F481932

General Info

Members Datasets Scaffolds Average Seq Length
813 436 739 453

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10161439|Ga0105240_101614391
Length 529
Sequence VQPHAVRPLDEQRLGRGLHLAVRQPKVLRAHPVPVRMNGRMVCEWVSRRRAASARDDCGDQVAPRSVYWAVCQTRFKMKNITCFKAYDVRGRVPSELDEDIAYRIGRGYAAFVEPKTVAVGRDIRLSSPALAAAVARGLTDAGVDVLDIGVGGTELAYFATFSRKLDGGIMVTASHNPPDYNGMKMVREESRPLSSATGLKDIRALAERGEFAPAKRRGSVRPVDIKPDYVAHLLSYVDRAELAPLKIVVNAGNGGAGPIIDLLEPHLPFEFVKIFHEPDGKFPNGVPNPMIEENRTVTMERVRAERADLGLAWDGDYDRCFFFDARGDFIEGYYIVGLLAQSFLKKHPGDRIVHDPRLTWNTLDIVKAAGGEPVQSKSGHAFIKQKMREVDAIYGGEMSAHHYFRKFSYADSGMIPWLLVTELMSRHKKSLAELVGDRMRRFPASGEINRKVTDAQAAIEKAEARYGAGALAIDRTDGLGIDFADWRFNLRASNTEPLLRLNVESRGDEQLMRRRTEELLELLGGEPG

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
3 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
4 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
5 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
6 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
7 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
8 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
28 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
29 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
30 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
31 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
32 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
33 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
34 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
35 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
36 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
37 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
38 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
39 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
40 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
41 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
42 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
43 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
44 2636415599 Klebsiella variicola DX120E Isolate Unclassified
45 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
46 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
47 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
48 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
49 2738543009 Luteibacter sp. OK325 Isolate Unclassified
50 2775507074 Klebsiella sp. D5A Isolate Unclassified
51 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
52 2847085930 Erwinia persicina B64 Isolate Bulb
53 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
54 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
55 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
56 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
57 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
58 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
59 2904504865 Serratia marcescens 1822 Isolate Unclassified
60 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
61 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
62 2919150387 Rahnella aceris 1817 Isolate Unclassified
63 2919513703 Luteimonas sp. 3794 Isolate Unclassified
64 2919675420 Luteimonas terrae 4099 Isolate Unclassified
65 2927143783 Rahnella sp. 2050 Isolate Unclassified
66 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
67 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
68 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
69 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
70 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
71 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
72 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
73 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
74 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
75 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
76 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
77 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
78 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
79 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
80 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
82 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
83 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
84 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
85 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
88 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
89 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
90 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
91 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
92 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
93 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
94 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
95 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
96 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
97 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
100 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
101 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
102 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
103 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
104 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
105 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
106 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
107 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
108 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
109 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
110 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
111 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
112 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
121 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
122 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
123 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
129 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
134 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
135 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
136 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
142 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
143 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
144 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
145 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
146 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
158 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
159 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
160 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
161 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
162 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
163 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
164 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
165 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
166 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
167 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
168 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
169 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
173 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
174 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
177 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
178 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
179 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
180 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
181 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
182 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
183 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
184 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
185 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
186 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
187 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
188 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
189 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
190 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
191 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
192 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
193 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
194 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
195 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
196 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
197 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
198 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
199 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
200 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
201 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
210 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
212 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
222 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
224 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
282 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
283 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
284 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
285 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
286 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
287 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
288 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
291 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
292 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
293 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
294 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
295 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
296 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
297 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
298 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
299 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
300 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
301 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
302 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
303 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
304 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
305 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
306 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
307 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
312 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
314 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
315 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
316 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
317 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
318 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
319 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
320 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
322 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
325 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
326 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
327 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
328 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
329 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
330 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
331 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
332 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
333 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
334 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
335 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
336 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
337 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
338 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
339 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
340 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
341 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
342 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
343 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
344 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
345 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
346 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
347 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
348 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
349 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
352 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
353 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
359 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
362 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
363 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
364 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
365 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
366 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
367 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
370 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
371 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
374 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
375 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
376 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
380 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
381 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
382 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
383 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
384 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
389 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
393 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
394 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
395 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
396 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
397 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
398 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
399 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
400 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
401 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
410 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
411 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
412 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
413 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
414 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
417 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
418 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
419 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
420 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
421 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
422 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
423 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
424 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
425 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
426 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
427 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
428 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
433 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
434 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
435 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
436 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.28
Metatranscriptomes 0.62
Isolates 9.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0.12
Endosphere 8.36
Nodule 0.25
Rhizoplane 8
Rhizosphere 71.34
Stem 0
Stem Tuber 0.12
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10003881 3300002067 Bacteria 5058
2 JGI25162J39368_1000006 3300002737 Bacteria 405267
3 JGI25163J39215_1000001 3300002771 Bacteria 314282
4 JGI25164J39214_1000001 3300002772 Bacteria 477015
5 JGI25150J39212_1000066 3300002774 Bacteria 63677
6 JGI25151J46595_10000139 3300003187 Bacteria 96000
7 JGI25406J46586_10004998 3300003203 Bacteria 6156
8 JGI25153J46596_10000101 3300003215 Bacteria 96639
9 rootH1_10084749 3300003323 Bacteria 3927
10 Ga0055538_1000004 3300003751 Bacteria 615646
11 Ga0055539_1000004 3300003752 Bacteria 615646
12 Ga0055533_1000007 3300003756 Bacteria 615646
13 Ga0055525_1000007 3300003759 Bacteria 615646
14 Ga0055527_1000079 3300003760 Bacteria 79303
15 Ga0055535_1000166 3300003761 Bacteria 71280
16 Ga0055542_1000210 3300003762 Bacteria 71284
17 Ga0055529_1000394 3300003763 Bacteria 46666
18 Ga0055526_1000218 3300003771 Bacteria 49706
19 Ga0055537_1000900 3300003773 Bacteria 14074
20 Ga0055536_1000489 3300003781 Bacteria 27490
21 Ga0055534_1000061 3300003784 Bacteria 82050
22 Ga0055534_1000519 3300003784 Bacteria 20776
23 Ga0055528_1000332 3300003790 Bacteria 39798
24 Ga0055531_10000741 3300003794 Bacteria 27490
25 Ga0055541_1000004 3300003841 Bacteria 615646
26 Ga0058692_1000585 3300003856 Bacteria 15400
27 Ga0058692_1005216 3300003856 Bacteria 3733
28 Ga0065704_10000131 3300005289 Bacteria 44705
29 Ga0065707_10082227 3300005295 Bacteria 18733
30 Ga0065707_10091420 3300005295 Bacteria 3950
31 Ga0070658_10011129 3300005327 Bacteria 7213
32 Ga0070658_10063524 3300005327 Bacteria 3010
33 Ga0070683_100003608 3300005329 Bacteria 12604
34 Ga0070670_100000015 3300005331 Bacteria 228819
35 Ga0070670_100007297 3300005331 Bacteria 9374
36 Ga0070670_100048855 3300005331 Bacteria 3640
37 Ga0070670_100109121 3300005331 Bacteria 2385
38 Ga0068869_100021901 3300005334 Bacteria 4398
39 Ga0070666_10000010 3300005335 Bacteria 264789
40 Ga0070666_10003001 3300005335 Bacteria 10229
41 Ga0070666_10113166 3300005335 Bacteria 1878
42 Ga0070680_100015372 3300005336 Bacteria 5998
43 Ga0068868_100003563 3300005338 Bacteria 10842
44 Ga0068868_100039324 3300005338 Bacteria 3676
45 Ga0068868_100105831 3300005338 Bacteria 2282
46 Ga0070660_100016031 3300005339 Bacteria 5428
47 Ga0070660_100083401 3300005339 Bacteria 2511
48 Ga0070689_100001380 3300005340 Bacteria 15441
49 Ga0070689_100008233 3300005340 Bacteria 7334
50 Ga0070691_10015541 3300005341 Bacteria 3496
51 Ga0070687_100067156 3300005343 Bacteria 1913
52 Ga0070668_100027973 3300005347 Bacteria 4279
53 Ga0070669_100002460 3300005353 Bacteria 13404
54 Ga0070669_100187800 3300005353 Bacteria 1620
55 Ga0070671_100000013 3300005355 Bacteria 173287
56 Ga0070671_100000102 3300005355 Bacteria 54494
57 Ga0070688_100007363 3300005365 Bacteria 5931
58 Ga0070659_100004133 3300005366 Bacteria 10348
59 Ga0070659_100004779 3300005366 Bacteria 9683
60 Ga0070659_100006051 3300005366 Bacteria 8727
61 Ga0070667_100000015 3300005367 Bacteria 238203
62 Ga0070667_100000316 3300005367 Bacteria 54130
63 Ga0070667_100008879 3300005367 Bacteria 8319
64 Ga0070667_100032883 3300005367 Bacteria 4329
65 Ga0070714_100000332 3300005435 Bacteria 35550
66 Ga0070714_100003381 3300005435 Bacteria 11890
67 Ga0070714_100010493 3300005435 Bacteria 7323
68 Ga0070713_100028320 3300005436 Bacteria 4423
69 Ga0070701_10003578 3300005438 Bacteria 6169
70 Ga0070701_10013846 3300005438 Bacteria 3681
71 Ga0070701_10015737 3300005438 Bacteria 3501
72 Ga0070711_100017875 3300005439 Bacteria 4519
73 Ga0070705_100019673 3300005440 Bacteria 3558
74 Ga0070705_100020123 3300005440 Bacteria 3526
75 Ga0070700_100041789 3300005441 Bacteria 2812
76 Ga0070700_100055800 3300005441 Bacteria 2474
77 Ga0070700_100072901 3300005441 Bacteria 2196
78 Ga0070663_100058726 3300005455 Bacteria 2763
79 Ga0070662_100006417 3300005457 Bacteria 7581
80 Ga0070662_100007912 3300005457 Bacteria 6912
81 Ga0070681_10001409 3300005458 Bacteria 21093
82 Ga0070681_10002788 3300005458 Bacteria 16141
83 Ga0070681_10017195 3300005458 Bacteria 7231
84 Ga0070681_10130923 3300005458 Bacteria 2441
85 Ga0068867_100038984 3300005459 Bacteria 3462
86 Ga0068867_100040263 3300005459 Bacteria 3409
87 Ga0070685_10000104 3300005466 Bacteria 53528
88 Ga0070699_100258653 3300005518 Bacteria 1557
89 Ga0070679_100004499 3300005530 Bacteria 12879
90 Ga0070679_100024620 3300005530 Bacteria 5900
91 Ga0070679_100038440 3300005530 Bacteria 4758
92 Ga0070679_100039655 3300005530 Bacteria 4681
93 Ga0070679_100071779 3300005530 Bacteria 3454
94 Ga0070679_100090867 3300005530 Bacteria 3041
95 Ga0070679_100154764 3300005530 Bacteria 2268
96 Ga0070684_100011689 3300005535 Bacteria 6999
97 Ga0070684_100022552 3300005535 Bacteria 5254
98 Ga0070672_100118933 3300005543 Bacteria 2161
99 Ga0070686_100013717 3300005544 Bacteria 4647
100 Ga0070686_100028431 3300005544 Bacteria 3391
101 Ga0070695_100063709 3300005545 Bacteria 2397
102 Ga0070695_100175008 3300005545 Bacteria 1517
103 Ga0070696_100001233 3300005546 Bacteria 16612
104 Ga0070693_100002362 3300005547 Bacteria 8677
105 Ga0070693_100077467 3300005547 Bacteria 1973
106 Ga0070665_100000975 3300005548 Bacteria 36228
107 Ga0070665_100001202 3300005548 Bacteria 31585
108 Ga0070665_100001355 3300005548 Bacteria 28967
109 Ga0070665_100011568 3300005548 Bacteria 8922
110 Ga0070665_100019218 3300005548 Bacteria 6854
111 Ga0070665_100040982 3300005548 Bacteria 4654
112 Ga0070665_100050144 3300005548 Bacteria 4189
113 Ga0070665_100071602 3300005548 Bacteria 3473
114 Ga0070665_100072100 3300005548 Bacteria 3462
115 Ga0070665_100132172 3300005548 Bacteria 2498
116 Ga0070704_100141065 3300005549 Bacteria 1882
117 Ga0068855_100029694 3300005563 Bacteria 6536
118 Ga0068855_100093536 3300005563 Bacteria 3467
119 Ga0068855_100140514 3300005563 Bacteria 2753
120 Ga0070664_100008203 3300005564 Bacteria 8448
121 Ga0070664_100010617 3300005564 Bacteria 7463
122 Ga0068854_100073627 3300005578 Bacteria 2504
123 Ga0068854_100163278 3300005578 Bacteria 1727
124 Ga0068856_100042191 3300005614 Bacteria 4487
125 Ga0070702_100012947 3300005615 Bacteria 4200
126 Ga0068852_100187784 3300005616 Bacteria 1948
127 Ga0068859_100000226 3300005617 Bacteria 55324
128 Ga0068859_100000716 3300005617 Bacteria 33426
129 Ga0068859_100006172 3300005617 Bacteria 12178
130 Ga0068859_100020160 3300005617 Bacteria 6695
131 Ga0068859_100041968 3300005617 Bacteria 4595
132 Ga0068859_100137349 3300005617 Bacteria 2518
133 Ga0068864_100000056 3300005618 Bacteria 127891
134 Ga0068864_100004974 3300005618 Bacteria 10901
135 Ga0068861_100000308 3300005719 Bacteria 27355
136 Ga0068861_100003643 3300005719 Bacteria 10269
137 Ga0068861_100010260 3300005719 Bacteria 6502
138 Ga0068861_100031081 3300005719 Bacteria 3919
139 Ga0068861_100031978 3300005719 Bacteria 3871
140 Ga0068861_100090186 3300005719 Bacteria 2417
141 Ga0068870_10003458 3300005840 Bacteria 6690
142 Ga0068870_10015306 3300005840 Bacteria 3636
143 Ga0068863_100001807 3300005841 Bacteria 21230
144 Ga0068863_100018409 3300005841 Bacteria 6684
145 Ga0068863_100111940 3300005841 Bacteria 2600
146 Ga0068863_100170748 3300005841 Bacteria 2086
147 Ga0068863_100220295 3300005841 Bacteria 1828
148 Ga0068858_100003005 3300005842 Bacteria 16912
149 Ga0068858_100031279 3300005842 Bacteria 4942
150 Ga0068858_100052903 3300005842 Bacteria 3757
151 Ga0068858_100108837 3300005842 Bacteria 2587
152 Ga0068860_100000270 3300005843 Bacteria 75836
153 Ga0068860_100001763 3300005843 Bacteria 23093
154 Ga0068860_100003237 3300005843 Bacteria 16794
155 Ga0068860_100068081 3300005843 Bacteria 3382
156 Ga0068862_100000651 3300005844 Bacteria 35850
157 Ga0068862_100004834 3300005844 Bacteria 11346
158 Ga0068862_100010635 3300005844 Bacteria 7602
159 Ga0068862_100013139 3300005844 Bacteria 6849
160 Ga0068862_100019633 3300005844 Bacteria 5643
161 Ga0068862_100058884 3300005844 Bacteria 3297
162 Ga0068862_100222401 3300005844 Bacteria 1710
163 Ga0068862_100249564 3300005844 Bacteria 1617
164 Ga0081455_10000140 3300005937 Bacteria 84977
165 Ga0081539_10000001 3300005985 Bacteria 808331
166 Ga0075365_10037994 3300006038 Bacteria 3127
167 Ga0075364_10020442 3300006051 Bacteria 4164
168 Ga0075364_10029466 3300006051 Bacteria 3520
169 Ga0097621_100016081 3300006237 Bacteria 5648
170 Ga0097621_100158575 3300006237 Bacteria 1944
171 Ga0097621_100202203 3300006237 Bacteria 1725
172 Ga0068871_100001261 3300006358 Bacteria 16923
173 Ga0068871_100015467 3300006358 Bacteria 5712
174 Ga0075428_100004861 3300006844 Bacteria 14907
175 Ga0075428_100008798 3300006844 Bacteria 11205
176 Ga0075428_100026092 3300006844 Bacteria 6470
177 Ga0075428_100039752 3300006844 Bacteria 5177
178 Ga0075430_100007160 3300006846 Bacteria 9414
179 Ga0075430_100021881 3300006846 Bacteria 5433
180 Ga0075430_100047171 3300006846 Bacteria 3637
181 Ga0075431_100000026 3300006847 Bacteria 75269
182 Ga0075431_100008443 3300006847 Bacteria 10314
183 Ga0075431_100011646 3300006847 Bacteria 8872
184 Ga0075429_100025071 3300006880 Bacteria 5177
185 Ga0075429_100033160 3300006880 Bacteria 4487
186 Ga0075429_100048276 3300006880 Bacteria 3702
187 Ga0075429_100079751 3300006880 Bacteria 2853
188 Ga0068865_100008065 3300006881 Bacteria 6502
189 Ga0068865_100013404 3300006881 Bacteria 5179
190 Ga0097620_100000226 3300006931 Bacteria 55324
191 Ga0097620_100000716 3300006931 Bacteria 33426
192 Ga0097620_100006171 3300006931 Bacteria 12178
193 Ga0097620_100020160 3300006931 Bacteria 6695
194 Ga0097620_100041967 3300006931 Bacteria 4595
195 Ga0097620_100137347 3300006931 Bacteria 2518
196 Ga0079104_1007220 3300006946 Bacteria 4066
197 Ga0099795_10000003 3300007788 Bacteria 110661
198 Ga0099795_10000125 3300007788 Bacteria 12966
199 Ga0105251_10004848 3300009011 Bacteria 8983
200 Ga0105251_10006989 3300009011 Bacteria 7050
201 Ga0105251_10007021 3300009011 Bacteria 7026
202 Ga0105251_10011245 3300009011 Bacteria 5123
203 Ga0105244_10001876 3300009036 Bacteria 16339
204 Ga0105244_10023140 3300009036 Bacteria 3411
205 Ga0105250_10000262 3300009092 Bacteria 42910
206 Ga0105250_10001432 3300009092 Bacteria 12885
207 Ga0105250_10006801 3300009092 Bacteria 4965
208 Ga0105240_10019300 3300009093 Bacteria 9111
209 Ga0105240_10032759 3300009093 Bacteria 6724
210 Ga0105240_10062207 3300009093 Bacteria 4648
211 Ga0105240_10087339 3300009093 Bacteria 3819
212 Ga0105240_10161439 3300009093 Bacteria 2661
213 Ga0105240_10444193 3300009093 Bacteria 1453
214 Ga0111539_10000759 3300009094 Bacteria 41999
215 Ga0111539_10011229 3300009094 Bacteria 11254
216 Ga0105245_10003333 3300009098 Bacteria 14415
217 Ga0105245_10015924 3300009098 Bacteria 6552
218 Ga0105245_10239744 3300009098 Bacteria 1757
219 Ga0105247_10000126 3300009101 Bacteria 74123
220 Ga0105247_10001692 3300009101 Bacteria 15563
221 Ga0105247_10014469 3300009101 Bacteria 4732
222 Ga0105247_10029529 3300009101 Bacteria 3323
223 Ga0105247_10035834 3300009101 Bacteria 3025
224 Ga0114129_10000158 3300009147 Bacteria 72596
225 Ga0105243_10042808 3300009148 Bacteria 3547
226 Ga0105242_10084907 3300009176 Bacteria 2654
227 Ga0105242_10189194 3300009176 Bacteria 1821
228 Ga0105248_10004270 3300009177 Bacteria 15813
229 Ga0105248_10010407 3300009177 Bacteria 10244
230 Ga0105248_10034626 3300009177 Bacteria 5649
231 Ga0105248_10035560 3300009177 Bacteria 5573
232 Ga0105248_10059402 3300009177 Bacteria 4295
233 Ga0105248_10146606 3300009177 Bacteria 2663
234 Ga0105238_10016023 3300009551 Bacteria 7581
235 Ga0105238_10061080 3300009551 Bacteria 3772
236 Ga0105238_10133579 3300009551 Bacteria 2459
237 Ga0105238_10139338 3300009551 Bacteria 2403
238 Ga0105238_10228572 3300009551 Bacteria 1837
239 Ga0105249_10032674 3300009553 Bacteria 4708
240 Ga0105249_10044940 3300009553 Bacteria 4017
241 Ga0105249_10055667 3300009553 Bacteria 3619
242 Ga0099796_10000077 3300010159 Bacteria 16717
243 Ga0105239_10095426 3300010375 Bacteria 3285
244 Ga0105239_10182658 3300010375 Bacteria 2347
245 Ga0105239_10205732 3300010375 Bacteria 2206
246 Ga0105246_10153103 3300011119 Bacteria 1748
247 Ga0157373_10079939 3300013100 Bacteria 2306
248 Ga0157371_10000327 3300013102 Bacteria 61256
249 Ga0157371_10014898 3300013102 Bacteria 5852
250 Ga0157370_10002542 3300013104 Bacteria 21916
251 Ga0157369_10036624 3300013105 Bacteria 5374
252 Ga0157369_10146846 3300013105 Bacteria 2493
253 Ga0157369_10165560 3300013105 Bacteria 2332
254 Ga0157374_10003622 3300013296 Bacteria 13001
255 Ga0157378_10101820 3300013297 Bacteria 2623
256 Ga0163162_10000193 3300013306 Bacteria 56063
257 Ga0163162_10022079 3300013306 Bacteria 6271
258 Ga0163162_10051398 3300013306 Bacteria 4136
259 Ga0163162_10060598 3300013306 Bacteria 3820
260 Ga0163162_10331417 3300013306 Bacteria 1655
261 Ga0157372_10015969 3300013307 Bacteria 8054
262 Ga0157372_10034994 3300013307 Bacteria 5527
263 Ga0157372_10064539 3300013307 Bacteria 4108
264 Ga0157375_10001552 3300013308 Bacteria 19770
265 Ga0157375_10004434 3300013308 Bacteria 12192
266 Ga0157375_10105249 3300013308 Bacteria 2911
267 Ga0163163_10000199 3300014325 Bacteria 62045
268 Ga0163163_10001793 3300014325 Bacteria 18091
269 Ga0163163_10002680 3300014325 Bacteria 15055
270 Ga0163163_10056400 3300014325 Bacteria 3883
271 Ga0163163_10111894 3300014325 Bacteria 2759
272 Ga0157380_10000366 3300014326 Bacteria 27213
273 Ga0157380_10005725 3300014326 Bacteria 8697
274 Ga0157380_10225915 3300014326 Bacteria 1678
275 Ga0157380_10235258 3300014326 Bacteria 1648
276 Ga0182008_10055257 3300014497 Bacteria 1964
277 Ga0157377_10019179 3300014745 Bacteria 3570
278 Ga0157379_10000004 3300014968 Bacteria 173351
279 Ga0157379_10007489 3300014968 Bacteria 9449
280 Ga0157379_10036011 3300014968 Bacteria 4413
281 Ga0157379_10049293 3300014968 Bacteria 3760
282 Ga0157379_10259622 3300014968 Bacteria 1578
283 Ga0157376_10034668 3300014969 Bacteria 4077
284 Ga0157376_10098559 3300014969 Bacteria 2548
285 Ga0182007_10001346 3300015262 Bacteria 13262
286 Ga0182005_1002932 3300015265 Bacteria 5921
287 Ga0163161_10000938 3300017792 Bacteria 22429
288 Ga0163161_10001227 3300017792 Bacteria 19219
289 Ga0163161_10003635 3300017792 Bacteria 10818
290 Ga0163161_10041524 3300017792 Bacteria 3305
291 Ga0206353_10645750 3300020082 Bacteria 3303
292 Ga0209760_100048 3300025207 Bacteria 107458
293 Ga0209784_100001 3300025224 Bacteria 3600592
294 Ga0209566_100001 3300025225 Bacteria 3600765
295 Ga0209674_100002 3300025226 Bacteria 3600592
296 Ga0209672_100004 3300025228 Bacteria 1467504
297 Ga0209563_100008 3300025230 Bacteria 1554545
298 Ga0207427_100002 3300025231 Bacteria 1355321
299 Ga0209437_100046 3300025233 Bacteria 405293
300 Ga0209258_100003 3300025242 Bacteria 1467504
301 Ga0207425_1000040 3300025245 Bacteria 218121
302 Ga0209677_100004 3300025253 Bacteria 1554545
303 Ga0209148_1000025 3300025254 Bacteria 663262
304 Ga0209129_1000011 3300025258 Bacteria 568657
305 Ga0209233_1004556 3300025261 Bacteria 4699
306 Ga0209565_1000037 3300025263 Bacteria 289371
307 Ga0209455_1000004 3300025272 Bacteria 1467504
308 Ga0209673_1000032 3300025273 Bacteria 339956
309 Ga0209675_1000020 3300025291 Bacteria 335854
310 Ga0209675_1006527 3300025291 Bacteria 4657
311 Ga0209676_1000775 3300025292 Bacteria 42707
312 Ga0209025_1000002 3300025294 Bacteria 1393142
313 Ga0209564_1000210 3300025295 Bacteria 133323
314 Ga0209758_1000003 3300025297 Bacteria 1398533
315 Ga0209256_1001437 3300025299 Bacteria 24667
316 Ga0209256_1001987 3300025299 Bacteria 18387
317 Ga0209257_1000734 3300025304 Bacteria 49703
318 Ga0207656_10030174 3300025321 Bacteria 2238
319 Ga0207696_1000263 3300025711 Bacteria 67526
320 Ga0207696_1000375 3300025711 Bacteria 43991
321 Ga0207696_1000973 3300025711 Bacteria 17405
322 Ga0207696_1004745 3300025711 Bacteria 5787
323 Ga0207655_1000126 3300025728 Bacteria 151903
324 Ga0207655_1002995 3300025728 Bacteria 12938
325 Ga0207713_1003022 3300025735 Bacteria 11737
326 Ga0207713_1021063 3300025735 Bacteria 3135
327 Ga0207713_1021500 3300025735 Bacteria 3090
328 Ga0207682_10023345 3300025893 Bacteria 2442
329 Ga0207710_10005014 3300025900 Bacteria 5735
330 Ga0207680_10000002 3300025903 Bacteria 1018646
331 Ga0207680_10001344 3300025903 Bacteria 11635
332 Ga0207680_10004644 3300025903 Bacteria 6522
333 Ga0207680_10020012 3300025903 Bacteria 3591
334 Ga0207647_10035047 3300025904 Bacteria 3200
335 Ga0207647_10044695 3300025904 Bacteria 2766
336 Ga0207645_10001117 3300025907 Bacteria 22196
337 Ga0207643_10025347 3300025908 Bacteria 3277
338 Ga0207707_10000592 3300025912 Bacteria 36551
339 Ga0207707_10002087 3300025912 Bacteria 18085
340 Ga0207707_10023465 3300025912 Bacteria 5396
341 Ga0207707_10030460 3300025912 Bacteria 4720
342 Ga0207695_10022323 3300025913 Bacteria 7189
343 Ga0207695_10026839 3300025913 Bacteria 6422
344 Ga0207695_10037128 3300025913 Bacteria 5258
345 Ga0207695_10092601 3300025913 Bacteria 3033
346 Ga0207663_10055474 3300025916 Bacteria 2487
347 Ga0207660_10028245 3300025917 Bacteria 3836
348 Ga0207660_10041342 3300025917 Bacteria 3230
349 Ga0207662_10025886 3300025918 Bacteria 3382
350 Ga0207657_10020522 3300025919 Bacteria 6241
351 Ga0207649_10037129 3300025920 Bacteria 2940
352 Ga0207652_10005312 3300025921 Bacteria 10449
353 Ga0207652_10009857 3300025921 Bacteria 7686
354 Ga0207652_10043119 3300025921 Bacteria 3842
355 Ga0207652_10046115 3300025921 Bacteria 3718
356 Ga0207652_10066984 3300025921 Bacteria 3113
357 Ga0207652_10102565 3300025921 Bacteria 2529
358 Ga0207681_10010785 3300025923 Bacteria 5610
359 Ga0207681_10074576 3300025923 Bacteria 2377
360 Ga0207681_10076413 3300025923 Bacteria 2352
361 Ga0207650_10000013 3300025925 Bacteria 409471
362 Ga0207650_10015067 3300025925 Bacteria 5378
363 Ga0207659_10096986 3300025926 Bacteria 2214
364 Ga0207664_10003922 3300025929 Bacteria 9999
365 Ga0207664_10112372 3300025929 Bacteria 2267
366 Ga0207644_10000106 3300025931 Bacteria 61480
367 Ga0207644_10010630 3300025931 Bacteria 6069
368 Ga0207690_10001878 3300025932 Bacteria 12887
369 Ga0207690_10005861 3300025932 Bacteria 7272
370 Ga0207690_10019430 3300025932 Bacteria 4184
371 Ga0207706_10010664 3300025933 Bacteria 8393
372 Ga0207706_10013421 3300025933 Bacteria 7448
373 Ga0207670_10009765 3300025936 Bacteria 5492
374 Ga0207670_10014828 3300025936 Bacteria 4639
375 Ga0207669_10060336 3300025937 Bacteria 2325
376 Ga0207691_10004950 3300025940 Bacteria 12848
377 Ga0207691_10073580 3300025940 Bacteria 3082
378 Ga0207691_10092194 3300025940 Bacteria 2713
379 Ga0207691_10257297 3300025940 Bacteria 1505
380 Ga0207711_10000789 3300025941 Bacteria 31134
381 Ga0207711_10005914 3300025941 Bacteria 10334
382 Ga0207711_10030506 3300025941 Bacteria 4547
383 Ga0207689_10025150 3300025942 Bacteria 4991
384 Ga0207667_10043209 3300025949 Bacteria 4784
385 Ga0207667_10076477 3300025949 Bacteria 3474
386 Ga0207667_10116416 3300025949 Bacteria 2754
387 Ga0207667_10131465 3300025949 Bacteria 2578
388 Ga0207667_10135135 3300025949 Bacteria 2539
389 Ga0207712_10045895 3300025961 Bacteria 3027
390 Ga0207668_10080770 3300025972 Bacteria 2356
391 Ga0207668_10174209 3300025972 Bacteria 1690
392 Ga0207640_10059011 3300025981 Bacteria 2530
393 Ga0207658_10000005 3300025986 Bacteria 408341
394 Ga0207658_10001415 3300025986 Bacteria 18704
395 Ga0207658_10009396 3300025986 Bacteria 6632
396 Ga0207677_10100724 3300026023 Bacteria 2125
397 Ga0207703_10000299 3300026035 Bacteria 54610
398 Ga0207703_10000362 3300026035 Bacteria 48617
399 Ga0207703_10002710 3300026035 Bacteria 15168
400 Ga0207703_10032898 3300026035 Bacteria 4107
401 Ga0207703_10033351 3300026035 Bacteria 4081
402 Ga0207703_10073481 3300026035 Bacteria 2829
403 Ga0207708_10039253 3300026075 Bacteria 3607
404 Ga0207708_10045681 3300026075 Bacteria 3337
405 Ga0207708_10046446 3300026075 Bacteria 3307
406 Ga0207708_10077474 3300026075 Bacteria 2552
407 Ga0207641_10000189 3300026088 Bacteria 86363
408 Ga0207641_10010019 3300026088 Bacteria 7795
409 Ga0207641_10057353 3300026088 Bacteria 3311
410 Ga0207641_10057354 3300026088 Bacteria 3311
411 Ga0207641_10069156 3300026088 Bacteria 3030
412 Ga0207648_10001386 3300026089 Bacteria 26692
413 Ga0207648_10031464 3300026089 Bacteria 4692
414 Ga0207648_10042699 3300026089 Bacteria 3980
415 Ga0207676_10000010 3300026095 Bacteria 519402
416 Ga0207674_10075635 3300026116 Bacteria 3377
417 Ga0207675_100002419 3300026118 Bacteria 18498
418 Ga0207675_100004826 3300026118 Bacteria 12983
419 Ga0207675_100005127 3300026118 Bacteria 12612
420 Ga0207675_100009736 3300026118 Bacteria 8998
421 Ga0207675_100022027 3300026118 Bacteria 5931
422 Ga0207675_100045880 3300026118 Bacteria 4082
423 Ga0207675_100131037 3300026118 Bacteria 2378
424 Ga0207675_100149794 3300026118 Bacteria 2220
425 Ga0207698_10095730 3300026142 Bacteria 2445
426 Ga0209371_1000002 3300027312 Bacteria 1551985
427 Ga0209371_1000731 3300027312 Bacteria 27606
428 Ga0209371_1000832 3300027312 Bacteria 25391
429 Ga0209179_1000043 3300027512 Bacteria 25706
430 Ga0209179_1000750 3300027512 Bacteria 3519
431 Ga0209970_1002398 3300027614 Bacteria 3192
432 Ga0209983_1000316 3300027665 Bacteria 10140
433 Ga0209971_1012668 3300027682 Bacteria 1996
434 Ga0209998_10001850 3300027717 Bacteria 5015
435 Ga0209974_10000905 3300027876 Bacteria 10327
436 Ga0207428_10011931 3300027907 Bacteria 7650
437 Ga0207428_10026550 3300027907 Bacteria 4833
438 Ga0268266_10000604 3300028379 Bacteria 49032
439 Ga0268266_10000886 3300028379 Bacteria 38796
440 Ga0268266_10014073 3300028379 Bacteria 6886
441 Ga0268266_10022685 3300028379 Bacteria 5344
442 Ga0268266_10085491 3300028379 Bacteria 2756
443 Ga0268265_10000383 3300028380 Bacteria 47354
444 Ga0268265_10000794 3300028380 Bacteria 30047
445 Ga0268265_10009074 3300028380 Bacteria 6725
446 Ga0268265_10026857 3300028380 Bacteria 4100
447 Ga0268265_10041277 3300028380 Bacteria 3413
448 Ga0268265_10101110 3300028380 Bacteria 2329
449 Ga0268264_10000036 3300028381 Bacteria 392994
450 Ga0268264_10000164 3300028381 Bacteria 147861
451 Ga0268264_10020390 3300028381 Bacteria 5418
452 Ga0268264_10032256 3300028381 Bacteria 4297
453 Ga0268264_10039050 3300028381 Bacteria 3921
454 Ga0268264_10081464 3300028381 Bacteria 2766
455 Ga0265326_10003972 3300028558 Bacteria 4797
456 Ga0265319_1038052 3300028563 Bacteria 1637
457 Ga0265334_10000005 3300028573 Bacteria 242590
458 Ga0265334_10001041 3300028573 Bacteria 13685
459 Ga0265318_10000626 3300028577 Bacteria 24443
460 Ga0265338_10006155 3300028800 Bacteria 15400
461 Ga0268256_1000002 3300030500 Bacteria 1535763
462 Ga0268256_1000815 3300030500 Bacteria 22341
463 Ga0307511_10003176 3300030521 Bacteria 16908
464 Ga0265770_1000173 3300030878 Bacteria 8387
465 Ga0265760_10002495 3300031090 Bacteria 5370
466 Ga0265332_10014061 3300031238 Bacteria 3541
467 Ga0265325_10034982 3300031241 Bacteria 2670
468 Ga0265340_10032357 3300031247 Bacteria 2611
469 Ga0265331_10002116 3300031250 Bacteria 13686
470 Ga0265327_10000238 3300031251 Bacteria 109943
471 Ga0307513_10001609 3300031456 Bacteria 32399
472 Ga0307513_10068924 3300031456 Bacteria 3703
473 Ga0307509_10000002 3300031507 Bacteria 607551
474 Ga0307509_10001575 3300031507 Bacteria 38357
475 Ga0307509_10087611 3300031507 Bacteria 3198
476 Ga0307408_100014019 3300031548 Bacteria 5325
477 Ga0265313_10000014 3300031595 Bacteria 156295
478 Ga0265313_10043611 3300031595 Bacteria 2195
479 Ga0307508_10193376 3300031616 Bacteria 1636
480 Ga0316575_10013613 3300031665 Bacteria 3041
481 Ga0265314_10039898 3300031711 Bacteria 3376
482 Ga0316576_10028779 3300031727 Bacteria 3921
483 Ga0316576_10046535 3300031727 Bacteria 3141
484 Ga0316576_10050467 3300031727 Bacteria 3026
485 Ga0316578_10005443 3300031728 Bacteria 6175
486 Ga0316578_10107087 3300031728 Bacteria 1678
487 Ga0307516_10000012 3300031730 Bacteria 224120
488 Ga0307405_10080790 3300031731 Bacteria 2123
489 Ga0307413_10038397 3300031824 Bacteria 2775
490 Ga0307413_10047796 3300031824 Bacteria 2554
491 Ga0307413_10112501 3300031824 Bacteria 1825
492 Ga0307409_100030309 3300031995 Bacteria 3884
493 Ga0307416_100056606 3300032002 Bacteria 3166
494 Ga0307411_10011008 3300032005 Bacteria 4856
495 Ga0307415_100103083 3300032126 Bacteria 2098
496 Ga0307415_100148694 3300032126 Bacteria 1800
497 Ga0316583_10001802 3300032133 Bacteria 7282
498 Ga0316593_10008778 3300032168 Bacteria 2833
499 Ga0316593_10022910 3300032168 Bacteria 1967
500 Ga0307510_10000007 3300033180 Bacteria 558582
501 Ga0307510_10000059 3300033180 Bacteria 84839
502 Ga0307510_10012240 3300033180 Bacteria 10168
503 Ga0373955_0009259 3300035172 Bacteria 4611
504 Ga0316574_0000894 3300035398 Bacteria 13197
505 Ga0316574_0045625 3300035398 Bacteria 2715
506 Ga0316574_0110962 3300035398 Bacteria 1758
507 Ga0316574_0129573 3300035398 Bacteria 1623
508 Ga0316574_0139387 3300035398 Bacteria 1562
509 Ga0373927_0000001 3300035695 Bacteria 1082160
510 Ga0373927_0037991 3300035695 Bacteria 3128
511 Ga0373933_0023517 3300035724 Bacteria 3521
512 Ga0373937_0021839 3300036401 Bacteria 5746
513 Ga0316584_0016579 3300036712 Bacteria 5283
514 Ga0316584_0020393 3300036712 Bacteria 4806
515 Ga0316584_0091986 3300036712 Bacteria 2271
516 Ga0373925_0163629 3300037068 Bacteria 1754
517 Ga0395898_0001583 3300037466 Bacteria 31093
518 Ga0395901_0007016 3300038443 Bacteria 11386
519 Ga0436365_0412003 3300039437 Bacteria 4505
520 Ga0436360_0322345 3300039438 Bacteria 2053
521 Ga0436363_1095124 3300039450 Bacteria 3227
522 Ga0436362_1127240 3300039453 Bacteria 6138
523 Ga0439438_000002 3300041405 Bacteria 618223
524 Ga0439438_000601 3300041405 Bacteria 16246
525 Ga0439447_001811 3300041407 Bacteria 7831
526 Ga0439466_0000001 3300041411 Bacteria 647258
527 Ga0439465_0002785 3300041413 Bacteria 5727
528 Ga0451791_1105936 3300041451 Bacteria 2326
529 Ga0451807_0058820 3300041486 Bacteria 3663
530 Ga0439432_000295 3300042006 Bacteria 17930
531 Ga0450908_000113 3300042184 Bacteria 16546
532 Ga0451577_0027485 3300042876 Bacteria 5150
533 Ga0451577_0145693 3300042876 Bacteria 2129
534 Ga0451577_0161308 3300042876 Bacteria 2019
535 Ga0466986_0077623 3300044650 Bacteria 2301
536 Ga0466969_0001735 3300044656 Bacteria 11620
537 Ga0466972_0000312 3300044658 Bacteria 28150
538 Ga0466982_0000029 3300044672 Bacteria 60348
539 Ga0453683_0000382 3300044673 Bacteria 52943
540 Ga0453683_0008560 3300044673 Bacteria 6865
541 Ga0466966_0008586 3300044684 Bacteria 6762
542 Ga0466966_0023085 3300044684 Bacteria 4075
543 Ga0466961_0005334 3300044693 Bacteria 8088
544 Ga0466961_0008397 3300044693 Bacteria 6578
545 Ga0453684_0086274 3300044712 Bacteria 3896
546 Ga0453684_0119527 3300044712 Bacteria 3184
547 Ga0466970_0000701 3300044765 Bacteria 16371
548 Ga0466957_0054394 3300044842 Bacteria 2443
549 Ga0466959_0002124 3300045049 Bacteria 12544
550 Ga0466959_0014509 3300045049 Bacteria 5729
551 Ga0466959_0050326 3300045049 Bacteria 3059
552 Ga0466959_0124395 3300045049 Bacteria 1831
553 Ga0495617_000122 3300046452 Bacteria 51915
554 Ga0495617_000218 3300046452 Bacteria 35037
555 Ga0495590_0009443 3300046457 Bacteria 3701
556 Ga0495638_0000319 3300046460 Bacteria 61852
557 Ga0495638_0000786 3300046460 Bacteria 33467
558 Ga0495638_0017412 3300046460 Bacteria 4790
559 Ga0495638_0022865 3300046460 Bacteria 4098
560 Ga0495638_0083949 3300046460 Bacteria 1928
561 Ga0495650_0000004 3300046471 Bacteria 779487
562 Ga0495650_0000667 3300046471 Bacteria 44706
563 Ga0495584_0001870 3300046491 Bacteria 12175
564 Ga0495585_0000180 3300046492 Bacteria 67101
565 Ga0495585_0011933 3300046492 Bacteria 5131
566 Ga0495596_0020607 3300046500 Bacteria 2698
567 Ga0495607_0000008 3300046501 Bacteria 265274
568 Ga0495583_0000833 3300046506 Bacteria 37749
569 Ga0495606_0001812 3300046507 Bacteria 27155
570 Ga0495606_0028991 3300046507 Bacteria 3894
571 Ga0495606_0058958 3300046507 Bacteria 2464
572 Ga0495616_0000003 3300046513 Bacteria 290178
573 Ga0495616_0002551 3300046513 Bacteria 12014
574 Ga0495620_0000182 3300046515 Bacteria 48877
575 Ga0495620_0000216 3300046515 Bacteria 43506
576 Ga0495631_0000061 3300046518 Bacteria 67503
577 Ga0495631_0000329 3300046518 Bacteria 32553
578 Ga0495643_0073189 3300046522 Bacteria 1796
579 Ga0495648_0000427 3300046524 Bacteria 46150
580 Ga0495663_0000227 3300046525 Bacteria 22449
581 Ga0495663_0003609 3300046525 Bacteria 4445
582 Ga0495654_0000009 3300046530 Bacteria 381872
583 Ga0495654_0001896 3300046530 Bacteria 13905
584 Ga0495640_0124556 3300046533 Bacteria 1672
585 Ga0495611_0000023 3300046648 Bacteria 120553
586 Ga0495611_0002701 3300046648 Bacteria 7998
587 Ga0495625_0002254 3300046660 Bacteria 21206
588 Ga0495625_0004093 3300046660 Bacteria 13924
589 Ga0495625_0017779 3300046660 Bacteria 5559
590 Ga0495661_0000471 3300046665 Bacteria 42549
591 Ga0495649_0003784 3300046694 Bacteria 10035
592 Ga0495660_0000013 3300046810 Bacteria 350283
593 Ga0495674_0128446 3300047319 Bacteria 2137
594 Ga0495672_0000015 3300047320 Bacteria 502855
595 Ga0495683_0005979 3300047323 Bacteria 6681
596 Ga0495679_007808 3300047446 Bacteria 4414
597 Ga0495673_0000036 3300047469 Bacteria 311035
598 Ga0495673_0000101 3300047469 Bacteria 173409
599 Ga0495681_0030972 3300047470 Bacteria 2716
600 Ga0495681_0033177 3300047470 Bacteria 2590
601 Ga0495686_0000608 3300047472 Bacteria 49564
602 Ga0495686_0019088 3300047472 Bacteria 4585
603 Ga0495602_0112760 3300048088 Bacteria 2206
604 Ga0496104_0002107 3300048907 Bacteria 17270
605 Ga0496104_0002393 3300048907 Bacteria 16157
606 Ga0496104_0083301 3300048907 Bacteria 3050
607 Ga0496104_0198496 3300048907 Bacteria 1918
608 Ga0496105_0004353 3300048908 Bacteria 10663
609 Ga0496105_0108068 3300048908 Bacteria 2297
610 Ga0496106_0011969 3300048909 Bacteria 6404
611 Ga0496106_0097417 3300048909 Bacteria 2277
612 Ga0496108_0037439 3300048911 Bacteria 4041
613 Ga0496108_0202737 3300048911 Bacteria 1721
614 Ga0496109_0023839 3300048912 Bacteria 5432
615 Ga0496109_0028718 3300048912 Bacteria 4979
616 Ga0496110_0009720 3300048913 Bacteria 7789
617 Ga0496111_0013076 3300048914 Bacteria 5637
618 Ga0496112_0000297 3300048915 Bacteria 32082
619 Ga0496112_0027540 3300048915 Bacteria 5480
620 Ga0496114_0001110 3300048917 Bacteria 20326
621 Ga0496115_0000092 3300048918 Bacteria 83381
622 Ga0496115_0079176 3300048918 Bacteria 2674
623 Ga0496115_0113082 3300048918 Bacteria 2231
624 Ga0496115_0136123 3300048918 Bacteria 2025
625 Ga0496116_0000016 3300048919 Bacteria 555146
626 Ga0496116_0010613 3300048919 Bacteria 7703
627 Ga0496117_0000038 3300048920 Bacteria 322781
628 Ga0496117_0000278 3300048920 Bacteria 95496
629 Ga0496117_0002395 3300048920 Bacteria 23846
630 Ga0496117_0002664 3300048920 Bacteria 22123
631 Ga0496117_0016308 3300048920 Bacteria 6276
632 Ga0496117_0047295 3300048920 Bacteria 3086
633 Ga0496117_0056705 3300048920 Bacteria 2726
634 Ga0496117_0056759 3300048920 Bacteria 2724
635 Ga0496118_0000019 3300048921 Bacteria 489649
636 Ga0496118_0000837 3300048921 Bacteria 48931
637 Ga0496118_0001003 3300048921 Bacteria 43972
638 Ga0496118_0002267 3300048921 Bacteria 26301
639 Ga0496118_0002536 3300048921 Bacteria 24447
640 Ga0496118_0003247 3300048921 Bacteria 20729
641 Ga0496118_0012786 3300048921 Bacteria 8013
642 Ga0496118_0013890 3300048921 Bacteria 7575
643 Ga0496119_0000352 3300048922 Bacteria 64461
644 Ga0496119_0020140 3300048922 Bacteria 4876
645 Ga0496119_0025244 3300048922 Bacteria 4155
646 Ga0496119_0027119 3300048922 Bacteria 3948
647 Ga0496119_0051481 3300048922 Bacteria 2530
648 Ga0496119_0071834 3300048922 Bacteria 2024
649 Ga0496120_0000649 3300048923 Bacteria 51212
650 Ga0496120_0000673 3300048923 Bacteria 50130
651 Ga0496120_0000711 3300048923 Bacteria 48821
652 Ga0496120_0002415 3300048923 Bacteria 18963
653 Ga0496120_0044321 3300048923 Bacteria 2585
654 Ga0496121_0001023 3300048924 Bacteria 49854
655 Ga0496121_0003712 3300048924 Bacteria 21413
656 Ga0496121_0005264 3300048924 Bacteria 16710
657 Ga0496121_0010927 3300048924 Bacteria 10141
658 Ga0496121_0037779 3300048924 Bacteria 4283
659 Ga0496121_0051442 3300048924 Bacteria 3469
660 Ga0496122_0000056 3300048925 Bacteria 258019
661 Ga0496122_0001646 3300048925 Bacteria 34664
662 Ga0496123_0000041 3300048926 Bacteria 258019
663 Ga0496123_0002496 3300048926 Bacteria 22656
664 Ga0496123_0035617 3300048926 Bacteria 3543
665 Ga0496124_0000010 3300048927 Bacteria 595157
666 Ga0496124_0000484 3300048927 Bacteria 68281
667 Ga0496124_0002027 3300048927 Bacteria 27552
668 Ga0496124_0002670 3300048927 Bacteria 22867
669 Ga0496124_0002743 3300048927 Bacteria 22447
670 Ga0496124_0023336 3300048927 Bacteria 5649
671 Ga0496124_0026576 3300048927 Bacteria 5216
672 Ga0496124_0047628 3300048927 Bacteria 3666
673 Ga0496125_0000113 3300048928 Bacteria 187290
674 Ga0496125_0001231 3300048928 Bacteria 38314
675 Ga0496125_0002990 3300048928 Bacteria 21187
676 Ga0496125_0003319 3300048928 Bacteria 19668
677 Ga0496125_0004334 3300048928 Bacteria 16463
678 Ga0496125_0044715 3300048928 Bacteria 3738
679 Ga0496125_0050361 3300048928 Bacteria 3449
680 Ga0496125_0082468 3300048928 Bacteria 2451
681 Ga0496126_0000847 3300048929 Bacteria 54109
682 Ga0496126_0004079 3300048929 Bacteria 17716
683 Ga0496126_0004182 3300048929 Bacteria 17401
684 Ga0496126_0052462 3300048929 Bacteria 3705
685 Ga0496126_0057538 3300048929 Bacteria 3509
686 Ga0496126_0093818 3300048929 Bacteria 2635
687 Ga0496126_0217647 3300048929 Bacteria 1606
688 Ga0495678_027670 3300049459 Bacteria 2403
689 Ga0495682_0000283 3300049460 Bacteria 39664
690 Ga0501034_0217493 3300049571 Bacteria 1864
691 Ga0501036_0076968 3300049572 Bacteria 2823
692 Ga0501039_0136890 3300049575 Bacteria 1923
693 Ga0501040_0009480 3300049576 Bacteria 6351
694 Ga0501041_0012357 3300049577 Bacteria 5058
695 Ga0501042_0006870 3300049578 Bacteria 7424
696 Ga0501042_0015839 3300049578 Bacteria 5167
697 Ga0501042_0059143 3300049578 Bacteria 2737
698 Ga0501048_0128199 3300049582 Bacteria 1794
699 Ga0501068_0010553 3300049584 Bacteria 5192
700 Ga0501072_0064495 3300049588 Bacteria 2889
701 Ga0501074_0016666 3300049590 Bacteria 5332
702 Ga0501075_0097383 3300049591 Bacteria 2232
703 Ga0501076_0095987 3300049592 Bacteria 2388
704 Ga0501077_0016429 3300049593 Bacteria 4663
705 Ga0501080_0013595 3300049742 Bacteria 7494
706 Ga0501080_0129473 3300049742 Bacteria 2336
707 Ga0501044_0000692 3300049823 Bacteria 40821
708 nmdc:mga00v17_30599_c1 3300050491 Bacteria 3168
709 nmdc:mga0yw44_38814_c1 3300050492 Bacteria 2820
710 nmdc:mga05p37_17533_c1 3300050507 Bacteria 8644
711 nmdc:mga09592_11179_c1 3300050508 Bacteria 7304
712 nmdc:mga09592_12328_c1 3300050508 Bacteria 6962
713 nmdc:mga09592_3449_c1 3300050508 Bacteria 12774
714 nmdc:mga0qj67_14461_c1 3300050509 Bacteria 5968
715 nmdc:mga06r32_102631_c1 3300050510 Bacteria 2808
716 nmdc:mga06r32_20840_c1 3300050510 Bacteria 6041
717 nmdc:mga06r32_354_c1 3300050510 Bacteria 38365
718 nmdc:mga06r32_910_c1 3300050510 Bacteria 26293
719 nmdc:mga08y16_7438_c1 3300050511 Bacteria 11469
720 nmdc:mga08y16_7927_c1 3300050511 Bacteria 11116
721 Ga0495601_0037588 3300053077 Bacteria 3027
722 Ga0495601_0118413 3300053077 Bacteria 1719
723 Ga0500643_000012 3300053087 Bacteria 369839
724 Ga0500583_0061057 3300053092 Bacteria 1779
725 Ga0500641_0049309 3300053096 Bacteria 1727
726 Ga0500650_0000059 3300053098 Bacteria 36038
727 Ga0500556_0000395 3300053104 Bacteria 31924
728 Ga0500568_0008591 3300053139 Bacteria 4908
729 Ga0500616_0000019 3300053153 Bacteria 549964
730 Ga0500616_0005666 3300053153 Bacteria 8423
731 Ga0500616_0040898 3300053153 Bacteria 2491
732 Ga0500622_0000292 3300053156 Bacteria 51243
733 Ga0500622_0006855 3300053156 Bacteria 6544
734 Ga0500622_0019336 3300053156 Bacteria 3617
735 Ga0500633_0009575 3300053160 Bacteria 2555
736 Ga0500637_0000915 3300053178 Bacteria 11897
737 Ga0500637_0010124 3300053178 Bacteria 4828
738 Ga0501084_0017415 3300054114 Bacteria 5973
739 Ga0501082_0040666 3300060353 Bacteria 4009

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2600255254 2601526434 370
2 iso_pu_bacteria 2600255255 2601531456 370
3 iso_pu_bacteria 2600255280 2601618299 370
4 iso_pu_bacteria 2600255281 2601623332 370
5 iso_pu_bacteria 2600255288 2601651723 370
6 iso_pu_bacteria 2600255289 2601656738 370
7 iso_pu_bacteria 2600255290 2601661754 370
8 iso_pu_bacteria 2600255300 2601709558 370
9 iso_pu_bacteria 2600255301 2601714576 370
10 iso_pu_bacteria 2600255302 2601719603 370
11 iso_pu_bacteria 2600255304 2601729522 370
12 iso_pu_bacteria 2600255305 2601734541 370
13 iso_pu_bacteria 2600255306 2601739548 370
14 iso_pu_bacteria 2602042103 2603838471 370
15 iso_pu_bacteria 2602042104 2603843547 370
16 iso_pu_bacteria 2602042105 2603848621 370
17 iso_pu_bacteria 2602042106 2603853694 370
18 iso_pu_bacteria 2602042110 2603869691 370
19 iso_pu_bacteria 2603880178 2606046876 370
20 iso_pu_bacteria 2603880202 2606144546 370
21 iso_pu_bacteria 2603880211 2606176341 370
22 3300035398 Ga0316574_0045625 Ga0316574_0045625_1513_2685 381
23 3300048929 Ga0496126_0093818 Ga0496126_0093818_1418_2623 388
24 3300048927 Ga0496124_0026576 Ga0496124_0026576_3952_5205 402
25 3300048922 Ga0496119_0051481 Ga0496119_0051481_24_1280 404
26 3300005295 Ga0065707_10082227 Ga0065707_100822273 419
27 3300005564 Ga0070664_100008203 Ga0070664_1000082035 419
28 3300005719 Ga0068861_100010260 Ga0068861_1000102604 419
29 3300009098 Ga0105245_10003333 Ga0105245_100033337 419
30 3300009177 Ga0105248_10004270 Ga0105248_100042702 419
31 3300013296 Ga0157374_10003622 Ga0157374_100036221 419
32 3300014325 Ga0163163_10002680 Ga0163163_100026807 419
33 3300026035 Ga0207703_10073481 Ga0207703_100734812 419
34 3300026118 Ga0207675_100005127 Ga0207675_1000051277 419
35 3300035172 Ga0373955_0009259 Ga0373955_0009259_2369_3727 419
36 3300035724 Ga0373933_0023517 Ga0373933_0023517_1782_3140 419
37 3300036401 Ga0373937_0021839 Ga0373937_0021839_4169_5527 419
38 3300046460 Ga0495638_0017412 Ga0495638_0017412_559_1920 419
39 3300046660 Ga0495625_0004093 Ga0495625_0004093_2613_3974 419
40 3300048924 Ga0496121_0051442 Ga0496121_0051442_385_1746 419
41 3300037466 Ga0395898_0001583 Ga0395898_0001583_11178_12524 422
42 3300038443 Ga0395901_0007016 Ga0395901_0007016_3959_5305 422
43 3300039450 Ga0436363_1095124 Ga0436363_1095124_89_1453 423
44 3300031250 Ga0265331_10002116 Ga0265331_100021162 425
45 3300031251 Ga0265327_10000238 Ga0265327_1000023892 425
46 3300039437 Ga0436365_0412003 Ga0436365_0412003_1844_3202 425
47 3300039453 Ga0436362_1127240 Ga0436362_1127240_2023_3381 425
48 3300031507 Ga0307509_10087611 Ga0307509_100876112 426
49 3300049578 Ga0501042_0006870 Ga0501042_0006870_4592_5965 426
50 3300005563 Ga0068855_100093536 Ga0068855_1000935362 427
51 3300025949 Ga0207667_10076477 Ga0207667_100764772 427
52 3300042876 Ga0451577_0027485 Ga0451577_0027485_3198_4571 427
53 3300005435 Ga0070714_100010493 Ga0070714_1000104934 428
54 3300025929 Ga0207664_10112372 Ga0207664_101123722 428
55 3300005335 Ga0070666_10000010 Ga0070666_10000010150 430
56 3300005530 Ga0070679_100039655 Ga0070679_1000396554 430
57 3300013306 Ga0163162_10000193 Ga0163162_100001935 430
58 3300025903 Ga0207680_10000002 Ga0207680_10000002241 430
59 3300025912 Ga0207707_10023465 Ga0207707_100234652 430
60 3300025921 Ga0207652_10043119 Ga0207652_100431194 430
61 3300025923 Ga0207681_10076413 Ga0207681_100764132 430
62 3300048088 Ga0495602_0112760 Ga0495602_0112760_122_1477 430
63 3300048929 Ga0496126_0004079 Ga0496126_0004079_13206_14549 430
64 3300031824 Ga0307413_10112501 Ga0307413_101125011 431
65 3300005327 Ga0070658_10011129 Ga0070658_100111297 432
66 3300013105 Ga0157369_10036624 Ga0157369_100366243 432
67 3300020082 Ga0206353_10645750 Ga0206353_106457502 432
68 3300005548 Ga0070665_100071602 Ga0070665_1000716024 434
69 3300028379 Ga0268266_10022685 Ga0268266_100226858 434
70 3300053153 Ga0500616_0005666 Ga0500616_0005666_4920_6275 434
71 3300005547 Ga0070693_100002362 Ga0070693_1000023623 436
72 iso_pu_bacteria 2898795034 2898795810 436
73 3300005331 Ga0070670_100007297 Ga0070670_1000072974 437
74 3300005331 Ga0070670_100048855 Ga0070670_1000488553 437
75 3300005331 Ga0070670_100109121 Ga0070670_1001091213 437
76 3300005334 Ga0068869_100021901 Ga0068869_1000219012 437
77 3300005336 Ga0070680_100015372 Ga0070680_1000153725 437
78 3300005338 Ga0068868_100003563 Ga0068868_1000035637 437
79 3300005338 Ga0068868_100105831 Ga0068868_1001058312 437
80 3300005340 Ga0070689_100008233 Ga0070689_1000082339 437
81 3300005343 Ga0070687_100067156 Ga0070687_1000671561 437
82 3300005347 Ga0070668_100027973 Ga0070668_1000279732 437
83 3300005353 Ga0070669_100187800 Ga0070669_1001878002 437
84 3300005438 Ga0070701_10013846 Ga0070701_100138463 437
85 3300005440 Ga0070705_100019673 Ga0070705_1000196734 437
86 3300005441 Ga0070700_100055800 Ga0070700_1000558002 437
87 3300005457 Ga0070662_100006417 Ga0070662_1000064177 437
88 3300005457 Ga0070662_100007912 Ga0070662_1000079124 437
89 3300005459 Ga0068867_100038984 Ga0068867_1000389845 437
90 3300005459 Ga0068867_100040263 Ga0068867_1000402633 437
91 3300005530 Ga0070679_100154764 Ga0070679_1001547642 437
92 3300005535 Ga0070684_100011689 Ga0070684_1000116892 437
93 3300005535 Ga0070684_100022552 Ga0070684_1000225523 437
94 3300005543 Ga0070672_100118933 Ga0070672_1001189333 437
95 3300005544 Ga0070686_100028431 Ga0070686_1000284313 437
96 3300005547 Ga0070693_100077467 Ga0070693_1000774672 437
97 3300005548 Ga0070665_100011568 Ga0070665_1000115686 437
98 3300005548 Ga0070665_100072100 Ga0070665_1000721002 437
99 3300005563 Ga0068855_100029694 Ga0068855_1000296943 437
100 3300005564 Ga0070664_100010617 Ga0070664_1000106172 437
101 3300005578 Ga0068854_100073627 Ga0068854_1000736274 437
102 3300005578 Ga0068854_100163278 Ga0068854_1001632781 437
103 3300005614 Ga0068856_100042191 Ga0068856_1000421912 437
104 3300005617 Ga0068859_100000226 Ga0068859_10000022645 437
105 3300005617 Ga0068859_100000716 Ga0068859_1000007164 437
106 3300005618 Ga0068864_100004974 Ga0068864_1000049743 437
107 3300005719 Ga0068861_100000308 Ga0068861_1000003085 437
108 3300005719 Ga0068861_100003643 Ga0068861_1000036439 437
109 3300005840 Ga0068870_10003458 Ga0068870_100034583 437
110 3300005840 Ga0068870_10015306 Ga0068870_100153063 437
111 3300005841 Ga0068863_100001807 Ga0068863_10000180717 437
112 3300005842 Ga0068858_100031279 Ga0068858_1000312794 437
113 3300005843 Ga0068860_100068081 Ga0068860_1000680812 437
114 3300005844 Ga0068862_100000651 Ga0068862_10000065110 437
115 3300005844 Ga0068862_100010635 Ga0068862_1000106351 437
116 3300005844 Ga0068862_100019633 Ga0068862_1000196333 437
117 3300006237 Ga0097621_100202203 Ga0097621_1002022032 437
118 3300006844 Ga0075428_100004861 Ga0075428_10000486111 437
119 3300006844 Ga0075428_100008798 Ga0075428_1000087986 437
120 3300006844 Ga0075428_100026092 Ga0075428_1000260922 437
121 3300006844 Ga0075428_100039752 Ga0075428_1000397523 437
122 3300006846 Ga0075430_100007160 Ga0075430_1000071604 437
123 3300006846 Ga0075430_100021881 Ga0075430_1000218811 437
124 3300006846 Ga0075430_100047171 Ga0075430_1000471712 437
125 3300006847 Ga0075431_100000026 Ga0075431_10000002624 437
126 3300006847 Ga0075431_100008443 Ga0075431_1000084436 437
127 3300006847 Ga0075431_100011646 Ga0075431_1000116463 437
128 3300006880 Ga0075429_100025071 Ga0075429_1000250713 437
129 3300006880 Ga0075429_100033160 Ga0075429_1000331602 437
130 3300006880 Ga0075429_100048276 Ga0075429_1000482763 437
131 3300006880 Ga0075429_100079751 Ga0075429_1000797513 437
132 3300006881 Ga0068865_100013404 Ga0068865_1000134043 437
133 3300006931 Ga0097620_100000226 Ga0097620_1000002264 437
134 3300006931 Ga0097620_100000716 Ga0097620_1000007164 437
135 3300009093 Ga0105240_10087339 Ga0105240_100873396 437
136 3300009093 Ga0105240_10161439 Ga0105240_101614391 437
137 3300009094 Ga0111539_10000759 Ga0111539_1000075912 437
138 3300009094 Ga0111539_10011229 Ga0111539_1001122912 437
139 3300009098 Ga0105245_10239744 Ga0105245_102397441 437
140 3300009101 Ga0105247_10035834 Ga0105247_100358342 437
141 3300009147 Ga0114129_10000158 Ga0114129_1000015856 437
142 3300009148 Ga0105243_10042808 Ga0105243_100428083 437
143 3300009177 Ga0105248_10059402 Ga0105248_100594023 437
144 3300009551 Ga0105238_10016023 Ga0105238_100160232 437
145 3300009551 Ga0105238_10133579 Ga0105238_101335792 437
146 3300009553 Ga0105249_10044940 Ga0105249_100449403 437
147 3300010375 Ga0105239_10182658 Ga0105239_101826582 437
148 3300011119 Ga0105246_10153103 Ga0105246_101531031 437
149 3300013306 Ga0163162_10022079 Ga0163162_100220794 437
150 3300013306 Ga0163162_10331417 Ga0163162_103314171 437
151 3300013308 Ga0157375_10004434 Ga0157375_100044346 437
152 3300013308 Ga0157375_10105249 Ga0157375_101052492 437
153 3300014326 Ga0157380_10000366 Ga0157380_1000036619 437
154 3300014745 Ga0157377_10019179 Ga0157377_100191792 437
155 3300014968 Ga0157379_10000004 Ga0157379_1000000445 437
156 3300014969 Ga0157376_10034668 Ga0157376_100346683 437
157 3300017792 Ga0163161_10041524 Ga0163161_100415243 437
158 3300025321 Ga0207656_10030174 Ga0207656_100301742 437
159 3300025711 Ga0207696_1000263 Ga0207696_100026331 437
160 3300025907 Ga0207645_10001117 Ga0207645_1000111715 437
161 3300025908 Ga0207643_10025347 Ga0207643_100253473 437
162 3300025917 Ga0207660_10028245 Ga0207660_100282452 437
163 3300025918 Ga0207662_10025886 Ga0207662_100258862 437
164 3300025920 Ga0207649_10037129 Ga0207649_100371292 437
165 3300025923 Ga0207681_10010785 Ga0207681_100107854 437
166 3300025923 Ga0207681_10074576 Ga0207681_100745762 437
167 3300025925 Ga0207650_10015067 Ga0207650_100150673 437
168 3300025926 Ga0207659_10096986 Ga0207659_100969862 437
169 3300025933 Ga0207706_10010664 Ga0207706_100106644 437
170 3300025933 Ga0207706_10013421 Ga0207706_100134213 437
171 3300025936 Ga0207670_10014828 Ga0207670_100148282 437
172 3300025937 Ga0207669_10060336 Ga0207669_100603362 437
173 3300025940 Ga0207691_10004950 Ga0207691_100049505 437
174 3300025940 Ga0207691_10257297 Ga0207691_102572971 437
175 3300025942 Ga0207689_10025150 Ga0207689_100251502 437
176 3300025949 Ga0207667_10131465 Ga0207667_101314654 437
177 3300025961 Ga0207712_10045895 Ga0207712_100458953 437
178 3300025972 Ga0207668_10080770 Ga0207668_100807702 437
179 3300025972 Ga0207668_10174209 Ga0207668_101742091 437
180 3300025981 Ga0207640_10059011 Ga0207640_100590112 437
181 3300026023 Ga0207677_10100724 Ga0207677_101007242 437
182 3300026035 Ga0207703_10032898 Ga0207703_100328984 437
183 3300026075 Ga0207708_10039253 Ga0207708_100392533 437
184 3300026075 Ga0207708_10077474 Ga0207708_100774743 437
185 3300026088 Ga0207641_10010019 Ga0207641_100100194 437
186 3300026089 Ga0207648_10001386 Ga0207648_1000138617 437
187 3300026089 Ga0207648_10031464 Ga0207648_100314643 437
188 3300026116 Ga0207674_10075635 Ga0207674_100756351 437
189 3300026118 Ga0207675_100002419 Ga0207675_10000241912 437
190 3300026118 Ga0207675_100004826 Ga0207675_1000048266 437
191 3300026118 Ga0207675_100045880 Ga0207675_1000458803 437
192 3300027614 Ga0209970_1002398 Ga0209970_10023982 437
193 3300027665 Ga0209983_1000316 Ga0209983_10003168 437
194 3300027682 Ga0209971_1012668 Ga0209971_10126682 437
195 3300027717 Ga0209998_10001850 Ga0209998_100018504 437
196 3300027876 Ga0209974_10000905 Ga0209974_100009054 437
197 3300027907 Ga0207428_10011931 Ga0207428_100119314 437
198 3300027907 Ga0207428_10026550 Ga0207428_100265505 437
199 3300028379 Ga0268266_10085491 Ga0268266_100854912 437
200 3300028380 Ga0268265_10000794 Ga0268265_1000079413 437
201 3300028380 Ga0268265_10026857 Ga0268265_100268574 437
202 3300028380 Ga0268265_10041277 Ga0268265_100412773 437
203 3300028381 Ga0268264_10032256 Ga0268264_100322562 437
204 3300028381 Ga0268264_10039050 Ga0268264_100390502 437
205 3300031507 Ga0307509_10001575 Ga0307509_100015758 437
206 3300031548 Ga0307408_100014019 Ga0307408_1000140196 437
207 3300031727 Ga0316576_10050467 Ga0316576_100504673 437
208 3300032002 Ga0307416_100056606 Ga0307416_1000566063 437
209 3300035398 Ga0316574_0000894 Ga0316574_0000894_3475_4926 437
210 3300036712 Ga0316584_0091986 Ga0316584_0091986_118_1530 437
211 3300042876 Ga0451577_0145693 Ga0451577_0145693_139_1563 437
212 3300042876 Ga0451577_0161308 Ga0451577_0161308_412_1758 437
213 3300044712 Ga0453684_0119527 Ga0453684_0119527_1066_2490 437
214 3300046533 Ga0495640_0124556 Ga0495640_0124556_31_1395 437
215 3300048909 Ga0496106_0097417 Ga0496106_0097417_864_2225 437
216 3300048911 Ga0496108_0037439 Ga0496108_0037439_1348_2709 437
217 3300048912 Ga0496109_0028718 Ga0496109_0028718_1056_2417 437
218 3300048915 Ga0496112_0000297 Ga0496112_0000297_11337_12818 437
219 3300048917 Ga0496114_0001110 Ga0496114_0001110_1527_2885 437
220 3300048918 Ga0496115_0136123 Ga0496115_0136123_252_1610 437
221 3300049572 Ga0501036_0076968 Ga0501036_0076968_478_1842 437
222 3300049575 Ga0501039_0136890 Ga0501039_0136890_153_1499 437
223 3300049577 Ga0501041_0012357 Ga0501041_0012357_963_2309 437
224 3300049578 Ga0501042_0015839 Ga0501042_0015839_1383_2729 437
225 3300049578 Ga0501042_0059143 Ga0501042_0059143_718_2064 437
226 3300049588 Ga0501072_0064495 Ga0501072_0064495_140_1486 437
227 3300049591 Ga0501075_0097383 Ga0501075_0097383_531_1877 437
228 3300049592 Ga0501076_0095987 Ga0501076_0095987_878_2242 437
229 3300049742 Ga0501080_0129473 Ga0501080_0129473_417_1763 437
230 3300050507 nmdc:mga05p37_17533_c1 nmdc:mga05p37_17533_c1_2998_4359 437
231 3300050508 nmdc:mga09592_11179_c1 nmdc:mga09592_11179_c1_2952_4316 437
232 3300050508 nmdc:mga09592_12328_c1 nmdc:mga09592_12328_c1_1022_2386 437
233 3300050508 nmdc:mga09592_3449_c1 nmdc:mga09592_3449_c1_2356_3717 437
234 3300050509 nmdc:mga0qj67_14461_c1 nmdc:mga0qj67_14461_c1_2566_3927 437
235 3300050510 nmdc:mga06r32_102631_c1 nmdc:mga06r32_102631_c1_201_1565 437
236 3300050510 nmdc:mga06r32_20840_c1 nmdc:mga06r32_20840_c1_3503_4864 437
237 3300050510 nmdc:mga06r32_354_c1 nmdc:mga06r32_354_c1_23921_25282 437
238 3300050510 nmdc:mga06r32_910_c1 nmdc:mga06r32_910_c1_22851_24212 437
239 3300050511 nmdc:mga08y16_7438_c1 nmdc:mga08y16_7438_c1_2108_3469 437
240 3300050511 nmdc:mga08y16_7927_c1 nmdc:mga08y16_7927_c1_3132_4526 437
241 3300053077 Ga0495601_0037588 Ga0495601_0037588_1097_2455 437
242 3300053096 Ga0500641_0049309 Ga0500641_0049309_57_1424 437
243 3300053139 Ga0500568_0008591 Ga0500568_0008591_475_1878 437
244 3300053156 Ga0500622_0000292 Ga0500622_0000292_74_1447 437
245 3300053156 Ga0500622_0006855 Ga0500622_0006855_4881_6254 437
246 3300053178 Ga0500637_0000915 Ga0500637_0000915_2106_3479 437
247 3300054114 Ga0501084_0017415 Ga0501084_0017415_64_1410 437
248 3300060353 Ga0501082_0040666 Ga0501082_0040666_1092_2438 437
249 iso_pu_bacteria 2738543009 2739227161 437
250 iso_pu_bacteria 2884338543 2884339420 437
251 iso_pu_bacteria 2895395659 2895396299 437
252 iso_pu_bacteria 2977247770 2977250931 437
253 3300005438 Ga0070701_10015737 Ga0070701_100157373 438
254 3300005441 Ga0070700_100072901 Ga0070700_1000729012 438
255 3300005545 Ga0070695_100175008 Ga0070695_1001750081 438
256 3300005549 Ga0070704_100141065 Ga0070704_1001410652 438
257 3300005719 Ga0068861_100090186 Ga0068861_1000901862 438
258 3300005844 Ga0068862_100004834 Ga0068862_1000048344 438
259 3300014326 Ga0157380_10005725 Ga0157380_100057254 438
260 3300014326 Ga0157380_10235258 Ga0157380_102352582 438
261 3300026075 Ga0207708_10045681 Ga0207708_100456812 438
262 3300026118 Ga0207675_100009736 Ga0207675_1000097361 438
263 3300031824 Ga0307413_10047796 Ga0307413_100477962 438
264 3300032126 Ga0307415_100148694 Ga0307415_1001486942 438
265 iso_pu_bacteria 2537561836 2538834748 438
266 iso_pu_bacteria 2919513703 2919515697 438
267 iso_pu_bacteria 2919675420 2919678530 438
268 iso_pu_bacteria 2939622612 2939624765 438
269 3300002774 JGI25150J39212_1000066 JGI25150J39212_100006626 439
270 3300003187 JGI25151J46595_10000139 JGI25151J46595_1000013928 439
271 3300003215 JGI25153J46596_10000101 JGI25153J46596_1000010128 439
272 3300003771 Ga0055526_1000218 Ga0055526_100021826 439
273 3300003773 Ga0055537_1000900 Ga0055537_10009001 439
274 3300003781 Ga0055536_1000489 Ga0055536_10004898 439
275 3300003784 Ga0055534_1000061 Ga0055534_100006165 439
276 3300003784 Ga0055534_1000519 Ga0055534_10005192 439
277 3300003790 Ga0055528_1000332 Ga0055528_100033224 439
278 3300003794 Ga0055531_10000741 Ga0055531_100007418 439
279 3300005327 Ga0070658_10063524 Ga0070658_100635242 439
280 3300005339 Ga0070660_100083401 Ga0070660_1000834013 439
281 3300005341 Ga0070691_10015541 Ga0070691_100155413 439
282 3300005366 Ga0070659_100004779 Ga0070659_1000047794 439
283 3300005439 Ga0070711_100017875 Ga0070711_1000178753 439
284 3300005455 Ga0070663_100058726 Ga0070663_1000587262 439
285 3300005530 Ga0070679_100024620 Ga0070679_1000246203 439
286 3300005546 Ga0070696_100001233 Ga0070696_1000012334 439
287 3300005548 Ga0070665_100132172 Ga0070665_1001321722 439
288 3300005563 Ga0068855_100140514 Ga0068855_1001405142 439
289 3300005616 Ga0068852_100187784 Ga0068852_1001877842 439
290 3300006038 Ga0075365_10037994 Ga0075365_100379942 439
291 3300007788 Ga0099795_10000125 Ga0099795_100001253 439
292 3300009011 Ga0105251_10004848 Ga0105251_100048485 439
293 3300009176 Ga0105242_10189194 Ga0105242_101891942 439
294 3300013104 Ga0157370_10002542 Ga0157370_100025423 439
295 3300017792 Ga0163161_10000938 Ga0163161_100009382 439
296 3300017792 Ga0163161_10001227 Ga0163161_1000122715 439
297 3300017792 Ga0163161_10003635 Ga0163161_100036352 439
298 3300025245 Ga0207425_1000040 Ga0207425_1000040146 439
299 3300025258 Ga0209129_1000011 Ga0209129_1000011116 439
300 3300025263 Ga0209565_1000037 Ga0209565_100003773 439
301 3300025273 Ga0209673_1000032 Ga0209673_1000032177 439
302 3300025291 Ga0209675_1000020 Ga0209675_1000020108 439
303 3300025291 Ga0209675_1006527 Ga0209675_10065274 439
304 3300025292 Ga0209676_1000775 Ga0209676_100077520 439
305 3300025294 Ga0209025_1000002 Ga0209025_1000002681 439
306 3300025295 Ga0209564_1000210 Ga0209564_100021015 439
307 3300025297 Ga0209758_1000003 Ga0209758_1000003688 439
308 3300025299 Ga0209256_1001437 Ga0209256_100143716 439
309 3300025299 Ga0209256_1001987 Ga0209256_100198715 439
310 3300025304 Ga0209257_1000734 Ga0209257_100073420 439
311 3300025735 Ga0207713_1003022 Ga0207713_100302211 439
312 3300025904 Ga0207647_10044695 Ga0207647_100446953 439
313 3300025912 Ga0207707_10002087 Ga0207707_1000208716 439
314 3300025921 Ga0207652_10005312 Ga0207652_100053127 439
315 3300025932 Ga0207690_10001878 Ga0207690_100018785 439
316 3300025949 Ga0207667_10116416 Ga0207667_101164162 439
317 3300026075 Ga0207708_10046446 Ga0207708_100464462 439
318 3300026089 Ga0207648_10042699 Ga0207648_100426993 439
319 3300026142 Ga0207698_10095730 Ga0207698_100957302 439
320 3300027512 Ga0209179_1000750 Ga0209179_10007502 439
321 3300030878 Ga0265770_1000173 Ga0265770_10001736 439
322 3300031090 Ga0265760_10002495 Ga0265760_100024953 439
323 3300031456 Ga0307513_10001609 Ga0307513_1000160910 439
324 3300031727 Ga0316576_10028779 Ga0316576_100287795 439
325 3300031727 Ga0316576_10046535 Ga0316576_100465353 439
326 3300031730 Ga0307516_10000012 Ga0307516_10000012181 439
327 3300032133 Ga0316583_10001802 Ga0316583_100018023 439
328 3300041413 Ga0439465_0002785 Ga0439465_0002785_1138_2508 439
329 3300041451 Ga0451791_1105936 Ga0451791_1105936_791_2164 439
330 3300041486 Ga0451807_0058820 Ga0451807_0058820_2041_3414 439
331 3300044658 Ga0466972_0000312 Ga0466972_0000312_10729_12102 439
332 3300044712 Ga0453684_0086274 Ga0453684_0086274_758_2104 439
333 3300046452 Ga0495617_000218 Ga0495617_000218_13524_14876 439
334 3300046460 Ga0495638_0000319 Ga0495638_0000319_38_1414 439
335 3300046460 Ga0495638_0083949 Ga0495638_0083949_234_1592 439
336 3300046471 Ga0495650_0000667 Ga0495650_0000667_25031_26404 439
337 3300046492 Ga0495585_0000180 Ga0495585_0000180_30857_32236 439
338 3300046507 Ga0495606_0001812 Ga0495606_0001812_24977_26350 439
339 3300046507 Ga0495606_0058958 Ga0495606_0058958_607_1980 439
340 3300046513 Ga0495616_0000003 Ga0495616_0000003_239320_240693 439
341 3300046518 Ga0495631_0000061 Ga0495631_0000061_36947_38326 439
342 3300046518 Ga0495631_0000329 Ga0495631_0000329_6361_7734 439
343 3300046524 Ga0495648_0000427 Ga0495648_0000427_25967_27319 439
344 3300046525 Ga0495663_0003609 Ga0495663_0003609_2042_3400 439
345 3300046660 Ga0495625_0002254 Ga0495625_0002254_18518_19876 439
346 3300046660 Ga0495625_0017779 Ga0495625_0017779_1138_2511 439
347 3300046665 Ga0495661_0000471 Ga0495661_0000471_24420_25799 439
348 3300047319 Ga0495674_0128446 Ga0495674_0128446_199_1572 439
349 3300047469 Ga0495673_0000101 Ga0495673_0000101_144184_145557 439
350 3300048907 Ga0496104_0002107 Ga0496104_0002107_1192_2568 439
351 3300048908 Ga0496105_0004353 Ga0496105_0004353_8096_9472 439
352 3300048909 Ga0496106_0011969 Ga0496106_0011969_2607_3980 439
353 3300048918 Ga0496115_0079176 Ga0496115_0079176_35_1411 439
354 3300048920 Ga0496117_0002395 Ga0496117_0002395_21180_22538 439
355 3300048920 Ga0496117_0056705 Ga0496117_0056705_153_1511 439
356 3300048921 Ga0496118_0002536 Ga0496118_0002536_21249_22607 439
357 3300048921 Ga0496118_0003247 Ga0496118_0003247_293_1651 439
358 3300048922 Ga0496119_0025244 Ga0496119_0025244_305_1663 439
359 3300048923 Ga0496120_0002415 Ga0496120_0002415_17341_18699 439
360 3300048924 Ga0496121_0003712 Ga0496121_0003712_19608_20966 439
361 3300048924 Ga0496121_0010927 Ga0496121_0010927_8329_9687 439
362 3300048925 Ga0496122_0001646 Ga0496122_0001646_21099_22457 439
363 3300048926 Ga0496123_0002496 Ga0496123_0002496_761_2119 439
364 3300048927 Ga0496124_0002670 Ga0496124_0002670_21134_22492 439
365 3300048927 Ga0496124_0002743 Ga0496124_0002743_520_1878 439
366 3300048928 Ga0496125_0002990 Ga0496125_0002990_492_1850 439
367 3300048928 Ga0496125_0003319 Ga0496125_0003319_17588_18946 439
368 3300048929 Ga0496126_0000847 Ga0496126_0000847_22209_23567 439
369 3300049571 Ga0501034_0217493 Ga0501034_0217493_386_1744 439
370 3300049584 Ga0501068_0010553 Ga0501068_0010553_1196_2569 439
371 3300049590 Ga0501074_0016666 Ga0501074_0016666_940_2313 439
372 3300049593 Ga0501077_0016429 Ga0501077_0016429_429_1802 439
373 3300049742 Ga0501080_0013595 Ga0501080_0013595_4541_5914 439
374 3300050492 nmdc:mga0yw44_38814_c1 nmdc:mga0yw44_38814_c1_1134_2492 439
375 3300053077 Ga0495601_0118413 Ga0495601_0118413_187_1563 439
376 3300053087 Ga0500643_000012 Ga0500643_000012_261952_263304 439
377 3300053160 Ga0500633_0009575 Ga0500633_0009575_1105_2478 439
378 iso_pu_bacteria 2869551831 2869553477 439
379 iso_pu_bacteria 2904513164 2904515583 439
380 iso_pu_bacteria 2919108558 2919111258 439
381 3300003760 Ga0055527_1000079 Ga0055527_100007936 440
382 3300003761 Ga0055535_1000166 Ga0055535_100016629 440
383 3300003762 Ga0055542_1000210 Ga0055542_100021030 440
384 3300003763 Ga0055529_1000394 Ga0055529_100039430 440
385 3300005331 Ga0070670_100000015 Ga0070670_10000001542 440
386 3300005335 Ga0070666_10113166 Ga0070666_101131662 440
387 3300005338 Ga0068868_100039324 Ga0068868_1000393243 440
388 3300005339 Ga0070660_100016031 Ga0070660_1000160314 440
389 3300005340 Ga0070689_100001380 Ga0070689_1000013802 440
390 3300005353 Ga0070669_100002460 Ga0070669_1000024604 440
391 3300005355 Ga0070671_100000013 Ga0070671_10000001347 440
392 3300005365 Ga0070688_100007363 Ga0070688_1000073631 440
393 3300005366 Ga0070659_100004133 Ga0070659_1000041335 440
394 3300005366 Ga0070659_100006051 Ga0070659_1000060514 440
395 3300005367 Ga0070667_100000015 Ga0070667_100000015173 440
396 3300005367 Ga0070667_100008879 Ga0070667_1000088795 440
397 3300005435 Ga0070714_100000332 Ga0070714_10000033224 440
398 3300005435 Ga0070714_100003381 Ga0070714_1000033814 440
399 3300005438 Ga0070701_10003578 Ga0070701_100035783 440
400 3300005440 Ga0070705_100020123 Ga0070705_1000201232 440
401 3300005441 Ga0070700_100041789 Ga0070700_1000417891 440
402 3300005466 Ga0070685_10000104 Ga0070685_1000010441 440
403 3300005544 Ga0070686_100013717 Ga0070686_1000137173 440
404 3300005545 Ga0070695_100063709 Ga0070695_1000637092 440
405 3300005548 Ga0070665_100001202 Ga0070665_10000120215 440
406 3300005548 Ga0070665_100040982 Ga0070665_1000409823 440
407 3300005548 Ga0070665_100050144 Ga0070665_1000501443 440
408 3300005615 Ga0070702_100012947 Ga0070702_1000129472 440
409 3300005617 Ga0068859_100006172 Ga0068859_1000061723 440
410 3300005617 Ga0068859_100041968 Ga0068859_1000419682 440
411 3300005617 Ga0068859_100137349 Ga0068859_1001373492 440
412 3300005618 Ga0068864_100000056 Ga0068864_10000005671 440
413 3300005719 Ga0068861_100031081 Ga0068861_1000310812 440
414 3300005841 Ga0068863_100111940 Ga0068863_1001119402 440
415 3300005841 Ga0068863_100170748 Ga0068863_1001707482 440
416 3300005842 Ga0068858_100052903 Ga0068858_1000529033 440
417 3300005842 Ga0068858_100108837 Ga0068858_1001088372 440
418 3300005843 Ga0068860_100001763 Ga0068860_1000017633 440
419 3300005843 Ga0068860_100003237 Ga0068860_10000323710 440
420 3300005844 Ga0068862_100058884 Ga0068862_1000588843 440
421 3300005844 Ga0068862_100249564 Ga0068862_1002495641 440
422 3300006051 Ga0075364_10020442 Ga0075364_100204422 440
423 3300006051 Ga0075364_10029466 Ga0075364_100294662 440
424 3300006237 Ga0097621_100016081 Ga0097621_1000160815 440
425 3300006237 Ga0097621_100158575 Ga0097621_1001585752 440
426 3300006358 Ga0068871_100001261 Ga0068871_1000012619 440
427 3300006358 Ga0068871_100015467 Ga0068871_1000154672 440
428 3300006881 Ga0068865_100008065 Ga0068865_1000080653 440
429 3300006931 Ga0097620_100006171 Ga0097620_1000061716 440
430 3300006931 Ga0097620_100041967 Ga0097620_1000419672 440
431 3300006931 Ga0097620_100137347 Ga0097620_1001373472 440
432 3300006946 Ga0079104_1007220 Ga0079104_10072203 440
433 3300007788 Ga0099795_10000003 Ga0099795_1000000325 440
434 3300009098 Ga0105245_10015924 Ga0105245_100159244 440
435 3300009101 Ga0105247_10029529 Ga0105247_100295292 440
436 3300009176 Ga0105242_10084907 Ga0105242_100849071 440
437 3300009177 Ga0105248_10010407 Ga0105248_100104073 440
438 3300009177 Ga0105248_10034626 Ga0105248_100346263 440
439 3300010159 Ga0099796_10000077 Ga0099796_100000779 440
440 3300013297 Ga0157378_10101820 Ga0157378_101018201 440
441 3300013307 Ga0157372_10034994 Ga0157372_100349942 440
442 3300013308 Ga0157375_10001552 Ga0157375_1000155219 440
443 3300014325 Ga0163163_10000199 Ga0163163_1000019913 440
444 3300014325 Ga0163163_10056400 Ga0163163_100564002 440
445 3300014326 Ga0157380_10225915 Ga0157380_102259151 440
446 3300014968 Ga0157379_10007489 Ga0157379_100074894 440
447 3300014968 Ga0157379_10049293 Ga0157379_100492933 440
448 3300014969 Ga0157376_10098559 Ga0157376_100985592 440
449 3300025228 Ga0209672_100004 Ga0209672_100004818 440
450 3300025242 Ga0209258_100003 Ga0209258_100003818 440
451 3300025254 Ga0209148_1000025 Ga0209148_1000025122 440
452 3300025272 Ga0209455_1000004 Ga0209455_1000004818 440
453 3300025893 Ga0207682_10023345 Ga0207682_100233452 440
454 3300025903 Ga0207680_10001344 Ga0207680_100013449 440
455 3300025903 Ga0207680_10004644 Ga0207680_100046444 440
456 3300025916 Ga0207663_10055474 Ga0207663_100554742 440
457 3300025919 Ga0207657_10020522 Ga0207657_100205223 440
458 3300025921 Ga0207652_10066984 Ga0207652_100669842 440
459 3300025925 Ga0207650_10000013 Ga0207650_10000013214 440
460 3300025929 Ga0207664_10003922 Ga0207664_100039223 440
461 3300025931 Ga0207644_10000106 Ga0207644_1000010641 440
462 3300025932 Ga0207690_10005861 Ga0207690_100058613 440
463 3300025932 Ga0207690_10019430 Ga0207690_100194302 440
464 3300025936 Ga0207670_10009765 Ga0207670_100097653 440
465 3300025940 Ga0207691_10073580 Ga0207691_100735802 440
466 3300025940 Ga0207691_10092194 Ga0207691_100921942 440
467 3300025941 Ga0207711_10000789 Ga0207711_1000078910 440
468 3300025941 Ga0207711_10005914 Ga0207711_100059147 440
469 3300025986 Ga0207658_10000005 Ga0207658_10000005215 440
470 3300025986 Ga0207658_10009396 Ga0207658_100093965 440
471 3300026035 Ga0207703_10002710 Ga0207703_1000271011 440
472 3300026035 Ga0207703_10033351 Ga0207703_100333513 440
473 3300026088 Ga0207641_10057353 Ga0207641_100573533 440
474 3300026088 Ga0207641_10057354 Ga0207641_100573541 440
475 3300026088 Ga0207641_10069156 Ga0207641_100691563 440
476 3300026095 Ga0207676_10000010 Ga0207676_10000010312 440
477 3300026118 Ga0207675_100022027 Ga0207675_1000220274 440
478 3300026118 Ga0207675_100149794 Ga0207675_1001497942 440
479 3300027512 Ga0209179_1000043 Ga0209179_100004311 440
480 3300028379 Ga0268266_10014073 Ga0268266_100140733 440
481 3300028380 Ga0268265_10000383 Ga0268265_1000038313 440
482 3300028381 Ga0268264_10000036 Ga0268264_10000036305 440
483 3300028381 Ga0268264_10081464 Ga0268264_100814642 440
484 3300028558 Ga0265326_10003972 Ga0265326_100039722 440
485 3300028573 Ga0265334_10000005 Ga0265334_10000005163 440
486 3300028800 Ga0265338_10006155 Ga0265338_100061551 440
487 3300031456 Ga0307513_10068924 Ga0307513_100689242 440
488 3300031595 Ga0265313_10000014 Ga0265313_1000001497 440
489 3300031595 Ga0265313_10043611 Ga0265313_100436112 440
490 3300031665 Ga0316575_10013613 Ga0316575_100136132 440
491 3300031728 Ga0316578_10005443 Ga0316578_100054432 440
492 3300031728 Ga0316578_10107087 Ga0316578_101070872 440
493 3300031731 Ga0307405_10080790 Ga0307405_100807902 440
494 3300031824 Ga0307413_10038397 Ga0307413_100383972 440
495 3300031995 Ga0307409_100030309 Ga0307409_1000303092 440
496 3300032005 Ga0307411_10011008 Ga0307411_100110083 440
497 3300032126 Ga0307415_100103083 Ga0307415_1001030832 440
498 3300032168 Ga0316593_10008778 Ga0316593_100087782 440
499 3300032168 Ga0316593_10022910 Ga0316593_100229102 440
500 3300033180 Ga0307510_10000059 Ga0307510_1000005911 440
501 3300035398 Ga0316574_0110962 Ga0316574_0110962_217_1566 440
502 3300035695 Ga0373927_0000001 Ga0373927_0000001_732635_734050 440
503 3300036712 Ga0316584_0016579 Ga0316584_0016579_92_1471 440
504 3300036712 Ga0316584_0020393 Ga0316584_0020393_2216_3565 440
505 3300037068 Ga0373925_0163629 Ga0373925_0163629_337_1716 440
506 3300044656 Ga0466969_0001735 Ga0466969_0001735_5423_6775 440
507 3300044673 Ga0453683_0000382 Ga0453683_0000382_15893_17242 440
508 3300044673 Ga0453683_0008560 Ga0453683_0008560_124_1476 440
509 3300044684 Ga0466966_0008586 Ga0466966_0008586_3140_4492 440
510 3300044693 Ga0466961_0005334 Ga0466961_0005334_6374_7717 440
511 3300044693 Ga0466961_0008397 Ga0466961_0008397_1668_3020 440
512 3300044765 Ga0466970_0000701 Ga0466970_0000701_4406_5749 440
513 3300044842 Ga0466957_0054394 Ga0466957_0054394_774_2126 440
514 3300045049 Ga0466959_0002124 Ga0466959_0002124_9953_11296 440
515 3300045049 Ga0466959_0124395 Ga0466959_0124395_275_1627 440
516 3300046457 Ga0495590_0009443 Ga0495590_0009443_1383_2750 440
517 3300046460 Ga0495638_0000786 Ga0495638_0000786_5265_6626 440
518 3300046460 Ga0495638_0022865 Ga0495638_0022865_1371_2747 440
519 3300046507 Ga0495606_0028991 Ga0495606_0028991_1857_3197 440
520 3300046513 Ga0495616_0002551 Ga0495616_0002551_3194_4570 440
521 3300046525 Ga0495663_0000227 Ga0495663_0000227_3873_5234 440
522 3300046530 Ga0495654_0001896 Ga0495654_0001896_2245_3654 440
523 3300046694 Ga0495649_0003784 Ga0495649_0003784_5273_6649 440
524 3300048907 Ga0496104_0083301 Ga0496104_0083301_1210_2565 440
525 3300048912 Ga0496109_0023839 Ga0496109_0023839_3322_4677 440
526 3300048913 Ga0496110_0009720 Ga0496110_0009720_3762_5117 440
527 3300048914 Ga0496111_0013076 Ga0496111_0013076_1018_2373 440
528 3300048920 Ga0496117_0000278 Ga0496117_0000278_83617_84978 440
529 3300048920 Ga0496117_0002664 Ga0496117_0002664_20026_21387 440
530 3300048920 Ga0496117_0056759 Ga0496117_0056759_283_1653 440
531 3300048921 Ga0496118_0001003 Ga0496118_0001003_23015_24376 440
532 3300048921 Ga0496118_0002267 Ga0496118_0002267_14458_15828 440
533 3300048927 Ga0496124_0023336 Ga0496124_0023336_1821_3194 440
534 3300048928 Ga0496125_0044715 Ga0496125_0044715_2054_3424 440
535 3300048928 Ga0496125_0082468 Ga0496125_0082468_631_1989 440
536 3300049582 Ga0501048_0128199 Ga0501048_0128199_185_1540 440
537 3300049823 Ga0501044_0000692 Ga0501044_0000692_15643_16998 440
538 3300050491 nmdc:mga00v17_30599_c1 nmdc:mga00v17_30599_c1_1373_2728 440
539 3300053098 Ga0500650_0000059 Ga0500650_0000059_768_2141 440
540 3300053156 Ga0500622_0019336 Ga0500622_0019336_1741_3096 440
541 iso_pu_bacteria 2599185169 2599411447 440
542 iso_pu_bacteria 2600255287 2601641870 440
543 iso_pu_bacteria 2600255291 2601665912 440
544 iso_pu_bacteria 2600255298 2601698769 440
545 iso_pu_bacteria 2600255299 2601701613 440
546 iso_pu_bacteria 2600255303 2601719677 440
547 iso_pu_bacteria 2600255307 2601741497 440
548 iso_pu_bacteria 2600255309 2601752249 440
549 iso_pu_bacteria 2600255392 2602019090 440
550 iso_pu_bacteria 2602042052 2603661371 440
551 iso_pu_bacteria 2602042053 2603664325 440
552 iso_pu_bacteria 2602042111 2603876649 440
553 iso_pu_bacteria 2603880184 2606068755 440
554 iso_pu_bacteria 2608642108 2608669899 440
555 iso_pu_bacteria 2636415599 2637224271 440
556 iso_pu_bacteria 2675903046 2676405673 440
557 iso_pu_bacteria 2711768156 2712469414 440
558 iso_pu_bacteria 2713897090 2715499396 440
559 iso_pu_bacteria 2775507074 2777020757 440
560 iso_pu_bacteria 2854601825 2854601894 440
561 iso_pu_bacteria 2904504865 2904507959 440
562 iso_pu_bacteria 2969079654 2969081311 440
563 iso_pu_bacteria 2984559226 2984563774 440
564 iso_pu_bacteria 2984595703 2984596506 440
565 3300002067 JGI24735J21928_10003881 JGI24735J21928_100038814 441
566 3300002737 JGI25162J39368_1000006 JGI25162J39368_1000006344 441
567 3300002771 JGI25163J39215_1000001 JGI25163J39215_100000115 441
568 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001413 441
569 3300003203 JGI25406J46586_10004998 JGI25406J46586_100049984 441
570 3300003323 rootH1_10084749 rootH1_100847492 441
571 3300003751 Ga0055538_1000004 Ga0055538_1000004543 441
572 3300003752 Ga0055539_1000004 Ga0055539_100000415 441
573 3300003756 Ga0055533_1000007 Ga0055533_1000007543 441
574 3300003759 Ga0055525_1000007 Ga0055525_1000007543 441
575 3300003841 Ga0055541_1000004 Ga0055541_1000004543 441
576 3300003856 Ga0058692_1000585 Ga0058692_10005859 441
577 3300003856 Ga0058692_1005216 Ga0058692_10052162 441
578 3300005289 Ga0065704_10000131 Ga0065704_1000013113 441
579 3300005295 Ga0065707_10091420 Ga0065707_100914201 441
580 3300005329 Ga0070683_100003608 Ga0070683_10000360811 441
581 3300005335 Ga0070666_10003001 Ga0070666_100030015 441
582 3300005355 Ga0070671_100000102 Ga0070671_10000010242 441
583 3300005367 Ga0070667_100000316 Ga0070667_10000031617 441
584 3300005367 Ga0070667_100032883 Ga0070667_1000328832 441
585 3300005436 Ga0070713_100028320 Ga0070713_1000283206 441
586 3300005458 Ga0070681_10001409 Ga0070681_1000140921 441
587 3300005458 Ga0070681_10002788 Ga0070681_100027884 441
588 3300005458 Ga0070681_10017195 Ga0070681_100171953 441
589 3300005458 Ga0070681_10130923 Ga0070681_101309232 441
590 3300005518 Ga0070699_100258653 Ga0070699_1002586531 441
591 3300005530 Ga0070679_100004499 Ga0070679_1000044993 441
592 3300005530 Ga0070679_100038440 Ga0070679_1000384403 441
593 3300005530 Ga0070679_100071779 Ga0070679_1000717793 441
594 3300005530 Ga0070679_100090867 Ga0070679_1000908672 441
595 3300005548 Ga0070665_100000975 Ga0070665_1000009753 441
596 3300005548 Ga0070665_100001355 Ga0070665_1000013552 441
597 3300005548 Ga0070665_100019218 Ga0070665_1000192182 441
598 3300005617 Ga0068859_100020160 Ga0068859_1000201602 441
599 3300005719 Ga0068861_100031978 Ga0068861_1000319783 441
600 3300005841 Ga0068863_100018409 Ga0068863_1000184096 441
601 3300005841 Ga0068863_100220295 Ga0068863_1002202952 441
602 3300005842 Ga0068858_100003005 Ga0068858_1000030052 441
603 3300005843 Ga0068860_100000270 Ga0068860_10000027054 441
604 3300005844 Ga0068862_100013139 Ga0068862_1000131394 441
605 3300005844 Ga0068862_100222401 Ga0068862_1002224011 441
606 3300005937 Ga0081455_10000140 Ga0081455_1000014064 441
607 3300005985 Ga0081539_10000001 Ga0081539_10000001286 441
608 3300006931 Ga0097620_100020160 Ga0097620_1000201602 441
609 3300009011 Ga0105251_10006989 Ga0105251_100069892 441
610 3300009011 Ga0105251_10007021 Ga0105251_100070214 441
611 3300009011 Ga0105251_10011245 Ga0105251_100112454 441
612 3300009036 Ga0105244_10001876 Ga0105244_1000187614 441
613 3300009036 Ga0105244_10023140 Ga0105244_100231402 441
614 3300009092 Ga0105250_10000262 Ga0105250_1000026224 441
615 3300009092 Ga0105250_10001432 Ga0105250_100014322 441
616 3300009092 Ga0105250_10006801 Ga0105250_100068014 441
617 3300009093 Ga0105240_10019300 Ga0105240_100193003 441
618 3300009093 Ga0105240_10032759 Ga0105240_100327593 441
619 3300009093 Ga0105240_10062207 Ga0105240_100622073 441
620 3300009093 Ga0105240_10444193 Ga0105240_104441931 441
621 3300009101 Ga0105247_10000126 Ga0105247_1000012639 441
622 3300009101 Ga0105247_10001692 Ga0105247_100016923 441
623 3300009101 Ga0105247_10014469 Ga0105247_100144695 441
624 3300009177 Ga0105248_10035560 Ga0105248_100355604 441
625 3300009177 Ga0105248_10146606 Ga0105248_101466062 441
626 3300009551 Ga0105238_10061080 Ga0105238_100610804 441
627 3300009551 Ga0105238_10139338 Ga0105238_101393383 441
628 3300009551 Ga0105238_10228572 Ga0105238_102285722 441
629 3300009553 Ga0105249_10032674 Ga0105249_100326744 441
630 3300009553 Ga0105249_10055667 Ga0105249_100556672 441
631 3300010375 Ga0105239_10095426 Ga0105239_100954262 441
632 3300010375 Ga0105239_10205732 Ga0105239_102057322 441
633 3300013100 Ga0157373_10079939 Ga0157373_100799392 441
634 3300013102 Ga0157371_10000327 Ga0157371_100003272 441
635 3300013102 Ga0157371_10014898 Ga0157371_100148981 441
636 3300013105 Ga0157369_10146846 Ga0157369_101468462 441
637 3300013105 Ga0157369_10165560 Ga0157369_101655601 441
638 3300013306 Ga0163162_10051398 Ga0163162_100513983 441
639 3300013306 Ga0163162_10060598 Ga0163162_100605983 441
640 3300013307 Ga0157372_10015969 Ga0157372_100159697 441
641 3300013307 Ga0157372_10064539 Ga0157372_100645395 441
642 3300014325 Ga0163163_10001793 Ga0163163_1000179313 441
643 3300014325 Ga0163163_10111894 Ga0163163_101118942 441
644 3300014497 Ga0182008_10055257 Ga0182008_100552572 441
645 3300014968 Ga0157379_10036011 Ga0157379_100360112 441
646 3300014968 Ga0157379_10259622 Ga0157379_102596222 441
647 3300015262 Ga0182007_10001346 Ga0182007_100013462 441
648 3300015265 Ga0182005_1002932 Ga0182005_10029322 441
649 3300025207 Ga0209760_100048 Ga0209760_10004813 441
650 3300025224 Ga0209784_100001 Ga0209784_100001533 441
651 3300025225 Ga0209566_100001 Ga0209566_100001533 441
652 3300025226 Ga0209674_100002 Ga0209674_100002533 441
653 3300025230 Ga0209563_100008 Ga0209563_100008536 441
654 3300025231 Ga0207427_100002 Ga0207427_100002744 441
655 3300025233 Ga0209437_100046 Ga0209437_100046338 441
656 3300025253 Ga0209677_100004 Ga0209677_100004536 441
657 3300025261 Ga0209233_1004556 Ga0209233_10045562 441
658 3300025711 Ga0207696_1000375 Ga0207696_100037530 441
659 3300025711 Ga0207696_1000973 Ga0207696_10009732 441
660 3300025711 Ga0207696_1004745 Ga0207696_10047452 441
661 3300025728 Ga0207655_1000126 Ga0207655_1000126133 441
662 3300025728 Ga0207655_1002995 Ga0207655_10029958 441
663 3300025735 Ga0207713_1021063 Ga0207713_10210632 441
664 3300025735 Ga0207713_1021500 Ga0207713_10215002 441
665 3300025900 Ga0207710_10005014 Ga0207710_100050143 441
666 3300025903 Ga0207680_10020012 Ga0207680_100200122 441
667 3300025904 Ga0207647_10035047 Ga0207647_100350472 441
668 3300025912 Ga0207707_10000592 Ga0207707_100005924 441
669 3300025912 Ga0207707_10030460 Ga0207707_100304602 441
670 3300025913 Ga0207695_10022323 Ga0207695_100223237 441
671 3300025913 Ga0207695_10026839 Ga0207695_100268397 441
672 3300025913 Ga0207695_10037128 Ga0207695_100371283 441
673 3300025913 Ga0207695_10092601 Ga0207695_100926011 441
674 3300025917 Ga0207660_10041342 Ga0207660_100413423 441
675 3300025921 Ga0207652_10009857 Ga0207652_100098574 441
676 3300025921 Ga0207652_10046115 Ga0207652_100461153 441
677 3300025921 Ga0207652_10102565 Ga0207652_101025653 441
678 3300025931 Ga0207644_10010630 Ga0207644_100106306 441
679 3300025941 Ga0207711_10030506 Ga0207711_100305064 441
680 3300025949 Ga0207667_10043209 Ga0207667_100432095 441
681 3300025949 Ga0207667_10135135 Ga0207667_101351352 441
682 3300025986 Ga0207658_10001415 Ga0207658_1000141517 441
683 3300026035 Ga0207703_10000299 Ga0207703_1000029941 441
684 3300026035 Ga0207703_10000362 Ga0207703_1000036215 441
685 3300026088 Ga0207641_10000189 Ga0207641_100001897 441
686 3300026118 Ga0207675_100131037 Ga0207675_1001310372 441
687 3300027312 Ga0209371_1000002 Ga0209371_10000021323 441
688 3300027312 Ga0209371_1000731 Ga0209371_10007316 441
689 3300027312 Ga0209371_1000832 Ga0209371_10008329 441
690 3300028379 Ga0268266_10000604 Ga0268266_1000060436 441
691 3300028379 Ga0268266_10000886 Ga0268266_1000088624 441
692 3300028380 Ga0268265_10009074 Ga0268265_100090744 441
693 3300028380 Ga0268265_10101110 Ga0268265_101011102 441
694 3300028381 Ga0268264_10000164 Ga0268264_1000016467 441
695 3300028381 Ga0268264_10020390 Ga0268264_100203902 441
696 3300028563 Ga0265319_1038052 Ga0265319_10380521 441
697 3300028573 Ga0265334_10001041 Ga0265334_100010414 441
698 3300028577 Ga0265318_10000626 Ga0265318_100006268 441
699 3300030500 Ga0268256_1000002 Ga0268256_1000002139 441
700 3300030500 Ga0268256_1000815 Ga0268256_10008156 441
701 3300030521 Ga0307511_10003176 Ga0307511_100031765 441
702 3300031238 Ga0265332_10014061 Ga0265332_100140612 441
703 3300031241 Ga0265325_10034982 Ga0265325_100349822 441
704 3300031247 Ga0265340_10032357 Ga0265340_100323572 441
705 3300031507 Ga0307509_10000002 Ga0307509_1000000248 441
706 3300031616 Ga0307508_10193376 Ga0307508_101933762 441
707 3300031711 Ga0265314_10039898 Ga0265314_100398983 441
708 3300033180 Ga0307510_10000007 Ga0307510_10000007369 441
709 3300033180 Ga0307510_10012240 Ga0307510_100122407 441
710 3300035398 Ga0316574_0129573 Ga0316574_0129573_174_1574 441
711 3300035398 Ga0316574_0139387 Ga0316574_0139387_85_1485 441
712 3300035695 Ga0373927_0037991 Ga0373927_0037991_1111_2466 441
713 3300039438 Ga0436360_0322345 Ga0436360_0322345_425_1786 441
714 3300041405 Ga0439438_000002 Ga0439438_000002_174343_175725 441
715 3300041405 Ga0439438_000601 Ga0439438_000601_11549_12928 441
716 3300041407 Ga0439447_001811 Ga0439447_001811_1392_2771 441
717 3300041411 Ga0439466_0000001 Ga0439466_0000001_212284_213666 441
718 3300042006 Ga0439432_000295 Ga0439432_000295_15095_16477 441
719 3300042184 Ga0450908_000113 Ga0450908_000113_6498_7904 441
720 3300044650 Ga0466986_0077623 Ga0466986_0077623_41_1423 441
721 3300044672 Ga0466982_0000029 Ga0466982_0000029_5650_7032 441
722 3300044684 Ga0466966_0023085 Ga0466966_0023085_1216_2586 441
723 3300045049 Ga0466959_0014509 Ga0466959_0014509_3481_4851 441
724 3300045049 Ga0466959_0050326 Ga0466959_0050326_130_1485 441
725 3300046452 Ga0495617_000122 Ga0495617_000122_44178_45557 441
726 3300046471 Ga0495650_0000004 Ga0495650_0000004_635873_637252 441
727 3300046491 Ga0495584_0001870 Ga0495584_0001870_8774_10117 441
728 3300046492 Ga0495585_0011933 Ga0495585_0011933_2303_3685 441
729 3300046500 Ga0495596_0020607 Ga0495596_0020607_754_2139 441
730 3300046501 Ga0495607_0000008 Ga0495607_0000008_155198_156577 441
731 3300046506 Ga0495583_0000833 Ga0495583_0000833_36267_37610 441
732 3300046515 Ga0495620_0000182 Ga0495620_0000182_5850_7193 441
733 3300046515 Ga0495620_0000216 Ga0495620_0000216_36695_38074 441
734 3300046522 Ga0495643_0073189 Ga0495643_0073189_260_1615 441
735 3300046530 Ga0495654_0000009 Ga0495654_0000009_114801_116180 441
736 3300046648 Ga0495611_0000023 Ga0495611_0000023_66733_68076 441
737 3300046648 Ga0495611_0002701 Ga0495611_0002701_101_1444 441
738 3300046810 Ga0495660_0000013 Ga0495660_0000013_14773_16152 441
739 3300047320 Ga0495672_0000015 Ga0495672_0000015_469542_470924 441
740 3300047323 Ga0495683_0005979 Ga0495683_0005979_612_1991 441
741 3300047446 Ga0495679_007808 Ga0495679_007808_1235_2617 441
742 3300047469 Ga0495673_0000036 Ga0495673_0000036_269358_270704 441
743 3300047470 Ga0495681_0030972 Ga0495681_0030972_163_1527 441
744 3300047470 Ga0495681_0033177 Ga0495681_0033177_919_2298 441
745 3300047472 Ga0495686_0000608 Ga0495686_0000608_41026_42405 441
746 3300047472 Ga0495686_0019088 Ga0495686_0019088_173_1516 441
747 3300048907 Ga0496104_0002393 Ga0496104_0002393_12874_14253 441
748 3300048907 Ga0496104_0198496 Ga0496104_0198496_180_1553 441
749 3300048908 Ga0496105_0108068 Ga0496105_0108068_413_1786 441
750 3300048911 Ga0496108_0202737 Ga0496108_0202737_95_1450 441
751 3300048915 Ga0496112_0027540 Ga0496112_0027540_828_2183 441
752 3300048918 Ga0496115_0000092 Ga0496115_0000092_58577_59920 441
753 3300048918 Ga0496115_0113082 Ga0496115_0113082_828_2186 441
754 3300048919 Ga0496116_0000016 Ga0496116_0000016_504560_505939 441
755 3300048919 Ga0496116_0010613 Ga0496116_0010613_1922_3304 441
756 3300048920 Ga0496117_0000038 Ga0496117_0000038_279390_280742 441
757 3300048920 Ga0496117_0016308 Ga0496117_0016308_4372_5754 441
758 3300048920 Ga0496117_0047295 Ga0496117_0047295_1092_2471 441
759 3300048921 Ga0496118_0000019 Ga0496118_0000019_378008_379360 441
760 3300048921 Ga0496118_0000837 Ga0496118_0000837_12225_13604 441
761 3300048921 Ga0496118_0012786 Ga0496118_0012786_2260_3642 441
762 3300048921 Ga0496118_0013890 Ga0496118_0013890_5820_7199 441
763 3300048922 Ga0496119_0000352 Ga0496119_0000352_33682_35055 441
764 3300048922 Ga0496119_0020140 Ga0496119_0020140_1321_2673 441
765 3300048922 Ga0496119_0027119 Ga0496119_0027119_1724_3106 441
766 3300048922 Ga0496119_0071834 Ga0496119_0071834_298_1650 441
767 3300048923 Ga0496120_0000649 Ga0496120_0000649_11171_12523 441
768 3300048923 Ga0496120_0000673 Ga0496120_0000673_27571_28944 441
769 3300048923 Ga0496120_0000711 Ga0496120_0000711_32311_33693 441
770 3300048923 Ga0496120_0044321 Ga0496120_0044321_838_2217 441
771 3300048924 Ga0496121_0001023 Ga0496121_0001023_24382_25737 441
772 3300048924 Ga0496121_0005264 Ga0496121_0005264_12356_13735 441
773 3300048924 Ga0496121_0037779 Ga0496121_0037779_580_1932 441
774 3300048925 Ga0496122_0000056 Ga0496122_0000056_104128_105507 441
775 3300048926 Ga0496123_0000041 Ga0496123_0000041_104128_105507 441
776 3300048926 Ga0496123_0035617 Ga0496123_0035617_938_2320 441
777 3300048927 Ga0496124_0000010 Ga0496124_0000010_571511_572890 441
778 3300048927 Ga0496124_0000484 Ga0496124_0000484_64323_65705 441
779 3300048927 Ga0496124_0002027 Ga0496124_0002027_19246_20622 441
780 3300048927 Ga0496124_0047628 Ga0496124_0047628_1581_2933 441
781 3300048928 Ga0496125_0000113 Ga0496125_0000113_104631_106010 441
782 3300048928 Ga0496125_0001231 Ga0496125_0001231_8324_9691 441
783 3300048928 Ga0496125_0004334 Ga0496125_0004334_1679_3061 441
784 3300048928 Ga0496125_0050361 Ga0496125_0050361_875_2227 441
785 3300048929 Ga0496126_0004182 Ga0496126_0004182_1444_2823 441
786 3300048929 Ga0496126_0052462 Ga0496126_0052462_176_1528 441
787 3300048929 Ga0496126_0057538 Ga0496126_0057538_1569_2936 441
788 3300048929 Ga0496126_0217647 Ga0496126_0217647_95_1450 441
789 3300049459 Ga0495678_027670 Ga0495678_027670_898_2280 441
790 3300049460 Ga0495682_0000283 Ga0495682_0000283_38006_39349 441
791 3300049576 Ga0501040_0009480 Ga0501040_0009480_4609_5982 441
792 3300053092 Ga0500583_0061057 Ga0500583_0061057_410_1762 441
793 3300053104 Ga0500556_0000395 Ga0500556_0000395_12444_13790 441
794 3300053153 Ga0500616_0000019 Ga0500616_0000019_131878_133233 441
795 3300053153 Ga0500616_0040898 Ga0500616_0040898_472_1836 441
796 3300053178 Ga0500637_0010124 Ga0500637_0010124_623_1978 441
797 iso_pu_bacteria 2585427591 2585827970 441
798 iso_pu_bacteria 2585427592 2585830982 441
799 iso_pu_bacteria 2600255256 2601534827 441
800 iso_pu_bacteria 2600255257 2601539544 441
801 iso_pu_bacteria 2600255310 2601757894 441
802 iso_pu_bacteria 2600255311 2601764252 441
803 iso_pu_bacteria 2602042109 2603868771 441
804 iso_pu_bacteria 2667528173 2671106250 441
805 iso_pu_bacteria 2791354903 2791922032 441
806 iso_pu_bacteria 2847085930 2847086785 441
807 iso_pu_bacteria 2904474040 2904474611 441
808 iso_pu_bacteria 2919150387 2919150957 441
809 iso_pu_bacteria 2927143783 2927145831 441
810 iso_pu_bacteria 2929297113 2929298565 441
811 iso_pu_bacteria 2939602548 2939606002 441
812 iso_pu_bacteria 2971820967 2971822719 441
813 iso_pu_bacteria 8016733728 8016734435 441

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

82

214

0.96

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

228

328

0.96

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

332

443

0.95

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

448

523

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nns-assembly1.cif.gz_A xanthomonas citri phospho-pgm in complex with glucose-6-phosphate 0.9689 2 438
6nns-assembly1.cif.gz_A xanthomonas citri phospho-pgm in complex with glucose-6-phosphate 0.9602 2 438
1wqa-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ 0.8993 2 439
1wqa-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ 0.8935 2 439
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.8905 3 353
ID Description Score Start End Superfamily
5bmpA03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9952 239 354 3.40.120.10
5bmpA04 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9714 358 438 3.30.310.50
af_P24175_2_147_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9711 3 142 3.40.120.10
af_O86374_256_373_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9652 239 353 3.40.120.10
5bmpA03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9621 239 354 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A5Y3XAS8-F1-model_v4 Phosphomannomutase CpsG (EC 5.4.2.8) 0.9933 217 438 GO:0004615
GO:0005975
AF-A0A505CHV4-F1-model_v4 Phosphomannomutase CpsG (EC 5.4.2.8) 0.9902 262 440 GO:0004615
GO:0005975
AF-A0A7V0ZK01-F1-model_v4 Phosphomannomutase 0.9883 248 440 GO:0005975
GO:0016868
AF-A0A379ST70-F1-model_v4 Phosphomannomutase (EC 5.4.2.10, EC 5.4.2.8) 0.9867 291 438 GO:0004615
GO:0005975
GO:0008966
AF-A0A609FGB3-F1-model_v4 Phosphomannomutase CpsG (EC 5.4.2.8) 0.9866 291 438 GO:0004615
GO:0005975

Feature Viewer

pLDDT pTM Quality
94.73 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map