F481932
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 813 | 436 | 739 | 453 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10161439|Ga0105240_101614391 |
| Length | 529 |
| Sequence | VQPHAVRPLDEQRLGRGLHLAVRQPKVLRAHPVPVRMNGRMVCEWVSRRRAASARDDCGDQVAPRSVYWAVCQTRFKMKNITCFKAYDVRGRVPSELDEDIAYRIGRGYAAFVEPKTVAVGRDIRLSSPALAAAVARGLTDAGVDVLDIGVGGTELAYFATFSRKLDGGIMVTASHNPPDYNGMKMVREESRPLSSATGLKDIRALAERGEFAPAKRRGSVRPVDIKPDYVAHLLSYVDRAELAPLKIVVNAGNGGAGPIIDLLEPHLPFEFVKIFHEPDGKFPNGVPNPMIEENRTVTMERVRAERADLGLAWDGDYDRCFFFDARGDFIEGYYIVGLLAQSFLKKHPGDRIVHDPRLTWNTLDIVKAAGGEPVQSKSGHAFIKQKMREVDAIYGGEMSAHHYFRKFSYADSGMIPWLLVTELMSRHKKSLAELVGDRMRRFPASGEINRKVTDAQAAIEKAEARYGAGALAIDRTDGLGIDFADWRFNLRASNTEPLLRLNVESRGDEQLMRRRTEELLELLGGEPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 3 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 4 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 5 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 6 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 7 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 8 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 9 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 10 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 11 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 12 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 13 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 14 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 15 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 16 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 17 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 18 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 19 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 20 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 21 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 22 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 23 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 24 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 25 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 26 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 27 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 28 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 29 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 30 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 31 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 32 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 33 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 34 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 35 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 36 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 37 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 38 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 39 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 40 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 41 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 42 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 43 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 44 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 45 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 46 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 47 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 48 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 49 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 50 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 51 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 52 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 53 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 54 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 55 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 56 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 57 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 58 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 59 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 60 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 61 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 62 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 63 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 64 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 65 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 66 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 67 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 68 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 69 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 70 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 71 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 72 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 73 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 74 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 75 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 76 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 77 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 79 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 80 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 82 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 83 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 90 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 92 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 93 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 94 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 95 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 96 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 98 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 99 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 101 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 105 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 108 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 128 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 134 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 142 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 143 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 145 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 146 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 147 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 148 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 149 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 150 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 151 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 152 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 153 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 154 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 155 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 156 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 157 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 159 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 160 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 161 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 162 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 163 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 164 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 166 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 167 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 181 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 195 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 199 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 200 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 282 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 283 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 284 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 285 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 286 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 287 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 288 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 292 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 293 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 294 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 295 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 296 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 297 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 298 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 299 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 300 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 301 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 303 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 304 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 305 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 306 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 307 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 308 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 309 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 310 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 311 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 312 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 314 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 315 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 316 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 317 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 318 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 319 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 320 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 325 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 326 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 327 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 328 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 329 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 330 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 331 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 333 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 334 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 335 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 336 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 337 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 338 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 339 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 340 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 341 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 342 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 343 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 344 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 345 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 346 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 347 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 379 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 380 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 381 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 384 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 393 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 394 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 395 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 396 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 397 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 398 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 399 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 425 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 426 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 427 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 428 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 429 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 430 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 431 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 432 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 433 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 434 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.28 |
| Metatranscriptomes | 0.62 |
| Isolates | 9.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.25 |
| Bulb | 0.12 |
| Endosphere | 8.36 |
| Nodule | 0.25 |
| Rhizoplane | 8 |
| Rhizosphere | 71.34 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10003881 | 3300002067 | Bacteria | 5058 |
| 2 | JGI25162J39368_1000006 | 3300002737 | Bacteria | 405267 |
| 3 | JGI25163J39215_1000001 | 3300002771 | Bacteria | 314282 |
| 4 | JGI25164J39214_1000001 | 3300002772 | Bacteria | 477015 |
| 5 | JGI25150J39212_1000066 | 3300002774 | Bacteria | 63677 |
| 6 | JGI25151J46595_10000139 | 3300003187 | Bacteria | 96000 |
| 7 | JGI25406J46586_10004998 | 3300003203 | Bacteria | 6156 |
| 8 | JGI25153J46596_10000101 | 3300003215 | Bacteria | 96639 |
| 9 | rootH1_10084749 | 3300003323 | Bacteria | 3927 |
| 10 | Ga0055538_1000004 | 3300003751 | Bacteria | 615646 |
| 11 | Ga0055539_1000004 | 3300003752 | Bacteria | 615646 |
| 12 | Ga0055533_1000007 | 3300003756 | Bacteria | 615646 |
| 13 | Ga0055525_1000007 | 3300003759 | Bacteria | 615646 |
| 14 | Ga0055527_1000079 | 3300003760 | Bacteria | 79303 |
| 15 | Ga0055535_1000166 | 3300003761 | Bacteria | 71280 |
| 16 | Ga0055542_1000210 | 3300003762 | Bacteria | 71284 |
| 17 | Ga0055529_1000394 | 3300003763 | Bacteria | 46666 |
| 18 | Ga0055526_1000218 | 3300003771 | Bacteria | 49706 |
| 19 | Ga0055537_1000900 | 3300003773 | Bacteria | 14074 |
| 20 | Ga0055536_1000489 | 3300003781 | Bacteria | 27490 |
| 21 | Ga0055534_1000061 | 3300003784 | Bacteria | 82050 |
| 22 | Ga0055534_1000519 | 3300003784 | Bacteria | 20776 |
| 23 | Ga0055528_1000332 | 3300003790 | Bacteria | 39798 |
| 24 | Ga0055531_10000741 | 3300003794 | Bacteria | 27490 |
| 25 | Ga0055541_1000004 | 3300003841 | Bacteria | 615646 |
| 26 | Ga0058692_1000585 | 3300003856 | Bacteria | 15400 |
| 27 | Ga0058692_1005216 | 3300003856 | Bacteria | 3733 |
| 28 | Ga0065704_10000131 | 3300005289 | Bacteria | 44705 |
| 29 | Ga0065707_10082227 | 3300005295 | Bacteria | 18733 |
| 30 | Ga0065707_10091420 | 3300005295 | Bacteria | 3950 |
| 31 | Ga0070658_10011129 | 3300005327 | Bacteria | 7213 |
| 32 | Ga0070658_10063524 | 3300005327 | Bacteria | 3010 |
| 33 | Ga0070683_100003608 | 3300005329 | Bacteria | 12604 |
| 34 | Ga0070670_100000015 | 3300005331 | Bacteria | 228819 |
| 35 | Ga0070670_100007297 | 3300005331 | Bacteria | 9374 |
| 36 | Ga0070670_100048855 | 3300005331 | Bacteria | 3640 |
| 37 | Ga0070670_100109121 | 3300005331 | Bacteria | 2385 |
| 38 | Ga0068869_100021901 | 3300005334 | Bacteria | 4398 |
| 39 | Ga0070666_10000010 | 3300005335 | Bacteria | 264789 |
| 40 | Ga0070666_10003001 | 3300005335 | Bacteria | 10229 |
| 41 | Ga0070666_10113166 | 3300005335 | Bacteria | 1878 |
| 42 | Ga0070680_100015372 | 3300005336 | Bacteria | 5998 |
| 43 | Ga0068868_100003563 | 3300005338 | Bacteria | 10842 |
| 44 | Ga0068868_100039324 | 3300005338 | Bacteria | 3676 |
| 45 | Ga0068868_100105831 | 3300005338 | Bacteria | 2282 |
| 46 | Ga0070660_100016031 | 3300005339 | Bacteria | 5428 |
| 47 | Ga0070660_100083401 | 3300005339 | Bacteria | 2511 |
| 48 | Ga0070689_100001380 | 3300005340 | Bacteria | 15441 |
| 49 | Ga0070689_100008233 | 3300005340 | Bacteria | 7334 |
| 50 | Ga0070691_10015541 | 3300005341 | Bacteria | 3496 |
| 51 | Ga0070687_100067156 | 3300005343 | Bacteria | 1913 |
| 52 | Ga0070668_100027973 | 3300005347 | Bacteria | 4279 |
| 53 | Ga0070669_100002460 | 3300005353 | Bacteria | 13404 |
| 54 | Ga0070669_100187800 | 3300005353 | Bacteria | 1620 |
| 55 | Ga0070671_100000013 | 3300005355 | Bacteria | 173287 |
| 56 | Ga0070671_100000102 | 3300005355 | Bacteria | 54494 |
| 57 | Ga0070688_100007363 | 3300005365 | Bacteria | 5931 |
| 58 | Ga0070659_100004133 | 3300005366 | Bacteria | 10348 |
| 59 | Ga0070659_100004779 | 3300005366 | Bacteria | 9683 |
| 60 | Ga0070659_100006051 | 3300005366 | Bacteria | 8727 |
| 61 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 62 | Ga0070667_100000316 | 3300005367 | Bacteria | 54130 |
| 63 | Ga0070667_100008879 | 3300005367 | Bacteria | 8319 |
| 64 | Ga0070667_100032883 | 3300005367 | Bacteria | 4329 |
| 65 | Ga0070714_100000332 | 3300005435 | Bacteria | 35550 |
| 66 | Ga0070714_100003381 | 3300005435 | Bacteria | 11890 |
| 67 | Ga0070714_100010493 | 3300005435 | Bacteria | 7323 |
| 68 | Ga0070713_100028320 | 3300005436 | Bacteria | 4423 |
| 69 | Ga0070701_10003578 | 3300005438 | Bacteria | 6169 |
| 70 | Ga0070701_10013846 | 3300005438 | Bacteria | 3681 |
| 71 | Ga0070701_10015737 | 3300005438 | Bacteria | 3501 |
| 72 | Ga0070711_100017875 | 3300005439 | Bacteria | 4519 |
| 73 | Ga0070705_100019673 | 3300005440 | Bacteria | 3558 |
| 74 | Ga0070705_100020123 | 3300005440 | Bacteria | 3526 |
| 75 | Ga0070700_100041789 | 3300005441 | Bacteria | 2812 |
| 76 | Ga0070700_100055800 | 3300005441 | Bacteria | 2474 |
| 77 | Ga0070700_100072901 | 3300005441 | Bacteria | 2196 |
| 78 | Ga0070663_100058726 | 3300005455 | Bacteria | 2763 |
| 79 | Ga0070662_100006417 | 3300005457 | Bacteria | 7581 |
| 80 | Ga0070662_100007912 | 3300005457 | Bacteria | 6912 |
| 81 | Ga0070681_10001409 | 3300005458 | Bacteria | 21093 |
| 82 | Ga0070681_10002788 | 3300005458 | Bacteria | 16141 |
| 83 | Ga0070681_10017195 | 3300005458 | Bacteria | 7231 |
| 84 | Ga0070681_10130923 | 3300005458 | Bacteria | 2441 |
| 85 | Ga0068867_100038984 | 3300005459 | Bacteria | 3462 |
| 86 | Ga0068867_100040263 | 3300005459 | Bacteria | 3409 |
| 87 | Ga0070685_10000104 | 3300005466 | Bacteria | 53528 |
| 88 | Ga0070699_100258653 | 3300005518 | Bacteria | 1557 |
| 89 | Ga0070679_100004499 | 3300005530 | Bacteria | 12879 |
| 90 | Ga0070679_100024620 | 3300005530 | Bacteria | 5900 |
| 91 | Ga0070679_100038440 | 3300005530 | Bacteria | 4758 |
| 92 | Ga0070679_100039655 | 3300005530 | Bacteria | 4681 |
| 93 | Ga0070679_100071779 | 3300005530 | Bacteria | 3454 |
| 94 | Ga0070679_100090867 | 3300005530 | Bacteria | 3041 |
| 95 | Ga0070679_100154764 | 3300005530 | Bacteria | 2268 |
| 96 | Ga0070684_100011689 | 3300005535 | Bacteria | 6999 |
| 97 | Ga0070684_100022552 | 3300005535 | Bacteria | 5254 |
| 98 | Ga0070672_100118933 | 3300005543 | Bacteria | 2161 |
| 99 | Ga0070686_100013717 | 3300005544 | Bacteria | 4647 |
| 100 | Ga0070686_100028431 | 3300005544 | Bacteria | 3391 |
| 101 | Ga0070695_100063709 | 3300005545 | Bacteria | 2397 |
| 102 | Ga0070695_100175008 | 3300005545 | Bacteria | 1517 |
| 103 | Ga0070696_100001233 | 3300005546 | Bacteria | 16612 |
| 104 | Ga0070693_100002362 | 3300005547 | Bacteria | 8677 |
| 105 | Ga0070693_100077467 | 3300005547 | Bacteria | 1973 |
| 106 | Ga0070665_100000975 | 3300005548 | Bacteria | 36228 |
| 107 | Ga0070665_100001202 | 3300005548 | Bacteria | 31585 |
| 108 | Ga0070665_100001355 | 3300005548 | Bacteria | 28967 |
| 109 | Ga0070665_100011568 | 3300005548 | Bacteria | 8922 |
| 110 | Ga0070665_100019218 | 3300005548 | Bacteria | 6854 |
| 111 | Ga0070665_100040982 | 3300005548 | Bacteria | 4654 |
| 112 | Ga0070665_100050144 | 3300005548 | Bacteria | 4189 |
| 113 | Ga0070665_100071602 | 3300005548 | Bacteria | 3473 |
| 114 | Ga0070665_100072100 | 3300005548 | Bacteria | 3462 |
| 115 | Ga0070665_100132172 | 3300005548 | Bacteria | 2498 |
| 116 | Ga0070704_100141065 | 3300005549 | Bacteria | 1882 |
| 117 | Ga0068855_100029694 | 3300005563 | Bacteria | 6536 |
| 118 | Ga0068855_100093536 | 3300005563 | Bacteria | 3467 |
| 119 | Ga0068855_100140514 | 3300005563 | Bacteria | 2753 |
| 120 | Ga0070664_100008203 | 3300005564 | Bacteria | 8448 |
| 121 | Ga0070664_100010617 | 3300005564 | Bacteria | 7463 |
| 122 | Ga0068854_100073627 | 3300005578 | Bacteria | 2504 |
| 123 | Ga0068854_100163278 | 3300005578 | Bacteria | 1727 |
| 124 | Ga0068856_100042191 | 3300005614 | Bacteria | 4487 |
| 125 | Ga0070702_100012947 | 3300005615 | Bacteria | 4200 |
| 126 | Ga0068852_100187784 | 3300005616 | Bacteria | 1948 |
| 127 | Ga0068859_100000226 | 3300005617 | Bacteria | 55324 |
| 128 | Ga0068859_100000716 | 3300005617 | Bacteria | 33426 |
| 129 | Ga0068859_100006172 | 3300005617 | Bacteria | 12178 |
| 130 | Ga0068859_100020160 | 3300005617 | Bacteria | 6695 |
| 131 | Ga0068859_100041968 | 3300005617 | Bacteria | 4595 |
| 132 | Ga0068859_100137349 | 3300005617 | Bacteria | 2518 |
| 133 | Ga0068864_100000056 | 3300005618 | Bacteria | 127891 |
| 134 | Ga0068864_100004974 | 3300005618 | Bacteria | 10901 |
| 135 | Ga0068861_100000308 | 3300005719 | Bacteria | 27355 |
| 136 | Ga0068861_100003643 | 3300005719 | Bacteria | 10269 |
| 137 | Ga0068861_100010260 | 3300005719 | Bacteria | 6502 |
| 138 | Ga0068861_100031081 | 3300005719 | Bacteria | 3919 |
| 139 | Ga0068861_100031978 | 3300005719 | Bacteria | 3871 |
| 140 | Ga0068861_100090186 | 3300005719 | Bacteria | 2417 |
| 141 | Ga0068870_10003458 | 3300005840 | Bacteria | 6690 |
| 142 | Ga0068870_10015306 | 3300005840 | Bacteria | 3636 |
| 143 | Ga0068863_100001807 | 3300005841 | Bacteria | 21230 |
| 144 | Ga0068863_100018409 | 3300005841 | Bacteria | 6684 |
| 145 | Ga0068863_100111940 | 3300005841 | Bacteria | 2600 |
| 146 | Ga0068863_100170748 | 3300005841 | Bacteria | 2086 |
| 147 | Ga0068863_100220295 | 3300005841 | Bacteria | 1828 |
| 148 | Ga0068858_100003005 | 3300005842 | Bacteria | 16912 |
| 149 | Ga0068858_100031279 | 3300005842 | Bacteria | 4942 |
| 150 | Ga0068858_100052903 | 3300005842 | Bacteria | 3757 |
| 151 | Ga0068858_100108837 | 3300005842 | Bacteria | 2587 |
| 152 | Ga0068860_100000270 | 3300005843 | Bacteria | 75836 |
| 153 | Ga0068860_100001763 | 3300005843 | Bacteria | 23093 |
| 154 | Ga0068860_100003237 | 3300005843 | Bacteria | 16794 |
| 155 | Ga0068860_100068081 | 3300005843 | Bacteria | 3382 |
| 156 | Ga0068862_100000651 | 3300005844 | Bacteria | 35850 |
| 157 | Ga0068862_100004834 | 3300005844 | Bacteria | 11346 |
| 158 | Ga0068862_100010635 | 3300005844 | Bacteria | 7602 |
| 159 | Ga0068862_100013139 | 3300005844 | Bacteria | 6849 |
| 160 | Ga0068862_100019633 | 3300005844 | Bacteria | 5643 |
| 161 | Ga0068862_100058884 | 3300005844 | Bacteria | 3297 |
| 162 | Ga0068862_100222401 | 3300005844 | Bacteria | 1710 |
| 163 | Ga0068862_100249564 | 3300005844 | Bacteria | 1617 |
| 164 | Ga0081455_10000140 | 3300005937 | Bacteria | 84977 |
| 165 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 166 | Ga0075365_10037994 | 3300006038 | Bacteria | 3127 |
| 167 | Ga0075364_10020442 | 3300006051 | Bacteria | 4164 |
| 168 | Ga0075364_10029466 | 3300006051 | Bacteria | 3520 |
| 169 | Ga0097621_100016081 | 3300006237 | Bacteria | 5648 |
| 170 | Ga0097621_100158575 | 3300006237 | Bacteria | 1944 |
| 171 | Ga0097621_100202203 | 3300006237 | Bacteria | 1725 |
| 172 | Ga0068871_100001261 | 3300006358 | Bacteria | 16923 |
| 173 | Ga0068871_100015467 | 3300006358 | Bacteria | 5712 |
| 174 | Ga0075428_100004861 | 3300006844 | Bacteria | 14907 |
| 175 | Ga0075428_100008798 | 3300006844 | Bacteria | 11205 |
| 176 | Ga0075428_100026092 | 3300006844 | Bacteria | 6470 |
| 177 | Ga0075428_100039752 | 3300006844 | Bacteria | 5177 |
| 178 | Ga0075430_100007160 | 3300006846 | Bacteria | 9414 |
| 179 | Ga0075430_100021881 | 3300006846 | Bacteria | 5433 |
| 180 | Ga0075430_100047171 | 3300006846 | Bacteria | 3637 |
| 181 | Ga0075431_100000026 | 3300006847 | Bacteria | 75269 |
| 182 | Ga0075431_100008443 | 3300006847 | Bacteria | 10314 |
| 183 | Ga0075431_100011646 | 3300006847 | Bacteria | 8872 |
| 184 | Ga0075429_100025071 | 3300006880 | Bacteria | 5177 |
| 185 | Ga0075429_100033160 | 3300006880 | Bacteria | 4487 |
| 186 | Ga0075429_100048276 | 3300006880 | Bacteria | 3702 |
| 187 | Ga0075429_100079751 | 3300006880 | Bacteria | 2853 |
| 188 | Ga0068865_100008065 | 3300006881 | Bacteria | 6502 |
| 189 | Ga0068865_100013404 | 3300006881 | Bacteria | 5179 |
| 190 | Ga0097620_100000226 | 3300006931 | Bacteria | 55324 |
| 191 | Ga0097620_100000716 | 3300006931 | Bacteria | 33426 |
| 192 | Ga0097620_100006171 | 3300006931 | Bacteria | 12178 |
| 193 | Ga0097620_100020160 | 3300006931 | Bacteria | 6695 |
| 194 | Ga0097620_100041967 | 3300006931 | Bacteria | 4595 |
| 195 | Ga0097620_100137347 | 3300006931 | Bacteria | 2518 |
| 196 | Ga0079104_1007220 | 3300006946 | Bacteria | 4066 |
| 197 | Ga0099795_10000003 | 3300007788 | Bacteria | 110661 |
| 198 | Ga0099795_10000125 | 3300007788 | Bacteria | 12966 |
| 199 | Ga0105251_10004848 | 3300009011 | Bacteria | 8983 |
| 200 | Ga0105251_10006989 | 3300009011 | Bacteria | 7050 |
| 201 | Ga0105251_10007021 | 3300009011 | Bacteria | 7026 |
| 202 | Ga0105251_10011245 | 3300009011 | Bacteria | 5123 |
| 203 | Ga0105244_10001876 | 3300009036 | Bacteria | 16339 |
| 204 | Ga0105244_10023140 | 3300009036 | Bacteria | 3411 |
| 205 | Ga0105250_10000262 | 3300009092 | Bacteria | 42910 |
| 206 | Ga0105250_10001432 | 3300009092 | Bacteria | 12885 |
| 207 | Ga0105250_10006801 | 3300009092 | Bacteria | 4965 |
| 208 | Ga0105240_10019300 | 3300009093 | Bacteria | 9111 |
| 209 | Ga0105240_10032759 | 3300009093 | Bacteria | 6724 |
| 210 | Ga0105240_10062207 | 3300009093 | Bacteria | 4648 |
| 211 | Ga0105240_10087339 | 3300009093 | Bacteria | 3819 |
| 212 | Ga0105240_10161439 | 3300009093 | Bacteria | 2661 |
| 213 | Ga0105240_10444193 | 3300009093 | Bacteria | 1453 |
| 214 | Ga0111539_10000759 | 3300009094 | Bacteria | 41999 |
| 215 | Ga0111539_10011229 | 3300009094 | Bacteria | 11254 |
| 216 | Ga0105245_10003333 | 3300009098 | Bacteria | 14415 |
| 217 | Ga0105245_10015924 | 3300009098 | Bacteria | 6552 |
| 218 | Ga0105245_10239744 | 3300009098 | Bacteria | 1757 |
| 219 | Ga0105247_10000126 | 3300009101 | Bacteria | 74123 |
| 220 | Ga0105247_10001692 | 3300009101 | Bacteria | 15563 |
| 221 | Ga0105247_10014469 | 3300009101 | Bacteria | 4732 |
| 222 | Ga0105247_10029529 | 3300009101 | Bacteria | 3323 |
| 223 | Ga0105247_10035834 | 3300009101 | Bacteria | 3025 |
| 224 | Ga0114129_10000158 | 3300009147 | Bacteria | 72596 |
| 225 | Ga0105243_10042808 | 3300009148 | Bacteria | 3547 |
| 226 | Ga0105242_10084907 | 3300009176 | Bacteria | 2654 |
| 227 | Ga0105242_10189194 | 3300009176 | Bacteria | 1821 |
| 228 | Ga0105248_10004270 | 3300009177 | Bacteria | 15813 |
| 229 | Ga0105248_10010407 | 3300009177 | Bacteria | 10244 |
| 230 | Ga0105248_10034626 | 3300009177 | Bacteria | 5649 |
| 231 | Ga0105248_10035560 | 3300009177 | Bacteria | 5573 |
| 232 | Ga0105248_10059402 | 3300009177 | Bacteria | 4295 |
| 233 | Ga0105248_10146606 | 3300009177 | Bacteria | 2663 |
| 234 | Ga0105238_10016023 | 3300009551 | Bacteria | 7581 |
| 235 | Ga0105238_10061080 | 3300009551 | Bacteria | 3772 |
| 236 | Ga0105238_10133579 | 3300009551 | Bacteria | 2459 |
| 237 | Ga0105238_10139338 | 3300009551 | Bacteria | 2403 |
| 238 | Ga0105238_10228572 | 3300009551 | Bacteria | 1837 |
| 239 | Ga0105249_10032674 | 3300009553 | Bacteria | 4708 |
| 240 | Ga0105249_10044940 | 3300009553 | Bacteria | 4017 |
| 241 | Ga0105249_10055667 | 3300009553 | Bacteria | 3619 |
| 242 | Ga0099796_10000077 | 3300010159 | Bacteria | 16717 |
| 243 | Ga0105239_10095426 | 3300010375 | Bacteria | 3285 |
| 244 | Ga0105239_10182658 | 3300010375 | Bacteria | 2347 |
| 245 | Ga0105239_10205732 | 3300010375 | Bacteria | 2206 |
| 246 | Ga0105246_10153103 | 3300011119 | Bacteria | 1748 |
| 247 | Ga0157373_10079939 | 3300013100 | Bacteria | 2306 |
| 248 | Ga0157371_10000327 | 3300013102 | Bacteria | 61256 |
| 249 | Ga0157371_10014898 | 3300013102 | Bacteria | 5852 |
| 250 | Ga0157370_10002542 | 3300013104 | Bacteria | 21916 |
| 251 | Ga0157369_10036624 | 3300013105 | Bacteria | 5374 |
| 252 | Ga0157369_10146846 | 3300013105 | Bacteria | 2493 |
| 253 | Ga0157369_10165560 | 3300013105 | Bacteria | 2332 |
| 254 | Ga0157374_10003622 | 3300013296 | Bacteria | 13001 |
| 255 | Ga0157378_10101820 | 3300013297 | Bacteria | 2623 |
| 256 | Ga0163162_10000193 | 3300013306 | Bacteria | 56063 |
| 257 | Ga0163162_10022079 | 3300013306 | Bacteria | 6271 |
| 258 | Ga0163162_10051398 | 3300013306 | Bacteria | 4136 |
| 259 | Ga0163162_10060598 | 3300013306 | Bacteria | 3820 |
| 260 | Ga0163162_10331417 | 3300013306 | Bacteria | 1655 |
| 261 | Ga0157372_10015969 | 3300013307 | Bacteria | 8054 |
| 262 | Ga0157372_10034994 | 3300013307 | Bacteria | 5527 |
| 263 | Ga0157372_10064539 | 3300013307 | Bacteria | 4108 |
| 264 | Ga0157375_10001552 | 3300013308 | Bacteria | 19770 |
| 265 | Ga0157375_10004434 | 3300013308 | Bacteria | 12192 |
| 266 | Ga0157375_10105249 | 3300013308 | Bacteria | 2911 |
| 267 | Ga0163163_10000199 | 3300014325 | Bacteria | 62045 |
| 268 | Ga0163163_10001793 | 3300014325 | Bacteria | 18091 |
| 269 | Ga0163163_10002680 | 3300014325 | Bacteria | 15055 |
| 270 | Ga0163163_10056400 | 3300014325 | Bacteria | 3883 |
| 271 | Ga0163163_10111894 | 3300014325 | Bacteria | 2759 |
| 272 | Ga0157380_10000366 | 3300014326 | Bacteria | 27213 |
| 273 | Ga0157380_10005725 | 3300014326 | Bacteria | 8697 |
| 274 | Ga0157380_10225915 | 3300014326 | Bacteria | 1678 |
| 275 | Ga0157380_10235258 | 3300014326 | Bacteria | 1648 |
| 276 | Ga0182008_10055257 | 3300014497 | Bacteria | 1964 |
| 277 | Ga0157377_10019179 | 3300014745 | Bacteria | 3570 |
| 278 | Ga0157379_10000004 | 3300014968 | Bacteria | 173351 |
| 279 | Ga0157379_10007489 | 3300014968 | Bacteria | 9449 |
| 280 | Ga0157379_10036011 | 3300014968 | Bacteria | 4413 |
| 281 | Ga0157379_10049293 | 3300014968 | Bacteria | 3760 |
| 282 | Ga0157379_10259622 | 3300014968 | Bacteria | 1578 |
| 283 | Ga0157376_10034668 | 3300014969 | Bacteria | 4077 |
| 284 | Ga0157376_10098559 | 3300014969 | Bacteria | 2548 |
| 285 | Ga0182007_10001346 | 3300015262 | Bacteria | 13262 |
| 286 | Ga0182005_1002932 | 3300015265 | Bacteria | 5921 |
| 287 | Ga0163161_10000938 | 3300017792 | Bacteria | 22429 |
| 288 | Ga0163161_10001227 | 3300017792 | Bacteria | 19219 |
| 289 | Ga0163161_10003635 | 3300017792 | Bacteria | 10818 |
| 290 | Ga0163161_10041524 | 3300017792 | Bacteria | 3305 |
| 291 | Ga0206353_10645750 | 3300020082 | Bacteria | 3303 |
| 292 | Ga0209760_100048 | 3300025207 | Bacteria | 107458 |
| 293 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 294 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 295 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 296 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 297 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 298 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 299 | Ga0209437_100046 | 3300025233 | Bacteria | 405293 |
| 300 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 301 | Ga0207425_1000040 | 3300025245 | Bacteria | 218121 |
| 302 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 303 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 304 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 305 | Ga0209233_1004556 | 3300025261 | Bacteria | 4699 |
| 306 | Ga0209565_1000037 | 3300025263 | Bacteria | 289371 |
| 307 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 308 | Ga0209673_1000032 | 3300025273 | Bacteria | 339956 |
| 309 | Ga0209675_1000020 | 3300025291 | Bacteria | 335854 |
| 310 | Ga0209675_1006527 | 3300025291 | Bacteria | 4657 |
| 311 | Ga0209676_1000775 | 3300025292 | Bacteria | 42707 |
| 312 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 313 | Ga0209564_1000210 | 3300025295 | Bacteria | 133323 |
| 314 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 315 | Ga0209256_1001437 | 3300025299 | Bacteria | 24667 |
| 316 | Ga0209256_1001987 | 3300025299 | Bacteria | 18387 |
| 317 | Ga0209257_1000734 | 3300025304 | Bacteria | 49703 |
| 318 | Ga0207656_10030174 | 3300025321 | Bacteria | 2238 |
| 319 | Ga0207696_1000263 | 3300025711 | Bacteria | 67526 |
| 320 | Ga0207696_1000375 | 3300025711 | Bacteria | 43991 |
| 321 | Ga0207696_1000973 | 3300025711 | Bacteria | 17405 |
| 322 | Ga0207696_1004745 | 3300025711 | Bacteria | 5787 |
| 323 | Ga0207655_1000126 | 3300025728 | Bacteria | 151903 |
| 324 | Ga0207655_1002995 | 3300025728 | Bacteria | 12938 |
| 325 | Ga0207713_1003022 | 3300025735 | Bacteria | 11737 |
| 326 | Ga0207713_1021063 | 3300025735 | Bacteria | 3135 |
| 327 | Ga0207713_1021500 | 3300025735 | Bacteria | 3090 |
| 328 | Ga0207682_10023345 | 3300025893 | Bacteria | 2442 |
| 329 | Ga0207710_10005014 | 3300025900 | Bacteria | 5735 |
| 330 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 331 | Ga0207680_10001344 | 3300025903 | Bacteria | 11635 |
| 332 | Ga0207680_10004644 | 3300025903 | Bacteria | 6522 |
| 333 | Ga0207680_10020012 | 3300025903 | Bacteria | 3591 |
| 334 | Ga0207647_10035047 | 3300025904 | Bacteria | 3200 |
| 335 | Ga0207647_10044695 | 3300025904 | Bacteria | 2766 |
| 336 | Ga0207645_10001117 | 3300025907 | Bacteria | 22196 |
| 337 | Ga0207643_10025347 | 3300025908 | Bacteria | 3277 |
| 338 | Ga0207707_10000592 | 3300025912 | Bacteria | 36551 |
| 339 | Ga0207707_10002087 | 3300025912 | Bacteria | 18085 |
| 340 | Ga0207707_10023465 | 3300025912 | Bacteria | 5396 |
| 341 | Ga0207707_10030460 | 3300025912 | Bacteria | 4720 |
| 342 | Ga0207695_10022323 | 3300025913 | Bacteria | 7189 |
| 343 | Ga0207695_10026839 | 3300025913 | Bacteria | 6422 |
| 344 | Ga0207695_10037128 | 3300025913 | Bacteria | 5258 |
| 345 | Ga0207695_10092601 | 3300025913 | Bacteria | 3033 |
| 346 | Ga0207663_10055474 | 3300025916 | Bacteria | 2487 |
| 347 | Ga0207660_10028245 | 3300025917 | Bacteria | 3836 |
| 348 | Ga0207660_10041342 | 3300025917 | Bacteria | 3230 |
| 349 | Ga0207662_10025886 | 3300025918 | Bacteria | 3382 |
| 350 | Ga0207657_10020522 | 3300025919 | Bacteria | 6241 |
| 351 | Ga0207649_10037129 | 3300025920 | Bacteria | 2940 |
| 352 | Ga0207652_10005312 | 3300025921 | Bacteria | 10449 |
| 353 | Ga0207652_10009857 | 3300025921 | Bacteria | 7686 |
| 354 | Ga0207652_10043119 | 3300025921 | Bacteria | 3842 |
| 355 | Ga0207652_10046115 | 3300025921 | Bacteria | 3718 |
| 356 | Ga0207652_10066984 | 3300025921 | Bacteria | 3113 |
| 357 | Ga0207652_10102565 | 3300025921 | Bacteria | 2529 |
| 358 | Ga0207681_10010785 | 3300025923 | Bacteria | 5610 |
| 359 | Ga0207681_10074576 | 3300025923 | Bacteria | 2377 |
| 360 | Ga0207681_10076413 | 3300025923 | Bacteria | 2352 |
| 361 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 362 | Ga0207650_10015067 | 3300025925 | Bacteria | 5378 |
| 363 | Ga0207659_10096986 | 3300025926 | Bacteria | 2214 |
| 364 | Ga0207664_10003922 | 3300025929 | Bacteria | 9999 |
| 365 | Ga0207664_10112372 | 3300025929 | Bacteria | 2267 |
| 366 | Ga0207644_10000106 | 3300025931 | Bacteria | 61480 |
| 367 | Ga0207644_10010630 | 3300025931 | Bacteria | 6069 |
| 368 | Ga0207690_10001878 | 3300025932 | Bacteria | 12887 |
| 369 | Ga0207690_10005861 | 3300025932 | Bacteria | 7272 |
| 370 | Ga0207690_10019430 | 3300025932 | Bacteria | 4184 |
| 371 | Ga0207706_10010664 | 3300025933 | Bacteria | 8393 |
| 372 | Ga0207706_10013421 | 3300025933 | Bacteria | 7448 |
| 373 | Ga0207670_10009765 | 3300025936 | Bacteria | 5492 |
| 374 | Ga0207670_10014828 | 3300025936 | Bacteria | 4639 |
| 375 | Ga0207669_10060336 | 3300025937 | Bacteria | 2325 |
| 376 | Ga0207691_10004950 | 3300025940 | Bacteria | 12848 |
| 377 | Ga0207691_10073580 | 3300025940 | Bacteria | 3082 |
| 378 | Ga0207691_10092194 | 3300025940 | Bacteria | 2713 |
| 379 | Ga0207691_10257297 | 3300025940 | Bacteria | 1505 |
| 380 | Ga0207711_10000789 | 3300025941 | Bacteria | 31134 |
| 381 | Ga0207711_10005914 | 3300025941 | Bacteria | 10334 |
| 382 | Ga0207711_10030506 | 3300025941 | Bacteria | 4547 |
| 383 | Ga0207689_10025150 | 3300025942 | Bacteria | 4991 |
| 384 | Ga0207667_10043209 | 3300025949 | Bacteria | 4784 |
| 385 | Ga0207667_10076477 | 3300025949 | Bacteria | 3474 |
| 386 | Ga0207667_10116416 | 3300025949 | Bacteria | 2754 |
| 387 | Ga0207667_10131465 | 3300025949 | Bacteria | 2578 |
| 388 | Ga0207667_10135135 | 3300025949 | Bacteria | 2539 |
| 389 | Ga0207712_10045895 | 3300025961 | Bacteria | 3027 |
| 390 | Ga0207668_10080770 | 3300025972 | Bacteria | 2356 |
| 391 | Ga0207668_10174209 | 3300025972 | Bacteria | 1690 |
| 392 | Ga0207640_10059011 | 3300025981 | Bacteria | 2530 |
| 393 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 394 | Ga0207658_10001415 | 3300025986 | Bacteria | 18704 |
| 395 | Ga0207658_10009396 | 3300025986 | Bacteria | 6632 |
| 396 | Ga0207677_10100724 | 3300026023 | Bacteria | 2125 |
| 397 | Ga0207703_10000299 | 3300026035 | Bacteria | 54610 |
| 398 | Ga0207703_10000362 | 3300026035 | Bacteria | 48617 |
| 399 | Ga0207703_10002710 | 3300026035 | Bacteria | 15168 |
| 400 | Ga0207703_10032898 | 3300026035 | Bacteria | 4107 |
| 401 | Ga0207703_10033351 | 3300026035 | Bacteria | 4081 |
| 402 | Ga0207703_10073481 | 3300026035 | Bacteria | 2829 |
| 403 | Ga0207708_10039253 | 3300026075 | Bacteria | 3607 |
| 404 | Ga0207708_10045681 | 3300026075 | Bacteria | 3337 |
| 405 | Ga0207708_10046446 | 3300026075 | Bacteria | 3307 |
| 406 | Ga0207708_10077474 | 3300026075 | Bacteria | 2552 |
| 407 | Ga0207641_10000189 | 3300026088 | Bacteria | 86363 |
| 408 | Ga0207641_10010019 | 3300026088 | Bacteria | 7795 |
| 409 | Ga0207641_10057353 | 3300026088 | Bacteria | 3311 |
| 410 | Ga0207641_10057354 | 3300026088 | Bacteria | 3311 |
| 411 | Ga0207641_10069156 | 3300026088 | Bacteria | 3030 |
| 412 | Ga0207648_10001386 | 3300026089 | Bacteria | 26692 |
| 413 | Ga0207648_10031464 | 3300026089 | Bacteria | 4692 |
| 414 | Ga0207648_10042699 | 3300026089 | Bacteria | 3980 |
| 415 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 416 | Ga0207674_10075635 | 3300026116 | Bacteria | 3377 |
| 417 | Ga0207675_100002419 | 3300026118 | Bacteria | 18498 |
| 418 | Ga0207675_100004826 | 3300026118 | Bacteria | 12983 |
| 419 | Ga0207675_100005127 | 3300026118 | Bacteria | 12612 |
| 420 | Ga0207675_100009736 | 3300026118 | Bacteria | 8998 |
| 421 | Ga0207675_100022027 | 3300026118 | Bacteria | 5931 |
| 422 | Ga0207675_100045880 | 3300026118 | Bacteria | 4082 |
| 423 | Ga0207675_100131037 | 3300026118 | Bacteria | 2378 |
| 424 | Ga0207675_100149794 | 3300026118 | Bacteria | 2220 |
| 425 | Ga0207698_10095730 | 3300026142 | Bacteria | 2445 |
| 426 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 427 | Ga0209371_1000731 | 3300027312 | Bacteria | 27606 |
| 428 | Ga0209371_1000832 | 3300027312 | Bacteria | 25391 |
| 429 | Ga0209179_1000043 | 3300027512 | Bacteria | 25706 |
| 430 | Ga0209179_1000750 | 3300027512 | Bacteria | 3519 |
| 431 | Ga0209970_1002398 | 3300027614 | Bacteria | 3192 |
| 432 | Ga0209983_1000316 | 3300027665 | Bacteria | 10140 |
| 433 | Ga0209971_1012668 | 3300027682 | Bacteria | 1996 |
| 434 | Ga0209998_10001850 | 3300027717 | Bacteria | 5015 |
| 435 | Ga0209974_10000905 | 3300027876 | Bacteria | 10327 |
| 436 | Ga0207428_10011931 | 3300027907 | Bacteria | 7650 |
| 437 | Ga0207428_10026550 | 3300027907 | Bacteria | 4833 |
| 438 | Ga0268266_10000604 | 3300028379 | Bacteria | 49032 |
| 439 | Ga0268266_10000886 | 3300028379 | Bacteria | 38796 |
| 440 | Ga0268266_10014073 | 3300028379 | Bacteria | 6886 |
| 441 | Ga0268266_10022685 | 3300028379 | Bacteria | 5344 |
| 442 | Ga0268266_10085491 | 3300028379 | Bacteria | 2756 |
| 443 | Ga0268265_10000383 | 3300028380 | Bacteria | 47354 |
| 444 | Ga0268265_10000794 | 3300028380 | Bacteria | 30047 |
| 445 | Ga0268265_10009074 | 3300028380 | Bacteria | 6725 |
| 446 | Ga0268265_10026857 | 3300028380 | Bacteria | 4100 |
| 447 | Ga0268265_10041277 | 3300028380 | Bacteria | 3413 |
| 448 | Ga0268265_10101110 | 3300028380 | Bacteria | 2329 |
| 449 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 450 | Ga0268264_10000164 | 3300028381 | Bacteria | 147861 |
| 451 | Ga0268264_10020390 | 3300028381 | Bacteria | 5418 |
| 452 | Ga0268264_10032256 | 3300028381 | Bacteria | 4297 |
| 453 | Ga0268264_10039050 | 3300028381 | Bacteria | 3921 |
| 454 | Ga0268264_10081464 | 3300028381 | Bacteria | 2766 |
| 455 | Ga0265326_10003972 | 3300028558 | Bacteria | 4797 |
| 456 | Ga0265319_1038052 | 3300028563 | Bacteria | 1637 |
| 457 | Ga0265334_10000005 | 3300028573 | Bacteria | 242590 |
| 458 | Ga0265334_10001041 | 3300028573 | Bacteria | 13685 |
| 459 | Ga0265318_10000626 | 3300028577 | Bacteria | 24443 |
| 460 | Ga0265338_10006155 | 3300028800 | Bacteria | 15400 |
| 461 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 462 | Ga0268256_1000815 | 3300030500 | Bacteria | 22341 |
| 463 | Ga0307511_10003176 | 3300030521 | Bacteria | 16908 |
| 464 | Ga0265770_1000173 | 3300030878 | Bacteria | 8387 |
| 465 | Ga0265760_10002495 | 3300031090 | Bacteria | 5370 |
| 466 | Ga0265332_10014061 | 3300031238 | Bacteria | 3541 |
| 467 | Ga0265325_10034982 | 3300031241 | Bacteria | 2670 |
| 468 | Ga0265340_10032357 | 3300031247 | Bacteria | 2611 |
| 469 | Ga0265331_10002116 | 3300031250 | Bacteria | 13686 |
| 470 | Ga0265327_10000238 | 3300031251 | Bacteria | 109943 |
| 471 | Ga0307513_10001609 | 3300031456 | Bacteria | 32399 |
| 472 | Ga0307513_10068924 | 3300031456 | Bacteria | 3703 |
| 473 | Ga0307509_10000002 | 3300031507 | Bacteria | 607551 |
| 474 | Ga0307509_10001575 | 3300031507 | Bacteria | 38357 |
| 475 | Ga0307509_10087611 | 3300031507 | Bacteria | 3198 |
| 476 | Ga0307408_100014019 | 3300031548 | Bacteria | 5325 |
| 477 | Ga0265313_10000014 | 3300031595 | Bacteria | 156295 |
| 478 | Ga0265313_10043611 | 3300031595 | Bacteria | 2195 |
| 479 | Ga0307508_10193376 | 3300031616 | Bacteria | 1636 |
| 480 | Ga0316575_10013613 | 3300031665 | Bacteria | 3041 |
| 481 | Ga0265314_10039898 | 3300031711 | Bacteria | 3376 |
| 482 | Ga0316576_10028779 | 3300031727 | Bacteria | 3921 |
| 483 | Ga0316576_10046535 | 3300031727 | Bacteria | 3141 |
| 484 | Ga0316576_10050467 | 3300031727 | Bacteria | 3026 |
| 485 | Ga0316578_10005443 | 3300031728 | Bacteria | 6175 |
| 486 | Ga0316578_10107087 | 3300031728 | Bacteria | 1678 |
| 487 | Ga0307516_10000012 | 3300031730 | Bacteria | 224120 |
| 488 | Ga0307405_10080790 | 3300031731 | Bacteria | 2123 |
| 489 | Ga0307413_10038397 | 3300031824 | Bacteria | 2775 |
| 490 | Ga0307413_10047796 | 3300031824 | Bacteria | 2554 |
| 491 | Ga0307413_10112501 | 3300031824 | Bacteria | 1825 |
| 492 | Ga0307409_100030309 | 3300031995 | Bacteria | 3884 |
| 493 | Ga0307416_100056606 | 3300032002 | Bacteria | 3166 |
| 494 | Ga0307411_10011008 | 3300032005 | Bacteria | 4856 |
| 495 | Ga0307415_100103083 | 3300032126 | Bacteria | 2098 |
| 496 | Ga0307415_100148694 | 3300032126 | Bacteria | 1800 |
| 497 | Ga0316583_10001802 | 3300032133 | Bacteria | 7282 |
| 498 | Ga0316593_10008778 | 3300032168 | Bacteria | 2833 |
| 499 | Ga0316593_10022910 | 3300032168 | Bacteria | 1967 |
| 500 | Ga0307510_10000007 | 3300033180 | Bacteria | 558582 |
| 501 | Ga0307510_10000059 | 3300033180 | Bacteria | 84839 |
| 502 | Ga0307510_10012240 | 3300033180 | Bacteria | 10168 |
| 503 | Ga0373955_0009259 | 3300035172 | Bacteria | 4611 |
| 504 | Ga0316574_0000894 | 3300035398 | Bacteria | 13197 |
| 505 | Ga0316574_0045625 | 3300035398 | Bacteria | 2715 |
| 506 | Ga0316574_0110962 | 3300035398 | Bacteria | 1758 |
| 507 | Ga0316574_0129573 | 3300035398 | Bacteria | 1623 |
| 508 | Ga0316574_0139387 | 3300035398 | Bacteria | 1562 |
| 509 | Ga0373927_0000001 | 3300035695 | Bacteria | 1082160 |
| 510 | Ga0373927_0037991 | 3300035695 | Bacteria | 3128 |
| 511 | Ga0373933_0023517 | 3300035724 | Bacteria | 3521 |
| 512 | Ga0373937_0021839 | 3300036401 | Bacteria | 5746 |
| 513 | Ga0316584_0016579 | 3300036712 | Bacteria | 5283 |
| 514 | Ga0316584_0020393 | 3300036712 | Bacteria | 4806 |
| 515 | Ga0316584_0091986 | 3300036712 | Bacteria | 2271 |
| 516 | Ga0373925_0163629 | 3300037068 | Bacteria | 1754 |
| 517 | Ga0395898_0001583 | 3300037466 | Bacteria | 31093 |
| 518 | Ga0395901_0007016 | 3300038443 | Bacteria | 11386 |
| 519 | Ga0436365_0412003 | 3300039437 | Bacteria | 4505 |
| 520 | Ga0436360_0322345 | 3300039438 | Bacteria | 2053 |
| 521 | Ga0436363_1095124 | 3300039450 | Bacteria | 3227 |
| 522 | Ga0436362_1127240 | 3300039453 | Bacteria | 6138 |
| 523 | Ga0439438_000002 | 3300041405 | Bacteria | 618223 |
| 524 | Ga0439438_000601 | 3300041405 | Bacteria | 16246 |
| 525 | Ga0439447_001811 | 3300041407 | Bacteria | 7831 |
| 526 | Ga0439466_0000001 | 3300041411 | Bacteria | 647258 |
| 527 | Ga0439465_0002785 | 3300041413 | Bacteria | 5727 |
| 528 | Ga0451791_1105936 | 3300041451 | Bacteria | 2326 |
| 529 | Ga0451807_0058820 | 3300041486 | Bacteria | 3663 |
| 530 | Ga0439432_000295 | 3300042006 | Bacteria | 17930 |
| 531 | Ga0450908_000113 | 3300042184 | Bacteria | 16546 |
| 532 | Ga0451577_0027485 | 3300042876 | Bacteria | 5150 |
| 533 | Ga0451577_0145693 | 3300042876 | Bacteria | 2129 |
| 534 | Ga0451577_0161308 | 3300042876 | Bacteria | 2019 |
| 535 | Ga0466986_0077623 | 3300044650 | Bacteria | 2301 |
| 536 | Ga0466969_0001735 | 3300044656 | Bacteria | 11620 |
| 537 | Ga0466972_0000312 | 3300044658 | Bacteria | 28150 |
| 538 | Ga0466982_0000029 | 3300044672 | Bacteria | 60348 |
| 539 | Ga0453683_0000382 | 3300044673 | Bacteria | 52943 |
| 540 | Ga0453683_0008560 | 3300044673 | Bacteria | 6865 |
| 541 | Ga0466966_0008586 | 3300044684 | Bacteria | 6762 |
| 542 | Ga0466966_0023085 | 3300044684 | Bacteria | 4075 |
| 543 | Ga0466961_0005334 | 3300044693 | Bacteria | 8088 |
| 544 | Ga0466961_0008397 | 3300044693 | Bacteria | 6578 |
| 545 | Ga0453684_0086274 | 3300044712 | Bacteria | 3896 |
| 546 | Ga0453684_0119527 | 3300044712 | Bacteria | 3184 |
| 547 | Ga0466970_0000701 | 3300044765 | Bacteria | 16371 |
| 548 | Ga0466957_0054394 | 3300044842 | Bacteria | 2443 |
| 549 | Ga0466959_0002124 | 3300045049 | Bacteria | 12544 |
| 550 | Ga0466959_0014509 | 3300045049 | Bacteria | 5729 |
| 551 | Ga0466959_0050326 | 3300045049 | Bacteria | 3059 |
| 552 | Ga0466959_0124395 | 3300045049 | Bacteria | 1831 |
| 553 | Ga0495617_000122 | 3300046452 | Bacteria | 51915 |
| 554 | Ga0495617_000218 | 3300046452 | Bacteria | 35037 |
| 555 | Ga0495590_0009443 | 3300046457 | Bacteria | 3701 |
| 556 | Ga0495638_0000319 | 3300046460 | Bacteria | 61852 |
| 557 | Ga0495638_0000786 | 3300046460 | Bacteria | 33467 |
| 558 | Ga0495638_0017412 | 3300046460 | Bacteria | 4790 |
| 559 | Ga0495638_0022865 | 3300046460 | Bacteria | 4098 |
| 560 | Ga0495638_0083949 | 3300046460 | Bacteria | 1928 |
| 561 | Ga0495650_0000004 | 3300046471 | Bacteria | 779487 |
| 562 | Ga0495650_0000667 | 3300046471 | Bacteria | 44706 |
| 563 | Ga0495584_0001870 | 3300046491 | Bacteria | 12175 |
| 564 | Ga0495585_0000180 | 3300046492 | Bacteria | 67101 |
| 565 | Ga0495585_0011933 | 3300046492 | Bacteria | 5131 |
| 566 | Ga0495596_0020607 | 3300046500 | Bacteria | 2698 |
| 567 | Ga0495607_0000008 | 3300046501 | Bacteria | 265274 |
| 568 | Ga0495583_0000833 | 3300046506 | Bacteria | 37749 |
| 569 | Ga0495606_0001812 | 3300046507 | Bacteria | 27155 |
| 570 | Ga0495606_0028991 | 3300046507 | Bacteria | 3894 |
| 571 | Ga0495606_0058958 | 3300046507 | Bacteria | 2464 |
| 572 | Ga0495616_0000003 | 3300046513 | Bacteria | 290178 |
| 573 | Ga0495616_0002551 | 3300046513 | Bacteria | 12014 |
| 574 | Ga0495620_0000182 | 3300046515 | Bacteria | 48877 |
| 575 | Ga0495620_0000216 | 3300046515 | Bacteria | 43506 |
| 576 | Ga0495631_0000061 | 3300046518 | Bacteria | 67503 |
| 577 | Ga0495631_0000329 | 3300046518 | Bacteria | 32553 |
| 578 | Ga0495643_0073189 | 3300046522 | Bacteria | 1796 |
| 579 | Ga0495648_0000427 | 3300046524 | Bacteria | 46150 |
| 580 | Ga0495663_0000227 | 3300046525 | Bacteria | 22449 |
| 581 | Ga0495663_0003609 | 3300046525 | Bacteria | 4445 |
| 582 | Ga0495654_0000009 | 3300046530 | Bacteria | 381872 |
| 583 | Ga0495654_0001896 | 3300046530 | Bacteria | 13905 |
| 584 | Ga0495640_0124556 | 3300046533 | Bacteria | 1672 |
| 585 | Ga0495611_0000023 | 3300046648 | Bacteria | 120553 |
| 586 | Ga0495611_0002701 | 3300046648 | Bacteria | 7998 |
| 587 | Ga0495625_0002254 | 3300046660 | Bacteria | 21206 |
| 588 | Ga0495625_0004093 | 3300046660 | Bacteria | 13924 |
| 589 | Ga0495625_0017779 | 3300046660 | Bacteria | 5559 |
| 590 | Ga0495661_0000471 | 3300046665 | Bacteria | 42549 |
| 591 | Ga0495649_0003784 | 3300046694 | Bacteria | 10035 |
| 592 | Ga0495660_0000013 | 3300046810 | Bacteria | 350283 |
| 593 | Ga0495674_0128446 | 3300047319 | Bacteria | 2137 |
| 594 | Ga0495672_0000015 | 3300047320 | Bacteria | 502855 |
| 595 | Ga0495683_0005979 | 3300047323 | Bacteria | 6681 |
| 596 | Ga0495679_007808 | 3300047446 | Bacteria | 4414 |
| 597 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 598 | Ga0495673_0000101 | 3300047469 | Bacteria | 173409 |
| 599 | Ga0495681_0030972 | 3300047470 | Bacteria | 2716 |
| 600 | Ga0495681_0033177 | 3300047470 | Bacteria | 2590 |
| 601 | Ga0495686_0000608 | 3300047472 | Bacteria | 49564 |
| 602 | Ga0495686_0019088 | 3300047472 | Bacteria | 4585 |
| 603 | Ga0495602_0112760 | 3300048088 | Bacteria | 2206 |
| 604 | Ga0496104_0002107 | 3300048907 | Bacteria | 17270 |
| 605 | Ga0496104_0002393 | 3300048907 | Bacteria | 16157 |
| 606 | Ga0496104_0083301 | 3300048907 | Bacteria | 3050 |
| 607 | Ga0496104_0198496 | 3300048907 | Bacteria | 1918 |
| 608 | Ga0496105_0004353 | 3300048908 | Bacteria | 10663 |
| 609 | Ga0496105_0108068 | 3300048908 | Bacteria | 2297 |
| 610 | Ga0496106_0011969 | 3300048909 | Bacteria | 6404 |
| 611 | Ga0496106_0097417 | 3300048909 | Bacteria | 2277 |
| 612 | Ga0496108_0037439 | 3300048911 | Bacteria | 4041 |
| 613 | Ga0496108_0202737 | 3300048911 | Bacteria | 1721 |
| 614 | Ga0496109_0023839 | 3300048912 | Bacteria | 5432 |
| 615 | Ga0496109_0028718 | 3300048912 | Bacteria | 4979 |
| 616 | Ga0496110_0009720 | 3300048913 | Bacteria | 7789 |
| 617 | Ga0496111_0013076 | 3300048914 | Bacteria | 5637 |
| 618 | Ga0496112_0000297 | 3300048915 | Bacteria | 32082 |
| 619 | Ga0496112_0027540 | 3300048915 | Bacteria | 5480 |
| 620 | Ga0496114_0001110 | 3300048917 | Bacteria | 20326 |
| 621 | Ga0496115_0000092 | 3300048918 | Bacteria | 83381 |
| 622 | Ga0496115_0079176 | 3300048918 | Bacteria | 2674 |
| 623 | Ga0496115_0113082 | 3300048918 | Bacteria | 2231 |
| 624 | Ga0496115_0136123 | 3300048918 | Bacteria | 2025 |
| 625 | Ga0496116_0000016 | 3300048919 | Bacteria | 555146 |
| 626 | Ga0496116_0010613 | 3300048919 | Bacteria | 7703 |
| 627 | Ga0496117_0000038 | 3300048920 | Bacteria | 322781 |
| 628 | Ga0496117_0000278 | 3300048920 | Bacteria | 95496 |
| 629 | Ga0496117_0002395 | 3300048920 | Bacteria | 23846 |
| 630 | Ga0496117_0002664 | 3300048920 | Bacteria | 22123 |
| 631 | Ga0496117_0016308 | 3300048920 | Bacteria | 6276 |
| 632 | Ga0496117_0047295 | 3300048920 | Bacteria | 3086 |
| 633 | Ga0496117_0056705 | 3300048920 | Bacteria | 2726 |
| 634 | Ga0496117_0056759 | 3300048920 | Bacteria | 2724 |
| 635 | Ga0496118_0000019 | 3300048921 | Bacteria | 489649 |
| 636 | Ga0496118_0000837 | 3300048921 | Bacteria | 48931 |
| 637 | Ga0496118_0001003 | 3300048921 | Bacteria | 43972 |
| 638 | Ga0496118_0002267 | 3300048921 | Bacteria | 26301 |
| 639 | Ga0496118_0002536 | 3300048921 | Bacteria | 24447 |
| 640 | Ga0496118_0003247 | 3300048921 | Bacteria | 20729 |
| 641 | Ga0496118_0012786 | 3300048921 | Bacteria | 8013 |
| 642 | Ga0496118_0013890 | 3300048921 | Bacteria | 7575 |
| 643 | Ga0496119_0000352 | 3300048922 | Bacteria | 64461 |
| 644 | Ga0496119_0020140 | 3300048922 | Bacteria | 4876 |
| 645 | Ga0496119_0025244 | 3300048922 | Bacteria | 4155 |
| 646 | Ga0496119_0027119 | 3300048922 | Bacteria | 3948 |
| 647 | Ga0496119_0051481 | 3300048922 | Bacteria | 2530 |
| 648 | Ga0496119_0071834 | 3300048922 | Bacteria | 2024 |
| 649 | Ga0496120_0000649 | 3300048923 | Bacteria | 51212 |
| 650 | Ga0496120_0000673 | 3300048923 | Bacteria | 50130 |
| 651 | Ga0496120_0000711 | 3300048923 | Bacteria | 48821 |
| 652 | Ga0496120_0002415 | 3300048923 | Bacteria | 18963 |
| 653 | Ga0496120_0044321 | 3300048923 | Bacteria | 2585 |
| 654 | Ga0496121_0001023 | 3300048924 | Bacteria | 49854 |
| 655 | Ga0496121_0003712 | 3300048924 | Bacteria | 21413 |
| 656 | Ga0496121_0005264 | 3300048924 | Bacteria | 16710 |
| 657 | Ga0496121_0010927 | 3300048924 | Bacteria | 10141 |
| 658 | Ga0496121_0037779 | 3300048924 | Bacteria | 4283 |
| 659 | Ga0496121_0051442 | 3300048924 | Bacteria | 3469 |
| 660 | Ga0496122_0000056 | 3300048925 | Bacteria | 258019 |
| 661 | Ga0496122_0001646 | 3300048925 | Bacteria | 34664 |
| 662 | Ga0496123_0000041 | 3300048926 | Bacteria | 258019 |
| 663 | Ga0496123_0002496 | 3300048926 | Bacteria | 22656 |
| 664 | Ga0496123_0035617 | 3300048926 | Bacteria | 3543 |
| 665 | Ga0496124_0000010 | 3300048927 | Bacteria | 595157 |
| 666 | Ga0496124_0000484 | 3300048927 | Bacteria | 68281 |
| 667 | Ga0496124_0002027 | 3300048927 | Bacteria | 27552 |
| 668 | Ga0496124_0002670 | 3300048927 | Bacteria | 22867 |
| 669 | Ga0496124_0002743 | 3300048927 | Bacteria | 22447 |
| 670 | Ga0496124_0023336 | 3300048927 | Bacteria | 5649 |
| 671 | Ga0496124_0026576 | 3300048927 | Bacteria | 5216 |
| 672 | Ga0496124_0047628 | 3300048927 | Bacteria | 3666 |
| 673 | Ga0496125_0000113 | 3300048928 | Bacteria | 187290 |
| 674 | Ga0496125_0001231 | 3300048928 | Bacteria | 38314 |
| 675 | Ga0496125_0002990 | 3300048928 | Bacteria | 21187 |
| 676 | Ga0496125_0003319 | 3300048928 | Bacteria | 19668 |
| 677 | Ga0496125_0004334 | 3300048928 | Bacteria | 16463 |
| 678 | Ga0496125_0044715 | 3300048928 | Bacteria | 3738 |
| 679 | Ga0496125_0050361 | 3300048928 | Bacteria | 3449 |
| 680 | Ga0496125_0082468 | 3300048928 | Bacteria | 2451 |
| 681 | Ga0496126_0000847 | 3300048929 | Bacteria | 54109 |
| 682 | Ga0496126_0004079 | 3300048929 | Bacteria | 17716 |
| 683 | Ga0496126_0004182 | 3300048929 | Bacteria | 17401 |
| 684 | Ga0496126_0052462 | 3300048929 | Bacteria | 3705 |
| 685 | Ga0496126_0057538 | 3300048929 | Bacteria | 3509 |
| 686 | Ga0496126_0093818 | 3300048929 | Bacteria | 2635 |
| 687 | Ga0496126_0217647 | 3300048929 | Bacteria | 1606 |
| 688 | Ga0495678_027670 | 3300049459 | Bacteria | 2403 |
| 689 | Ga0495682_0000283 | 3300049460 | Bacteria | 39664 |
| 690 | Ga0501034_0217493 | 3300049571 | Bacteria | 1864 |
| 691 | Ga0501036_0076968 | 3300049572 | Bacteria | 2823 |
| 692 | Ga0501039_0136890 | 3300049575 | Bacteria | 1923 |
| 693 | Ga0501040_0009480 | 3300049576 | Bacteria | 6351 |
| 694 | Ga0501041_0012357 | 3300049577 | Bacteria | 5058 |
| 695 | Ga0501042_0006870 | 3300049578 | Bacteria | 7424 |
| 696 | Ga0501042_0015839 | 3300049578 | Bacteria | 5167 |
| 697 | Ga0501042_0059143 | 3300049578 | Bacteria | 2737 |
| 698 | Ga0501048_0128199 | 3300049582 | Bacteria | 1794 |
| 699 | Ga0501068_0010553 | 3300049584 | Bacteria | 5192 |
| 700 | Ga0501072_0064495 | 3300049588 | Bacteria | 2889 |
| 701 | Ga0501074_0016666 | 3300049590 | Bacteria | 5332 |
| 702 | Ga0501075_0097383 | 3300049591 | Bacteria | 2232 |
| 703 | Ga0501076_0095987 | 3300049592 | Bacteria | 2388 |
| 704 | Ga0501077_0016429 | 3300049593 | Bacteria | 4663 |
| 705 | Ga0501080_0013595 | 3300049742 | Bacteria | 7494 |
| 706 | Ga0501080_0129473 | 3300049742 | Bacteria | 2336 |
| 707 | Ga0501044_0000692 | 3300049823 | Bacteria | 40821 |
| 708 | nmdc:mga00v17_30599_c1 | 3300050491 | Bacteria | 3168 |
| 709 | nmdc:mga0yw44_38814_c1 | 3300050492 | Bacteria | 2820 |
| 710 | nmdc:mga05p37_17533_c1 | 3300050507 | Bacteria | 8644 |
| 711 | nmdc:mga09592_11179_c1 | 3300050508 | Bacteria | 7304 |
| 712 | nmdc:mga09592_12328_c1 | 3300050508 | Bacteria | 6962 |
| 713 | nmdc:mga09592_3449_c1 | 3300050508 | Bacteria | 12774 |
| 714 | nmdc:mga0qj67_14461_c1 | 3300050509 | Bacteria | 5968 |
| 715 | nmdc:mga06r32_102631_c1 | 3300050510 | Bacteria | 2808 |
| 716 | nmdc:mga06r32_20840_c1 | 3300050510 | Bacteria | 6041 |
| 717 | nmdc:mga06r32_354_c1 | 3300050510 | Bacteria | 38365 |
| 718 | nmdc:mga06r32_910_c1 | 3300050510 | Bacteria | 26293 |
| 719 | nmdc:mga08y16_7438_c1 | 3300050511 | Bacteria | 11469 |
| 720 | nmdc:mga08y16_7927_c1 | 3300050511 | Bacteria | 11116 |
| 721 | Ga0495601_0037588 | 3300053077 | Bacteria | 3027 |
| 722 | Ga0495601_0118413 | 3300053077 | Bacteria | 1719 |
| 723 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 724 | Ga0500583_0061057 | 3300053092 | Bacteria | 1779 |
| 725 | Ga0500641_0049309 | 3300053096 | Bacteria | 1727 |
| 726 | Ga0500650_0000059 | 3300053098 | Bacteria | 36038 |
| 727 | Ga0500556_0000395 | 3300053104 | Bacteria | 31924 |
| 728 | Ga0500568_0008591 | 3300053139 | Bacteria | 4908 |
| 729 | Ga0500616_0000019 | 3300053153 | Bacteria | 549964 |
| 730 | Ga0500616_0005666 | 3300053153 | Bacteria | 8423 |
| 731 | Ga0500616_0040898 | 3300053153 | Bacteria | 2491 |
| 732 | Ga0500622_0000292 | 3300053156 | Bacteria | 51243 |
| 733 | Ga0500622_0006855 | 3300053156 | Bacteria | 6544 |
| 734 | Ga0500622_0019336 | 3300053156 | Bacteria | 3617 |
| 735 | Ga0500633_0009575 | 3300053160 | Bacteria | 2555 |
| 736 | Ga0500637_0000915 | 3300053178 | Bacteria | 11897 |
| 737 | Ga0500637_0010124 | 3300053178 | Bacteria | 4828 |
| 738 | Ga0501084_0017415 | 3300054114 | Bacteria | 5973 |
| 739 | Ga0501082_0040666 | 3300060353 | Bacteria | 4009 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2600255254 | 2601526434 | 370 |
| 2 | iso_pu_bacteria | 2600255255 | 2601531456 | 370 |
| 3 | iso_pu_bacteria | 2600255280 | 2601618299 | 370 |
| 4 | iso_pu_bacteria | 2600255281 | 2601623332 | 370 |
| 5 | iso_pu_bacteria | 2600255288 | 2601651723 | 370 |
| 6 | iso_pu_bacteria | 2600255289 | 2601656738 | 370 |
| 7 | iso_pu_bacteria | 2600255290 | 2601661754 | 370 |
| 8 | iso_pu_bacteria | 2600255300 | 2601709558 | 370 |
| 9 | iso_pu_bacteria | 2600255301 | 2601714576 | 370 |
| 10 | iso_pu_bacteria | 2600255302 | 2601719603 | 370 |
| 11 | iso_pu_bacteria | 2600255304 | 2601729522 | 370 |
| 12 | iso_pu_bacteria | 2600255305 | 2601734541 | 370 |
| 13 | iso_pu_bacteria | 2600255306 | 2601739548 | 370 |
| 14 | iso_pu_bacteria | 2602042103 | 2603838471 | 370 |
| 15 | iso_pu_bacteria | 2602042104 | 2603843547 | 370 |
| 16 | iso_pu_bacteria | 2602042105 | 2603848621 | 370 |
| 17 | iso_pu_bacteria | 2602042106 | 2603853694 | 370 |
| 18 | iso_pu_bacteria | 2602042110 | 2603869691 | 370 |
| 19 | iso_pu_bacteria | 2603880178 | 2606046876 | 370 |
| 20 | iso_pu_bacteria | 2603880202 | 2606144546 | 370 |
| 21 | iso_pu_bacteria | 2603880211 | 2606176341 | 370 |
| 22 | 3300035398 | Ga0316574_0045625 | Ga0316574_0045625_1513_2685 | 381 |
| 23 | 3300048929 | Ga0496126_0093818 | Ga0496126_0093818_1418_2623 | 388 |
| 24 | 3300048927 | Ga0496124_0026576 | Ga0496124_0026576_3952_5205 | 402 |
| 25 | 3300048922 | Ga0496119_0051481 | Ga0496119_0051481_24_1280 | 404 |
| 26 | 3300005295 | Ga0065707_10082227 | Ga0065707_100822273 | 419 |
| 27 | 3300005564 | Ga0070664_100008203 | Ga0070664_1000082035 | 419 |
| 28 | 3300005719 | Ga0068861_100010260 | Ga0068861_1000102604 | 419 |
| 29 | 3300009098 | Ga0105245_10003333 | Ga0105245_100033337 | 419 |
| 30 | 3300009177 | Ga0105248_10004270 | Ga0105248_100042702 | 419 |
| 31 | 3300013296 | Ga0157374_10003622 | Ga0157374_100036221 | 419 |
| 32 | 3300014325 | Ga0163163_10002680 | Ga0163163_100026807 | 419 |
| 33 | 3300026035 | Ga0207703_10073481 | Ga0207703_100734812 | 419 |
| 34 | 3300026118 | Ga0207675_100005127 | Ga0207675_1000051277 | 419 |
| 35 | 3300035172 | Ga0373955_0009259 | Ga0373955_0009259_2369_3727 | 419 |
| 36 | 3300035724 | Ga0373933_0023517 | Ga0373933_0023517_1782_3140 | 419 |
| 37 | 3300036401 | Ga0373937_0021839 | Ga0373937_0021839_4169_5527 | 419 |
| 38 | 3300046460 | Ga0495638_0017412 | Ga0495638_0017412_559_1920 | 419 |
| 39 | 3300046660 | Ga0495625_0004093 | Ga0495625_0004093_2613_3974 | 419 |
| 40 | 3300048924 | Ga0496121_0051442 | Ga0496121_0051442_385_1746 | 419 |
| 41 | 3300037466 | Ga0395898_0001583 | Ga0395898_0001583_11178_12524 | 422 |
| 42 | 3300038443 | Ga0395901_0007016 | Ga0395901_0007016_3959_5305 | 422 |
| 43 | 3300039450 | Ga0436363_1095124 | Ga0436363_1095124_89_1453 | 423 |
| 44 | 3300031250 | Ga0265331_10002116 | Ga0265331_100021162 | 425 |
| 45 | 3300031251 | Ga0265327_10000238 | Ga0265327_1000023892 | 425 |
| 46 | 3300039437 | Ga0436365_0412003 | Ga0436365_0412003_1844_3202 | 425 |
| 47 | 3300039453 | Ga0436362_1127240 | Ga0436362_1127240_2023_3381 | 425 |
| 48 | 3300031507 | Ga0307509_10087611 | Ga0307509_100876112 | 426 |
| 49 | 3300049578 | Ga0501042_0006870 | Ga0501042_0006870_4592_5965 | 426 |
| 50 | 3300005563 | Ga0068855_100093536 | Ga0068855_1000935362 | 427 |
| 51 | 3300025949 | Ga0207667_10076477 | Ga0207667_100764772 | 427 |
| 52 | 3300042876 | Ga0451577_0027485 | Ga0451577_0027485_3198_4571 | 427 |
| 53 | 3300005435 | Ga0070714_100010493 | Ga0070714_1000104934 | 428 |
| 54 | 3300025929 | Ga0207664_10112372 | Ga0207664_101123722 | 428 |
| 55 | 3300005335 | Ga0070666_10000010 | Ga0070666_10000010150 | 430 |
| 56 | 3300005530 | Ga0070679_100039655 | Ga0070679_1000396554 | 430 |
| 57 | 3300013306 | Ga0163162_10000193 | Ga0163162_100001935 | 430 |
| 58 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002241 | 430 |
| 59 | 3300025912 | Ga0207707_10023465 | Ga0207707_100234652 | 430 |
| 60 | 3300025921 | Ga0207652_10043119 | Ga0207652_100431194 | 430 |
| 61 | 3300025923 | Ga0207681_10076413 | Ga0207681_100764132 | 430 |
| 62 | 3300048088 | Ga0495602_0112760 | Ga0495602_0112760_122_1477 | 430 |
| 63 | 3300048929 | Ga0496126_0004079 | Ga0496126_0004079_13206_14549 | 430 |
| 64 | 3300031824 | Ga0307413_10112501 | Ga0307413_101125011 | 431 |
| 65 | 3300005327 | Ga0070658_10011129 | Ga0070658_100111297 | 432 |
| 66 | 3300013105 | Ga0157369_10036624 | Ga0157369_100366243 | 432 |
| 67 | 3300020082 | Ga0206353_10645750 | Ga0206353_106457502 | 432 |
| 68 | 3300005548 | Ga0070665_100071602 | Ga0070665_1000716024 | 434 |
| 69 | 3300028379 | Ga0268266_10022685 | Ga0268266_100226858 | 434 |
| 70 | 3300053153 | Ga0500616_0005666 | Ga0500616_0005666_4920_6275 | 434 |
| 71 | 3300005547 | Ga0070693_100002362 | Ga0070693_1000023623 | 436 |
| 72 | iso_pu_bacteria | 2898795034 | 2898795810 | 436 |
| 73 | 3300005331 | Ga0070670_100007297 | Ga0070670_1000072974 | 437 |
| 74 | 3300005331 | Ga0070670_100048855 | Ga0070670_1000488553 | 437 |
| 75 | 3300005331 | Ga0070670_100109121 | Ga0070670_1001091213 | 437 |
| 76 | 3300005334 | Ga0068869_100021901 | Ga0068869_1000219012 | 437 |
| 77 | 3300005336 | Ga0070680_100015372 | Ga0070680_1000153725 | 437 |
| 78 | 3300005338 | Ga0068868_100003563 | Ga0068868_1000035637 | 437 |
| 79 | 3300005338 | Ga0068868_100105831 | Ga0068868_1001058312 | 437 |
| 80 | 3300005340 | Ga0070689_100008233 | Ga0070689_1000082339 | 437 |
| 81 | 3300005343 | Ga0070687_100067156 | Ga0070687_1000671561 | 437 |
| 82 | 3300005347 | Ga0070668_100027973 | Ga0070668_1000279732 | 437 |
| 83 | 3300005353 | Ga0070669_100187800 | Ga0070669_1001878002 | 437 |
| 84 | 3300005438 | Ga0070701_10013846 | Ga0070701_100138463 | 437 |
| 85 | 3300005440 | Ga0070705_100019673 | Ga0070705_1000196734 | 437 |
| 86 | 3300005441 | Ga0070700_100055800 | Ga0070700_1000558002 | 437 |
| 87 | 3300005457 | Ga0070662_100006417 | Ga0070662_1000064177 | 437 |
| 88 | 3300005457 | Ga0070662_100007912 | Ga0070662_1000079124 | 437 |
| 89 | 3300005459 | Ga0068867_100038984 | Ga0068867_1000389845 | 437 |
| 90 | 3300005459 | Ga0068867_100040263 | Ga0068867_1000402633 | 437 |
| 91 | 3300005530 | Ga0070679_100154764 | Ga0070679_1001547642 | 437 |
| 92 | 3300005535 | Ga0070684_100011689 | Ga0070684_1000116892 | 437 |
| 93 | 3300005535 | Ga0070684_100022552 | Ga0070684_1000225523 | 437 |
| 94 | 3300005543 | Ga0070672_100118933 | Ga0070672_1001189333 | 437 |
| 95 | 3300005544 | Ga0070686_100028431 | Ga0070686_1000284313 | 437 |
| 96 | 3300005547 | Ga0070693_100077467 | Ga0070693_1000774672 | 437 |
| 97 | 3300005548 | Ga0070665_100011568 | Ga0070665_1000115686 | 437 |
| 98 | 3300005548 | Ga0070665_100072100 | Ga0070665_1000721002 | 437 |
| 99 | 3300005563 | Ga0068855_100029694 | Ga0068855_1000296943 | 437 |
| 100 | 3300005564 | Ga0070664_100010617 | Ga0070664_1000106172 | 437 |
| 101 | 3300005578 | Ga0068854_100073627 | Ga0068854_1000736274 | 437 |
| 102 | 3300005578 | Ga0068854_100163278 | Ga0068854_1001632781 | 437 |
| 103 | 3300005614 | Ga0068856_100042191 | Ga0068856_1000421912 | 437 |
| 104 | 3300005617 | Ga0068859_100000226 | Ga0068859_10000022645 | 437 |
| 105 | 3300005617 | Ga0068859_100000716 | Ga0068859_1000007164 | 437 |
| 106 | 3300005618 | Ga0068864_100004974 | Ga0068864_1000049743 | 437 |
| 107 | 3300005719 | Ga0068861_100000308 | Ga0068861_1000003085 | 437 |
| 108 | 3300005719 | Ga0068861_100003643 | Ga0068861_1000036439 | 437 |
| 109 | 3300005840 | Ga0068870_10003458 | Ga0068870_100034583 | 437 |
| 110 | 3300005840 | Ga0068870_10015306 | Ga0068870_100153063 | 437 |
| 111 | 3300005841 | Ga0068863_100001807 | Ga0068863_10000180717 | 437 |
| 112 | 3300005842 | Ga0068858_100031279 | Ga0068858_1000312794 | 437 |
| 113 | 3300005843 | Ga0068860_100068081 | Ga0068860_1000680812 | 437 |
| 114 | 3300005844 | Ga0068862_100000651 | Ga0068862_10000065110 | 437 |
| 115 | 3300005844 | Ga0068862_100010635 | Ga0068862_1000106351 | 437 |
| 116 | 3300005844 | Ga0068862_100019633 | Ga0068862_1000196333 | 437 |
| 117 | 3300006237 | Ga0097621_100202203 | Ga0097621_1002022032 | 437 |
| 118 | 3300006844 | Ga0075428_100004861 | Ga0075428_10000486111 | 437 |
| 119 | 3300006844 | Ga0075428_100008798 | Ga0075428_1000087986 | 437 |
| 120 | 3300006844 | Ga0075428_100026092 | Ga0075428_1000260922 | 437 |
| 121 | 3300006844 | Ga0075428_100039752 | Ga0075428_1000397523 | 437 |
| 122 | 3300006846 | Ga0075430_100007160 | Ga0075430_1000071604 | 437 |
| 123 | 3300006846 | Ga0075430_100021881 | Ga0075430_1000218811 | 437 |
| 124 | 3300006846 | Ga0075430_100047171 | Ga0075430_1000471712 | 437 |
| 125 | 3300006847 | Ga0075431_100000026 | Ga0075431_10000002624 | 437 |
| 126 | 3300006847 | Ga0075431_100008443 | Ga0075431_1000084436 | 437 |
| 127 | 3300006847 | Ga0075431_100011646 | Ga0075431_1000116463 | 437 |
| 128 | 3300006880 | Ga0075429_100025071 | Ga0075429_1000250713 | 437 |
| 129 | 3300006880 | Ga0075429_100033160 | Ga0075429_1000331602 | 437 |
| 130 | 3300006880 | Ga0075429_100048276 | Ga0075429_1000482763 | 437 |
| 131 | 3300006880 | Ga0075429_100079751 | Ga0075429_1000797513 | 437 |
| 132 | 3300006881 | Ga0068865_100013404 | Ga0068865_1000134043 | 437 |
| 133 | 3300006931 | Ga0097620_100000226 | Ga0097620_1000002264 | 437 |
| 134 | 3300006931 | Ga0097620_100000716 | Ga0097620_1000007164 | 437 |
| 135 | 3300009093 | Ga0105240_10087339 | Ga0105240_100873396 | 437 |
| 136 | 3300009093 | Ga0105240_10161439 | Ga0105240_101614391 | 437 |
| 137 | 3300009094 | Ga0111539_10000759 | Ga0111539_1000075912 | 437 |
| 138 | 3300009094 | Ga0111539_10011229 | Ga0111539_1001122912 | 437 |
| 139 | 3300009098 | Ga0105245_10239744 | Ga0105245_102397441 | 437 |
| 140 | 3300009101 | Ga0105247_10035834 | Ga0105247_100358342 | 437 |
| 141 | 3300009147 | Ga0114129_10000158 | Ga0114129_1000015856 | 437 |
| 142 | 3300009148 | Ga0105243_10042808 | Ga0105243_100428083 | 437 |
| 143 | 3300009177 | Ga0105248_10059402 | Ga0105248_100594023 | 437 |
| 144 | 3300009551 | Ga0105238_10016023 | Ga0105238_100160232 | 437 |
| 145 | 3300009551 | Ga0105238_10133579 | Ga0105238_101335792 | 437 |
| 146 | 3300009553 | Ga0105249_10044940 | Ga0105249_100449403 | 437 |
| 147 | 3300010375 | Ga0105239_10182658 | Ga0105239_101826582 | 437 |
| 148 | 3300011119 | Ga0105246_10153103 | Ga0105246_101531031 | 437 |
| 149 | 3300013306 | Ga0163162_10022079 | Ga0163162_100220794 | 437 |
| 150 | 3300013306 | Ga0163162_10331417 | Ga0163162_103314171 | 437 |
| 151 | 3300013308 | Ga0157375_10004434 | Ga0157375_100044346 | 437 |
| 152 | 3300013308 | Ga0157375_10105249 | Ga0157375_101052492 | 437 |
| 153 | 3300014326 | Ga0157380_10000366 | Ga0157380_1000036619 | 437 |
| 154 | 3300014745 | Ga0157377_10019179 | Ga0157377_100191792 | 437 |
| 155 | 3300014968 | Ga0157379_10000004 | Ga0157379_1000000445 | 437 |
| 156 | 3300014969 | Ga0157376_10034668 | Ga0157376_100346683 | 437 |
| 157 | 3300017792 | Ga0163161_10041524 | Ga0163161_100415243 | 437 |
| 158 | 3300025321 | Ga0207656_10030174 | Ga0207656_100301742 | 437 |
| 159 | 3300025711 | Ga0207696_1000263 | Ga0207696_100026331 | 437 |
| 160 | 3300025907 | Ga0207645_10001117 | Ga0207645_1000111715 | 437 |
| 161 | 3300025908 | Ga0207643_10025347 | Ga0207643_100253473 | 437 |
| 162 | 3300025917 | Ga0207660_10028245 | Ga0207660_100282452 | 437 |
| 163 | 3300025918 | Ga0207662_10025886 | Ga0207662_100258862 | 437 |
| 164 | 3300025920 | Ga0207649_10037129 | Ga0207649_100371292 | 437 |
| 165 | 3300025923 | Ga0207681_10010785 | Ga0207681_100107854 | 437 |
| 166 | 3300025923 | Ga0207681_10074576 | Ga0207681_100745762 | 437 |
| 167 | 3300025925 | Ga0207650_10015067 | Ga0207650_100150673 | 437 |
| 168 | 3300025926 | Ga0207659_10096986 | Ga0207659_100969862 | 437 |
| 169 | 3300025933 | Ga0207706_10010664 | Ga0207706_100106644 | 437 |
| 170 | 3300025933 | Ga0207706_10013421 | Ga0207706_100134213 | 437 |
| 171 | 3300025936 | Ga0207670_10014828 | Ga0207670_100148282 | 437 |
| 172 | 3300025937 | Ga0207669_10060336 | Ga0207669_100603362 | 437 |
| 173 | 3300025940 | Ga0207691_10004950 | Ga0207691_100049505 | 437 |
| 174 | 3300025940 | Ga0207691_10257297 | Ga0207691_102572971 | 437 |
| 175 | 3300025942 | Ga0207689_10025150 | Ga0207689_100251502 | 437 |
| 176 | 3300025949 | Ga0207667_10131465 | Ga0207667_101314654 | 437 |
| 177 | 3300025961 | Ga0207712_10045895 | Ga0207712_100458953 | 437 |
| 178 | 3300025972 | Ga0207668_10080770 | Ga0207668_100807702 | 437 |
| 179 | 3300025972 | Ga0207668_10174209 | Ga0207668_101742091 | 437 |
| 180 | 3300025981 | Ga0207640_10059011 | Ga0207640_100590112 | 437 |
| 181 | 3300026023 | Ga0207677_10100724 | Ga0207677_101007242 | 437 |
| 182 | 3300026035 | Ga0207703_10032898 | Ga0207703_100328984 | 437 |
| 183 | 3300026075 | Ga0207708_10039253 | Ga0207708_100392533 | 437 |
| 184 | 3300026075 | Ga0207708_10077474 | Ga0207708_100774743 | 437 |
| 185 | 3300026088 | Ga0207641_10010019 | Ga0207641_100100194 | 437 |
| 186 | 3300026089 | Ga0207648_10001386 | Ga0207648_1000138617 | 437 |
| 187 | 3300026089 | Ga0207648_10031464 | Ga0207648_100314643 | 437 |
| 188 | 3300026116 | Ga0207674_10075635 | Ga0207674_100756351 | 437 |
| 189 | 3300026118 | Ga0207675_100002419 | Ga0207675_10000241912 | 437 |
| 190 | 3300026118 | Ga0207675_100004826 | Ga0207675_1000048266 | 437 |
| 191 | 3300026118 | Ga0207675_100045880 | Ga0207675_1000458803 | 437 |
| 192 | 3300027614 | Ga0209970_1002398 | Ga0209970_10023982 | 437 |
| 193 | 3300027665 | Ga0209983_1000316 | Ga0209983_10003168 | 437 |
| 194 | 3300027682 | Ga0209971_1012668 | Ga0209971_10126682 | 437 |
| 195 | 3300027717 | Ga0209998_10001850 | Ga0209998_100018504 | 437 |
| 196 | 3300027876 | Ga0209974_10000905 | Ga0209974_100009054 | 437 |
| 197 | 3300027907 | Ga0207428_10011931 | Ga0207428_100119314 | 437 |
| 198 | 3300027907 | Ga0207428_10026550 | Ga0207428_100265505 | 437 |
| 199 | 3300028379 | Ga0268266_10085491 | Ga0268266_100854912 | 437 |
| 200 | 3300028380 | Ga0268265_10000794 | Ga0268265_1000079413 | 437 |
| 201 | 3300028380 | Ga0268265_10026857 | Ga0268265_100268574 | 437 |
| 202 | 3300028380 | Ga0268265_10041277 | Ga0268265_100412773 | 437 |
| 203 | 3300028381 | Ga0268264_10032256 | Ga0268264_100322562 | 437 |
| 204 | 3300028381 | Ga0268264_10039050 | Ga0268264_100390502 | 437 |
| 205 | 3300031507 | Ga0307509_10001575 | Ga0307509_100015758 | 437 |
| 206 | 3300031548 | Ga0307408_100014019 | Ga0307408_1000140196 | 437 |
| 207 | 3300031727 | Ga0316576_10050467 | Ga0316576_100504673 | 437 |
| 208 | 3300032002 | Ga0307416_100056606 | Ga0307416_1000566063 | 437 |
| 209 | 3300035398 | Ga0316574_0000894 | Ga0316574_0000894_3475_4926 | 437 |
| 210 | 3300036712 | Ga0316584_0091986 | Ga0316584_0091986_118_1530 | 437 |
| 211 | 3300042876 | Ga0451577_0145693 | Ga0451577_0145693_139_1563 | 437 |
| 212 | 3300042876 | Ga0451577_0161308 | Ga0451577_0161308_412_1758 | 437 |
| 213 | 3300044712 | Ga0453684_0119527 | Ga0453684_0119527_1066_2490 | 437 |
| 214 | 3300046533 | Ga0495640_0124556 | Ga0495640_0124556_31_1395 | 437 |
| 215 | 3300048909 | Ga0496106_0097417 | Ga0496106_0097417_864_2225 | 437 |
| 216 | 3300048911 | Ga0496108_0037439 | Ga0496108_0037439_1348_2709 | 437 |
| 217 | 3300048912 | Ga0496109_0028718 | Ga0496109_0028718_1056_2417 | 437 |
| 218 | 3300048915 | Ga0496112_0000297 | Ga0496112_0000297_11337_12818 | 437 |
| 219 | 3300048917 | Ga0496114_0001110 | Ga0496114_0001110_1527_2885 | 437 |
| 220 | 3300048918 | Ga0496115_0136123 | Ga0496115_0136123_252_1610 | 437 |
| 221 | 3300049572 | Ga0501036_0076968 | Ga0501036_0076968_478_1842 | 437 |
| 222 | 3300049575 | Ga0501039_0136890 | Ga0501039_0136890_153_1499 | 437 |
| 223 | 3300049577 | Ga0501041_0012357 | Ga0501041_0012357_963_2309 | 437 |
| 224 | 3300049578 | Ga0501042_0015839 | Ga0501042_0015839_1383_2729 | 437 |
| 225 | 3300049578 | Ga0501042_0059143 | Ga0501042_0059143_718_2064 | 437 |
| 226 | 3300049588 | Ga0501072_0064495 | Ga0501072_0064495_140_1486 | 437 |
| 227 | 3300049591 | Ga0501075_0097383 | Ga0501075_0097383_531_1877 | 437 |
| 228 | 3300049592 | Ga0501076_0095987 | Ga0501076_0095987_878_2242 | 437 |
| 229 | 3300049742 | Ga0501080_0129473 | Ga0501080_0129473_417_1763 | 437 |
| 230 | 3300050507 | nmdc:mga05p37_17533_c1 | nmdc:mga05p37_17533_c1_2998_4359 | 437 |
| 231 | 3300050508 | nmdc:mga09592_11179_c1 | nmdc:mga09592_11179_c1_2952_4316 | 437 |
| 232 | 3300050508 | nmdc:mga09592_12328_c1 | nmdc:mga09592_12328_c1_1022_2386 | 437 |
| 233 | 3300050508 | nmdc:mga09592_3449_c1 | nmdc:mga09592_3449_c1_2356_3717 | 437 |
| 234 | 3300050509 | nmdc:mga0qj67_14461_c1 | nmdc:mga0qj67_14461_c1_2566_3927 | 437 |
| 235 | 3300050510 | nmdc:mga06r32_102631_c1 | nmdc:mga06r32_102631_c1_201_1565 | 437 |
| 236 | 3300050510 | nmdc:mga06r32_20840_c1 | nmdc:mga06r32_20840_c1_3503_4864 | 437 |
| 237 | 3300050510 | nmdc:mga06r32_354_c1 | nmdc:mga06r32_354_c1_23921_25282 | 437 |
| 238 | 3300050510 | nmdc:mga06r32_910_c1 | nmdc:mga06r32_910_c1_22851_24212 | 437 |
| 239 | 3300050511 | nmdc:mga08y16_7438_c1 | nmdc:mga08y16_7438_c1_2108_3469 | 437 |
| 240 | 3300050511 | nmdc:mga08y16_7927_c1 | nmdc:mga08y16_7927_c1_3132_4526 | 437 |
| 241 | 3300053077 | Ga0495601_0037588 | Ga0495601_0037588_1097_2455 | 437 |
| 242 | 3300053096 | Ga0500641_0049309 | Ga0500641_0049309_57_1424 | 437 |
| 243 | 3300053139 | Ga0500568_0008591 | Ga0500568_0008591_475_1878 | 437 |
| 244 | 3300053156 | Ga0500622_0000292 | Ga0500622_0000292_74_1447 | 437 |
| 245 | 3300053156 | Ga0500622_0006855 | Ga0500622_0006855_4881_6254 | 437 |
| 246 | 3300053178 | Ga0500637_0000915 | Ga0500637_0000915_2106_3479 | 437 |
| 247 | 3300054114 | Ga0501084_0017415 | Ga0501084_0017415_64_1410 | 437 |
| 248 | 3300060353 | Ga0501082_0040666 | Ga0501082_0040666_1092_2438 | 437 |
| 249 | iso_pu_bacteria | 2738543009 | 2739227161 | 437 |
| 250 | iso_pu_bacteria | 2884338543 | 2884339420 | 437 |
| 251 | iso_pu_bacteria | 2895395659 | 2895396299 | 437 |
| 252 | iso_pu_bacteria | 2977247770 | 2977250931 | 437 |
| 253 | 3300005438 | Ga0070701_10015737 | Ga0070701_100157373 | 438 |
| 254 | 3300005441 | Ga0070700_100072901 | Ga0070700_1000729012 | 438 |
| 255 | 3300005545 | Ga0070695_100175008 | Ga0070695_1001750081 | 438 |
| 256 | 3300005549 | Ga0070704_100141065 | Ga0070704_1001410652 | 438 |
| 257 | 3300005719 | Ga0068861_100090186 | Ga0068861_1000901862 | 438 |
| 258 | 3300005844 | Ga0068862_100004834 | Ga0068862_1000048344 | 438 |
| 259 | 3300014326 | Ga0157380_10005725 | Ga0157380_100057254 | 438 |
| 260 | 3300014326 | Ga0157380_10235258 | Ga0157380_102352582 | 438 |
| 261 | 3300026075 | Ga0207708_10045681 | Ga0207708_100456812 | 438 |
| 262 | 3300026118 | Ga0207675_100009736 | Ga0207675_1000097361 | 438 |
| 263 | 3300031824 | Ga0307413_10047796 | Ga0307413_100477962 | 438 |
| 264 | 3300032126 | Ga0307415_100148694 | Ga0307415_1001486942 | 438 |
| 265 | iso_pu_bacteria | 2537561836 | 2538834748 | 438 |
| 266 | iso_pu_bacteria | 2919513703 | 2919515697 | 438 |
| 267 | iso_pu_bacteria | 2919675420 | 2919678530 | 438 |
| 268 | iso_pu_bacteria | 2939622612 | 2939624765 | 438 |
| 269 | 3300002774 | JGI25150J39212_1000066 | JGI25150J39212_100006626 | 439 |
| 270 | 3300003187 | JGI25151J46595_10000139 | JGI25151J46595_1000013928 | 439 |
| 271 | 3300003215 | JGI25153J46596_10000101 | JGI25153J46596_1000010128 | 439 |
| 272 | 3300003771 | Ga0055526_1000218 | Ga0055526_100021826 | 439 |
| 273 | 3300003773 | Ga0055537_1000900 | Ga0055537_10009001 | 439 |
| 274 | 3300003781 | Ga0055536_1000489 | Ga0055536_10004898 | 439 |
| 275 | 3300003784 | Ga0055534_1000061 | Ga0055534_100006165 | 439 |
| 276 | 3300003784 | Ga0055534_1000519 | Ga0055534_10005192 | 439 |
| 277 | 3300003790 | Ga0055528_1000332 | Ga0055528_100033224 | 439 |
| 278 | 3300003794 | Ga0055531_10000741 | Ga0055531_100007418 | 439 |
| 279 | 3300005327 | Ga0070658_10063524 | Ga0070658_100635242 | 439 |
| 280 | 3300005339 | Ga0070660_100083401 | Ga0070660_1000834013 | 439 |
| 281 | 3300005341 | Ga0070691_10015541 | Ga0070691_100155413 | 439 |
| 282 | 3300005366 | Ga0070659_100004779 | Ga0070659_1000047794 | 439 |
| 283 | 3300005439 | Ga0070711_100017875 | Ga0070711_1000178753 | 439 |
| 284 | 3300005455 | Ga0070663_100058726 | Ga0070663_1000587262 | 439 |
| 285 | 3300005530 | Ga0070679_100024620 | Ga0070679_1000246203 | 439 |
| 286 | 3300005546 | Ga0070696_100001233 | Ga0070696_1000012334 | 439 |
| 287 | 3300005548 | Ga0070665_100132172 | Ga0070665_1001321722 | 439 |
| 288 | 3300005563 | Ga0068855_100140514 | Ga0068855_1001405142 | 439 |
| 289 | 3300005616 | Ga0068852_100187784 | Ga0068852_1001877842 | 439 |
| 290 | 3300006038 | Ga0075365_10037994 | Ga0075365_100379942 | 439 |
| 291 | 3300007788 | Ga0099795_10000125 | Ga0099795_100001253 | 439 |
| 292 | 3300009011 | Ga0105251_10004848 | Ga0105251_100048485 | 439 |
| 293 | 3300009176 | Ga0105242_10189194 | Ga0105242_101891942 | 439 |
| 294 | 3300013104 | Ga0157370_10002542 | Ga0157370_100025423 | 439 |
| 295 | 3300017792 | Ga0163161_10000938 | Ga0163161_100009382 | 439 |
| 296 | 3300017792 | Ga0163161_10001227 | Ga0163161_1000122715 | 439 |
| 297 | 3300017792 | Ga0163161_10003635 | Ga0163161_100036352 | 439 |
| 298 | 3300025245 | Ga0207425_1000040 | Ga0207425_1000040146 | 439 |
| 299 | 3300025258 | Ga0209129_1000011 | Ga0209129_1000011116 | 439 |
| 300 | 3300025263 | Ga0209565_1000037 | Ga0209565_100003773 | 439 |
| 301 | 3300025273 | Ga0209673_1000032 | Ga0209673_1000032177 | 439 |
| 302 | 3300025291 | Ga0209675_1000020 | Ga0209675_1000020108 | 439 |
| 303 | 3300025291 | Ga0209675_1006527 | Ga0209675_10065274 | 439 |
| 304 | 3300025292 | Ga0209676_1000775 | Ga0209676_100077520 | 439 |
| 305 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002681 | 439 |
| 306 | 3300025295 | Ga0209564_1000210 | Ga0209564_100021015 | 439 |
| 307 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003688 | 439 |
| 308 | 3300025299 | Ga0209256_1001437 | Ga0209256_100143716 | 439 |
| 309 | 3300025299 | Ga0209256_1001987 | Ga0209256_100198715 | 439 |
| 310 | 3300025304 | Ga0209257_1000734 | Ga0209257_100073420 | 439 |
| 311 | 3300025735 | Ga0207713_1003022 | Ga0207713_100302211 | 439 |
| 312 | 3300025904 | Ga0207647_10044695 | Ga0207647_100446953 | 439 |
| 313 | 3300025912 | Ga0207707_10002087 | Ga0207707_1000208716 | 439 |
| 314 | 3300025921 | Ga0207652_10005312 | Ga0207652_100053127 | 439 |
| 315 | 3300025932 | Ga0207690_10001878 | Ga0207690_100018785 | 439 |
| 316 | 3300025949 | Ga0207667_10116416 | Ga0207667_101164162 | 439 |
| 317 | 3300026075 | Ga0207708_10046446 | Ga0207708_100464462 | 439 |
| 318 | 3300026089 | Ga0207648_10042699 | Ga0207648_100426993 | 439 |
| 319 | 3300026142 | Ga0207698_10095730 | Ga0207698_100957302 | 439 |
| 320 | 3300027512 | Ga0209179_1000750 | Ga0209179_10007502 | 439 |
| 321 | 3300030878 | Ga0265770_1000173 | Ga0265770_10001736 | 439 |
| 322 | 3300031090 | Ga0265760_10002495 | Ga0265760_100024953 | 439 |
| 323 | 3300031456 | Ga0307513_10001609 | Ga0307513_1000160910 | 439 |
| 324 | 3300031727 | Ga0316576_10028779 | Ga0316576_100287795 | 439 |
| 325 | 3300031727 | Ga0316576_10046535 | Ga0316576_100465353 | 439 |
| 326 | 3300031730 | Ga0307516_10000012 | Ga0307516_10000012181 | 439 |
| 327 | 3300032133 | Ga0316583_10001802 | Ga0316583_100018023 | 439 |
| 328 | 3300041413 | Ga0439465_0002785 | Ga0439465_0002785_1138_2508 | 439 |
| 329 | 3300041451 | Ga0451791_1105936 | Ga0451791_1105936_791_2164 | 439 |
| 330 | 3300041486 | Ga0451807_0058820 | Ga0451807_0058820_2041_3414 | 439 |
| 331 | 3300044658 | Ga0466972_0000312 | Ga0466972_0000312_10729_12102 | 439 |
| 332 | 3300044712 | Ga0453684_0086274 | Ga0453684_0086274_758_2104 | 439 |
| 333 | 3300046452 | Ga0495617_000218 | Ga0495617_000218_13524_14876 | 439 |
| 334 | 3300046460 | Ga0495638_0000319 | Ga0495638_0000319_38_1414 | 439 |
| 335 | 3300046460 | Ga0495638_0083949 | Ga0495638_0083949_234_1592 | 439 |
| 336 | 3300046471 | Ga0495650_0000667 | Ga0495650_0000667_25031_26404 | 439 |
| 337 | 3300046492 | Ga0495585_0000180 | Ga0495585_0000180_30857_32236 | 439 |
| 338 | 3300046507 | Ga0495606_0001812 | Ga0495606_0001812_24977_26350 | 439 |
| 339 | 3300046507 | Ga0495606_0058958 | Ga0495606_0058958_607_1980 | 439 |
| 340 | 3300046513 | Ga0495616_0000003 | Ga0495616_0000003_239320_240693 | 439 |
| 341 | 3300046518 | Ga0495631_0000061 | Ga0495631_0000061_36947_38326 | 439 |
| 342 | 3300046518 | Ga0495631_0000329 | Ga0495631_0000329_6361_7734 | 439 |
| 343 | 3300046524 | Ga0495648_0000427 | Ga0495648_0000427_25967_27319 | 439 |
| 344 | 3300046525 | Ga0495663_0003609 | Ga0495663_0003609_2042_3400 | 439 |
| 345 | 3300046660 | Ga0495625_0002254 | Ga0495625_0002254_18518_19876 | 439 |
| 346 | 3300046660 | Ga0495625_0017779 | Ga0495625_0017779_1138_2511 | 439 |
| 347 | 3300046665 | Ga0495661_0000471 | Ga0495661_0000471_24420_25799 | 439 |
| 348 | 3300047319 | Ga0495674_0128446 | Ga0495674_0128446_199_1572 | 439 |
| 349 | 3300047469 | Ga0495673_0000101 | Ga0495673_0000101_144184_145557 | 439 |
| 350 | 3300048907 | Ga0496104_0002107 | Ga0496104_0002107_1192_2568 | 439 |
| 351 | 3300048908 | Ga0496105_0004353 | Ga0496105_0004353_8096_9472 | 439 |
| 352 | 3300048909 | Ga0496106_0011969 | Ga0496106_0011969_2607_3980 | 439 |
| 353 | 3300048918 | Ga0496115_0079176 | Ga0496115_0079176_35_1411 | 439 |
| 354 | 3300048920 | Ga0496117_0002395 | Ga0496117_0002395_21180_22538 | 439 |
| 355 | 3300048920 | Ga0496117_0056705 | Ga0496117_0056705_153_1511 | 439 |
| 356 | 3300048921 | Ga0496118_0002536 | Ga0496118_0002536_21249_22607 | 439 |
| 357 | 3300048921 | Ga0496118_0003247 | Ga0496118_0003247_293_1651 | 439 |
| 358 | 3300048922 | Ga0496119_0025244 | Ga0496119_0025244_305_1663 | 439 |
| 359 | 3300048923 | Ga0496120_0002415 | Ga0496120_0002415_17341_18699 | 439 |
| 360 | 3300048924 | Ga0496121_0003712 | Ga0496121_0003712_19608_20966 | 439 |
| 361 | 3300048924 | Ga0496121_0010927 | Ga0496121_0010927_8329_9687 | 439 |
| 362 | 3300048925 | Ga0496122_0001646 | Ga0496122_0001646_21099_22457 | 439 |
| 363 | 3300048926 | Ga0496123_0002496 | Ga0496123_0002496_761_2119 | 439 |
| 364 | 3300048927 | Ga0496124_0002670 | Ga0496124_0002670_21134_22492 | 439 |
| 365 | 3300048927 | Ga0496124_0002743 | Ga0496124_0002743_520_1878 | 439 |
| 366 | 3300048928 | Ga0496125_0002990 | Ga0496125_0002990_492_1850 | 439 |
| 367 | 3300048928 | Ga0496125_0003319 | Ga0496125_0003319_17588_18946 | 439 |
| 368 | 3300048929 | Ga0496126_0000847 | Ga0496126_0000847_22209_23567 | 439 |
| 369 | 3300049571 | Ga0501034_0217493 | Ga0501034_0217493_386_1744 | 439 |
| 370 | 3300049584 | Ga0501068_0010553 | Ga0501068_0010553_1196_2569 | 439 |
| 371 | 3300049590 | Ga0501074_0016666 | Ga0501074_0016666_940_2313 | 439 |
| 372 | 3300049593 | Ga0501077_0016429 | Ga0501077_0016429_429_1802 | 439 |
| 373 | 3300049742 | Ga0501080_0013595 | Ga0501080_0013595_4541_5914 | 439 |
| 374 | 3300050492 | nmdc:mga0yw44_38814_c1 | nmdc:mga0yw44_38814_c1_1134_2492 | 439 |
| 375 | 3300053077 | Ga0495601_0118413 | Ga0495601_0118413_187_1563 | 439 |
| 376 | 3300053087 | Ga0500643_000012 | Ga0500643_000012_261952_263304 | 439 |
| 377 | 3300053160 | Ga0500633_0009575 | Ga0500633_0009575_1105_2478 | 439 |
| 378 | iso_pu_bacteria | 2869551831 | 2869553477 | 439 |
| 379 | iso_pu_bacteria | 2904513164 | 2904515583 | 439 |
| 380 | iso_pu_bacteria | 2919108558 | 2919111258 | 439 |
| 381 | 3300003760 | Ga0055527_1000079 | Ga0055527_100007936 | 440 |
| 382 | 3300003761 | Ga0055535_1000166 | Ga0055535_100016629 | 440 |
| 383 | 3300003762 | Ga0055542_1000210 | Ga0055542_100021030 | 440 |
| 384 | 3300003763 | Ga0055529_1000394 | Ga0055529_100039430 | 440 |
| 385 | 3300005331 | Ga0070670_100000015 | Ga0070670_10000001542 | 440 |
| 386 | 3300005335 | Ga0070666_10113166 | Ga0070666_101131662 | 440 |
| 387 | 3300005338 | Ga0068868_100039324 | Ga0068868_1000393243 | 440 |
| 388 | 3300005339 | Ga0070660_100016031 | Ga0070660_1000160314 | 440 |
| 389 | 3300005340 | Ga0070689_100001380 | Ga0070689_1000013802 | 440 |
| 390 | 3300005353 | Ga0070669_100002460 | Ga0070669_1000024604 | 440 |
| 391 | 3300005355 | Ga0070671_100000013 | Ga0070671_10000001347 | 440 |
| 392 | 3300005365 | Ga0070688_100007363 | Ga0070688_1000073631 | 440 |
| 393 | 3300005366 | Ga0070659_100004133 | Ga0070659_1000041335 | 440 |
| 394 | 3300005366 | Ga0070659_100006051 | Ga0070659_1000060514 | 440 |
| 395 | 3300005367 | Ga0070667_100000015 | Ga0070667_100000015173 | 440 |
| 396 | 3300005367 | Ga0070667_100008879 | Ga0070667_1000088795 | 440 |
| 397 | 3300005435 | Ga0070714_100000332 | Ga0070714_10000033224 | 440 |
| 398 | 3300005435 | Ga0070714_100003381 | Ga0070714_1000033814 | 440 |
| 399 | 3300005438 | Ga0070701_10003578 | Ga0070701_100035783 | 440 |
| 400 | 3300005440 | Ga0070705_100020123 | Ga0070705_1000201232 | 440 |
| 401 | 3300005441 | Ga0070700_100041789 | Ga0070700_1000417891 | 440 |
| 402 | 3300005466 | Ga0070685_10000104 | Ga0070685_1000010441 | 440 |
| 403 | 3300005544 | Ga0070686_100013717 | Ga0070686_1000137173 | 440 |
| 404 | 3300005545 | Ga0070695_100063709 | Ga0070695_1000637092 | 440 |
| 405 | 3300005548 | Ga0070665_100001202 | Ga0070665_10000120215 | 440 |
| 406 | 3300005548 | Ga0070665_100040982 | Ga0070665_1000409823 | 440 |
| 407 | 3300005548 | Ga0070665_100050144 | Ga0070665_1000501443 | 440 |
| 408 | 3300005615 | Ga0070702_100012947 | Ga0070702_1000129472 | 440 |
| 409 | 3300005617 | Ga0068859_100006172 | Ga0068859_1000061723 | 440 |
| 410 | 3300005617 | Ga0068859_100041968 | Ga0068859_1000419682 | 440 |
| 411 | 3300005617 | Ga0068859_100137349 | Ga0068859_1001373492 | 440 |
| 412 | 3300005618 | Ga0068864_100000056 | Ga0068864_10000005671 | 440 |
| 413 | 3300005719 | Ga0068861_100031081 | Ga0068861_1000310812 | 440 |
| 414 | 3300005841 | Ga0068863_100111940 | Ga0068863_1001119402 | 440 |
| 415 | 3300005841 | Ga0068863_100170748 | Ga0068863_1001707482 | 440 |
| 416 | 3300005842 | Ga0068858_100052903 | Ga0068858_1000529033 | 440 |
| 417 | 3300005842 | Ga0068858_100108837 | Ga0068858_1001088372 | 440 |
| 418 | 3300005843 | Ga0068860_100001763 | Ga0068860_1000017633 | 440 |
| 419 | 3300005843 | Ga0068860_100003237 | Ga0068860_10000323710 | 440 |
| 420 | 3300005844 | Ga0068862_100058884 | Ga0068862_1000588843 | 440 |
| 421 | 3300005844 | Ga0068862_100249564 | Ga0068862_1002495641 | 440 |
| 422 | 3300006051 | Ga0075364_10020442 | Ga0075364_100204422 | 440 |
| 423 | 3300006051 | Ga0075364_10029466 | Ga0075364_100294662 | 440 |
| 424 | 3300006237 | Ga0097621_100016081 | Ga0097621_1000160815 | 440 |
| 425 | 3300006237 | Ga0097621_100158575 | Ga0097621_1001585752 | 440 |
| 426 | 3300006358 | Ga0068871_100001261 | Ga0068871_1000012619 | 440 |
| 427 | 3300006358 | Ga0068871_100015467 | Ga0068871_1000154672 | 440 |
| 428 | 3300006881 | Ga0068865_100008065 | Ga0068865_1000080653 | 440 |
| 429 | 3300006931 | Ga0097620_100006171 | Ga0097620_1000061716 | 440 |
| 430 | 3300006931 | Ga0097620_100041967 | Ga0097620_1000419672 | 440 |
| 431 | 3300006931 | Ga0097620_100137347 | Ga0097620_1001373472 | 440 |
| 432 | 3300006946 | Ga0079104_1007220 | Ga0079104_10072203 | 440 |
| 433 | 3300007788 | Ga0099795_10000003 | Ga0099795_1000000325 | 440 |
| 434 | 3300009098 | Ga0105245_10015924 | Ga0105245_100159244 | 440 |
| 435 | 3300009101 | Ga0105247_10029529 | Ga0105247_100295292 | 440 |
| 436 | 3300009176 | Ga0105242_10084907 | Ga0105242_100849071 | 440 |
| 437 | 3300009177 | Ga0105248_10010407 | Ga0105248_100104073 | 440 |
| 438 | 3300009177 | Ga0105248_10034626 | Ga0105248_100346263 | 440 |
| 439 | 3300010159 | Ga0099796_10000077 | Ga0099796_100000779 | 440 |
| 440 | 3300013297 | Ga0157378_10101820 | Ga0157378_101018201 | 440 |
| 441 | 3300013307 | Ga0157372_10034994 | Ga0157372_100349942 | 440 |
| 442 | 3300013308 | Ga0157375_10001552 | Ga0157375_1000155219 | 440 |
| 443 | 3300014325 | Ga0163163_10000199 | Ga0163163_1000019913 | 440 |
| 444 | 3300014325 | Ga0163163_10056400 | Ga0163163_100564002 | 440 |
| 445 | 3300014326 | Ga0157380_10225915 | Ga0157380_102259151 | 440 |
| 446 | 3300014968 | Ga0157379_10007489 | Ga0157379_100074894 | 440 |
| 447 | 3300014968 | Ga0157379_10049293 | Ga0157379_100492933 | 440 |
| 448 | 3300014969 | Ga0157376_10098559 | Ga0157376_100985592 | 440 |
| 449 | 3300025228 | Ga0209672_100004 | Ga0209672_100004818 | 440 |
| 450 | 3300025242 | Ga0209258_100003 | Ga0209258_100003818 | 440 |
| 451 | 3300025254 | Ga0209148_1000025 | Ga0209148_1000025122 | 440 |
| 452 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004818 | 440 |
| 453 | 3300025893 | Ga0207682_10023345 | Ga0207682_100233452 | 440 |
| 454 | 3300025903 | Ga0207680_10001344 | Ga0207680_100013449 | 440 |
| 455 | 3300025903 | Ga0207680_10004644 | Ga0207680_100046444 | 440 |
| 456 | 3300025916 | Ga0207663_10055474 | Ga0207663_100554742 | 440 |
| 457 | 3300025919 | Ga0207657_10020522 | Ga0207657_100205223 | 440 |
| 458 | 3300025921 | Ga0207652_10066984 | Ga0207652_100669842 | 440 |
| 459 | 3300025925 | Ga0207650_10000013 | Ga0207650_10000013214 | 440 |
| 460 | 3300025929 | Ga0207664_10003922 | Ga0207664_100039223 | 440 |
| 461 | 3300025931 | Ga0207644_10000106 | Ga0207644_1000010641 | 440 |
| 462 | 3300025932 | Ga0207690_10005861 | Ga0207690_100058613 | 440 |
| 463 | 3300025932 | Ga0207690_10019430 | Ga0207690_100194302 | 440 |
| 464 | 3300025936 | Ga0207670_10009765 | Ga0207670_100097653 | 440 |
| 465 | 3300025940 | Ga0207691_10073580 | Ga0207691_100735802 | 440 |
| 466 | 3300025940 | Ga0207691_10092194 | Ga0207691_100921942 | 440 |
| 467 | 3300025941 | Ga0207711_10000789 | Ga0207711_1000078910 | 440 |
| 468 | 3300025941 | Ga0207711_10005914 | Ga0207711_100059147 | 440 |
| 469 | 3300025986 | Ga0207658_10000005 | Ga0207658_10000005215 | 440 |
| 470 | 3300025986 | Ga0207658_10009396 | Ga0207658_100093965 | 440 |
| 471 | 3300026035 | Ga0207703_10002710 | Ga0207703_1000271011 | 440 |
| 472 | 3300026035 | Ga0207703_10033351 | Ga0207703_100333513 | 440 |
| 473 | 3300026088 | Ga0207641_10057353 | Ga0207641_100573533 | 440 |
| 474 | 3300026088 | Ga0207641_10057354 | Ga0207641_100573541 | 440 |
| 475 | 3300026088 | Ga0207641_10069156 | Ga0207641_100691563 | 440 |
| 476 | 3300026095 | Ga0207676_10000010 | Ga0207676_10000010312 | 440 |
| 477 | 3300026118 | Ga0207675_100022027 | Ga0207675_1000220274 | 440 |
| 478 | 3300026118 | Ga0207675_100149794 | Ga0207675_1001497942 | 440 |
| 479 | 3300027512 | Ga0209179_1000043 | Ga0209179_100004311 | 440 |
| 480 | 3300028379 | Ga0268266_10014073 | Ga0268266_100140733 | 440 |
| 481 | 3300028380 | Ga0268265_10000383 | Ga0268265_1000038313 | 440 |
| 482 | 3300028381 | Ga0268264_10000036 | Ga0268264_10000036305 | 440 |
| 483 | 3300028381 | Ga0268264_10081464 | Ga0268264_100814642 | 440 |
| 484 | 3300028558 | Ga0265326_10003972 | Ga0265326_100039722 | 440 |
| 485 | 3300028573 | Ga0265334_10000005 | Ga0265334_10000005163 | 440 |
| 486 | 3300028800 | Ga0265338_10006155 | Ga0265338_100061551 | 440 |
| 487 | 3300031456 | Ga0307513_10068924 | Ga0307513_100689242 | 440 |
| 488 | 3300031595 | Ga0265313_10000014 | Ga0265313_1000001497 | 440 |
| 489 | 3300031595 | Ga0265313_10043611 | Ga0265313_100436112 | 440 |
| 490 | 3300031665 | Ga0316575_10013613 | Ga0316575_100136132 | 440 |
| 491 | 3300031728 | Ga0316578_10005443 | Ga0316578_100054432 | 440 |
| 492 | 3300031728 | Ga0316578_10107087 | Ga0316578_101070872 | 440 |
| 493 | 3300031731 | Ga0307405_10080790 | Ga0307405_100807902 | 440 |
| 494 | 3300031824 | Ga0307413_10038397 | Ga0307413_100383972 | 440 |
| 495 | 3300031995 | Ga0307409_100030309 | Ga0307409_1000303092 | 440 |
| 496 | 3300032005 | Ga0307411_10011008 | Ga0307411_100110083 | 440 |
| 497 | 3300032126 | Ga0307415_100103083 | Ga0307415_1001030832 | 440 |
| 498 | 3300032168 | Ga0316593_10008778 | Ga0316593_100087782 | 440 |
| 499 | 3300032168 | Ga0316593_10022910 | Ga0316593_100229102 | 440 |
| 500 | 3300033180 | Ga0307510_10000059 | Ga0307510_1000005911 | 440 |
| 501 | 3300035398 | Ga0316574_0110962 | Ga0316574_0110962_217_1566 | 440 |
| 502 | 3300035695 | Ga0373927_0000001 | Ga0373927_0000001_732635_734050 | 440 |
| 503 | 3300036712 | Ga0316584_0016579 | Ga0316584_0016579_92_1471 | 440 |
| 504 | 3300036712 | Ga0316584_0020393 | Ga0316584_0020393_2216_3565 | 440 |
| 505 | 3300037068 | Ga0373925_0163629 | Ga0373925_0163629_337_1716 | 440 |
| 506 | 3300044656 | Ga0466969_0001735 | Ga0466969_0001735_5423_6775 | 440 |
| 507 | 3300044673 | Ga0453683_0000382 | Ga0453683_0000382_15893_17242 | 440 |
| 508 | 3300044673 | Ga0453683_0008560 | Ga0453683_0008560_124_1476 | 440 |
| 509 | 3300044684 | Ga0466966_0008586 | Ga0466966_0008586_3140_4492 | 440 |
| 510 | 3300044693 | Ga0466961_0005334 | Ga0466961_0005334_6374_7717 | 440 |
| 511 | 3300044693 | Ga0466961_0008397 | Ga0466961_0008397_1668_3020 | 440 |
| 512 | 3300044765 | Ga0466970_0000701 | Ga0466970_0000701_4406_5749 | 440 |
| 513 | 3300044842 | Ga0466957_0054394 | Ga0466957_0054394_774_2126 | 440 |
| 514 | 3300045049 | Ga0466959_0002124 | Ga0466959_0002124_9953_11296 | 440 |
| 515 | 3300045049 | Ga0466959_0124395 | Ga0466959_0124395_275_1627 | 440 |
| 516 | 3300046457 | Ga0495590_0009443 | Ga0495590_0009443_1383_2750 | 440 |
| 517 | 3300046460 | Ga0495638_0000786 | Ga0495638_0000786_5265_6626 | 440 |
| 518 | 3300046460 | Ga0495638_0022865 | Ga0495638_0022865_1371_2747 | 440 |
| 519 | 3300046507 | Ga0495606_0028991 | Ga0495606_0028991_1857_3197 | 440 |
| 520 | 3300046513 | Ga0495616_0002551 | Ga0495616_0002551_3194_4570 | 440 |
| 521 | 3300046525 | Ga0495663_0000227 | Ga0495663_0000227_3873_5234 | 440 |
| 522 | 3300046530 | Ga0495654_0001896 | Ga0495654_0001896_2245_3654 | 440 |
| 523 | 3300046694 | Ga0495649_0003784 | Ga0495649_0003784_5273_6649 | 440 |
| 524 | 3300048907 | Ga0496104_0083301 | Ga0496104_0083301_1210_2565 | 440 |
| 525 | 3300048912 | Ga0496109_0023839 | Ga0496109_0023839_3322_4677 | 440 |
| 526 | 3300048913 | Ga0496110_0009720 | Ga0496110_0009720_3762_5117 | 440 |
| 527 | 3300048914 | Ga0496111_0013076 | Ga0496111_0013076_1018_2373 | 440 |
| 528 | 3300048920 | Ga0496117_0000278 | Ga0496117_0000278_83617_84978 | 440 |
| 529 | 3300048920 | Ga0496117_0002664 | Ga0496117_0002664_20026_21387 | 440 |
| 530 | 3300048920 | Ga0496117_0056759 | Ga0496117_0056759_283_1653 | 440 |
| 531 | 3300048921 | Ga0496118_0001003 | Ga0496118_0001003_23015_24376 | 440 |
| 532 | 3300048921 | Ga0496118_0002267 | Ga0496118_0002267_14458_15828 | 440 |
| 533 | 3300048927 | Ga0496124_0023336 | Ga0496124_0023336_1821_3194 | 440 |
| 534 | 3300048928 | Ga0496125_0044715 | Ga0496125_0044715_2054_3424 | 440 |
| 535 | 3300048928 | Ga0496125_0082468 | Ga0496125_0082468_631_1989 | 440 |
| 536 | 3300049582 | Ga0501048_0128199 | Ga0501048_0128199_185_1540 | 440 |
| 537 | 3300049823 | Ga0501044_0000692 | Ga0501044_0000692_15643_16998 | 440 |
| 538 | 3300050491 | nmdc:mga00v17_30599_c1 | nmdc:mga00v17_30599_c1_1373_2728 | 440 |
| 539 | 3300053098 | Ga0500650_0000059 | Ga0500650_0000059_768_2141 | 440 |
| 540 | 3300053156 | Ga0500622_0019336 | Ga0500622_0019336_1741_3096 | 440 |
| 541 | iso_pu_bacteria | 2599185169 | 2599411447 | 440 |
| 542 | iso_pu_bacteria | 2600255287 | 2601641870 | 440 |
| 543 | iso_pu_bacteria | 2600255291 | 2601665912 | 440 |
| 544 | iso_pu_bacteria | 2600255298 | 2601698769 | 440 |
| 545 | iso_pu_bacteria | 2600255299 | 2601701613 | 440 |
| 546 | iso_pu_bacteria | 2600255303 | 2601719677 | 440 |
| 547 | iso_pu_bacteria | 2600255307 | 2601741497 | 440 |
| 548 | iso_pu_bacteria | 2600255309 | 2601752249 | 440 |
| 549 | iso_pu_bacteria | 2600255392 | 2602019090 | 440 |
| 550 | iso_pu_bacteria | 2602042052 | 2603661371 | 440 |
| 551 | iso_pu_bacteria | 2602042053 | 2603664325 | 440 |
| 552 | iso_pu_bacteria | 2602042111 | 2603876649 | 440 |
| 553 | iso_pu_bacteria | 2603880184 | 2606068755 | 440 |
| 554 | iso_pu_bacteria | 2608642108 | 2608669899 | 440 |
| 555 | iso_pu_bacteria | 2636415599 | 2637224271 | 440 |
| 556 | iso_pu_bacteria | 2675903046 | 2676405673 | 440 |
| 557 | iso_pu_bacteria | 2711768156 | 2712469414 | 440 |
| 558 | iso_pu_bacteria | 2713897090 | 2715499396 | 440 |
| 559 | iso_pu_bacteria | 2775507074 | 2777020757 | 440 |
| 560 | iso_pu_bacteria | 2854601825 | 2854601894 | 440 |
| 561 | iso_pu_bacteria | 2904504865 | 2904507959 | 440 |
| 562 | iso_pu_bacteria | 2969079654 | 2969081311 | 440 |
| 563 | iso_pu_bacteria | 2984559226 | 2984563774 | 440 |
| 564 | iso_pu_bacteria | 2984595703 | 2984596506 | 440 |
| 565 | 3300002067 | JGI24735J21928_10003881 | JGI24735J21928_100038814 | 441 |
| 566 | 3300002737 | JGI25162J39368_1000006 | JGI25162J39368_1000006344 | 441 |
| 567 | 3300002771 | JGI25163J39215_1000001 | JGI25163J39215_100000115 | 441 |
| 568 | 3300002772 | JGI25164J39214_1000001 | JGI25164J39214_1000001413 | 441 |
| 569 | 3300003203 | JGI25406J46586_10004998 | JGI25406J46586_100049984 | 441 |
| 570 | 3300003323 | rootH1_10084749 | rootH1_100847492 | 441 |
| 571 | 3300003751 | Ga0055538_1000004 | Ga0055538_1000004543 | 441 |
| 572 | 3300003752 | Ga0055539_1000004 | Ga0055539_100000415 | 441 |
| 573 | 3300003756 | Ga0055533_1000007 | Ga0055533_1000007543 | 441 |
| 574 | 3300003759 | Ga0055525_1000007 | Ga0055525_1000007543 | 441 |
| 575 | 3300003841 | Ga0055541_1000004 | Ga0055541_1000004543 | 441 |
| 576 | 3300003856 | Ga0058692_1000585 | Ga0058692_10005859 | 441 |
| 577 | 3300003856 | Ga0058692_1005216 | Ga0058692_10052162 | 441 |
| 578 | 3300005289 | Ga0065704_10000131 | Ga0065704_1000013113 | 441 |
| 579 | 3300005295 | Ga0065707_10091420 | Ga0065707_100914201 | 441 |
| 580 | 3300005329 | Ga0070683_100003608 | Ga0070683_10000360811 | 441 |
| 581 | 3300005335 | Ga0070666_10003001 | Ga0070666_100030015 | 441 |
| 582 | 3300005355 | Ga0070671_100000102 | Ga0070671_10000010242 | 441 |
| 583 | 3300005367 | Ga0070667_100000316 | Ga0070667_10000031617 | 441 |
| 584 | 3300005367 | Ga0070667_100032883 | Ga0070667_1000328832 | 441 |
| 585 | 3300005436 | Ga0070713_100028320 | Ga0070713_1000283206 | 441 |
| 586 | 3300005458 | Ga0070681_10001409 | Ga0070681_1000140921 | 441 |
| 587 | 3300005458 | Ga0070681_10002788 | Ga0070681_100027884 | 441 |
| 588 | 3300005458 | Ga0070681_10017195 | Ga0070681_100171953 | 441 |
| 589 | 3300005458 | Ga0070681_10130923 | Ga0070681_101309232 | 441 |
| 590 | 3300005518 | Ga0070699_100258653 | Ga0070699_1002586531 | 441 |
| 591 | 3300005530 | Ga0070679_100004499 | Ga0070679_1000044993 | 441 |
| 592 | 3300005530 | Ga0070679_100038440 | Ga0070679_1000384403 | 441 |
| 593 | 3300005530 | Ga0070679_100071779 | Ga0070679_1000717793 | 441 |
| 594 | 3300005530 | Ga0070679_100090867 | Ga0070679_1000908672 | 441 |
| 595 | 3300005548 | Ga0070665_100000975 | Ga0070665_1000009753 | 441 |
| 596 | 3300005548 | Ga0070665_100001355 | Ga0070665_1000013552 | 441 |
| 597 | 3300005548 | Ga0070665_100019218 | Ga0070665_1000192182 | 441 |
| 598 | 3300005617 | Ga0068859_100020160 | Ga0068859_1000201602 | 441 |
| 599 | 3300005719 | Ga0068861_100031978 | Ga0068861_1000319783 | 441 |
| 600 | 3300005841 | Ga0068863_100018409 | Ga0068863_1000184096 | 441 |
| 601 | 3300005841 | Ga0068863_100220295 | Ga0068863_1002202952 | 441 |
| 602 | 3300005842 | Ga0068858_100003005 | Ga0068858_1000030052 | 441 |
| 603 | 3300005843 | Ga0068860_100000270 | Ga0068860_10000027054 | 441 |
| 604 | 3300005844 | Ga0068862_100013139 | Ga0068862_1000131394 | 441 |
| 605 | 3300005844 | Ga0068862_100222401 | Ga0068862_1002224011 | 441 |
| 606 | 3300005937 | Ga0081455_10000140 | Ga0081455_1000014064 | 441 |
| 607 | 3300005985 | Ga0081539_10000001 | Ga0081539_10000001286 | 441 |
| 608 | 3300006931 | Ga0097620_100020160 | Ga0097620_1000201602 | 441 |
| 609 | 3300009011 | Ga0105251_10006989 | Ga0105251_100069892 | 441 |
| 610 | 3300009011 | Ga0105251_10007021 | Ga0105251_100070214 | 441 |
| 611 | 3300009011 | Ga0105251_10011245 | Ga0105251_100112454 | 441 |
| 612 | 3300009036 | Ga0105244_10001876 | Ga0105244_1000187614 | 441 |
| 613 | 3300009036 | Ga0105244_10023140 | Ga0105244_100231402 | 441 |
| 614 | 3300009092 | Ga0105250_10000262 | Ga0105250_1000026224 | 441 |
| 615 | 3300009092 | Ga0105250_10001432 | Ga0105250_100014322 | 441 |
| 616 | 3300009092 | Ga0105250_10006801 | Ga0105250_100068014 | 441 |
| 617 | 3300009093 | Ga0105240_10019300 | Ga0105240_100193003 | 441 |
| 618 | 3300009093 | Ga0105240_10032759 | Ga0105240_100327593 | 441 |
| 619 | 3300009093 | Ga0105240_10062207 | Ga0105240_100622073 | 441 |
| 620 | 3300009093 | Ga0105240_10444193 | Ga0105240_104441931 | 441 |
| 621 | 3300009101 | Ga0105247_10000126 | Ga0105247_1000012639 | 441 |
| 622 | 3300009101 | Ga0105247_10001692 | Ga0105247_100016923 | 441 |
| 623 | 3300009101 | Ga0105247_10014469 | Ga0105247_100144695 | 441 |
| 624 | 3300009177 | Ga0105248_10035560 | Ga0105248_100355604 | 441 |
| 625 | 3300009177 | Ga0105248_10146606 | Ga0105248_101466062 | 441 |
| 626 | 3300009551 | Ga0105238_10061080 | Ga0105238_100610804 | 441 |
| 627 | 3300009551 | Ga0105238_10139338 | Ga0105238_101393383 | 441 |
| 628 | 3300009551 | Ga0105238_10228572 | Ga0105238_102285722 | 441 |
| 629 | 3300009553 | Ga0105249_10032674 | Ga0105249_100326744 | 441 |
| 630 | 3300009553 | Ga0105249_10055667 | Ga0105249_100556672 | 441 |
| 631 | 3300010375 | Ga0105239_10095426 | Ga0105239_100954262 | 441 |
| 632 | 3300010375 | Ga0105239_10205732 | Ga0105239_102057322 | 441 |
| 633 | 3300013100 | Ga0157373_10079939 | Ga0157373_100799392 | 441 |
| 634 | 3300013102 | Ga0157371_10000327 | Ga0157371_100003272 | 441 |
| 635 | 3300013102 | Ga0157371_10014898 | Ga0157371_100148981 | 441 |
| 636 | 3300013105 | Ga0157369_10146846 | Ga0157369_101468462 | 441 |
| 637 | 3300013105 | Ga0157369_10165560 | Ga0157369_101655601 | 441 |
| 638 | 3300013306 | Ga0163162_10051398 | Ga0163162_100513983 | 441 |
| 639 | 3300013306 | Ga0163162_10060598 | Ga0163162_100605983 | 441 |
| 640 | 3300013307 | Ga0157372_10015969 | Ga0157372_100159697 | 441 |
| 641 | 3300013307 | Ga0157372_10064539 | Ga0157372_100645395 | 441 |
| 642 | 3300014325 | Ga0163163_10001793 | Ga0163163_1000179313 | 441 |
| 643 | 3300014325 | Ga0163163_10111894 | Ga0163163_101118942 | 441 |
| 644 | 3300014497 | Ga0182008_10055257 | Ga0182008_100552572 | 441 |
| 645 | 3300014968 | Ga0157379_10036011 | Ga0157379_100360112 | 441 |
| 646 | 3300014968 | Ga0157379_10259622 | Ga0157379_102596222 | 441 |
| 647 | 3300015262 | Ga0182007_10001346 | Ga0182007_100013462 | 441 |
| 648 | 3300015265 | Ga0182005_1002932 | Ga0182005_10029322 | 441 |
| 649 | 3300025207 | Ga0209760_100048 | Ga0209760_10004813 | 441 |
| 650 | 3300025224 | Ga0209784_100001 | Ga0209784_100001533 | 441 |
| 651 | 3300025225 | Ga0209566_100001 | Ga0209566_100001533 | 441 |
| 652 | 3300025226 | Ga0209674_100002 | Ga0209674_100002533 | 441 |
| 653 | 3300025230 | Ga0209563_100008 | Ga0209563_100008536 | 441 |
| 654 | 3300025231 | Ga0207427_100002 | Ga0207427_100002744 | 441 |
| 655 | 3300025233 | Ga0209437_100046 | Ga0209437_100046338 | 441 |
| 656 | 3300025253 | Ga0209677_100004 | Ga0209677_100004536 | 441 |
| 657 | 3300025261 | Ga0209233_1004556 | Ga0209233_10045562 | 441 |
| 658 | 3300025711 | Ga0207696_1000375 | Ga0207696_100037530 | 441 |
| 659 | 3300025711 | Ga0207696_1000973 | Ga0207696_10009732 | 441 |
| 660 | 3300025711 | Ga0207696_1004745 | Ga0207696_10047452 | 441 |
| 661 | 3300025728 | Ga0207655_1000126 | Ga0207655_1000126133 | 441 |
| 662 | 3300025728 | Ga0207655_1002995 | Ga0207655_10029958 | 441 |
| 663 | 3300025735 | Ga0207713_1021063 | Ga0207713_10210632 | 441 |
| 664 | 3300025735 | Ga0207713_1021500 | Ga0207713_10215002 | 441 |
| 665 | 3300025900 | Ga0207710_10005014 | Ga0207710_100050143 | 441 |
| 666 | 3300025903 | Ga0207680_10020012 | Ga0207680_100200122 | 441 |
| 667 | 3300025904 | Ga0207647_10035047 | Ga0207647_100350472 | 441 |
| 668 | 3300025912 | Ga0207707_10000592 | Ga0207707_100005924 | 441 |
| 669 | 3300025912 | Ga0207707_10030460 | Ga0207707_100304602 | 441 |
| 670 | 3300025913 | Ga0207695_10022323 | Ga0207695_100223237 | 441 |
| 671 | 3300025913 | Ga0207695_10026839 | Ga0207695_100268397 | 441 |
| 672 | 3300025913 | Ga0207695_10037128 | Ga0207695_100371283 | 441 |
| 673 | 3300025913 | Ga0207695_10092601 | Ga0207695_100926011 | 441 |
| 674 | 3300025917 | Ga0207660_10041342 | Ga0207660_100413423 | 441 |
| 675 | 3300025921 | Ga0207652_10009857 | Ga0207652_100098574 | 441 |
| 676 | 3300025921 | Ga0207652_10046115 | Ga0207652_100461153 | 441 |
| 677 | 3300025921 | Ga0207652_10102565 | Ga0207652_101025653 | 441 |
| 678 | 3300025931 | Ga0207644_10010630 | Ga0207644_100106306 | 441 |
| 679 | 3300025941 | Ga0207711_10030506 | Ga0207711_100305064 | 441 |
| 680 | 3300025949 | Ga0207667_10043209 | Ga0207667_100432095 | 441 |
| 681 | 3300025949 | Ga0207667_10135135 | Ga0207667_101351352 | 441 |
| 682 | 3300025986 | Ga0207658_10001415 | Ga0207658_1000141517 | 441 |
| 683 | 3300026035 | Ga0207703_10000299 | Ga0207703_1000029941 | 441 |
| 684 | 3300026035 | Ga0207703_10000362 | Ga0207703_1000036215 | 441 |
| 685 | 3300026088 | Ga0207641_10000189 | Ga0207641_100001897 | 441 |
| 686 | 3300026118 | Ga0207675_100131037 | Ga0207675_1001310372 | 441 |
| 687 | 3300027312 | Ga0209371_1000002 | Ga0209371_10000021323 | 441 |
| 688 | 3300027312 | Ga0209371_1000731 | Ga0209371_10007316 | 441 |
| 689 | 3300027312 | Ga0209371_1000832 | Ga0209371_10008329 | 441 |
| 690 | 3300028379 | Ga0268266_10000604 | Ga0268266_1000060436 | 441 |
| 691 | 3300028379 | Ga0268266_10000886 | Ga0268266_1000088624 | 441 |
| 692 | 3300028380 | Ga0268265_10009074 | Ga0268265_100090744 | 441 |
| 693 | 3300028380 | Ga0268265_10101110 | Ga0268265_101011102 | 441 |
| 694 | 3300028381 | Ga0268264_10000164 | Ga0268264_1000016467 | 441 |
| 695 | 3300028381 | Ga0268264_10020390 | Ga0268264_100203902 | 441 |
| 696 | 3300028563 | Ga0265319_1038052 | Ga0265319_10380521 | 441 |
| 697 | 3300028573 | Ga0265334_10001041 | Ga0265334_100010414 | 441 |
| 698 | 3300028577 | Ga0265318_10000626 | Ga0265318_100006268 | 441 |
| 699 | 3300030500 | Ga0268256_1000002 | Ga0268256_1000002139 | 441 |
| 700 | 3300030500 | Ga0268256_1000815 | Ga0268256_10008156 | 441 |
| 701 | 3300030521 | Ga0307511_10003176 | Ga0307511_100031765 | 441 |
| 702 | 3300031238 | Ga0265332_10014061 | Ga0265332_100140612 | 441 |
| 703 | 3300031241 | Ga0265325_10034982 | Ga0265325_100349822 | 441 |
| 704 | 3300031247 | Ga0265340_10032357 | Ga0265340_100323572 | 441 |
| 705 | 3300031507 | Ga0307509_10000002 | Ga0307509_1000000248 | 441 |
| 706 | 3300031616 | Ga0307508_10193376 | Ga0307508_101933762 | 441 |
| 707 | 3300031711 | Ga0265314_10039898 | Ga0265314_100398983 | 441 |
| 708 | 3300033180 | Ga0307510_10000007 | Ga0307510_10000007369 | 441 |
| 709 | 3300033180 | Ga0307510_10012240 | Ga0307510_100122407 | 441 |
| 710 | 3300035398 | Ga0316574_0129573 | Ga0316574_0129573_174_1574 | 441 |
| 711 | 3300035398 | Ga0316574_0139387 | Ga0316574_0139387_85_1485 | 441 |
| 712 | 3300035695 | Ga0373927_0037991 | Ga0373927_0037991_1111_2466 | 441 |
| 713 | 3300039438 | Ga0436360_0322345 | Ga0436360_0322345_425_1786 | 441 |
| 714 | 3300041405 | Ga0439438_000002 | Ga0439438_000002_174343_175725 | 441 |
| 715 | 3300041405 | Ga0439438_000601 | Ga0439438_000601_11549_12928 | 441 |
| 716 | 3300041407 | Ga0439447_001811 | Ga0439447_001811_1392_2771 | 441 |
| 717 | 3300041411 | Ga0439466_0000001 | Ga0439466_0000001_212284_213666 | 441 |
| 718 | 3300042006 | Ga0439432_000295 | Ga0439432_000295_15095_16477 | 441 |
| 719 | 3300042184 | Ga0450908_000113 | Ga0450908_000113_6498_7904 | 441 |
| 720 | 3300044650 | Ga0466986_0077623 | Ga0466986_0077623_41_1423 | 441 |
| 721 | 3300044672 | Ga0466982_0000029 | Ga0466982_0000029_5650_7032 | 441 |
| 722 | 3300044684 | Ga0466966_0023085 | Ga0466966_0023085_1216_2586 | 441 |
| 723 | 3300045049 | Ga0466959_0014509 | Ga0466959_0014509_3481_4851 | 441 |
| 724 | 3300045049 | Ga0466959_0050326 | Ga0466959_0050326_130_1485 | 441 |
| 725 | 3300046452 | Ga0495617_000122 | Ga0495617_000122_44178_45557 | 441 |
| 726 | 3300046471 | Ga0495650_0000004 | Ga0495650_0000004_635873_637252 | 441 |
| 727 | 3300046491 | Ga0495584_0001870 | Ga0495584_0001870_8774_10117 | 441 |
| 728 | 3300046492 | Ga0495585_0011933 | Ga0495585_0011933_2303_3685 | 441 |
| 729 | 3300046500 | Ga0495596_0020607 | Ga0495596_0020607_754_2139 | 441 |
| 730 | 3300046501 | Ga0495607_0000008 | Ga0495607_0000008_155198_156577 | 441 |
| 731 | 3300046506 | Ga0495583_0000833 | Ga0495583_0000833_36267_37610 | 441 |
| 732 | 3300046515 | Ga0495620_0000182 | Ga0495620_0000182_5850_7193 | 441 |
| 733 | 3300046515 | Ga0495620_0000216 | Ga0495620_0000216_36695_38074 | 441 |
| 734 | 3300046522 | Ga0495643_0073189 | Ga0495643_0073189_260_1615 | 441 |
| 735 | 3300046530 | Ga0495654_0000009 | Ga0495654_0000009_114801_116180 | 441 |
| 736 | 3300046648 | Ga0495611_0000023 | Ga0495611_0000023_66733_68076 | 441 |
| 737 | 3300046648 | Ga0495611_0002701 | Ga0495611_0002701_101_1444 | 441 |
| 738 | 3300046810 | Ga0495660_0000013 | Ga0495660_0000013_14773_16152 | 441 |
| 739 | 3300047320 | Ga0495672_0000015 | Ga0495672_0000015_469542_470924 | 441 |
| 740 | 3300047323 | Ga0495683_0005979 | Ga0495683_0005979_612_1991 | 441 |
| 741 | 3300047446 | Ga0495679_007808 | Ga0495679_007808_1235_2617 | 441 |
| 742 | 3300047469 | Ga0495673_0000036 | Ga0495673_0000036_269358_270704 | 441 |
| 743 | 3300047470 | Ga0495681_0030972 | Ga0495681_0030972_163_1527 | 441 |
| 744 | 3300047470 | Ga0495681_0033177 | Ga0495681_0033177_919_2298 | 441 |
| 745 | 3300047472 | Ga0495686_0000608 | Ga0495686_0000608_41026_42405 | 441 |
| 746 | 3300047472 | Ga0495686_0019088 | Ga0495686_0019088_173_1516 | 441 |
| 747 | 3300048907 | Ga0496104_0002393 | Ga0496104_0002393_12874_14253 | 441 |
| 748 | 3300048907 | Ga0496104_0198496 | Ga0496104_0198496_180_1553 | 441 |
| 749 | 3300048908 | Ga0496105_0108068 | Ga0496105_0108068_413_1786 | 441 |
| 750 | 3300048911 | Ga0496108_0202737 | Ga0496108_0202737_95_1450 | 441 |
| 751 | 3300048915 | Ga0496112_0027540 | Ga0496112_0027540_828_2183 | 441 |
| 752 | 3300048918 | Ga0496115_0000092 | Ga0496115_0000092_58577_59920 | 441 |
| 753 | 3300048918 | Ga0496115_0113082 | Ga0496115_0113082_828_2186 | 441 |
| 754 | 3300048919 | Ga0496116_0000016 | Ga0496116_0000016_504560_505939 | 441 |
| 755 | 3300048919 | Ga0496116_0010613 | Ga0496116_0010613_1922_3304 | 441 |
| 756 | 3300048920 | Ga0496117_0000038 | Ga0496117_0000038_279390_280742 | 441 |
| 757 | 3300048920 | Ga0496117_0016308 | Ga0496117_0016308_4372_5754 | 441 |
| 758 | 3300048920 | Ga0496117_0047295 | Ga0496117_0047295_1092_2471 | 441 |
| 759 | 3300048921 | Ga0496118_0000019 | Ga0496118_0000019_378008_379360 | 441 |
| 760 | 3300048921 | Ga0496118_0000837 | Ga0496118_0000837_12225_13604 | 441 |
| 761 | 3300048921 | Ga0496118_0012786 | Ga0496118_0012786_2260_3642 | 441 |
| 762 | 3300048921 | Ga0496118_0013890 | Ga0496118_0013890_5820_7199 | 441 |
| 763 | 3300048922 | Ga0496119_0000352 | Ga0496119_0000352_33682_35055 | 441 |
| 764 | 3300048922 | Ga0496119_0020140 | Ga0496119_0020140_1321_2673 | 441 |
| 765 | 3300048922 | Ga0496119_0027119 | Ga0496119_0027119_1724_3106 | 441 |
| 766 | 3300048922 | Ga0496119_0071834 | Ga0496119_0071834_298_1650 | 441 |
| 767 | 3300048923 | Ga0496120_0000649 | Ga0496120_0000649_11171_12523 | 441 |
| 768 | 3300048923 | Ga0496120_0000673 | Ga0496120_0000673_27571_28944 | 441 |
| 769 | 3300048923 | Ga0496120_0000711 | Ga0496120_0000711_32311_33693 | 441 |
| 770 | 3300048923 | Ga0496120_0044321 | Ga0496120_0044321_838_2217 | 441 |
| 771 | 3300048924 | Ga0496121_0001023 | Ga0496121_0001023_24382_25737 | 441 |
| 772 | 3300048924 | Ga0496121_0005264 | Ga0496121_0005264_12356_13735 | 441 |
| 773 | 3300048924 | Ga0496121_0037779 | Ga0496121_0037779_580_1932 | 441 |
| 774 | 3300048925 | Ga0496122_0000056 | Ga0496122_0000056_104128_105507 | 441 |
| 775 | 3300048926 | Ga0496123_0000041 | Ga0496123_0000041_104128_105507 | 441 |
| 776 | 3300048926 | Ga0496123_0035617 | Ga0496123_0035617_938_2320 | 441 |
| 777 | 3300048927 | Ga0496124_0000010 | Ga0496124_0000010_571511_572890 | 441 |
| 778 | 3300048927 | Ga0496124_0000484 | Ga0496124_0000484_64323_65705 | 441 |
| 779 | 3300048927 | Ga0496124_0002027 | Ga0496124_0002027_19246_20622 | 441 |
| 780 | 3300048927 | Ga0496124_0047628 | Ga0496124_0047628_1581_2933 | 441 |
| 781 | 3300048928 | Ga0496125_0000113 | Ga0496125_0000113_104631_106010 | 441 |
| 782 | 3300048928 | Ga0496125_0001231 | Ga0496125_0001231_8324_9691 | 441 |
| 783 | 3300048928 | Ga0496125_0004334 | Ga0496125_0004334_1679_3061 | 441 |
| 784 | 3300048928 | Ga0496125_0050361 | Ga0496125_0050361_875_2227 | 441 |
| 785 | 3300048929 | Ga0496126_0004182 | Ga0496126_0004182_1444_2823 | 441 |
| 786 | 3300048929 | Ga0496126_0052462 | Ga0496126_0052462_176_1528 | 441 |
| 787 | 3300048929 | Ga0496126_0057538 | Ga0496126_0057538_1569_2936 | 441 |
| 788 | 3300048929 | Ga0496126_0217647 | Ga0496126_0217647_95_1450 | 441 |
| 789 | 3300049459 | Ga0495678_027670 | Ga0495678_027670_898_2280 | 441 |
| 790 | 3300049460 | Ga0495682_0000283 | Ga0495682_0000283_38006_39349 | 441 |
| 791 | 3300049576 | Ga0501040_0009480 | Ga0501040_0009480_4609_5982 | 441 |
| 792 | 3300053092 | Ga0500583_0061057 | Ga0500583_0061057_410_1762 | 441 |
| 793 | 3300053104 | Ga0500556_0000395 | Ga0500556_0000395_12444_13790 | 441 |
| 794 | 3300053153 | Ga0500616_0000019 | Ga0500616_0000019_131878_133233 | 441 |
| 795 | 3300053153 | Ga0500616_0040898 | Ga0500616_0040898_472_1836 | 441 |
| 796 | 3300053178 | Ga0500637_0010124 | Ga0500637_0010124_623_1978 | 441 |
| 797 | iso_pu_bacteria | 2585427591 | 2585827970 | 441 |
| 798 | iso_pu_bacteria | 2585427592 | 2585830982 | 441 |
| 799 | iso_pu_bacteria | 2600255256 | 2601534827 | 441 |
| 800 | iso_pu_bacteria | 2600255257 | 2601539544 | 441 |
| 801 | iso_pu_bacteria | 2600255310 | 2601757894 | 441 |
| 802 | iso_pu_bacteria | 2600255311 | 2601764252 | 441 |
| 803 | iso_pu_bacteria | 2602042109 | 2603868771 | 441 |
| 804 | iso_pu_bacteria | 2667528173 | 2671106250 | 441 |
| 805 | iso_pu_bacteria | 2791354903 | 2791922032 | 441 |
| 806 | iso_pu_bacteria | 2847085930 | 2847086785 | 441 |
| 807 | iso_pu_bacteria | 2904474040 | 2904474611 | 441 |
| 808 | iso_pu_bacteria | 2919150387 | 2919150957 | 441 |
| 809 | iso_pu_bacteria | 2927143783 | 2927145831 | 441 |
| 810 | iso_pu_bacteria | 2929297113 | 2929298565 | 441 |
| 811 | iso_pu_bacteria | 2939602548 | 2939606002 | 441 |
| 812 | iso_pu_bacteria | 2971820967 | 2971822719 | 441 |
| 813 | iso_pu_bacteria | 8016733728 | 8016734435 | 441 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6nns-assembly1.cif.gz_A | xanthomonas citri phospho-pgm in complex with glucose-6-phosphate | 0.9689 | 2 | 438 |
| 6nns-assembly1.cif.gz_A | xanthomonas citri phospho-pgm in complex with glucose-6-phosphate | 0.9602 | 2 | 438 |
| 1wqa-assembly1.cif.gz_A | crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ | 0.8993 | 2 | 439 |
| 1wqa-assembly1.cif.gz_A | crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ | 0.8935 | 2 | 439 |
| 7olh-assembly3.cif.gz_E | bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) | 0.8905 | 3 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bmpA03 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9952 | 239 | 354 | 3.40.120.10 |
| 5bmpA04 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.9714 | 358 | 438 | 3.30.310.50 |
| af_P24175_2_147_3.40.120.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9711 | 3 | 142 | 3.40.120.10 |
| af_O86374_256_373_3.40.120.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9652 | 239 | 353 | 3.40.120.10 |
| 5bmpA03 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9621 | 239 | 354 | 3.40.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5Y3XAS8-F1-model_v4 | Phosphomannomutase CpsG (EC 5.4.2.8) | 0.9933 | 217 | 438 |
GO:0004615
GO:0005975 |
| AF-A0A505CHV4-F1-model_v4 | Phosphomannomutase CpsG (EC 5.4.2.8) | 0.9902 | 262 | 440 |
GO:0004615
GO:0005975 |
| AF-A0A7V0ZK01-F1-model_v4 | Phosphomannomutase | 0.9883 | 248 | 440 |
GO:0005975
GO:0016868 |
| AF-A0A379ST70-F1-model_v4 | Phosphomannomutase (EC 5.4.2.10, EC 5.4.2.8) | 0.9867 | 291 | 438 |
GO:0004615
GO:0005975 GO:0008966 |
| AF-A0A609FGB3-F1-model_v4 | Phosphomannomutase CpsG (EC 5.4.2.8) | 0.9866 | 291 | 438 |
GO:0004615
GO:0005975 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar