643 3300005471 Ga0070698_100001558 Ga0070698_10000155810 141
644 3300005535 Ga0070684_101607352 Ga0070684_1016073521 141
645 3300005548 Ga0070665_100278101 Ga0070665_1002781013 141
646 3300005614 Ga0068856_100147913 Ga0068856_1001479132 141
647 3300005719 Ga0068861_101036755 Ga0068861_1010367552 141
648 3300005937 Ga0081455_10000125 Ga0081455_1000012557 141
649 3300005937 Ga0081455_10031896 Ga0081455_100318962 141
650 3300005985 Ga0081539_10301175 Ga0081539_103011751 141
651 3300006028 Ga0070717_10008469 Ga0070717_100084697 141
652 3300006028 Ga0070717_10022387 Ga0070717_100223871 141
653 3300006028 Ga0070717_10346818 Ga0070717_103468182 141
654 3300006163 Ga0070715_10019535 Ga0070715_100195353 141
655 3300006173 Ga0070716_100002854 Ga0070716_1000028544 141
656 3300006173 Ga0070716_100468628 Ga0070716_1004686282 141
657 3300006175 Ga0070712_100114727 Ga0070712_1001147272 141
658 3300006175 Ga0070712_100144039 Ga0070712_1001440392 141
659 3300006175 Ga0070712_100429456 Ga0070712_1004294562 141
660 3300006844 Ga0075428_100035847 Ga0075428_1000358476 141
661 3300006846 Ga0075430_100007507 Ga0075430_1000075078 141
662 3300006847 Ga0075431_100199687 Ga0075431_1001996874 141
663 3300006871 Ga0075434_100093239 Ga0075434_1000932392 141
664 3300006880 Ga0075429_101811210 Ga0075429_1018112101 141
665 3300006880 Ga0075429_101811211 Ga0075429_1018112111 141
666 3300006914 Ga0075436_100482023 Ga0075436_1004820232 141
667 3300007076 Ga0075435_100033678 Ga0075435_1000336784 141
668 3300009094 Ga0111539_10041267 Ga0111539_100412674 141
669 3300009147 Ga0114129_10042088 Ga0114129_100420889 141
670 3300009147 Ga0114129_12721635 Ga0114129_127216351 141
671 3300009551 Ga0105238_10210629 Ga0105238_102106292 141
672 3300011119 Ga0105246_10300029 Ga0105246_103000292 141
673 3300013105 Ga0157369_10040204 Ga0157369_100402043 141
674 3300013306 Ga0163162_10921625 Ga0163162_109216252 141
675 3300014325 Ga0163163_10458610 Ga0163163_104586102 141
676 3300014325 Ga0163163_11018756 Ga0163163_110187562 141
677 3300014745 Ga0157377_11117914 Ga0157377_111179141 141
678 3300025898 Ga0207692_10014684 Ga0207692_100146846 141
679 3300025901 Ga0207688_10094259 Ga0207688_100942592 141
680 3300025905 Ga0207685_10001778 Ga0207685_100017782 141
681 3300025906 Ga0207699_10001799 Ga0207699_100017996 141
682 3300025910 Ga0207684_10000603 Ga0207684_1000060337 141
683 3300025915 Ga0207693_10095339 Ga0207693_100953391 141
684 3300025915 Ga0207693_10142067 Ga0207693_101420672 141
685 3300025916 Ga0207663_10003868 Ga0207663_100038687 141
686 3300025922 Ga0207646_10001784 Ga0207646_1000178419 141
687 3300025922 Ga0207646_10440238 Ga0207646_104402381 141
688 3300025922 Ga0207646_10584035 Ga0207646_105840352 141
689 3300025925 Ga0207650_10350401 Ga0207650_103504012 141
690 3300025928 Ga0207700_10002168 Ga0207700_100021682 141
691 3300025928 Ga0207700_10216048 Ga0207700_102160483 141
692 3300025928 Ga0207700_10304431 Ga0207700_103044311 141
693 3300025928 Ga0207700_10408833 Ga0207700_104088333 141
694 3300025928 Ga0207700_10645966 Ga0207700_106459662 141
695 3300025929 Ga0207664_10019092 Ga0207664_100190925 141
696 3300025929 Ga0207664_10029998 Ga0207664_100299984 141
697 3300025929 Ga0207664_10238440 Ga0207664_102384402 141
698 3300025929 Ga0207664_10720569 Ga0207664_107205691 141
699 3300025931 Ga0207644_10141049 Ga0207644_101410492 141
700 3300025939 Ga0207665_10000276 Ga0207665_1000027612 141
701 3300025939 Ga0207665_10657974 Ga0207665_106579741 141
702 3300025944 Ga0207661_10067067 Ga0207661_100670672 141
703 3300025944 Ga0207661_11243983 Ga0207661_112439832 141
704 3300026078 Ga0207702_10066800 Ga0207702_100668004 141
705 3300026078 Ga0207702_10107551 Ga0207702_101075512 141
706 3300026116 Ga0207674_10053026 Ga0207674_100530265 141
707 3300026118 Ga0207675_100756800 Ga0207675_1007568002 141
708 3300026121 Ga0207683_10015284 Ga0207683_100152842 141
709 3300027907 Ga0207428_10015077 Ga0207428_100150773 141
710 3300028556 Ga0265337_1000651 Ga0265337_100065110 141
711 3300028558 Ga0265326_10015114 Ga0265326_100151143 141
712 3300028573 Ga0265334_10000598 Ga0265334_100005986 141
713 3300028577 Ga0265318_10032583 Ga0265318_100325831 141
714 3300028653 Ga0265323_10010425 Ga0265323_100104252 141
715 3300028666 Ga0265336_10019721 Ga0265336_100197213 141
716 3300028800 Ga0265338_10004244 Ga0265338_100042446 141
717 3300029957 Ga0265324_10002870 Ga0265324_100028703 141
718 3300030731 Ga0316177_1042139 Ga0316177_10421392 141
719 3300030732 Ga0316176_1121491 Ga0316176_11214911 141
720 3300030733 Ga0314311_1199186 Ga0314311_11991862 141
721 3300030733 Ga0314311_1242111 Ga0314311_12421112 141
722 3300030736 Ga0316180_1157337 Ga0316180_11573372 141
723 3300030744 Ga0316181_1288931 Ga0316181_12889312 141
724 3300031238 Ga0265332_10024023 Ga0265332_100240232 141
725 3300031240 Ga0265320_10009656 Ga0265320_100096566 141
726 3300031251 Ga0265327_10060576 Ga0265327_100605763 141
727 3300031665 Ga0316575_10026583 Ga0316575_100265834 141
728 3300031711 Ga0265314_10016682 Ga0265314_100166821 141
729 3300031712 Ga0265342_10001644 Ga0265342_100016449 141
730 3300031727 Ga0316576_10011456 Ga0316576_100114566 141
731 3300031727 Ga0316576_10076273 Ga0316576_100762731 141
732 3300031728 Ga0316578_10049213 Ga0316578_100492133 141
733 3300031824 Ga0307413_10279580 Ga0307413_102795802 141
734 3300031824 Ga0307413_11102817 Ga0307413_111028172 141
735 3300031903 Ga0307407_10783892 Ga0307407_107838922 141
736 3300031903 Ga0307407_10884968 Ga0307407_108849682 141
737 3300032126 Ga0307415_100064170 Ga0307415_1000641704 141
738 3300032133 Ga0316583_10031640 Ga0316583_100316402 141
739 3300032139 Ga0316580_10047953 Ga0316580_100479532 141
740 3300035113 Ga0373936_0125741 Ga0373936_0125741_207_632 141
741 3300035398 Ga0316574_0042242 Ga0316574_0042242_1870_2295 141
742 3300035398 Ga0316574_0154709 Ga0316574_0154709_749_1174 141
743 3300035398 Ga0316574_0482884 Ga0316574_0482884_36_503 141
744 3300036712 Ga0316584_0098005 Ga0316584_0098005_1292_1723 141
745 3300036712 Ga0316584_0225293 Ga0316584_0225293_222_680 141
746 3300036712 Ga0316584_0309703 Ga0316584_0309703_700_1125 141
747 3300037418 Ga0395900_0141015 Ga0395900_0141015_1152_1577 141
748 3300037466 Ga0395898_0172182 Ga0395898_0172182_488_913 141
749 3300038443 Ga0395901_0011481 Ga0395901_0011481_3915_4340 141
750 3300041404 Ga0439436_0048764 Ga0439436_0048764_104_556 141
751 3300041413 Ga0439465_0207217 Ga0439465_0207217_234_659 141
752 3300041512 Ga0451853_0190429 Ga0451853_0190429_1082_1543 141
753 3300042002 Ga0439442_001536 Ga0439442_001536_730_1182 141
754 3300042002 Ga0439442_001802 Ga0439442_001802_990_1442 141
755 3300042006 Ga0439432_024978 Ga0439432_024978_429_881 141
756 3300042007 Ga0439449_0021066 Ga0439449_0021066_451_903 141
757 3300042121 Ga0450919_002392 Ga0450919_002392_1583_2035 141
758 3300042122 Ga0450920_000417 Ga0450920_000417_3351_3803 141
759 3300042125 Ga0450923_095083 Ga0450923_095083_89_562 141
760 3300042146 Ga0450907_001195 Ga0450907_001195_2037_2489 141
761 3300042435 Ga0439434_0001257 Ga0439434_0001257_1402_1854 141
762 3300042531 Ga0450918_005774 Ga0450918_005774_460_912 141
763 3300044693 Ga0466961_0066331 Ga0466961_0066331_1740_2165 141
764 3300044693 Ga0466961_0268710 Ga0466961_0268710_568_1014 141
765 3300044694 Ga0466963_0525640 Ga0466963_0525640_167_592 141
766 3300044706 Ga0466964_0658453 Ga0466964_0658453_101_547 141
767 3300044901 Ga0466960_0411077 Ga0466960_0411077_272_724 141
768 3300045976 Ga0466967_0135033 Ga0466967_0135033_240_692 141
769 3300045976 Ga0466967_0178852 Ga0466967_0178852_68_493 141
770 3300045976 Ga0466967_0204538 Ga0466967_0204538_185_610 141
771 3300046455 Ga0495603_0836788 Ga0495603_0836788_47_472 141
772 3300046463 Ga0495653_0046282 Ga0495653_0046282_1353_1778 141
773 3300046477 Ga0495664_0147304 Ga0495664_0147304_856_1281 141
774 3300046511 Ga0495608_0368566 Ga0495608_0368566_349_783 141
775 3300046514 Ga0495618_0315468 Ga0495618_0315468_59_484 141
776 3300046516 Ga0495628_0793273 Ga0495628_0793273_95_520 141
777 3300046529 Ga0495652_0556681 Ga0495652_0556681_327_752 141
778 3300046543 Ga0495645_0032474 Ga0495645_0032474_3129_3554 141
779 3300047319 Ga0495674_0090813 Ga0495674_0090813_1071_1496 141
780 3300048905 Ga0496102_1732733 Ga0496102_1732733_32_457 141
781 3300048911 Ga0496108_0438707 Ga0496108_0438707_448_873 141
782 3300048912 Ga0496109_0748394 Ga0496109_0748394_221_646 141
783 3300048914 Ga0496111_0117819 Ga0496111_0117819_935_1360 141
784 3300048915 Ga0496112_0482964 Ga0496112_0482964_89_514 141
785 3300048920 Ga0496117_0299066 Ga0496117_0299066_57_491 141
786 3300048921 Ga0496118_0086946 Ga0496118_0086946_1491_1928 141
787 3300049568 Ga0501031_0000509 Ga0501031_0000509_21455_21880 141
788 3300049569 Ga0501032_0000310 Ga0501032_0000310_1993_2418 141
789 3300049570 Ga0501033_0000835 Ga0501033_0000835_13193_13618 141
790 3300049571 Ga0501034_0036667 Ga0501034_0036667_312_737 141
791 3300049572 Ga0501036_0000080 Ga0501036_0000080_41156_41581 141
792 3300049573 Ga0501037_0001757 Ga0501037_0001757_12841_13266 141
793 3300049574 Ga0501038_0013323 Ga0501038_0013323_1238_1663 141
794 3300049575 Ga0501039_0001383 Ga0501039_0001383_16375_16800 141
795 3300049578 Ga0501042_0263259 Ga0501042_0263259_462_887 141
796 3300049579 Ga0501043_0001371 Ga0501043_0001371_14651_15076 141
797 3300049580 Ga0501046_0007065 Ga0501046_0007065_1377_1802 141
798 3300049581 Ga0501047_0032375 Ga0501047_0032375_4101_4526 141
799 3300049581 Ga0501047_0114499 Ga0501047_0114499_54_479 141
800 3300049582 Ga0501048_0408742 Ga0501048_0408742_200_625 141
801 3300049584 Ga0501068_0090509 Ga0501068_0090509_1435_1860 141
802 3300049585 Ga0501069_0000598 Ga0501069_0000598_1870_2295 141
803 3300049586 Ga0501070_0007557 Ga0501070_0007557_1117_1542 141
804 3300049587 Ga0501071_0154685 Ga0501071_0154685_1194_1619 141
805 3300049588 Ga0501072_0202616 Ga0501072_0202616_365_790 141
806 3300049589 Ga0501073_0004179 Ga0501073_0004179_311_736 141
807 3300049590 Ga0501074_0058490 Ga0501074_0058490_2014_2439 141
808 3300049741 Ga0501079_0136778 Ga0501079_0136778_321_746 141
809 3300049742 Ga0501080_0003245 Ga0501080_0003245_874_1299 141
810 3300049823 Ga0501044_0002910 Ga0501044_0002910_12523_12948 141
811 3300050492 nmdc:mga0yw44_677980_c1 nmdc:mga0yw44_677980_c1_29_454 141
812 3300050492 nmdc:mga0yw44_740544_c1 nmdc:mga0yw44_740544_c1_102_530 141
813 3300050507 nmdc:mga05p37_4595_c1 nmdc:mga05p37_4595_c1_6694_7119 141
814 3300050508 nmdc:mga09592_666_c1 nmdc:mga09592_666_c1_23856_24281 141
815 3300050509 nmdc:mga0qj67_10937_c1 nmdc:mga0qj67_10937_c1_2700_3125 141
816 3300050510 nmdc:mga06r32_68_c1 nmdc:mga06r32_68_c1_10110_10535 141
817 3300050511 nmdc:mga08y16_72389_c1 nmdc:mga08y16_72389_c1_467_892 141
818 3300053084 Ga0495595_0743561 Ga0495595_0743561_14_448 141
819 3300054114 Ga0501084_0005553 Ga0501084_0005553_7567_7992 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

17

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9651 1 140
3ko7-assembly2.cif.gz_D dtd from plasmodium falciparum in complex with d-lysine 0.9581 1 140
3knf-assembly2.cif.gz_D crystal structure of d-tyr-trna(tyr) deacylase from plasmodium falciparum 0.9553 1 140
3lmv-assembly2.cif.gz_D d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9547 1 140
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9522 1 141
ID Description Score Start End Superfamily
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9908 1 141 3.50.80.10
af_P9WNS9_1_143_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9838 1 141 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9651 1 140 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9593 1 140 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9579 1 141 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A4R2IFD2-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 1.004 2 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A852Z478-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 1.003 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A641AQP8-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9995 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A6I4MPF9-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9991 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A847KJW6-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9984 1 141 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026

Feature Viewer

pLDDT pTM Quality
97.86 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map