F481897
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 812 | 620 | 458 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0210545|Ga0436364_0210545_377_1315 |
| Length | 312 |
| Sequence | MIDAIARTDQEISEVAAELEAAGPRLIDRPERLSWDSRLRTTITVYIPLAIFVIVLLFPFYWMAITAIKPDYEMYDYKTYNPFWVHSPTLHNIEVLLLQTNYPRWLMITMGIAVAATFLSVGSSVLAAYAIERLRFRGAEHAGLLIYLAYLVPPSILFIPLATLIYQFGLFDNPVALILTYPTFLVPFCTWLLIGYFKSIPYELEECALIDGASRLQILRRITLPLAVPGLISAGIFAFTLSWNEFIYALAFIQSTDRKTVPVAILTELVTGDVYQWGALMAGSLLGSIPVALIYSFFVEYYVSSMTGAVKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 12 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 13 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 14 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 15 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 16 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 17 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 18 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 19 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 20 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 21 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 22 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 23 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 24 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 25 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 26 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 27 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 28 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 29 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 30 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 31 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 32 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 33 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 34 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 35 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 36 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 37 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 38 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 39 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 40 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 41 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 42 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 43 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 44 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 45 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 46 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 47 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 48 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 49 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 50 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 51 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 52 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 53 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 54 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 55 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 56 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 57 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 58 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 59 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 60 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 61 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 62 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 63 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 64 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 65 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 66 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 67 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 68 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 69 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 70 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 71 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 72 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 73 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 74 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 75 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 76 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 77 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 78 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 79 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 80 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 81 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 82 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 83 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 84 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 85 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 86 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 87 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 88 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 89 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 90 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 91 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 92 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 93 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 94 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 95 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 96 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 97 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 98 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 99 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 100 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 101 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 102 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 103 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 104 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 105 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 106 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 107 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 108 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 109 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 110 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 111 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 112 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 113 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 114 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 115 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 116 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 117 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 118 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 119 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 120 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 121 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 122 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 123 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 124 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 125 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 126 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 127 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 128 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 129 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 130 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 131 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 132 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 133 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 134 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 135 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 136 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 137 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 138 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 139 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 140 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 141 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 142 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 143 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 144 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 145 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 146 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 147 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 148 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 149 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 150 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 151 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 152 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 153 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 154 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 155 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 156 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 157 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 158 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 159 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 160 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 161 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 162 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 163 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 164 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 165 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 166 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 167 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 168 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 169 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 170 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 171 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 172 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 173 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 174 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 175 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 176 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 177 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 178 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 179 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 180 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 181 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 182 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 183 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 184 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 185 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 186 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 187 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 188 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 189 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 190 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 191 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 192 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 193 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 194 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 195 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 196 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 197 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 198 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 199 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 200 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 201 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 202 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 203 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 204 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 205 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 206 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 207 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 208 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 209 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 210 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 211 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 212 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 213 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 214 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 215 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 216 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 217 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 218 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 219 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 220 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 221 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 222 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 223 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 224 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 225 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 226 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 227 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 228 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 229 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 230 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 231 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 232 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 233 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 234 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 235 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 236 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 237 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 238 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 239 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 240 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 241 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 242 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 243 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 244 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 245 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 246 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 247 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 248 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 249 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 250 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 251 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 252 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 253 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 254 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 255 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 256 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 257 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 258 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 259 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 260 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 261 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 262 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 263 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 264 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 265 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 266 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 267 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 268 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 269 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 270 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 271 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 272 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 273 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 274 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 275 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 276 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 277 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 278 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 279 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 280 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 281 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 282 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 283 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 284 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 285 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 286 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 287 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 288 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 289 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 290 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 291 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 292 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 293 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 294 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 295 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 296 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 297 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 298 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 299 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 300 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 301 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 302 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 303 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 304 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 305 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 306 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 307 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 308 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 309 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 310 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 311 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 312 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 313 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 314 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 315 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 316 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 317 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 318 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 319 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 320 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 321 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 322 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 323 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 324 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 325 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 326 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 328 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 329 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 330 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 331 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 332 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 333 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 334 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 337 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 339 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 340 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 341 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 343 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 344 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 345 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 346 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 347 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 348 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 349 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 350 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 352 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 353 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 354 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 355 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 356 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 357 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 358 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 359 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 360 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 361 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 362 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 364 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 365 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 366 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 367 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 368 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 369 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 370 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 371 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 372 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 373 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 374 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 375 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 376 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 377 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 378 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 379 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 384 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 385 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 386 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 387 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 388 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 389 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 395 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 397 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 398 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 399 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 400 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 401 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 402 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 403 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 404 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 405 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 407 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 409 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 411 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 412 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 413 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 415 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 416 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 417 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 419 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 449 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 450 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 453 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 454 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 455 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 456 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 457 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 458 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 459 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 460 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 461 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 462 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 463 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 464 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 465 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 466 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 467 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 468 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 469 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 470 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 471 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 472 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 473 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 474 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 475 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 476 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 477 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 478 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 479 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 480 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 481 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 482 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 483 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 484 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 485 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 486 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 511 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 512 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 513 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 514 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 515 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 516 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 517 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 518 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 519 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 520 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 521 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 522 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 523 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 524 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 525 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 526 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 527 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 528 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 529 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 530 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 534 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 537 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 541 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 547 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 548 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 549 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 550 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 551 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 552 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 553 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 554 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 559 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 560 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 561 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 562 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 563 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 564 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 565 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 566 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 567 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 568 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 570 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 571 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 572 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 573 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 574 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 575 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 576 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 577 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 578 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 579 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 580 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 581 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 582 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 583 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 584 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 585 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 586 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 587 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 588 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 589 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 590 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 591 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 592 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 593 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 594 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 595 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 596 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 597 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 598 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 599 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 600 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 601 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 602 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 603 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 604 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 605 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 606 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 607 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 608 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 609 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 610 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 611 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 612 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 613 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 614 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 615 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 616 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 617 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 618 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 619 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 620 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.16 |
| Metatranscriptomes | 0.25 |
| Isolates | 43.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.38 |
| Nodule | 38.3 |
| Rhizoplane | 1.6 |
| Rhizosphere | 33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1000448 | 3300002739 | Bacteria | 8533 |
| 2 | JGI25152J39213_1005931 | 3300002773 | Bacteria | 3437 |
| 3 | JGI25159J45721_1004075 | 3300002987 | Bacteria | 4958 |
| 4 | JGI25159J45721_1008482 | 3300002987 | Bacteria | 2818 |
| 5 | JGI25151J46595_10000458 | 3300003187 | Bacteria | 39262 |
| 6 | JGI25151J46595_10000508 | 3300003187 | Bacteria | 36520 |
| 7 | JGI25406J46586_10000433 | 3300003203 | Bacteria | 19355 |
| 8 | JGI25153J46596_10002535 | 3300003215 | Bacteria | 10466 |
| 9 | JGI25153J46596_10010647 | 3300003215 | Bacteria | 4140 |
| 10 | JGI25153J46596_10014909 | 3300003215 | Bacteria | 3199 |
| 11 | JGI25160J50197_1003716 | 3300003354 | Bacteria | 6735 |
| 12 | JGI25160J50197_1040511 | 3300003354 | Bacteria | 1079 |
| 13 | JGI25161J50226_1000075 | 3300003374 | Bacteria | 84775 |
| 14 | JGI25161J50226_1006294 | 3300003374 | Bacteria | 2167 |
| 15 | JGI25404J52841_10000339 | 3300003659 | Bacteria | 6235 |
| 16 | JGI25404J52841_10016648 | 3300003659 | Bacteria | 1595 |
| 17 | Ga0055542_1003894 | 3300003762 | Bacteria | 3838 |
| 18 | Ga0055526_1000017 | 3300003771 | Bacteria | 210613 |
| 19 | Ga0055526_1005597 | 3300003771 | Bacteria | 7157 |
| 20 | Ga0055526_1024737 | 3300003771 | Bacteria | 1951 |
| 21 | Ga0055524_1000014 | 3300003775 | Bacteria | 259417 |
| 22 | Ga0055524_1010792 | 3300003775 | Bacteria | 3614 |
| 23 | Ga0055528_1000054 | 3300003790 | Bacteria | 90334 |
| 24 | Ga0055528_1002349 | 3300003790 | Bacteria | 10235 |
| 25 | Ga0055540_1000255 | 3300003792 | Bacteria | 48177 |
| 26 | Ga0055540_1025147 | 3300003792 | Bacteria | 1464 |
| 27 | Ga0055531_10016286 | 3300003794 | Bacteria | 3216 |
| 28 | Ga0055531_10046365 | 3300003794 | Bacteria | 1195 |
| 29 | Ga0055543_1000096 | 3300004625 | Bacteria | 75972 |
| 30 | Ga0055543_1000578 | 3300004625 | Bacteria | 20193 |
| 31 | Ga0055543_1008108 | 3300004625 | Bacteria | 2356 |
| 32 | Ga0058862_12352147 | 3300004803 | Bacteria | 1728 |
| 33 | Ga0065165_1000231 | 3300005262 | Bacteria | 97237 |
| 34 | Ga0065165_1007353 | 3300005262 | Bacteria | 5443 |
| 35 | Ga0065165_1011236 | 3300005262 | Bacteria | 3763 |
| 36 | Ga0065715_10161723 | 3300005293 | Bacteria | 1620 |
| 37 | Ga0065707_10039833 | 3300005295 | Bacteria | 1392 |
| 38 | Ga0065707_10117356 | 3300005295 | Bacteria | 2213 |
| 39 | Ga0070683_100440100 | 3300005329 | Bacteria | 1244 |
| 40 | Ga0070683_100473626 | 3300005329 | Bacteria | 1196 |
| 41 | Ga0070683_100492237 | 3300005329 | Bacteria | 1171 |
| 42 | Ga0070680_100034094 | 3300005336 | Bacteria | 4105 |
| 43 | Ga0070680_100064135 | 3300005336 | Bacteria | 3011 |
| 44 | Ga0070680_100098095 | 3300005336 | Bacteria | 2430 |
| 45 | Ga0068868_100011310 | 3300005338 | Bacteria | 6497 |
| 46 | Ga0070691_10003977 | 3300005341 | Bacteria | 6687 |
| 47 | Ga0070669_100400495 | 3300005353 | Bacteria | 1123 |
| 48 | Ga0070669_100666918 | 3300005353 | Bacteria | 876 |
| 49 | Ga0070674_100246652 | 3300005356 | Bacteria | 1401 |
| 50 | Ga0070659_100259525 | 3300005366 | Bacteria | 1441 |
| 51 | Ga0070667_100291403 | 3300005367 | Bacteria | 1468 |
| 52 | Ga0070713_100160398 | 3300005436 | Bacteria | 2007 |
| 53 | Ga0070713_100186107 | 3300005436 | Bacteria | 1869 |
| 54 | Ga0070700_100040608 | 3300005441 | Bacteria | 2849 |
| 55 | Ga0070694_100003712 | 3300005444 | Bacteria | 9106 |
| 56 | Ga0070694_100112115 | 3300005444 | Bacteria | 1945 |
| 57 | Ga0070663_100007767 | 3300005455 | Bacteria | 6551 |
| 58 | Ga0070678_100070667 | 3300005456 | Bacteria | 2611 |
| 59 | Ga0070681_10000393 | 3300005458 | Bacteria | 35383 |
| 60 | Ga0070681_10014505 | 3300005458 | Bacteria | 7842 |
| 61 | Ga0070681_10116057 | 3300005458 | Bacteria | 2614 |
| 62 | Ga0070707_100093884 | 3300005468 | Bacteria | 2905 |
| 63 | Ga0070698_100446600 | 3300005471 | Bacteria | 1229 |
| 64 | Ga0070679_100019403 | 3300005530 | Bacteria | 6610 |
| 65 | Ga0070679_100172761 | 3300005530 | Bacteria | 2134 |
| 66 | Ga0068853_100060577 | 3300005539 | Bacteria | 3271 |
| 67 | Ga0068853_100112670 | 3300005539 | Bacteria | 2418 |
| 68 | Ga0070686_100512241 | 3300005544 | Bacteria | 933 |
| 69 | Ga0070695_100100156 | 3300005545 | Bacteria | 1950 |
| 70 | Ga0070665_100175214 | 3300005548 | Bacteria | 2146 |
| 71 | Ga0070665_100277455 | 3300005548 | Bacteria | 1678 |
| 72 | Ga0070704_100003315 | 3300005549 | Bacteria | 9212 |
| 73 | Ga0068855_100513777 | 3300005563 | Bacteria | 1300 |
| 74 | Ga0070664_100061891 | 3300005564 | Bacteria | 3190 |
| 75 | Ga0070664_100169755 | 3300005564 | Bacteria | 1935 |
| 76 | Ga0068857_100013484 | 3300005577 | Bacteria | 7120 |
| 77 | Ga0068856_100002849 | 3300005614 | Bacteria | 17692 |
| 78 | Ga0068856_100072955 | 3300005614 | Bacteria | 3398 |
| 79 | Ga0068852_100002288 | 3300005616 | Bacteria | 13173 |
| 80 | Ga0068852_100071600 | 3300005616 | Bacteria | 3045 |
| 81 | Ga0068861_100075148 | 3300005719 | Bacteria | 2630 |
| 82 | Ga0068851_10131991 | 3300005834 | Bacteria | 1351 |
| 83 | Ga0068858_100132512 | 3300005842 | Bacteria | 2338 |
| 84 | Ga0081540_1000338 | 3300005983 | Bacteria | 48150 |
| 85 | Ga0081540_1003442 | 3300005983 | Bacteria | 12498 |
| 86 | Ga0081540_1005876 | 3300005983 | Bacteria | 9072 |
| 87 | Ga0081540_1006001 | 3300005983 | Bacteria | 8945 |
| 88 | Ga0081540_1014249 | 3300005983 | Bacteria | 5106 |
| 89 | Ga0081539_10000549 | 3300005985 | Bacteria | 77428 |
| 90 | Ga0070717_10082654 | 3300006028 | Bacteria | 2700 |
| 91 | Ga0075365_10005493 | 3300006038 | Bacteria | 6843 |
| 92 | Ga0075365_10016988 | 3300006038 | Bacteria | 4443 |
| 93 | Ga0075365_10116315 | 3300006038 | Bacteria | 1841 |
| 94 | Ga0075368_10062883 | 3300006042 | Bacteria | 1488 |
| 95 | Ga0075368_10092149 | 3300006042 | Bacteria | 1240 |
| 96 | Ga0075363_100002563 | 3300006048 | Bacteria | 7472 |
| 97 | Ga0075364_10000285 | 3300006051 | Bacteria | 24819 |
| 98 | Ga0075364_10317613 | 3300006051 | Bacteria | 1061 |
| 99 | Ga0075432_10016468 | 3300006058 | Bacteria | 2523 |
| 100 | Ga0075362_10006876 | 3300006177 | Bacteria | 4262 |
| 101 | Ga0075362_10061163 | 3300006177 | Bacteria | 1704 |
| 102 | Ga0075367_10002436 | 3300006178 | Bacteria | 8500 |
| 103 | Ga0075367_10008149 | 3300006178 | Bacteria | 5412 |
| 104 | Ga0075369_10083286 | 3300006186 | Bacteria | 1420 |
| 105 | Ga0075366_10096705 | 3300006195 | Bacteria | 1770 |
| 106 | Ga0075370_10139245 | 3300006353 | Bacteria | 1418 |
| 107 | Ga0075428_100092179 | 3300006844 | Bacteria | 3303 |
| 108 | Ga0075428_100097827 | 3300006844 | Bacteria | 3200 |
| 109 | Ga0075428_100250183 | 3300006844 | Bacteria | 1910 |
| 110 | Ga0075428_100358949 | 3300006844 | Bacteria | 1563 |
| 111 | Ga0075428_100427878 | 3300006844 | Bacteria | 1418 |
| 112 | Ga0075430_100109636 | 3300006846 | Bacteria | 2302 |
| 113 | Ga0075430_100119818 | 3300006846 | Bacteria | 2194 |
| 114 | Ga0075430_100248046 | 3300006846 | Bacteria | 1475 |
| 115 | Ga0075430_100275755 | 3300006846 | Bacteria | 1391 |
| 116 | Ga0075431_100004249 | 3300006847 | Bacteria | 14032 |
| 117 | Ga0075431_100015726 | 3300006847 | Bacteria | 7672 |
| 118 | Ga0075431_100247157 | 3300006847 | Bacteria | 1813 |
| 119 | Ga0075431_100342482 | 3300006847 | Bacteria | 1504 |
| 120 | Ga0075434_100116694 | 3300006871 | Bacteria | 2682 |
| 121 | Ga0075429_100073335 | 3300006880 | Bacteria | 2982 |
| 122 | Ga0105240_10011032 | 3300009093 | Bacteria | 12637 |
| 123 | Ga0105240_10097351 | 3300009093 | Bacteria | 3585 |
| 124 | Ga0105240_10119069 | 3300009093 | Bacteria | 3181 |
| 125 | Ga0105245_10214159 | 3300009098 | Bacteria | 1855 |
| 126 | Ga0114129_10042219 | 3300009147 | Bacteria | 6420 |
| 127 | Ga0114129_10228326 | 3300009147 | Bacteria | 2508 |
| 128 | Ga0105243_10108107 | 3300009148 | Bacteria | 2321 |
| 129 | Ga0105243_10342701 | 3300009148 | Bacteria | 1369 |
| 130 | Ga0105241_10297806 | 3300009174 | Bacteria | 1383 |
| 131 | Ga0123341_1000012 | 3300009765 | Bacteria | 105056 |
| 132 | Ga0123342_1012643 | 3300009766 | Bacteria | 8727 |
| 133 | Ga0105028_108689 | 3300009993 | Bacteria | 1063 |
| 134 | Ga0105239_10089511 | 3300010375 | Bacteria | 3394 |
| 135 | Ga0105239_10523033 | 3300010375 | Bacteria | 1350 |
| 136 | Ga0105246_10032074 | 3300011119 | Bacteria | 3481 |
| 137 | Ga0105246_10188245 | 3300011119 | Bacteria | 1595 |
| 138 | Ga0157370_10023801 | 3300013104 | Bacteria | 6076 |
| 139 | Ga0157370_10211933 | 3300013104 | Bacteria | 1795 |
| 140 | Ga0157370_10314929 | 3300013104 | Bacteria | 1444 |
| 141 | Ga0163162_10222678 | 3300013306 | Bacteria | 2016 |
| 142 | Ga0163162_10423863 | 3300013306 | Bacteria | 1463 |
| 143 | Ga0157372_10517315 | 3300013307 | Bacteria | 1391 |
| 144 | Ga0157375_10073454 | 3300013308 | Bacteria | 3439 |
| 145 | Ga0163163_10321085 | 3300014325 | Bacteria | 1602 |
| 146 | Ga0157380_10007607 | 3300014326 | Bacteria | 7700 |
| 147 | Ga0157380_10590924 | 3300014326 | Bacteria | 1097 |
| 148 | Ga0182008_10039986 | 3300014497 | Bacteria | 2342 |
| 149 | Ga0157376_10215584 | 3300014969 | Bacteria | 1775 |
| 150 | Ga0206350_11027389 | 3300020080 | Bacteria | 1104 |
| 151 | Ga0213873_10032919 | 3300021358 | Bacteria | 1298 |
| 152 | Ga0213874_10003165 | 3300021377 | Bacteria | 3626 |
| 153 | Ga0213876_10006880 | 3300021384 | Bacteria | 6200 |
| 154 | Ga0213876_10009074 | 3300021384 | Bacteria | 5355 |
| 155 | Ga0213876_10058498 | 3300021384 | Bacteria | 2035 |
| 156 | Ga0213875_10001033 | 3300021388 | Bacteria | 19652 |
| 157 | Ga0213875_10004683 | 3300021388 | Bacteria | 7452 |
| 158 | Ga0213875_10059905 | 3300021388 | Bacteria | 1781 |
| 159 | Ga0209436_100035 | 3300025208 | Bacteria | 79010 |
| 160 | Ga0209563_104900 | 3300025230 | Bacteria | 2497 |
| 161 | Ga0207425_1002132 | 3300025245 | Bacteria | 7266 |
| 162 | Ga0207425_1012579 | 3300025245 | Bacteria | 1981 |
| 163 | Ga0209677_101018 | 3300025253 | Bacteria | 13392 |
| 164 | Ga0209148_1000475 | 3300025254 | Bacteria | 42476 |
| 165 | Ga0209129_1003154 | 3300025258 | Bacteria | 7387 |
| 166 | Ga0209129_1005382 | 3300025258 | Bacteria | 4560 |
| 167 | Ga0209455_1001935 | 3300025272 | Bacteria | 8555 |
| 168 | Ga0209673_1000067 | 3300025273 | Bacteria | 249077 |
| 169 | Ga0209673_1000750 | 3300025273 | Bacteria | 44330 |
| 170 | Ga0209673_1001376 | 3300025273 | Bacteria | 23910 |
| 171 | Ga0209130_1000031 | 3300025284 | Bacteria | 322932 |
| 172 | Ga0209130_1000467 | 3300025284 | Bacteria | 41801 |
| 173 | Ga0209675_1002662 | 3300025291 | Bacteria | 9016 |
| 174 | Ga0209025_1000017 | 3300025294 | Bacteria | 768983 |
| 175 | Ga0209025_1000099 | 3300025294 | Bacteria | 231353 |
| 176 | Ga0209025_1000397 | 3300025294 | Bacteria | 89703 |
| 177 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 178 | Ga0209564_1000082 | 3300025295 | Bacteria | 261494 |
| 179 | Ga0209564_1000092 | 3300025295 | Bacteria | 249018 |
| 180 | Ga0209564_1000511 | 3300025295 | Bacteria | 63773 |
| 181 | Ga0209564_1000925 | 3300025295 | Bacteria | 38190 |
| 182 | Ga0209564_1022634 | 3300025295 | Bacteria | 2212 |
| 183 | Ga0209758_1000504 | 3300025297 | Bacteria | 63308 |
| 184 | Ga0209758_1000585 | 3300025297 | Bacteria | 56861 |
| 185 | Ga0209758_1001602 | 3300025297 | Bacteria | 25857 |
| 186 | Ga0209758_1005532 | 3300025297 | Bacteria | 9647 |
| 187 | Ga0209758_1007908 | 3300025297 | Bacteria | 7058 |
| 188 | Ga0209758_1019714 | 3300025297 | Bacteria | 3235 |
| 189 | Ga0209050_1004942 | 3300025298 | Bacteria | 8693 |
| 190 | Ga0209256_1000033 | 3300025299 | Bacteria | 393924 |
| 191 | Ga0209256_1000170 | 3300025299 | Bacteria | 130504 |
| 192 | Ga0209256_1000181 | 3300025299 | Bacteria | 123624 |
| 193 | Ga0209256_1004342 | 3300025299 | Bacteria | 8997 |
| 194 | Ga0209256_1015056 | 3300025299 | Bacteria | 2732 |
| 195 | Ga0209256_1022722 | 3300025299 | Bacteria | 1891 |
| 196 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 197 | Ga0207426_1000065 | 3300025302 | Bacteria | 353625 |
| 198 | Ga0207426_1000355 | 3300025302 | Bacteria | 83450 |
| 199 | Ga0207426_1012996 | 3300025302 | Bacteria | 3104 |
| 200 | Ga0209051_1000062 | 3300025303 | Bacteria | 251081 |
| 201 | Ga0209051_1009790 | 3300025303 | Bacteria | 4909 |
| 202 | Ga0209257_1000376 | 3300025304 | Bacteria | 89065 |
| 203 | Ga0209257_1000970 | 3300025304 | Bacteria | 39244 |
| 204 | Ga0209257_1037430 | 3300025304 | Bacteria | 1479 |
| 205 | Ga0207705_10225043 | 3300025909 | Bacteria | 1426 |
| 206 | Ga0207707_10100127 | 3300025912 | Bacteria | 2533 |
| 207 | Ga0207707_10425776 | 3300025912 | Bacteria | 1137 |
| 208 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 209 | Ga0207695_10087976 | 3300025913 | Bacteria | 3128 |
| 210 | Ga0207671_10010828 | 3300025914 | Bacteria | 7480 |
| 211 | Ga0207662_10197196 | 3300025918 | Bacteria | 1302 |
| 212 | Ga0207657_10060743 | 3300025919 | Bacteria | 3243 |
| 213 | Ga0207652_10075415 | 3300025921 | Bacteria | 2939 |
| 214 | Ga0207652_10119480 | 3300025921 | Bacteria | 2344 |
| 215 | Ga0207652_10326275 | 3300025921 | Bacteria | 1386 |
| 216 | Ga0207652_10469754 | 3300025921 | Bacteria | 1133 |
| 217 | Ga0207646_10053281 | 3300025922 | Bacteria | 3619 |
| 218 | Ga0207646_10078849 | 3300025922 | Bacteria | 2944 |
| 219 | Ga0207659_10142049 | 3300025926 | Bacteria | 1865 |
| 220 | Ga0207687_10071054 | 3300025927 | Bacteria | 2486 |
| 221 | Ga0207700_10010378 | 3300025928 | Bacteria | 5873 |
| 222 | Ga0207700_10276604 | 3300025928 | Bacteria | 1443 |
| 223 | Ga0207664_10343807 | 3300025929 | Bacteria | 1319 |
| 224 | Ga0207690_10222726 | 3300025932 | Bacteria | 1444 |
| 225 | Ga0207661_10281098 | 3300025944 | Bacteria | 1487 |
| 226 | Ga0207679_10018807 | 3300025945 | Bacteria | 4635 |
| 227 | Ga0207679_10299600 | 3300025945 | Bacteria | 1385 |
| 228 | Ga0207667_10049571 | 3300025949 | Bacteria | 4434 |
| 229 | Ga0207712_10190524 | 3300025961 | Bacteria | 1618 |
| 230 | Ga0207640_10144624 | 3300025981 | Bacteria | 1738 |
| 231 | Ga0207658_10028464 | 3300025986 | Bacteria | 3935 |
| 232 | Ga0207677_10012388 | 3300026023 | Bacteria | 4900 |
| 233 | Ga0207677_10414397 | 3300026023 | Bacteria | 1146 |
| 234 | Ga0207639_10105232 | 3300026041 | Bacteria | 2289 |
| 235 | Ga0207639_10124095 | 3300026041 | Bacteria | 2127 |
| 236 | Ga0207639_10290016 | 3300026041 | Bacteria | 1442 |
| 237 | Ga0207678_10020039 | 3300026067 | Bacteria | 5876 |
| 238 | Ga0207708_10058747 | 3300026075 | Bacteria | 2934 |
| 239 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 240 | Ga0207702_10053185 | 3300026078 | Bacteria | 3427 |
| 241 | Ga0207676_10145019 | 3300026095 | Bacteria | 2038 |
| 242 | Ga0207674_10149448 | 3300026116 | Bacteria | 2293 |
| 243 | Ga0207675_100177673 | 3300026118 | Bacteria | 2037 |
| 244 | Ga0207683_10099071 | 3300026121 | Bacteria | 2601 |
| 245 | Ga0207698_10033601 | 3300026142 | Bacteria | 3729 |
| 246 | Ga0209813_10073571 | 3300027866 | Bacteria | 1116 |
| 247 | Ga0207428_10059159 | 3300027907 | Bacteria | 3039 |
| 248 | Ga0207428_10074571 | 3300027907 | Bacteria | 2661 |
| 249 | Ga0268266_10003379 | 3300028379 | Bacteria | 15975 |
| 250 | Ga0268266_10087468 | 3300028379 | Bacteria | 2726 |
| 251 | Ga0268265_10178697 | 3300028380 | Bacteria | 1822 |
| 252 | Ga0307513_10213258 | 3300031456 | Bacteria | 1760 |
| 253 | Ga0307513_10269250 | 3300031456 | Bacteria | 1488 |
| 254 | Ga0265314_10010424 | 3300031711 | Bacteria | 7753 |
| 255 | Ga0307516_10023182 | 3300031730 | Bacteria | 6367 |
| 256 | Ga0307516_10196893 | 3300031730 | Bacteria | 1737 |
| 257 | Ga0307516_10393820 | 3300031730 | Bacteria | 1045 |
| 258 | Ga0307510_10008141 | 3300033180 | Bacteria | 12485 |
| 259 | Ga0373955_0043094 | 3300035172 | Bacteria | 2426 |
| 260 | Ga0373937_0191104 | 3300036401 | Bacteria | 1924 |
| 261 | Ga0373937_0274478 | 3300036401 | Bacteria | 1591 |
| 262 | Ga0395899_0005619 | 3300037312 | Bacteria | 9731 |
| 263 | Ga0395899_0013520 | 3300037312 | Bacteria | 6240 |
| 264 | Ga0395900_0003232 | 3300037418 | Bacteria | 17642 |
| 265 | Ga0395900_0008561 | 3300037418 | Bacteria | 10519 |
| 266 | Ga0395900_0018325 | 3300037418 | Bacteria | 7142 |
| 267 | Ga0395900_0529655 | 3300037418 | Bacteria | 1125 |
| 268 | Ga0395898_0007511 | 3300037466 | Bacteria | 11584 |
| 269 | Ga0395898_0009099 | 3300037466 | Bacteria | 10459 |
| 270 | Ga0395905_0014555 | 3300037471 | Bacteria | 7504 |
| 271 | Ga0436364_0063930 | 3300037853 | Bacteria | 4672 |
| 272 | Ga0436364_0103156 | 3300037853 | Bacteria | 17490 |
| 273 | Ga0436364_0210545 | 3300037853 | Bacteria | 2008 |
| 274 | Ga0436364_0533917 | 3300037853 | Bacteria | 9986 |
| 275 | Ga0436364_0642169 | 3300037853 | Bacteria | 25731 |
| 276 | Ga0436364_0659865 | 3300037853 | Bacteria | 47070 |
| 277 | Ga0436364_0674187 | 3300037853 | Bacteria | 9456 |
| 278 | Ga0436364_1379234 | 3300037853 | Bacteria | 5061 |
| 279 | Ga0395901_0011181 | 3300038443 | Bacteria | 9096 |
| 280 | Ga0395901_0012192 | 3300038443 | Bacteria | 8723 |
| 281 | Ga0395901_0159895 | 3300038443 | Bacteria | 2366 |
| 282 | Ga0395901_0456464 | 3300038443 | Bacteria | 1306 |
| 283 | Ga0436365_0138565 | 3300039437 | Bacteria | 8501 |
| 284 | Ga0436365_0481731 | 3300039437 | Bacteria | 2890 |
| 285 | Ga0436365_0712519 | 3300039437 | Bacteria | 10286 |
| 286 | Ga0436365_0879300 | 3300039437 | Bacteria | 3197 |
| 287 | Ga0436365_1535876 | 3300039437 | Bacteria | 20439 |
| 288 | Ga0436365_1736919 | 3300039437 | Bacteria | 6655 |
| 289 | Ga0436360_0178193 | 3300039438 | Bacteria | 6576 |
| 290 | Ga0436360_1090709 | 3300039438 | Bacteria | 1837 |
| 291 | Ga0436361_0606306 | 3300039447 | Bacteria | 2508 |
| 292 | Ga0436363_0282535 | 3300039450 | Bacteria | 16541 |
| 293 | Ga0436363_0472610 | 3300039450 | Bacteria | 6308 |
| 294 | Ga0436363_1477180 | 3300039450 | Bacteria | 2712 |
| 295 | Ga0436362_0822437 | 3300039453 | Bacteria | 5872 |
| 296 | Ga0439453_0001749 | 3300041408 | Bacteria | 2864 |
| 297 | Ga0451802_0956542 | 3300041460 | Bacteria | 1297 |
| 298 | Ga0451837_1690335 | 3300041494 | Bacteria | 1347 |
| 299 | Ga0451839_0668746 | 3300041496 | Bacteria | 1848 |
| 300 | Ga0451841_0665146 | 3300041498 | Bacteria | 1343 |
| 301 | Ga0451841_0873827 | 3300041498 | Bacteria | 1077 |
| 302 | Ga0451847_0365642 | 3300041503 | Bacteria | 1261 |
| 303 | Ga0451847_0833553 | 3300041503 | Bacteria | 3861 |
| 304 | Ga0451849_0492377 | 3300041505 | Bacteria | 3337 |
| 305 | Ga0451843_0493458 | 3300041509 | Bacteria | 1825 |
| 306 | Ga0451843_1370099 | 3300041509 | Bacteria | 1299 |
| 307 | Ga0451853_2198736 | 3300041512 | Bacteria | 5299 |
| 308 | Ga0439458_0027395 | 3300042157 | Bacteria | 1344 |
| 309 | Ga0439464_0028317 | 3300042439 | Bacteria | 1561 |
| 310 | Ga0451577_0013112 | 3300042876 | Bacteria | 7769 |
| 311 | Ga0466961_0000154 | 3300044693 | Bacteria | 46518 |
| 312 | Ga0466963_0044844 | 3300044694 | Bacteria | 2911 |
| 313 | Ga0466963_0145165 | 3300044694 | Bacteria | 1646 |
| 314 | Ga0466970_0024331 | 3300044765 | Bacteria | 3165 |
| 315 | Ga0451576_0000231 | 3300045051 | Bacteria | 136040 |
| 316 | Ga0466967_0008224 | 3300045976 | Bacteria | 7620 |
| 317 | Ga0495638_0000475 | 3300046460 | Bacteria | 48300 |
| 318 | Ga0495638_0017603 | 3300046460 | Bacteria | 4760 |
| 319 | Ga0495651_0017859 | 3300046462 | Bacteria | 5492 |
| 320 | Ga0495664_0077379 | 3300046477 | Bacteria | 1992 |
| 321 | Ga0495585_0058598 | 3300046492 | Bacteria | 2124 |
| 322 | Ga0495607_0021279 | 3300046501 | Bacteria | 4083 |
| 323 | Ga0495583_0117562 | 3300046506 | Bacteria | 1122 |
| 324 | Ga0495610_0068843 | 3300046512 | Bacteria | 1657 |
| 325 | Ga0495632_0054675 | 3300046519 | Bacteria | 1956 |
| 326 | Ga0495644_0047074 | 3300046523 | Bacteria | 1621 |
| 327 | Ga0495640_0145381 | 3300046533 | Bacteria | 1526 |
| 328 | Ga0495597_0018419 | 3300046542 | Bacteria | 3277 |
| 329 | Ga0495645_0029087 | 3300046543 | Bacteria | 4016 |
| 330 | Ga0495668_0091160 | 3300046616 | Bacteria | 1670 |
| 331 | Ga0495625_0065986 | 3300046660 | Bacteria | 2550 |
| 332 | Ga0495625_0149096 | 3300046660 | Bacteria | 1573 |
| 333 | Ga0495670_0079396 | 3300046691 | Bacteria | 1670 |
| 334 | Ga0495589_0196969 | 3300046794 | Bacteria | 952 |
| 335 | Ga0495660_0133140 | 3300046810 | Bacteria | 1245 |
| 336 | Ga0495604_0157604 | 3300047317 | Bacteria | 1607 |
| 337 | Ga0495680_0209890 | 3300047322 | Bacteria | 1394 |
| 338 | Ga0495683_0074182 | 3300047323 | Bacteria | 1668 |
| 339 | Ga0495687_097650 | 3300047443 | Bacteria | 1110 |
| 340 | Ga0495685_063961 | 3300047447 | Bacteria | 1238 |
| 341 | Ga0495681_0119790 | 3300047470 | Bacteria | 1131 |
| 342 | Ga0495686_0038269 | 3300047472 | Bacteria | 3068 |
| 343 | Ga0496100_0020009 | 3300048903 | Bacteria | 4006 |
| 344 | Ga0496102_0202039 | 3300048905 | Bacteria | 1873 |
| 345 | Ga0496103_0073279 | 3300048906 | Bacteria | 2145 |
| 346 | Ga0496104_0082985 | 3300048907 | Bacteria | 3056 |
| 347 | Ga0496105_0021632 | 3300048908 | Bacteria | 5205 |
| 348 | Ga0496107_0015042 | 3300048910 | Bacteria | 5421 |
| 349 | Ga0496108_0075698 | 3300048911 | Bacteria | 2844 |
| 350 | Ga0496110_0043688 | 3300048913 | Bacteria | 3913 |
| 351 | Ga0496111_0032362 | 3300048914 | Bacteria | 3728 |
| 352 | Ga0496112_0088237 | 3300048915 | Bacteria | 3069 |
| 353 | Ga0496114_0019685 | 3300048917 | Bacteria | 5470 |
| 354 | Ga0496115_0002706 | 3300048918 | Bacteria | 12727 |
| 355 | Ga0496116_0009436 | 3300048919 | Bacteria | 8312 |
| 356 | Ga0496117_0017924 | 3300048920 | Bacteria | 5895 |
| 357 | Ga0496117_0071594 | 3300048920 | Bacteria | 2322 |
| 358 | Ga0496117_0087353 | 3300048920 | Bacteria | 2022 |
| 359 | Ga0496118_0002068 | 3300048921 | Bacteria | 28261 |
| 360 | Ga0496118_0028344 | 3300048921 | Bacteria | 4718 |
| 361 | Ga0496119_0008868 | 3300048922 | Bacteria | 8749 |
| 362 | Ga0496120_0276800 | 3300048923 | Bacteria | 777 |
| 363 | Ga0496121_0000406 | 3300048924 | Bacteria | 85761 |
| 364 | Ga0496122_0023409 | 3300048925 | Bacteria | 5447 |
| 365 | Ga0496122_0026726 | 3300048925 | Bacteria | 4964 |
| 366 | Ga0496125_0000145 | 3300048928 | Bacteria | 156267 |
| 367 | Ga0496125_0000471 | 3300048928 | Bacteria | 71765 |
| 368 | Ga0496125_0010847 | 3300048928 | Bacteria | 9172 |
| 369 | Ga0501031_0013786 | 3300049568 | Bacteria | 5269 |
| 370 | Ga0501033_0010498 | 3300049570 | Bacteria | 7103 |
| 371 | Ga0501034_0022087 | 3300049571 | Bacteria | 6482 |
| 372 | Ga0501034_0036019 | 3300049571 | Bacteria | 5016 |
| 373 | Ga0501034_0096432 | 3300049571 | Bacteria | 2953 |
| 374 | Ga0501034_0145736 | 3300049571 | Bacteria | 2345 |
| 375 | Ga0501036_0666533 | 3300049572 | Bacteria | 861 |
| 376 | Ga0501037_0000107 | 3300049573 | Bacteria | 78666 |
| 377 | Ga0501037_0093876 | 3300049573 | Bacteria | 2169 |
| 378 | Ga0501037_0186493 | 3300049573 | Bacteria | 1470 |
| 379 | Ga0501038_0027545 | 3300049574 | Bacteria | 5056 |
| 380 | Ga0501038_0028509 | 3300049574 | Bacteria | 4961 |
| 381 | Ga0501038_0098912 | 3300049574 | Bacteria | 2432 |
| 382 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 383 | Ga0501043_0067753 | 3300049579 | Bacteria | 2803 |
| 384 | Ga0501046_0191968 | 3300049580 | Bacteria | 1523 |
| 385 | Ga0501047_0061392 | 3300049581 | Bacteria | 3627 |
| 386 | Ga0501069_0000033 | 3300049585 | Bacteria | 92477 |
| 387 | Ga0501070_0000913 | 3300049586 | Bacteria | 26864 |
| 388 | Ga0501073_0060391 | 3300049589 | Bacteria | 2646 |
| 389 | Ga0501074_0000571 | 3300049590 | Bacteria | 22782 |
| 390 | Ga0501076_0176737 | 3300049592 | Bacteria | 1740 |
| 391 | Ga0501083_0000355 | 3300049744 | Bacteria | 29001 |
| 392 | Ga0501083_0028777 | 3300049744 | Bacteria | 3827 |
| 393 | Ga0501035_0000086 | 3300049822 | Bacteria | 115822 |
| 394 | Ga0501035_0228322 | 3300049822 | Bacteria | 1587 |
| 395 | Ga0501044_0000223 | 3300049823 | Bacteria | 71752 |
| 396 | Ga0501044_0018528 | 3300049823 | Bacteria | 7459 |
| 397 | Ga0501044_0072326 | 3300049823 | Bacteria | 3506 |
| 398 | Ga0501044_0107423 | 3300049823 | Bacteria | 2802 |
| 399 | Ga0501044_0114589 | 3300049823 | Bacteria | 2701 |
| 400 | Ga0501045_0099903 | 3300049824 | Bacteria | 2148 |
| 401 | nmdc:mga03683_70184_c1 | 3300050489 | Bacteria | 1496 |
| 402 | nmdc:mga03683_70474_c1 | 3300050489 | Bacteria | 1494 |
| 403 | nmdc:mga03n38_10745_c1 | 3300050490 | Bacteria | 3383 |
| 404 | nmdc:mga03n38_157664_c1 | 3300050490 | Bacteria | 1147 |
| 405 | nmdc:mga00v17_104960_c1 | 3300050491 | Bacteria | 1787 |
| 406 | nmdc:mga00v17_14_c1 | 3300050491 | Bacteria | 126589 |
| 407 | nmdc:mga0yw44_112489_c1 | 3300050492 | Bacteria | 1746 |
| 408 | nmdc:mga0yw44_250837_c1 | 3300050492 | Bacteria | 1178 |
| 409 | nmdc:mga0yw44_3294_c1 | 3300050492 | Bacteria | 7137 |
| 410 | nmdc:mga0yw44_7443_c1 | 3300050492 | Bacteria | 5387 |
| 411 | nmdc:mga0k408_45159_c1 | 3300050493 | Bacteria | 1269 |
| 412 | nmdc:mga06z11_11047_c1 | 3300050494 | Bacteria | 3876 |
| 413 | nmdc:mga06z11_160131_c1 | 3300050494 | Bacteria | 1286 |
| 414 | nmdc:mga05p37_106889_c1 | 3300050507 | Bacteria | 3443 |
| 415 | nmdc:mga09592_188763_c1 | 3300050508 | Bacteria | 1784 |
| 416 | nmdc:mga09592_45885_c1 | 3300050508 | Bacteria | 3680 |
| 417 | nmdc:mga09592_53176_c1 | 3300050508 | Bacteria | 2063 |
| 418 | nmdc:mga0qj67_132735_c1 | 3300050509 | Bacteria | 2017 |
| 419 | nmdc:mga0qj67_238091_c1 | 3300050509 | Bacteria | 1477 |
| 420 | nmdc:mga0qj67_27792_c1 | 3300050509 | Bacteria | 4386 |
| 421 | nmdc:mga0qj67_51412_c1 | 3300050509 | Bacteria | 1770 |
| 422 | nmdc:mga06r32_12511_c1 | 3300050510 | Bacteria | 7658 |
| 423 | nmdc:mga06r32_235229_c1 | 3300050510 | Bacteria | 1820 |
| 424 | nmdc:mga06r32_245293_c1 | 3300050510 | Bacteria | 1779 |
| 425 | nmdc:mga06r32_4390_c1 | 3300050510 | Bacteria | 12611 |
| 426 | nmdc:mga06r32_941408_c1 | 3300050510 | Bacteria | 819 |
| 427 | nmdc:mga08y16_230140_c1 | 3300050511 | Bacteria | 1917 |
| 428 | nmdc:mga08y16_438965_c1 | 3300050511 | Bacteria | 1333 |
| 429 | nmdc:mga08y16_545866_c1 | 3300050511 | Bacteria | 1173 |
| 430 | nmdc:mga08y16_76334_c1 | 3300050511 | Bacteria | 3493 |
| 431 | nmdc:mga0sz30_74628_c1 | 3300050516 | Bacteria | 1463 |
| 432 | Ga0500578_0249768 | 3300053086 | Bacteria | 1069 |
| 433 | Ga0500643_000035 | 3300053087 | Bacteria | 184794 |
| 434 | Ga0500644_0060791 | 3300053088 | Bacteria | 1330 |
| 435 | Ga0500641_0066828 | 3300053096 | Bacteria | 1506 |
| 436 | Ga0500555_006777 | 3300053103 | Bacteria | 3256 |
| 437 | Ga0500562_022839 | 3300053108 | Bacteria | 1631 |
| 438 | Ga0500569_002841 | 3300053109 | Bacteria | 3462 |
| 439 | Ga0500569_046106 | 3300053109 | Bacteria | 1297 |
| 440 | Ga0500595_001183 | 3300053119 | Bacteria | 14392 |
| 441 | Ga0500595_002181 | 3300053119 | Bacteria | 9945 |
| 442 | Ga0500658_0002498 | 3300053134 | Bacteria | 7116 |
| 443 | Ga0500658_0044689 | 3300053134 | Bacteria | 1788 |
| 444 | Ga0500568_0001438 | 3300053139 | Bacteria | 15421 |
| 445 | Ga0500568_0016475 | 3300053139 | Bacteria | 3285 |
| 446 | Ga0500568_0143808 | 3300053139 | Bacteria | 883 |
| 447 | Ga0500577_0033238 | 3300053142 | Bacteria | 1821 |
| 448 | Ga0500616_0000472 | 3300053153 | Bacteria | 52191 |
| 449 | Ga0500616_0026922 | 3300053153 | Bacteria | 3178 |
| 450 | Ga0500634_0000507 | 3300053161 | Bacteria | 12661 |
| 451 | Ga0500634_0073408 | 3300053161 | Bacteria | 1784 |
| 452 | Ga0500638_009653 | 3300053162 | Bacteria | 4187 |
| 453 | Ga0500636_0001753 | 3300053177 | Bacteria | 11889 |
| 454 | Ga0500637_0000138 | 3300053178 | Bacteria | 26740 |
| 455 | Ga0500609_000759 | 3300053731 | Bacteria | 4841 |
| 456 | Ga0500601_000712 | 3300053737 | Bacteria | 4407 |
| 457 | Ga0500661_000130 | 3300055283 | Bacteria | 12645 |
| 458 | Ga0466962_0101240 | 3300061719 | Bacteria | 1383 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005353 | Ga0070669_100666918 | Ga0070669_1006669181 | 250 |
| 2 | 3300035172 | Ga0373955_0043094 | Ga0373955_0043094_1660_2412 | 250 |
| 3 | 3300036401 | Ga0373937_0191104 | Ga0373937_0191104_16_768 | 250 |
| 4 | 3300044694 | Ga0466963_0044844 | Ga0466963_0044844_35_787 | 250 |
| 5 | 3300048905 | Ga0496102_0202039 | Ga0496102_0202039_24_776 | 250 |
| 6 | 3300048920 | Ga0496117_0087353 | Ga0496117_0087353_19_771 | 250 |
| 7 | 3300048923 | Ga0496120_0276800 | Ga0496120_0276800_14_766 | 250 |
| 8 | 3300049572 | Ga0501036_0666533 | Ga0501036_0666533_11_763 | 250 |
| 9 | 3300050510 | nmdc:mga06r32_941408_c1 | nmdc:mga06r32_941408_c1_12_764 | 250 |
| 10 | 3300053139 | Ga0500568_0143808 | Ga0500568_0143808_36_788 | 250 |
| 11 | 3300037853 | Ga0436364_0674187 | Ga0436364_0674187_2222_3004 | 260 |
| 12 | iso_pu_bacteria | 2881155292 | 2881156999 | 260 |
| 13 | 3300005468 | Ga0070707_100093884 | Ga0070707_1000938843 | 261 |
| 14 | 3300025922 | Ga0207646_10053281 | Ga0207646_100532813 | 261 |
| 15 | 3300005544 | Ga0070686_100512241 | Ga0070686_1005122411 | 266 |
| 16 | 3300041498 | Ga0451841_0873827 | Ga0451841_0873827_250_1059 | 269 |
| 17 | 3300046523 | Ga0495644_0047074 | Ga0495644_0047074_413_1234 | 270 |
| 18 | 3300048908 | Ga0496105_0021632 | Ga0496105_0021632_4383_5195 | 270 |
| 19 | iso_pu_bacteria | 2876406927 | 2876410527 | 274 |
| 20 | 3300049573 | Ga0501037_0093876 | Ga0501037_0093876_1330_2157 | 275 |
| 21 | 3300025921 | Ga0207652_10469754 | Ga0207652_104697542 | 277 |
| 22 | 3300005295 | Ga0065707_10039833 | Ga0065707_100398331 | 279 |
| 23 | 3300049592 | Ga0501076_0176737 | Ga0501076_0176737_547_1449 | 279 |
| 24 | 3300049824 | Ga0501045_0099903 | Ga0501045_0099903_1037_1939 | 279 |
| 25 | 3300050511 | nmdc:mga08y16_438965_c1 | nmdc:mga08y16_438965_c1_453_1319 | 279 |
| 26 | 3300005295 | Ga0065707_10117356 | Ga0065707_101173562 | 280 |
| 27 | 3300005458 | Ga0070681_10000393 | Ga0070681_1000039332 | 280 |
| 28 | 3300009174 | Ga0105241_10297806 | Ga0105241_102978062 | 280 |
| 29 | 3300025918 | Ga0207662_10197196 | Ga0207662_101971962 | 280 |
| 30 | 3300050489 | nmdc:mga03683_70184_c1 | nmdc:mga03683_70184_c1_560_1402 | 280 |
| 31 | 3300009093 | Ga0105240_10011032 | Ga0105240_100110327 | 281 |
| 32 | 3300025922 | Ga0207646_10078849 | Ga0207646_100788493 | 281 |
| 33 | 3300053096 | Ga0500641_0066828 | Ga0500641_0066828_622_1467 | 281 |
| 34 | 3300053109 | Ga0500569_002841 | Ga0500569_002841_2353_3198 | 281 |
| 35 | 3300046810 | Ga0495660_0133140 | Ga0495660_0133140_197_1075 | 284 |
| 36 | 3300053153 | Ga0500616_0026922 | Ga0500616_0026922_872_1750 | 284 |
| 37 | iso_pu_bacteria | 2713897090 | 2715501879 | 286 |
| 38 | iso_pu_bacteria | 3005710791 | 3005715184 | 286 |
| 39 | 3300005983 | Ga0081540_1006001 | Ga0081540_10060012 | 287 |
| 40 | iso_pu_bacteria | 2511231028 | 2511394989 | 287 |
| 41 | iso_pu_bacteria | 2842775625 | 2842777250 | 287 |
| 42 | iso_pu_bacteria | 2874628541 | 2874632158 | 287 |
| 43 | iso_pu_bacteria | 2883577096 | 2883577390 | 287 |
| 44 | iso_pu_bacteria | 2888388044 | 2888393539 | 287 |
| 45 | iso_pu_bacteria | 3005594810 | 3005599513 | 287 |
| 46 | iso_pu_bacteria | 8056967851 | 8056968301 | 287 |
| 47 | 3300050509 | nmdc:mga0qj67_238091_c1 | nmdc:mga0qj67_238091_c1_388_1275 | 289 |
| 48 | 3300050510 | nmdc:mga06r32_245293_c1 | nmdc:mga06r32_245293_c1_499_1386 | 289 |
| 49 | 3300053177 | Ga0500636_0001753 | Ga0500636_0001753_2424_3302 | 289 |
| 50 | 3300009993 | Ga0105028_108689 | Ga0105028_1086891 | 290 |
| 51 | 3300042876 | Ga0451577_0013112 | Ga0451577_0013112_6289_7161 | 290 |
| 52 | 3300003762 | Ga0055542_1003894 | Ga0055542_10038944 | 291 |
| 53 | 3300004625 | Ga0055543_1008108 | Ga0055543_10081082 | 291 |
| 54 | 3300005262 | Ga0065165_1000231 | Ga0065165_10002314 | 291 |
| 55 | 3300005366 | Ga0070659_100259525 | Ga0070659_1002595252 | 291 |
| 56 | 3300005616 | Ga0068852_100002288 | Ga0068852_1000022886 | 291 |
| 57 | 3300005834 | Ga0068851_10131991 | Ga0068851_101319912 | 291 |
| 58 | 3300005983 | Ga0081540_1005876 | Ga0081540_10058765 | 291 |
| 59 | 3300006038 | Ga0075365_10116315 | Ga0075365_101163151 | 291 |
| 60 | 3300025230 | Ga0209563_104900 | Ga0209563_1049002 | 291 |
| 61 | 3300025253 | Ga0209677_101018 | Ga0209677_1010188 | 291 |
| 62 | 3300025254 | Ga0209148_1000475 | Ga0209148_100047527 | 291 |
| 63 | 3300025272 | Ga0209455_1001935 | Ga0209455_10019356 | 291 |
| 64 | 3300025297 | Ga0209758_1007908 | Ga0209758_10079086 | 291 |
| 65 | 3300025297 | Ga0209758_1019714 | Ga0209758_10197142 | 291 |
| 66 | 3300025913 | Ga0207695_10000008 | Ga0207695_1000000854 | 291 |
| 67 | 3300025914 | Ga0207671_10010828 | Ga0207671_100108285 | 291 |
| 68 | 3300025932 | Ga0207690_10222726 | Ga0207690_102227262 | 291 |
| 69 | 3300025981 | Ga0207640_10144624 | Ga0207640_101446242 | 291 |
| 70 | 3300026041 | Ga0207639_10290016 | Ga0207639_102900162 | 291 |
| 71 | 3300026067 | Ga0207678_10020039 | Ga0207678_100200392 | 291 |
| 72 | 3300033180 | Ga0307510_10008141 | Ga0307510_1000814112 | 291 |
| 73 | 3300037312 | Ga0395899_0013520 | Ga0395899_0013520_594_1481 | 291 |
| 74 | 3300038443 | Ga0395901_0011181 | Ga0395901_0011181_1169_2056 | 291 |
| 75 | 3300044693 | Ga0466961_0000154 | Ga0466961_0000154_33709_34584 | 291 |
| 76 | 3300046506 | Ga0495583_0117562 | Ga0495583_0117562_91_966 | 291 |
| 77 | 3300047323 | Ga0495683_0074182 | Ga0495683_0074182_230_1105 | 291 |
| 78 | 3300049568 | Ga0501031_0013786 | Ga0501031_0013786_2002_2892 | 291 |
| 79 | 3300049570 | Ga0501033_0010498 | Ga0501033_0010498_6009_6899 | 291 |
| 80 | 3300049571 | Ga0501034_0096432 | Ga0501034_0096432_89_985 | 291 |
| 81 | 3300049573 | Ga0501037_0000107 | Ga0501037_0000107_23206_24096 | 291 |
| 82 | 3300049573 | Ga0501037_0186493 | Ga0501037_0186493_208_1104 | 291 |
| 83 | 3300049579 | Ga0501043_0000005 | Ga0501043_0000005_244811_245701 | 291 |
| 84 | 3300049585 | Ga0501069_0000033 | Ga0501069_0000033_82777_83667 | 291 |
| 85 | 3300049586 | Ga0501070_0000913 | Ga0501070_0000913_1428_2318 | 291 |
| 86 | 3300049589 | Ga0501073_0060391 | Ga0501073_0060391_1721_2611 | 291 |
| 87 | 3300049590 | Ga0501074_0000571 | Ga0501074_0000571_13126_14016 | 291 |
| 88 | 3300049744 | Ga0501083_0000355 | Ga0501083_0000355_4378_5268 | 291 |
| 89 | 3300049822 | Ga0501035_0000086 | Ga0501035_0000086_106122_107012 | 291 |
| 90 | 3300049823 | Ga0501044_0000223 | Ga0501044_0000223_37079_37969 | 291 |
| 91 | 3300049823 | Ga0501044_0018528 | Ga0501044_0018528_1511_2407 | 291 |
| 92 | 3300050492 | nmdc:mga0yw44_250837_c1 | nmdc:mga0yw44_250837_c1_84_959 | 291 |
| 93 | 3300053086 | Ga0500578_0249768 | Ga0500578_0249768_17_892 | 291 |
| 94 | 3300053087 | Ga0500643_000035 | Ga0500643_000035_79891_80766 | 291 |
| 95 | 3300053103 | Ga0500555_006777 | Ga0500555_006777_1766_2641 | 291 |
| 96 | 3300053142 | Ga0500577_0033238 | Ga0500577_0033238_610_1485 | 291 |
| 97 | 3300053161 | Ga0500634_0073408 | Ga0500634_0073408_892_1767 | 291 |
| 98 | 3300053731 | Ga0500609_000759 | Ga0500609_000759_1801_2676 | 291 |
| 99 | 3300053737 | Ga0500601_000712 | Ga0500601_000712_208_1083 | 291 |
| 100 | iso_pu_bacteria | 2882632389 | 2882633809 | 291 |
| 101 | 3300005564 | Ga0070664_100061891 | Ga0070664_1000618913 | 292 |
| 102 | 3300005614 | Ga0068856_100072955 | Ga0068856_1000729553 | 292 |
| 103 | 3300005616 | Ga0068852_100071600 | Ga0068852_1000716002 | 292 |
| 104 | 3300010375 | Ga0105239_10089511 | Ga0105239_100895111 | 292 |
| 105 | 3300013307 | Ga0157372_10517315 | Ga0157372_105173152 | 292 |
| 106 | 3300021388 | Ga0213875_10001033 | Ga0213875_1000103314 | 292 |
| 107 | 3300025302 | Ga0207426_1012996 | Ga0207426_10129965 | 292 |
| 108 | 3300025919 | Ga0207657_10060743 | Ga0207657_100607433 | 292 |
| 109 | 3300025944 | Ga0207661_10281098 | Ga0207661_102810982 | 292 |
| 110 | 3300025945 | Ga0207679_10018807 | Ga0207679_100188073 | 292 |
| 111 | 3300026116 | Ga0207674_10149448 | Ga0207674_101494482 | 292 |
| 112 | 3300026142 | Ga0207698_10033601 | Ga0207698_100336013 | 292 |
| 113 | 3300037312 | Ga0395899_0005619 | Ga0395899_0005619_8240_9136 | 292 |
| 114 | 3300037418 | Ga0395900_0003232 | Ga0395900_0003232_1490_2386 | 292 |
| 115 | 3300037418 | Ga0395900_0008561 | Ga0395900_0008561_4389_5282 | 292 |
| 116 | 3300037466 | Ga0395898_0009099 | Ga0395898_0009099_8422_9318 | 292 |
| 117 | 3300037853 | Ga0436364_0642169 | Ga0436364_0642169_15195_16088 | 292 |
| 118 | 3300037853 | Ga0436364_0659865 | Ga0436364_0659865_17386_18267 | 292 |
| 119 | 3300038443 | Ga0395901_0012192 | Ga0395901_0012192_1311_2207 | 292 |
| 120 | 3300039447 | Ga0436361_0606306 | Ga0436361_0606306_1444_2346 | 292 |
| 121 | 3300045976 | Ga0466967_0008224 | Ga0466967_0008224_1515_2411 | 292 |
| 122 | iso_pu_bacteria | 2828305725 | 2828310327 | 292 |
| 123 | iso_pu_bacteria | 2894817345 | 2894822088 | 292 |
| 124 | iso_pu_bacteria | 8055909800 | 8055916096 | 292 |
| 125 | 3300005336 | Ga0070680_100098095 | Ga0070680_1000980952 | 293 |
| 126 | 3300005548 | Ga0070665_100175214 | Ga0070665_1001752142 | 293 |
| 127 | 3300021358 | Ga0213873_10032919 | Ga0213873_100329192 | 293 |
| 128 | 3300021377 | Ga0213874_10003165 | Ga0213874_100031653 | 293 |
| 129 | 3300021384 | Ga0213876_10006880 | Ga0213876_100068809 | 293 |
| 130 | 3300021384 | Ga0213876_10009074 | Ga0213876_100090742 | 293 |
| 131 | 3300021384 | Ga0213876_10058498 | Ga0213876_100584982 | 293 |
| 132 | 3300021388 | Ga0213875_10059905 | Ga0213875_100599053 | 293 |
| 133 | 3300028379 | Ga0268266_10087468 | Ga0268266_100874682 | 293 |
| 134 | 3300037853 | Ga0436364_1379234 | Ga0436364_1379234_1479_2378 | 293 |
| 135 | 3300039437 | Ga0436365_0138565 | Ga0436365_0138565_7534_8433 | 293 |
| 136 | 3300039437 | Ga0436365_0712519 | Ga0436365_0712519_9344_10243 | 293 |
| 137 | 3300039437 | Ga0436365_1535876 | Ga0436365_1535876_8400_9299 | 293 |
| 138 | 3300039437 | Ga0436365_1736919 | Ga0436365_1736919_1760_2662 | 293 |
| 139 | 3300039450 | Ga0436363_0282535 | Ga0436363_0282535_8541_9440 | 293 |
| 140 | 3300039450 | Ga0436363_0472610 | Ga0436363_0472610_228_1127 | 293 |
| 141 | 3300039453 | Ga0436362_0822437 | Ga0436362_0822437_4565_5464 | 293 |
| 142 | 3300053139 | Ga0500568_0016475 | Ga0500568_0016475_1015_1914 | 293 |
| 143 | iso_pu_bacteria | 2503198000 | 2503200951 | 293 |
| 144 | iso_pu_bacteria | 2509276018 | 2509369537 | 293 |
| 145 | iso_pu_bacteria | 2510065059 | 2510319291 | 293 |
| 146 | iso_pu_bacteria | 2513237305 | 2514423072 | 293 |
| 147 | iso_pu_bacteria | 2597489875 | 2597814606 | 293 |
| 148 | iso_pu_bacteria | 2643221733 | 2644730069 | 293 |
| 149 | iso_pu_bacteria | 2643221736 | 2644746170 | 293 |
| 150 | iso_pu_bacteria | 2687453392 | 2688597244 | 293 |
| 151 | iso_pu_bacteria | 2721755686 | 2723577073 | 293 |
| 152 | iso_pu_bacteria | 2818991467 | 2819720105 | 293 |
| 153 | iso_pu_bacteria | 2841760612 | 2841766118 | 293 |
| 154 | iso_pu_bacteria | 2844009547 | 2844012627 | 293 |
| 155 | iso_pu_bacteria | 2844104063 | 2844105884 | 293 |
| 156 | iso_pu_bacteria | 2851182111 | 2851186382 | 293 |
| 157 | iso_pu_bacteria | 2851246043 | 2851246240 | 293 |
| 158 | iso_pu_bacteria | 2856328259 | 2856334866 | 293 |
| 159 | iso_pu_bacteria | 2856334872 | 2856341583 | 293 |
| 160 | iso_pu_bacteria | 2856342000 | 2856347706 | 293 |
| 161 | iso_pu_bacteria | 2856349417 | 2856352999 | 293 |
| 162 | iso_pu_bacteria | 2856356410 | 2856362010 | 293 |
| 163 | iso_pu_bacteria | 2857367948 | 2857373248 | 293 |
| 164 | iso_pu_bacteria | 2869169390 | 2869171175 | 293 |
| 165 | iso_pu_bacteria | 2869234852 | 2869238807 | 293 |
| 166 | iso_pu_bacteria | 2869242130 | 2869248133 | 293 |
| 167 | iso_pu_bacteria | 2869249662 | 2869251560 | 293 |
| 168 | iso_pu_bacteria | 2869256925 | 2869260095 | 293 |
| 169 | iso_pu_bacteria | 2869264136 | 2869271068 | 293 |
| 170 | iso_pu_bacteria | 2869271264 | 2869277774 | 293 |
| 171 | iso_pu_bacteria | 2871435913 | 2871436915 | 293 |
| 172 | iso_pu_bacteria | 2871451962 | 2871454630 | 293 |
| 173 | iso_pu_bacteria | 2871459585 | 2871465715 | 293 |
| 174 | iso_pu_bacteria | 2871481445 | 2871487692 | 293 |
| 175 | iso_pu_bacteria | 2871488783 | 2871493618 | 293 |
| 176 | iso_pu_bacteria | 2871495908 | 2871497151 | 293 |
| 177 | iso_pu_bacteria | 2874109183 | 2874110346 | 293 |
| 178 | iso_pu_bacteria | 2874116593 | 2874122791 | 293 |
| 179 | iso_pu_bacteria | 2874131515 | 2874137122 | 293 |
| 180 | iso_pu_bacteria | 2874162495 | 2874167956 | 293 |
| 181 | iso_pu_bacteria | 2876386047 | 2876389737 | 293 |
| 182 | iso_pu_bacteria | 2876399893 | 2876402861 | 293 |
| 183 | iso_pu_bacteria | 2876420981 | 2876427447 | 293 |
| 184 | iso_pu_bacteria | 2878730984 | 2878737482 | 293 |
| 185 | iso_pu_bacteria | 2878753008 | 2878756191 | 293 |
| 186 | iso_pu_bacteria | 2878760144 | 2878761372 | 293 |
| 187 | iso_pu_bacteria | 2878767105 | 2878768339 | 293 |
| 188 | iso_pu_bacteria | 2878774303 | 2878775068 | 293 |
| 189 | iso_pu_bacteria | 2878781027 | 2878783594 | 293 |
| 190 | iso_pu_bacteria | 2881845957 | 2881851600 | 293 |
| 191 | iso_pu_bacteria | 2881853255 | 2881860304 | 293 |
| 192 | iso_pu_bacteria | 2881861095 | 2881864925 | 293 |
| 193 | iso_pu_bacteria | 2882912400 | 2882918125 | 293 |
| 194 | iso_pu_bacteria | 2885318864 | 2885321319 | 293 |
| 195 | iso_pu_bacteria | 2885342637 | 2885343950 | 293 |
| 196 | iso_pu_bacteria | 2885350715 | 2885352797 | 293 |
| 197 | iso_pu_bacteria | 2888343758 | 2888348047 | 293 |
| 198 | iso_pu_bacteria | 2888350351 | 2888356719 | 293 |
| 199 | iso_pu_bacteria | 2889016732 | 2889023299 | 293 |
| 200 | iso_pu_bacteria | 2894772417 | 2894776640 | 293 |
| 201 | iso_pu_bacteria | 2903492973 | 2903502878 | 293 |
| 202 | iso_pu_bacteria | 2903540706 | 2903541946 | 293 |
| 203 | iso_pu_bacteria | 2906354277 | 2906363078 | 293 |
| 204 | iso_pu_bacteria | 2906363423 | 2906364668 | 293 |
| 205 | iso_pu_bacteria | 2906370794 | 2906376936 | 293 |
| 206 | iso_pu_bacteria | 2906386501 | 2906389595 | 293 |
| 207 | iso_pu_bacteria | 2906393657 | 2906401129 | 293 |
| 208 | iso_pu_bacteria | 2906401398 | 2906401782 | 293 |
| 209 | iso_pu_bacteria | 2906408224 | 2906411357 | 293 |
| 210 | iso_pu_bacteria | 2917699015 | 2917703899 | 293 |
| 211 | iso_pu_bacteria | 2922130491 | 2922135486 | 293 |
| 212 | iso_pu_bacteria | 2922151315 | 2922155928 | 293 |
| 213 | iso_pu_bacteria | 2922172374 | 2922177625 | 293 |
| 214 | iso_pu_bacteria | 2922178524 | 2922179333 | 293 |
| 215 | iso_pu_bacteria | 2922185730 | 2922192520 | 293 |
| 216 | iso_pu_bacteria | 2924710171 | 2924716945 | 293 |
| 217 | iso_pu_bacteria | 2924733363 | 2924737865 | 293 |
| 218 | iso_pu_bacteria | 2924741084 | 2924742681 | 293 |
| 219 | iso_pu_bacteria | 2924748358 | 2924749427 | 293 |
| 220 | iso_pu_bacteria | 2924754689 | 2924757664 | 293 |
| 221 | iso_pu_bacteria | 2924784321 | 2924787761 | 293 |
| 222 | iso_pu_bacteria | 2929199973 | 2929202996 | 293 |
| 223 | iso_pu_bacteria | 2935769743 | 2935773905 | 293 |
| 224 | iso_pu_bacteria | 2935785616 | 2935788659 | 293 |
| 225 | iso_pu_bacteria | 2935793552 | 2935795715 | 293 |
| 226 | iso_pu_bacteria | 2937861824 | 2937862656 | 293 |
| 227 | iso_pu_bacteria | 2937868953 | 2937870048 | 293 |
| 228 | iso_pu_bacteria | 2937980651 | 2937981210 | 293 |
| 229 | iso_pu_bacteria | 2937994558 | 2937995802 | 293 |
| 230 | iso_pu_bacteria | 2958100919 | 2958105499 | 293 |
| 231 | iso_pu_bacteria | 2958108152 | 2958115082 | 293 |
| 232 | iso_pu_bacteria | 2958122699 | 2958129824 | 293 |
| 233 | iso_pu_bacteria | 2958158011 | 2958158293 | 293 |
| 234 | iso_pu_bacteria | 2958165035 | 2958166274 | 293 |
| 235 | iso_pu_bacteria | 2958172287 | 2958178763 | 293 |
| 236 | iso_pu_bacteria | 2961127735 | 2961129930 | 293 |
| 237 | iso_pu_bacteria | 2961163497 | 2961164736 | 293 |
| 238 | iso_pu_bacteria | 2961170736 | 2961172479 | 293 |
| 239 | iso_pu_bacteria | 2961183825 | 2961184365 | 293 |
| 240 | iso_pu_bacteria | 2965018300 | 2965019562 | 293 |
| 241 | iso_pu_bacteria | 2965025482 | 2965027621 | 293 |
| 242 | iso_pu_bacteria | 2965032056 | 2965036221 | 293 |
| 243 | iso_pu_bacteria | 2965040258 | 2965043330 | 293 |
| 244 | iso_pu_bacteria | 2965047637 | 2965049654 | 293 |
| 245 | iso_pu_bacteria | 2965089291 | 2965090548 | 293 |
| 246 | iso_pu_bacteria | 2965102966 | 2965107374 | 293 |
| 247 | iso_pu_bacteria | 2965110997 | 2965111228 | 293 |
| 248 | iso_pu_bacteria | 2965119406 | 2965119757 | 293 |
| 249 | iso_pu_bacteria | 2967996073 | 2967997695 | 293 |
| 250 | iso_pu_bacteria | 2968003550 | 2968008346 | 293 |
| 251 | iso_pu_bacteria | 2968138860 | 2968141126 | 293 |
| 252 | iso_pu_bacteria | 2968171901 | 2968173138 | 293 |
| 253 | iso_pu_bacteria | 2970489779 | 2970495187 | 293 |
| 254 | iso_pu_bacteria | 2970503327 | 2970505073 | 293 |
| 255 | iso_pu_bacteria | 2970524798 | 2970531949 | 293 |
| 256 | iso_pu_bacteria | 2970540015 | 2970547656 | 293 |
| 257 | iso_pu_bacteria | 2970547951 | 2970552322 | 293 |
| 258 | iso_pu_bacteria | 2970554993 | 2970556228 | 293 |
| 259 | iso_pu_bacteria | 2970619444 | 2970626597 | 293 |
| 260 | iso_pu_bacteria | 2970627176 | 2970627861 | 293 |
| 261 | iso_pu_bacteria | 2977821940 | 2977825372 | 293 |
| 262 | iso_pu_bacteria | 2977828996 | 2977832682 | 293 |
| 263 | iso_pu_bacteria | 2977851361 | 2977852029 | 293 |
| 264 | iso_pu_bacteria | 2977872689 | 2977873863 | 293 |
| 265 | iso_pu_bacteria | 2977898635 | 2977905078 | 293 |
| 266 | iso_pu_bacteria | 2977907340 | 2977914961 | 293 |
| 267 | iso_pu_bacteria | 2977915119 | 2977916508 | 293 |
| 268 | iso_pu_bacteria | 2977935797 | 2977941666 | 293 |
| 269 | iso_pu_bacteria | 2977950692 | 2977951032 | 293 |
| 270 | iso_pu_bacteria | 2977957713 | 2977960464 | 293 |
| 271 | iso_pu_bacteria | 2977971508 | 2977974932 | 293 |
| 272 | iso_pu_bacteria | 2979710463 | 2979716026 | 293 |
| 273 | iso_pu_bacteria | 2979742915 | 2979750769 | 293 |
| 274 | iso_pu_bacteria | 2979764755 | 2979769648 | 293 |
| 275 | iso_pu_bacteria | 2979772303 | 2979779733 | 293 |
| 276 | iso_pu_bacteria | 2979793036 | 2979797187 | 293 |
| 277 | iso_pu_bacteria | 2979808191 | 2979809794 | 293 |
| 278 | iso_pu_bacteria | 2987645492 | 2987648178 | 293 |
| 279 | iso_pu_bacteria | 2987659509 | 2987660745 | 293 |
| 280 | iso_pu_bacteria | 2987673487 | 2987680946 | 293 |
| 281 | iso_pu_bacteria | 2996386984 | 2996390031 | 293 |
| 282 | iso_pu_bacteria | 3004188549 | 3004189793 | 293 |
| 283 | iso_pu_bacteria | 3004195979 | 3004203512 | 293 |
| 284 | iso_pu_bacteria | 3004232784 | 3004235875 | 293 |
| 285 | iso_pu_bacteria | 3004239961 | 3004243286 | 293 |
| 286 | iso_pu_bacteria | 3004248173 | 3004253659 | 293 |
| 287 | iso_pu_bacteria | 3004268573 | 3004273896 | 293 |
| 288 | iso_pu_bacteria | 649633066 | 649871797 | 293 |
| 289 | iso_pu_bacteria | 8004300914 | 8004302835 | 293 |
| 290 | iso_pu_bacteria | 8004312739 | 8004312760 | 293 |
| 291 | iso_pu_bacteria | 8004361976 | 8004365152 | 293 |
| 292 | iso_pu_bacteria | 8004374579 | 8004377780 | 293 |
| 293 | iso_pu_bacteria | 8004395343 | 8004397839 | 293 |
| 294 | iso_pu_bacteria | 8004695233 | 8004702367 | 293 |
| 295 | iso_pu_bacteria | 8004727605 | 8004731568 | 293 |
| 296 | iso_pu_bacteria | 8055617313 | 8055622158 | 293 |
| 297 | iso_pu_bacteria | 8057529695 | 8057531534 | 293 |
| 298 | 3300002987 | JGI25159J45721_1008482 | JGI25159J45721_10084823 | 294 |
| 299 | 3300003187 | JGI25151J46595_10000458 | JGI25151J46595_1000045814 | 294 |
| 300 | 3300003354 | JGI25160J50197_1003716 | JGI25160J50197_10037162 | 294 |
| 301 | 3300005336 | Ga0070680_100064135 | Ga0070680_1000641352 | 294 |
| 302 | 3300005458 | Ga0070681_10014505 | Ga0070681_100145058 | 294 |
| 303 | 3300005530 | Ga0070679_100172761 | Ga0070679_1001727612 | 294 |
| 304 | 3300005563 | Ga0068855_100513777 | Ga0068855_1005137772 | 294 |
| 305 | 3300005842 | Ga0068858_100132512 | Ga0068858_1001325122 | 294 |
| 306 | 3300013104 | Ga0157370_10211933 | Ga0157370_102119332 | 294 |
| 307 | 3300025284 | Ga0209130_1000467 | Ga0209130_10004673 | 294 |
| 308 | 3300025294 | Ga0209025_1000099 | Ga0209025_100009924 | 294 |
| 309 | 3300025297 | Ga0209758_1001602 | Ga0209758_100160218 | 294 |
| 310 | 3300025302 | Ga0207426_1000065 | Ga0207426_1000065148 | 294 |
| 311 | 3300025912 | Ga0207707_10425776 | Ga0207707_104257761 | 294 |
| 312 | 3300025921 | Ga0207652_10075415 | Ga0207652_100754151 | 294 |
| 313 | 3300026041 | Ga0207639_10105232 | Ga0207639_101052322 | 294 |
| 314 | 3300028379 | Ga0268266_10003379 | Ga0268266_100033792 | 294 |
| 315 | 3300031730 | Ga0307516_10023182 | Ga0307516_100231823 | 294 |
| 316 | 3300046533 | Ga0495640_0145381 | Ga0495640_0145381_513_1400 | 294 |
| 317 | 3300049579 | Ga0501043_0067753 | Ga0501043_0067753_174_1076 | 294 |
| 318 | 3300049580 | Ga0501046_0191968 | Ga0501046_0191968_163_1065 | 294 |
| 319 | 3300049823 | Ga0501044_0107423 | Ga0501044_0107423_1352_2254 | 294 |
| 320 | 3300053088 | Ga0500644_0060791 | Ga0500644_0060791_318_1220 | 294 |
| 321 | 3300053119 | Ga0500595_001183 | Ga0500595_001183_8698_9591 | 294 |
| 322 | 3300053162 | Ga0500638_009653 | Ga0500638_009653_335_1228 | 294 |
| 323 | 3300053178 | Ga0500637_0000138 | Ga0500637_0000138_20849_21742 | 294 |
| 324 | 3300055283 | Ga0500661_000130 | Ga0500661_000130_3293_4186 | 294 |
| 325 | iso_pu_bacteria | 2996310559 | 2996316207 | 294 |
| 326 | 3300003203 | JGI25406J46586_10000433 | JGI25406J46586_1000043313 | 295 |
| 327 | 3300003794 | Ga0055531_10046365 | Ga0055531_100463652 | 295 |
| 328 | 3300005329 | Ga0070683_100473626 | Ga0070683_1004736262 | 295 |
| 329 | 3300005338 | Ga0068868_100011310 | Ga0068868_1000113104 | 295 |
| 330 | 3300005341 | Ga0070691_10003977 | Ga0070691_100039771 | 295 |
| 331 | 3300005353 | Ga0070669_100400495 | Ga0070669_1004004952 | 295 |
| 332 | 3300005356 | Ga0070674_100246652 | Ga0070674_1002466521 | 295 |
| 333 | 3300005444 | Ga0070694_100003712 | Ga0070694_10000371210 | 295 |
| 334 | 3300005444 | Ga0070694_100112115 | Ga0070694_1001121153 | 295 |
| 335 | 3300005455 | Ga0070663_100007767 | Ga0070663_1000077673 | 295 |
| 336 | 3300005471 | Ga0070698_100446600 | Ga0070698_1004466001 | 295 |
| 337 | 3300005539 | Ga0068853_100112670 | Ga0068853_1001126702 | 295 |
| 338 | 3300005545 | Ga0070695_100100156 | Ga0070695_1001001561 | 295 |
| 339 | 3300005549 | Ga0070704_100003315 | Ga0070704_1000033153 | 295 |
| 340 | 3300005564 | Ga0070664_100169755 | Ga0070664_1001697552 | 295 |
| 341 | 3300005614 | Ga0068856_100002849 | Ga0068856_10000284914 | 295 |
| 342 | 3300005719 | Ga0068861_100075148 | Ga0068861_1000751482 | 295 |
| 343 | 3300005983 | Ga0081540_1000338 | Ga0081540_100033839 | 295 |
| 344 | 3300005985 | Ga0081539_10000549 | Ga0081539_1000054928 | 295 |
| 345 | 3300006048 | Ga0075363_100002563 | Ga0075363_1000025634 | 295 |
| 346 | 3300006178 | Ga0075367_10002436 | Ga0075367_100024365 | 295 |
| 347 | 3300006844 | Ga0075428_100097827 | Ga0075428_1000978272 | 295 |
| 348 | 3300006846 | Ga0075430_100109636 | Ga0075430_1001096362 | 295 |
| 349 | 3300006847 | Ga0075431_100004249 | Ga0075431_10000424910 | 295 |
| 350 | 3300006871 | Ga0075434_100116694 | Ga0075434_1001166942 | 295 |
| 351 | 3300009098 | Ga0105245_10214159 | Ga0105245_102141592 | 295 |
| 352 | 3300009147 | Ga0114129_10042219 | Ga0114129_100422193 | 295 |
| 353 | 3300009148 | Ga0105243_10342701 | Ga0105243_103427012 | 295 |
| 354 | 3300011119 | Ga0105246_10032074 | Ga0105246_100320743 | 295 |
| 355 | 3300013306 | Ga0163162_10222678 | Ga0163162_102226782 | 295 |
| 356 | 3300013308 | Ga0157375_10073454 | Ga0157375_100734542 | 295 |
| 357 | 3300014325 | Ga0163163_10321085 | Ga0163163_103210852 | 295 |
| 358 | 3300014969 | Ga0157376_10215584 | Ga0157376_102155842 | 295 |
| 359 | 3300021388 | Ga0213875_10004683 | Ga0213875_100046836 | 295 |
| 360 | 3300025304 | Ga0209257_1000376 | Ga0209257_100037632 | 295 |
| 361 | 3300025909 | Ga0207705_10225043 | Ga0207705_102250432 | 295 |
| 362 | 3300025921 | Ga0207652_10326275 | Ga0207652_103262752 | 295 |
| 363 | 3300025926 | Ga0207659_10142049 | Ga0207659_101420493 | 295 |
| 364 | 3300025927 | Ga0207687_10071054 | Ga0207687_100710542 | 295 |
| 365 | 3300025929 | Ga0207664_10343807 | Ga0207664_103438072 | 295 |
| 366 | 3300025945 | Ga0207679_10299600 | Ga0207679_102996002 | 295 |
| 367 | 3300025961 | Ga0207712_10190524 | Ga0207712_101905242 | 295 |
| 368 | 3300026023 | Ga0207677_10012388 | Ga0207677_100123883 | 295 |
| 369 | 3300026078 | Ga0207702_10000325 | Ga0207702_1000032559 | 295 |
| 370 | 3300026095 | Ga0207676_10145019 | Ga0207676_101450192 | 295 |
| 371 | 3300026118 | Ga0207675_100177673 | Ga0207675_1001776731 | 295 |
| 372 | 3300031711 | Ga0265314_10010424 | Ga0265314_100104242 | 295 |
| 373 | 3300031730 | Ga0307516_10196893 | Ga0307516_101968931 | 295 |
| 374 | 3300031730 | Ga0307516_10393820 | Ga0307516_103938201 | 295 |
| 375 | 3300037853 | Ga0436364_0103156 | Ga0436364_0103156_14844_15755 | 295 |
| 376 | 3300037853 | Ga0436364_0533917 | Ga0436364_0533917_6792_7688 | 295 |
| 377 | 3300038443 | Ga0395901_0456464 | Ga0395901_0456464_77_973 | 295 |
| 378 | 3300039437 | Ga0436365_0879300 | Ga0436365_0879300_2069_2980 | 295 |
| 379 | 3300039438 | Ga0436360_1090709 | Ga0436360_1090709_200_1099 | 295 |
| 380 | 3300039450 | Ga0436363_1477180 | Ga0436363_1477180_382_1278 | 295 |
| 381 | 3300041408 | Ga0439453_0001749 | Ga0439453_0001749_501_1400 | 295 |
| 382 | 3300045051 | Ga0451576_0000231 | Ga0451576_0000231_89382_90278 | 295 |
| 383 | 3300048903 | Ga0496100_0020009 | Ga0496100_0020009_2672_3568 | 295 |
| 384 | 3300048906 | Ga0496103_0073279 | Ga0496103_0073279_360_1256 | 295 |
| 385 | 3300048907 | Ga0496104_0082985 | Ga0496104_0082985_1063_1959 | 295 |
| 386 | 3300048910 | Ga0496107_0015042 | Ga0496107_0015042_1202_2098 | 295 |
| 387 | 3300048911 | Ga0496108_0075698 | Ga0496108_0075698_119_1015 | 295 |
| 388 | 3300048913 | Ga0496110_0043688 | Ga0496110_0043688_2371_3267 | 295 |
| 389 | 3300048914 | Ga0496111_0032362 | Ga0496111_0032362_1675_2571 | 295 |
| 390 | 3300048915 | Ga0496112_0088237 | Ga0496112_0088237_805_1701 | 295 |
| 391 | 3300048917 | Ga0496114_0019685 | Ga0496114_0019685_1090_1986 | 295 |
| 392 | 3300048918 | Ga0496115_0002706 | Ga0496115_0002706_7551_8447 | 295 |
| 393 | 3300049571 | Ga0501034_0036019 | Ga0501034_0036019_3841_4749 | 295 |
| 394 | 3300050490 | nmdc:mga03n38_10745_c1 | nmdc:mga03n38_10745_c1_511_1407 | 295 |
| 395 | 3300050494 | nmdc:mga06z11_11047_c1 | nmdc:mga06z11_11047_c1_2651_3547 | 295 |
| 396 | 3300050509 | nmdc:mga0qj67_27792_c1 | nmdc:mga0qj67_27792_c1_285_1187 | 295 |
| 397 | 3300050510 | nmdc:mga06r32_12511_c1 | nmdc:mga06r32_12511_c1_4071_4973 | 295 |
| 398 | 3300050511 | nmdc:mga08y16_230140_c1 | nmdc:mga08y16_230140_c1_646_1545 | 295 |
| 399 | 3300050511 | nmdc:mga08y16_545866_c1 | nmdc:mga08y16_545866_c1_205_1104 | 295 |
| 400 | iso_pu_bacteria | 2508501050 | 2508728166 | 295 |
| 401 | iso_pu_bacteria | 2509276021 | 2509385617 | 295 |
| 402 | iso_pu_bacteria | 2509276033 | 2509448335 | 295 |
| 403 | iso_pu_bacteria | 2510065019 | 2510136429 | 295 |
| 404 | iso_pu_bacteria | 2510461076 | 2510892308 | 295 |
| 405 | iso_pu_bacteria | 2510917030 | 2511198102 | 295 |
| 406 | iso_pu_bacteria | 2513237084 | 2513568058 | 295 |
| 407 | iso_pu_bacteria | 2513237085 | 2513578388 | 295 |
| 408 | iso_pu_bacteria | 2513237093 | 2513630999 | 295 |
| 409 | iso_pu_bacteria | 2513237103 | 2513711081 | 295 |
| 410 | iso_pu_bacteria | 2513237159 | 2513999351 | 295 |
| 411 | iso_pu_bacteria | 2513237162 | 2514021105 | 295 |
| 412 | iso_pu_bacteria | 2515154113 | 2515632215 | 295 |
| 413 | iso_pu_bacteria | 2515154114 | 2515643533 | 295 |
| 414 | iso_pu_bacteria | 2515154116 | 2515658332 | 295 |
| 415 | iso_pu_bacteria | 2515154134 | 2515738118 | 295 |
| 416 | iso_pu_bacteria | 2516653077 | 2517041200 | 295 |
| 417 | iso_pu_bacteria | 2516653085 | 2517080174 | 295 |
| 418 | iso_pu_bacteria | 2517093000 | 2517098175 | 295 |
| 419 | iso_pu_bacteria | 2517287029 | 2517410062 | 295 |
| 420 | iso_pu_bacteria | 2585427526 | 2585525578 | 295 |
| 421 | iso_pu_bacteria | 2585427528 | 2585538689 | 295 |
| 422 | iso_pu_bacteria | 2585427593 | 2585836642 | 295 |
| 423 | iso_pu_bacteria | 2615840624 | 2616294743 | 295 |
| 424 | iso_pu_bacteria | 2643221558 | 2643814631 | 295 |
| 425 | iso_pu_bacteria | 2718217882 | 2719184499 | 295 |
| 426 | iso_pu_bacteria | 2718217997 | 2719668392 | 295 |
| 427 | iso_pu_bacteria | 2718218009 | 2719728519 | 295 |
| 428 | iso_pu_bacteria | 2718218199 | 2720489085 | 295 |
| 429 | iso_pu_bacteria | 2718218232 | 2720609777 | 295 |
| 430 | iso_pu_bacteria | 2718218233 | 2720617209 | 295 |
| 431 | iso_pu_bacteria | 2718218235 | 2720628350 | 295 |
| 432 | iso_pu_bacteria | 2718218269 | 2720772304 | 295 |
| 433 | iso_pu_bacteria | 2718218363 | 2721144207 | 295 |
| 434 | iso_pu_bacteria | 2718218365 | 2721156305 | 295 |
| 435 | iso_pu_bacteria | 2718218366 | 2721161582 | 295 |
| 436 | iso_pu_bacteria | 2721755514 | 2722842727 | 295 |
| 437 | iso_pu_bacteria | 2721755556 | 2723029725 | 295 |
| 438 | iso_pu_bacteria | 2721755684 | 2723564094 | 295 |
| 439 | iso_pu_bacteria | 2721755685 | 2723570212 | 295 |
| 440 | iso_pu_bacteria | 2721755810 | 2724041544 | 295 |
| 441 | iso_pu_bacteria | 2721755819 | 2724092333 | 295 |
| 442 | iso_pu_bacteria | 2721755822 | 2724101759 | 295 |
| 443 | iso_pu_bacteria | 2721755823 | 2724112709 | 295 |
| 444 | iso_pu_bacteria | 2724679232 | 2725947834 | 295 |
| 445 | iso_pu_bacteria | 2728369352 | 2730110258 | 295 |
| 446 | iso_pu_bacteria | 2728369365 | 2730160615 | 295 |
| 447 | iso_pu_bacteria | 2728369397 | 2730295838 | 295 |
| 448 | iso_pu_bacteria | 2738541333 | 2739034112 | 295 |
| 449 | iso_pu_bacteria | 2758568016 | 2758637829 | 295 |
| 450 | iso_pu_bacteria | 2765235942 | 2766065111 | 295 |
| 451 | iso_pu_bacteria | 2791355256 | 2793297445 | 295 |
| 452 | iso_pu_bacteria | 2791355259 | 2793317318 | 295 |
| 453 | iso_pu_bacteria | 2791355260 | 2793323110 | 295 |
| 454 | iso_pu_bacteria | 2791355261 | 2793329872 | 295 |
| 455 | iso_pu_bacteria | 2791355262 | 2793336602 | 295 |
| 456 | iso_pu_bacteria | 2791355264 | 2793345379 | 295 |
| 457 | iso_pu_bacteria | 2791355265 | 2793354924 | 295 |
| 458 | iso_pu_bacteria | 2791355266 | 2793358163 | 295 |
| 459 | iso_pu_bacteria | 2802429605 | 2805927144 | 295 |
| 460 | iso_pu_bacteria | 2802429606 | 2805934430 | 295 |
| 461 | iso_pu_bacteria | 2802429633 | 2806042909 | 295 |
| 462 | iso_pu_bacteria | 2802429634 | 2806050862 | 295 |
| 463 | iso_pu_bacteria | 2802429635 | 2806057970 | 295 |
| 464 | iso_pu_bacteria | 2802429636 | 2806065317 | 295 |
| 465 | iso_pu_bacteria | 2802429637 | 2806076800 | 295 |
| 466 | iso_pu_bacteria | 2835312727 | 2835316039 | 295 |
| 467 | iso_pu_bacteria | 2838016132 | 2838016391 | 295 |
| 468 | iso_pu_bacteria | 2838022645 | 2838028328 | 295 |
| 469 | iso_pu_bacteria | 2838048938 | 2838049498 | 295 |
| 470 | iso_pu_bacteria | 2838061910 | 2838065227 | 295 |
| 471 | iso_pu_bacteria | 2838068647 | 2838068927 | 295 |
| 472 | iso_pu_bacteria | 2838668709 | 2838669552 | 295 |
| 473 | iso_pu_bacteria | 2838680041 | 2838686244 | 295 |
| 474 | iso_pu_bacteria | 2838686498 | 2838687469 | 295 |
| 475 | iso_pu_bacteria | 2838701080 | 2838701924 | 295 |
| 476 | iso_pu_bacteria | 2838707686 | 2838713951 | 295 |
| 477 | iso_pu_bacteria | 2838729681 | 2838734119 | 295 |
| 478 | iso_pu_bacteria | 2838742623 | 2838746571 | 295 |
| 479 | iso_pu_bacteria | 2841851746 | 2841854019 | 295 |
| 480 | iso_pu_bacteria | 2841864319 | 2841869339 | 295 |
| 481 | iso_pu_bacteria | 2842077413 | 2842083349 | 295 |
| 482 | iso_pu_bacteria | 2842110456 | 2842116732 | 295 |
| 483 | iso_pu_bacteria | 2842118031 | 2842124296 | 295 |
| 484 | iso_pu_bacteria | 2842156927 | 2842159614 | 295 |
| 485 | iso_pu_bacteria | 2842163707 | 2842164063 | 295 |
| 486 | iso_pu_bacteria | 2842180545 | 2842182816 | 295 |
| 487 | iso_pu_bacteria | 2842192696 | 2842198539 | 295 |
| 488 | iso_pu_bacteria | 2842198810 | 2842204304 | 295 |
| 489 | iso_pu_bacteria | 2842205361 | 2842209371 | 295 |
| 490 | iso_pu_bacteria | 2842217011 | 2842221591 | 295 |
| 491 | iso_pu_bacteria | 2842229732 | 2842232527 | 295 |
| 492 | iso_pu_bacteria | 2842237096 | 2842243368 | 295 |
| 493 | iso_pu_bacteria | 2842243621 | 2842247230 | 295 |
| 494 | iso_pu_bacteria | 2842250916 | 2842251653 | 295 |
| 495 | iso_pu_bacteria | 2842257432 | 2842259083 | 295 |
| 496 | iso_pu_bacteria | 2842264693 | 2842265263 | 295 |
| 497 | iso_pu_bacteria | 2842271015 | 2842272497 | 295 |
| 498 | iso_pu_bacteria | 2842278818 | 2842282585 | 295 |
| 499 | iso_pu_bacteria | 2842291075 | 2842297550 | 295 |
| 500 | iso_pu_bacteria | 2842304105 | 2842309831 | 295 |
| 501 | iso_pu_bacteria | 2842311132 | 2842313404 | 295 |
| 502 | iso_pu_bacteria | 2842317721 | 2842323361 | 295 |
| 503 | iso_pu_bacteria | 2842341865 | 2842344113 | 295 |
| 504 | iso_pu_bacteria | 2842370503 | 2842376579 | 295 |
| 505 | iso_pu_bacteria | 2842377471 | 2842383832 | 295 |
| 506 | iso_pu_bacteria | 2842384541 | 2842390975 | 295 |
| 507 | iso_pu_bacteria | 2842402390 | 2842405726 | 295 |
| 508 | iso_pu_bacteria | 2842409023 | 2842412310 | 295 |
| 509 | iso_pu_bacteria | 2842415677 | 2842418956 | 295 |
| 510 | iso_pu_bacteria | 2842422224 | 2842423073 | 295 |
| 511 | iso_pu_bacteria | 2842428310 | 2842428684 | 295 |
| 512 | iso_pu_bacteria | 2842434925 | 2842435297 | 295 |
| 513 | iso_pu_bacteria | 2842441272 | 2842441840 | 295 |
| 514 | iso_pu_bacteria | 2842447887 | 2842448114 | 295 |
| 515 | iso_pu_bacteria | 2842462802 | 2842463108 | 295 |
| 516 | iso_pu_bacteria | 2842469257 | 2842469628 | 295 |
| 517 | iso_pu_bacteria | 2842489311 | 2842489630 | 295 |
| 518 | iso_pu_bacteria | 2842495871 | 2842500462 | 295 |
| 519 | iso_pu_bacteria | 2842521101 | 2842525143 | 295 |
| 520 | iso_pu_bacteria | 2844454524 | 2844460465 | 295 |
| 521 | iso_pu_bacteria | 2854896431 | 2854899956 | 295 |
| 522 | iso_pu_bacteria | 2857516855 | 2857518030 | 295 |
| 523 | iso_pu_bacteria | 2894232714 | 2894237774 | 295 |
| 524 | iso_pu_bacteria | 2919100787 | 2919102789 | 295 |
| 525 | iso_pu_bacteria | 2933570622 | 2933576273 | 295 |
| 526 | iso_pu_bacteria | 2933586486 | 2933592948 | 295 |
| 527 | iso_pu_bacteria | 2933599457 | 2933599595 | 295 |
| 528 | iso_pu_bacteria | 2935894831 | 2935900993 | 295 |
| 529 | iso_pu_bacteria | 2935901341 | 2935903164 | 295 |
| 530 | iso_pu_bacteria | 2936367885 | 2936374399 | 295 |
| 531 | iso_pu_bacteria | 2936375103 | 2936378759 | 295 |
| 532 | iso_pu_bacteria | 2996893221 | 2996894491 | 295 |
| 533 | iso_pu_bacteria | 3005409236 | 3005413507 | 295 |
| 534 | iso_pu_bacteria | 3005445848 | 3005452049 | 295 |
| 535 | iso_pu_bacteria | 8005282627 | 8005287613 | 295 |
| 536 | iso_pu_bacteria | 8005289223 | 8005295520 | 295 |
| 537 | iso_pu_bacteria | 8005301065 | 8005306310 | 295 |
| 538 | iso_pu_bacteria | 8005307578 | 8005307933 | 295 |
| 539 | iso_pu_bacteria | 8005376324 | 8005379798 | 295 |
| 540 | iso_pu_bacteria | 8005382845 | 8005383403 | 295 |
| 541 | iso_pu_bacteria | 8005395548 | 8005398997 | 295 |
| 542 | iso_pu_bacteria | 8005430974 | 8005431769 | 295 |
| 543 | iso_pu_bacteria | 8005497431 | 8005502600 | 295 |
| 544 | iso_pu_bacteria | 8005556819 | 8005562360 | 295 |
| 545 | iso_pu_bacteria | 8005563573 | 8005565522 | 295 |
| 546 | iso_pu_bacteria | 8005570704 | 8005575762 | 295 |
| 547 | iso_pu_bacteria | 8005619151 | 8005623807 | 295 |
| 548 | iso_pu_bacteria | 8005626139 | 8005626366 | 295 |
| 549 | iso_pu_bacteria | 8005668836 | 8005674029 | 295 |
| 550 | iso_pu_bacteria | 8005688590 | 8005693994 | 295 |
| 551 | iso_pu_bacteria | 8018127388 | 8018131905 | 295 |
| 552 | iso_pu_bacteria | 8018163183 | 8018165502 | 295 |
| 553 | iso_pu_bacteria | 8023680758 | 8023688085 | 295 |
| 554 | iso_pu_bacteria | 8024479707 | 8024485040 | 295 |
| 555 | iso_pu_bacteria | 8024501048 | 8024507170 | 295 |
| 556 | iso_pu_bacteria | 8056375014 | 8056375043 | 295 |
| 557 | iso_pu_bacteria | 8056382006 | 8056382491 | 295 |
| 558 | iso_pu_bacteria | 8057874678 | 8057878015 | 295 |
| 559 | 3300003659 | JGI25404J52841_10000339 | JGI25404J52841_100003398 | 296 |
| 560 | 3300003659 | JGI25404J52841_10016648 | JGI25404J52841_100166482 | 296 |
| 561 | 3300005293 | Ga0065715_10161723 | Ga0065715_101617232 | 296 |
| 562 | 3300005336 | Ga0070680_100034094 | Ga0070680_1000340944 | 296 |
| 563 | 3300005367 | Ga0070667_100291403 | Ga0070667_1002914032 | 296 |
| 564 | 3300005458 | Ga0070681_10116057 | Ga0070681_101160573 | 296 |
| 565 | 3300005530 | Ga0070679_100019403 | Ga0070679_1000194035 | 296 |
| 566 | 3300005539 | Ga0068853_100060577 | Ga0068853_1000605773 | 296 |
| 567 | 3300005548 | Ga0070665_100277455 | Ga0070665_1002774552 | 296 |
| 568 | 3300005577 | Ga0068857_100013484 | Ga0068857_1000134843 | 296 |
| 569 | 3300005983 | Ga0081540_1003442 | Ga0081540_10034423 | 296 |
| 570 | 3300005983 | Ga0081540_1014249 | Ga0081540_10142491 | 296 |
| 571 | 3300006042 | Ga0075368_10092149 | Ga0075368_100921491 | 296 |
| 572 | 3300006051 | Ga0075364_10317613 | Ga0075364_103176132 | 296 |
| 573 | 3300006177 | Ga0075362_10061163 | Ga0075362_100611632 | 296 |
| 574 | 3300006186 | Ga0075369_10083286 | Ga0075369_100832862 | 296 |
| 575 | 3300006844 | Ga0075428_100092179 | Ga0075428_1000921792 | 296 |
| 576 | 3300006844 | Ga0075428_100250183 | Ga0075428_1002501832 | 296 |
| 577 | 3300006844 | Ga0075428_100358949 | Ga0075428_1003589491 | 296 |
| 578 | 3300006844 | Ga0075428_100427878 | Ga0075428_1004278782 | 296 |
| 579 | 3300006846 | Ga0075430_100119818 | Ga0075430_1001198182 | 296 |
| 580 | 3300006846 | Ga0075430_100248046 | Ga0075430_1002480462 | 296 |
| 581 | 3300006846 | Ga0075430_100275755 | Ga0075430_1002757552 | 296 |
| 582 | 3300006847 | Ga0075431_100015726 | Ga0075431_1000157265 | 296 |
| 583 | 3300006847 | Ga0075431_100247157 | Ga0075431_1002471572 | 296 |
| 584 | 3300006847 | Ga0075431_100342482 | Ga0075431_1003424822 | 296 |
| 585 | 3300006880 | Ga0075429_100073335 | Ga0075429_1000733353 | 296 |
| 586 | 3300009093 | Ga0105240_10097351 | Ga0105240_100973513 | 296 |
| 587 | 3300009147 | Ga0114129_10228326 | Ga0114129_102283262 | 296 |
| 588 | 3300010375 | Ga0105239_10523033 | Ga0105239_105230332 | 296 |
| 589 | 3300013104 | Ga0157370_10023801 | Ga0157370_100238012 | 296 |
| 590 | 3300013104 | Ga0157370_10314929 | Ga0157370_103149292 | 296 |
| 591 | 3300013306 | Ga0163162_10423863 | Ga0163162_104238632 | 296 |
| 592 | 3300025912 | Ga0207707_10100127 | Ga0207707_101001272 | 296 |
| 593 | 3300025913 | Ga0207695_10087976 | Ga0207695_100879763 | 296 |
| 594 | 3300025921 | Ga0207652_10119480 | Ga0207652_101194802 | 296 |
| 595 | 3300025949 | Ga0207667_10049571 | Ga0207667_100495711 | 296 |
| 596 | 3300025986 | Ga0207658_10028464 | Ga0207658_100284645 | 296 |
| 597 | 3300026041 | Ga0207639_10124095 | Ga0207639_101240951 | 296 |
| 598 | 3300026078 | Ga0207702_10053185 | Ga0207702_100531854 | 296 |
| 599 | 3300027907 | Ga0207428_10059159 | Ga0207428_100591592 | 296 |
| 600 | 3300028380 | Ga0268265_10178697 | Ga0268265_101786972 | 296 |
| 601 | 3300031456 | Ga0307513_10213258 | Ga0307513_102132582 | 296 |
| 602 | 3300031456 | Ga0307513_10269250 | Ga0307513_102692503 | 296 |
| 603 | 3300037418 | Ga0395900_0018325 | Ga0395900_0018325_6042_6944 | 296 |
| 604 | 3300037418 | Ga0395900_0529655 | Ga0395900_0529655_189_1082 | 296 |
| 605 | 3300037466 | Ga0395898_0007511 | Ga0395898_0007511_7073_7975 | 296 |
| 606 | 3300037853 | Ga0436364_0063930 | Ga0436364_0063930_1044_1952 | 296 |
| 607 | 3300038443 | Ga0395901_0159895 | Ga0395901_0159895_797_1690 | 296 |
| 608 | 3300039437 | Ga0436365_0481731 | Ga0436365_0481731_1841_2749 | 296 |
| 609 | 3300039438 | Ga0436360_0178193 | Ga0436360_0178193_2476_3384 | 296 |
| 610 | 3300041460 | Ga0451802_0956542 | Ga0451802_0956542_325_1239 | 296 |
| 611 | 3300042157 | Ga0439458_0027395 | Ga0439458_0027395_108_1001 | 296 |
| 612 | 3300042439 | Ga0439464_0028317 | Ga0439464_0028317_150_1043 | 296 |
| 613 | 3300046477 | Ga0495664_0077379 | Ga0495664_0077379_564_1478 | 296 |
| 614 | 3300046543 | Ga0495645_0029087 | Ga0495645_0029087_2903_3817 | 296 |
| 615 | 3300047443 | Ga0495687_097650 | Ga0495687_097650_30_938 | 296 |
| 616 | 3300048924 | Ga0496121_0000406 | Ga0496121_0000406_18737_19642 | 296 |
| 617 | 3300049574 | Ga0501038_0027545 | Ga0501038_0027545_2481_3380 | 296 |
| 618 | 3300049574 | Ga0501038_0028509 | Ga0501038_0028509_3196_4110 | 296 |
| 619 | 3300049822 | Ga0501035_0228322 | Ga0501035_0228322_290_1204 | 296 |
| 620 | 3300049823 | Ga0501044_0072326 | Ga0501044_0072326_1319_2233 | 296 |
| 621 | 3300050491 | nmdc:mga00v17_104960_c1 | nmdc:mga00v17_104960_c1_610_1509 | 296 |
| 622 | 3300050492 | nmdc:mga0yw44_112489_c1 | nmdc:mga0yw44_112489_c1_390_1283 | 296 |
| 623 | 3300050492 | nmdc:mga0yw44_7443_c1 | nmdc:mga0yw44_7443_c1_1055_1954 | 296 |
| 624 | 3300050493 | nmdc:mga0k408_45159_c1 | nmdc:mga0k408_45159_c1_18_932 | 296 |
| 625 | 3300050507 | nmdc:mga05p37_106889_c1 | nmdc:mga05p37_106889_c1_1431_2345 | 296 |
| 626 | 3300050508 | nmdc:mga09592_188763_c1 | nmdc:mga09592_188763_c1_532_1446 | 296 |
| 627 | 3300050508 | nmdc:mga09592_45885_c1 | nmdc:mga09592_45885_c1_1236_2150 | 296 |
| 628 | 3300050508 | nmdc:mga09592_53176_c1 | nmdc:mga09592_53176_c1_948_1862 | 296 |
| 629 | 3300050509 | nmdc:mga0qj67_132735_c1 | nmdc:mga0qj67_132735_c1_981_1895 | 296 |
| 630 | 3300050509 | nmdc:mga0qj67_51412_c1 | nmdc:mga0qj67_51412_c1_575_1489 | 296 |
| 631 | 3300050510 | nmdc:mga06r32_235229_c1 | nmdc:mga06r32_235229_c1_540_1454 | 296 |
| 632 | 3300050510 | nmdc:mga06r32_4390_c1 | nmdc:mga06r32_4390_c1_6448_7362 | 296 |
| 633 | 3300050511 | nmdc:mga08y16_76334_c1 | nmdc:mga08y16_76334_c1_1163_2077 | 296 |
| 634 | iso_pu_bacteria | 2508501127 | 2509144701 | 296 |
| 635 | iso_pu_bacteria | 2513237087 | 2513591257 | 296 |
| 636 | iso_pu_bacteria | 2751185800 | 2753361093 | 296 |
| 637 | iso_pu_bacteria | 2842694124 | 2842695716 | 296 |
| 638 | iso_pu_bacteria | 2924762789 | 2924765984 | 296 |
| 639 | iso_pu_bacteria | 2987666974 | 2987668500 | 296 |
| 640 | iso_pu_bacteria | 639633055 | 639644988 | 296 |
| 641 | 3300003771 | Ga0055526_1000017 | Ga0055526_1000017111 | 297 |
| 642 | 3300003775 | Ga0055524_1000014 | Ga0055524_100001457 | 297 |
| 643 | 3300003775 | Ga0055524_1010792 | Ga0055524_10107922 | 297 |
| 644 | 3300005329 | Ga0070683_100492237 | Ga0070683_1004922372 | 297 |
| 645 | 3300005436 | Ga0070713_100160398 | Ga0070713_1001603981 | 297 |
| 646 | 3300005436 | Ga0070713_100186107 | Ga0070713_1001861072 | 297 |
| 647 | 3300006028 | Ga0070717_10082654 | Ga0070717_100826542 | 297 |
| 648 | 3300014326 | Ga0157380_10590924 | Ga0157380_105909241 | 297 |
| 649 | 3300014497 | Ga0182008_10039986 | Ga0182008_100399862 | 297 |
| 650 | 3300020080 | Ga0206350_11027389 | Ga0206350_110273891 | 297 |
| 651 | 3300025291 | Ga0209675_1002662 | Ga0209675_10026629 | 297 |
| 652 | 3300025294 | Ga0209025_1000017 | Ga0209025_100001768 | 297 |
| 653 | 3300025295 | Ga0209564_1000031 | Ga0209564_100003196 | 297 |
| 654 | 3300025295 | Ga0209564_1000082 | Ga0209564_1000082170 | 297 |
| 655 | 3300025299 | Ga0209256_1000033 | Ga0209256_1000033291 | 297 |
| 656 | 3300025299 | Ga0209256_1000181 | Ga0209256_100018175 | 297 |
| 657 | 3300025928 | Ga0207700_10010378 | Ga0207700_100103783 | 297 |
| 658 | 3300025928 | Ga0207700_10276604 | Ga0207700_102766042 | 297 |
| 659 | 3300026023 | Ga0207677_10414397 | Ga0207677_104143971 | 297 |
| 660 | 3300048920 | Ga0496117_0017924 | Ga0496117_0017924_4138_5040 | 297 |
| 661 | 3300048920 | Ga0496117_0071594 | Ga0496117_0071594_894_1799 | 297 |
| 662 | 3300048922 | Ga0496119_0008868 | Ga0496119_0008868_989_1900 | 297 |
| 663 | 3300048925 | Ga0496122_0023409 | Ga0496122_0023409_1560_2471 | 297 |
| 664 | 3300048928 | Ga0496125_0000471 | Ga0496125_0000471_35109_36020 | 297 |
| 665 | 3300049571 | Ga0501034_0022087 | Ga0501034_0022087_460_1362 | 297 |
| 666 | 3300053119 | Ga0500595_002181 | Ga0500595_002181_4177_5088 | 297 |
| 667 | iso_pu_bacteria | 2791355263 | 2793344511 | 297 |
| 668 | iso_pu_bacteria | 2936381700 | 2936386549 | 297 |
| 669 | 3300004803 | Ga0058862_12352147 | Ga0058862_123521472 | 298 |
| 670 | 3300005329 | Ga0070683_100440100 | Ga0070683_1004401002 | 298 |
| 671 | 3300005456 | Ga0070678_100070667 | Ga0070678_1000706673 | 298 |
| 672 | 3300009093 | Ga0105240_10119069 | Ga0105240_101190692 | 298 |
| 673 | 3300026121 | Ga0207683_10099071 | Ga0207683_100990711 | 298 |
| 674 | 3300036401 | Ga0373937_0274478 | Ga0373937_0274478_151_1074 | 298 |
| 675 | 3300037853 | Ga0436364_0210545 | Ga0436364_0210545_377_1315 | 298 |
| 676 | 3300044694 | Ga0466963_0145165 | Ga0466963_0145165_16_954 | 298 |
| 677 | 3300046462 | Ga0495651_0017859 | Ga0495651_0017859_3166_4089 | 298 |
| 678 | 3300047317 | Ga0495604_0157604 | Ga0495604_0157604_591_1514 | 298 |
| 679 | 3300047322 | Ga0495680_0209890 | Ga0495680_0209890_153_1076 | 298 |
| 680 | 3300048928 | Ga0496125_0000145 | Ga0496125_0000145_60579_61487 | 298 |
| 681 | 3300053161 | Ga0500634_0000507 | Ga0500634_0000507_11204_12100 | 298 |
| 682 | 3300002739 | JGI25158J39367_1000448 | JGI25158J39367_10004482 | 299 |
| 683 | 3300002773 | JGI25152J39213_1005931 | JGI25152J39213_10059313 | 299 |
| 684 | 3300002987 | JGI25159J45721_1004075 | JGI25159J45721_10040752 | 299 |
| 685 | 3300003187 | JGI25151J46595_10000508 | JGI25151J46595_1000050826 | 299 |
| 686 | 3300003215 | JGI25153J46596_10002535 | JGI25153J46596_1000253511 | 299 |
| 687 | 3300003215 | JGI25153J46596_10010647 | JGI25153J46596_100106473 | 299 |
| 688 | 3300003215 | JGI25153J46596_10014909 | JGI25153J46596_100149093 | 299 |
| 689 | 3300003354 | JGI25160J50197_1040511 | JGI25160J50197_10405111 | 299 |
| 690 | 3300003374 | JGI25161J50226_1000075 | JGI25161J50226_100007554 | 299 |
| 691 | 3300003374 | JGI25161J50226_1006294 | JGI25161J50226_10062942 | 299 |
| 692 | 3300003771 | Ga0055526_1005597 | Ga0055526_10055973 | 299 |
| 693 | 3300003771 | Ga0055526_1024737 | Ga0055526_10247372 | 299 |
| 694 | 3300003790 | Ga0055528_1000054 | Ga0055528_100005460 | 299 |
| 695 | 3300003790 | Ga0055528_1002349 | Ga0055528_10023492 | 299 |
| 696 | 3300003792 | Ga0055540_1000255 | Ga0055540_100025521 | 299 |
| 697 | 3300003792 | Ga0055540_1025147 | Ga0055540_10251472 | 299 |
| 698 | 3300003794 | Ga0055531_10016286 | Ga0055531_100162861 | 299 |
| 699 | 3300004625 | Ga0055543_1000096 | Ga0055543_100009644 | 299 |
| 700 | 3300004625 | Ga0055543_1000578 | Ga0055543_10005784 | 299 |
| 701 | 3300005262 | Ga0065165_1007353 | Ga0065165_10073532 | 299 |
| 702 | 3300005262 | Ga0065165_1011236 | Ga0065165_10112364 | 299 |
| 703 | 3300005441 | Ga0070700_100040608 | Ga0070700_1000406081 | 299 |
| 704 | 3300006038 | Ga0075365_10005493 | Ga0075365_100054932 | 299 |
| 705 | 3300006038 | Ga0075365_10016988 | Ga0075365_100169883 | 299 |
| 706 | 3300006042 | Ga0075368_10062883 | Ga0075368_100628832 | 299 |
| 707 | 3300006051 | Ga0075364_10000285 | Ga0075364_100002852 | 299 |
| 708 | 3300006058 | Ga0075432_10016468 | Ga0075432_100164683 | 299 |
| 709 | 3300006177 | Ga0075362_10006876 | Ga0075362_100068761 | 299 |
| 710 | 3300006178 | Ga0075367_10008149 | Ga0075367_100081497 | 299 |
| 711 | 3300006195 | Ga0075366_10096705 | Ga0075366_100967052 | 299 |
| 712 | 3300006353 | Ga0075370_10139245 | Ga0075370_101392451 | 299 |
| 713 | 3300009148 | Ga0105243_10108107 | Ga0105243_101081072 | 299 |
| 714 | 3300009765 | Ga0123341_1000012 | Ga0123341_100001246 | 299 |
| 715 | 3300009766 | Ga0123342_1012643 | Ga0123342_101264311 | 299 |
| 716 | 3300011119 | Ga0105246_10188245 | Ga0105246_101882452 | 299 |
| 717 | 3300014326 | Ga0157380_10007607 | Ga0157380_100076072 | 299 |
| 718 | 3300025208 | Ga0209436_100035 | Ga0209436_10003515 | 299 |
| 719 | 3300025245 | Ga0207425_1002132 | Ga0207425_10021324 | 299 |
| 720 | 3300025245 | Ga0207425_1012579 | Ga0207425_10125792 | 299 |
| 721 | 3300025258 | Ga0209129_1003154 | Ga0209129_10031543 | 299 |
| 722 | 3300025258 | Ga0209129_1005382 | Ga0209129_10053822 | 299 |
| 723 | 3300025273 | Ga0209673_1000067 | Ga0209673_1000067172 | 299 |
| 724 | 3300025273 | Ga0209673_1000750 | Ga0209673_100075024 | 299 |
| 725 | 3300025273 | Ga0209673_1001376 | Ga0209673_100137624 | 299 |
| 726 | 3300025284 | Ga0209130_1000031 | Ga0209130_1000031189 | 299 |
| 727 | 3300025294 | Ga0209025_1000397 | Ga0209025_100039774 | 299 |
| 728 | 3300025295 | Ga0209564_1000092 | Ga0209564_1000092172 | 299 |
| 729 | 3300025295 | Ga0209564_1000511 | Ga0209564_10005117 | 299 |
| 730 | 3300025295 | Ga0209564_1000925 | Ga0209564_10009256 | 299 |
| 731 | 3300025295 | Ga0209564_1022634 | Ga0209564_10226342 | 299 |
| 732 | 3300025297 | Ga0209758_1000504 | Ga0209758_100050440 | 299 |
| 733 | 3300025297 | Ga0209758_1000585 | Ga0209758_100058511 | 299 |
| 734 | 3300025297 | Ga0209758_1005532 | Ga0209758_10055328 | 299 |
| 735 | 3300025298 | Ga0209050_1004942 | Ga0209050_10049427 | 299 |
| 736 | 3300025299 | Ga0209256_1000170 | Ga0209256_1000170112 | 299 |
| 737 | 3300025299 | Ga0209256_1004342 | Ga0209256_10043428 | 299 |
| 738 | 3300025299 | Ga0209256_1015056 | Ga0209256_10150563 | 299 |
| 739 | 3300025299 | Ga0209256_1022722 | Ga0209256_10227222 | 299 |
| 740 | 3300025302 | Ga0207426_1000042 | Ga0207426_1000042221 | 299 |
| 741 | 3300025302 | Ga0207426_1000355 | Ga0207426_100035565 | 299 |
| 742 | 3300025303 | Ga0209051_1000062 | Ga0209051_100006266 | 299 |
| 743 | 3300025303 | Ga0209051_1009790 | Ga0209051_10097903 | 299 |
| 744 | 3300025304 | Ga0209257_1000970 | Ga0209257_100097019 | 299 |
| 745 | 3300025304 | Ga0209257_1037430 | Ga0209257_10374301 | 299 |
| 746 | 3300026075 | Ga0207708_10058747 | Ga0207708_100587471 | 299 |
| 747 | 3300027866 | Ga0209813_10073571 | Ga0209813_100735711 | 299 |
| 748 | 3300027907 | Ga0207428_10074571 | Ga0207428_100745713 | 299 |
| 749 | 3300037471 | Ga0395905_0014555 | Ga0395905_0014555_2504_3403 | 299 |
| 750 | 3300041494 | Ga0451837_1690335 | Ga0451837_1690335_340_1242 | 299 |
| 751 | 3300041496 | Ga0451839_0668746 | Ga0451839_0668746_252_1154 | 299 |
| 752 | 3300041498 | Ga0451841_0665146 | Ga0451841_0665146_217_1119 | 299 |
| 753 | 3300041503 | Ga0451847_0365642 | Ga0451847_0365642_217_1119 | 299 |
| 754 | 3300041503 | Ga0451847_0833553 | Ga0451847_0833553_422_1324 | 299 |
| 755 | 3300041505 | Ga0451849_0492377 | Ga0451849_0492377_2104_3006 | 299 |
| 756 | 3300041509 | Ga0451843_0493458 | Ga0451843_0493458_217_1119 | 299 |
| 757 | 3300041509 | Ga0451843_1370099 | Ga0451843_1370099_380_1282 | 299 |
| 758 | 3300041512 | Ga0451853_2198736 | Ga0451853_2198736_1612_2511 | 299 |
| 759 | 3300044765 | Ga0466970_0024331 | Ga0466970_0024331_651_1550 | 299 |
| 760 | 3300046460 | Ga0495638_0000475 | Ga0495638_0000475_3704_4603 | 299 |
| 761 | 3300046460 | Ga0495638_0017603 | Ga0495638_0017603_347_1249 | 299 |
| 762 | 3300046492 | Ga0495585_0058598 | Ga0495585_0058598_170_1072 | 299 |
| 763 | 3300046501 | Ga0495607_0021279 | Ga0495607_0021279_2941_3843 | 299 |
| 764 | 3300046512 | Ga0495610_0068843 | Ga0495610_0068843_312_1214 | 299 |
| 765 | 3300046519 | Ga0495632_0054675 | Ga0495632_0054675_469_1371 | 299 |
| 766 | 3300046542 | Ga0495597_0018419 | Ga0495597_0018419_591_1493 | 299 |
| 767 | 3300046616 | Ga0495668_0091160 | Ga0495668_0091160_138_1040 | 299 |
| 768 | 3300046660 | Ga0495625_0065986 | Ga0495625_0065986_1005_1907 | 299 |
| 769 | 3300046660 | Ga0495625_0149096 | Ga0495625_0149096_562_1464 | 299 |
| 770 | 3300046691 | Ga0495670_0079396 | Ga0495670_0079396_226_1128 | 299 |
| 771 | 3300046794 | Ga0495589_0196969 | Ga0495589_0196969_24_923 | 299 |
| 772 | 3300047447 | Ga0495685_063961 | Ga0495685_063961_288_1190 | 299 |
| 773 | 3300047470 | Ga0495681_0119790 | Ga0495681_0119790_37_939 | 299 |
| 774 | 3300047472 | Ga0495686_0038269 | Ga0495686_0038269_398_1300 | 299 |
| 775 | 3300048919 | Ga0496116_0009436 | Ga0496116_0009436_4538_5437 | 299 |
| 776 | 3300048921 | Ga0496118_0002068 | Ga0496118_0002068_5980_6879 | 299 |
| 777 | 3300048921 | Ga0496118_0028344 | Ga0496118_0028344_3328_4227 | 299 |
| 778 | 3300048925 | Ga0496122_0026726 | Ga0496122_0026726_720_1619 | 299 |
| 779 | 3300048928 | Ga0496125_0010847 | Ga0496125_0010847_5897_6796 | 299 |
| 780 | 3300049571 | Ga0501034_0145736 | Ga0501034_0145736_1256_2155 | 299 |
| 781 | 3300049574 | Ga0501038_0098912 | Ga0501038_0098912_326_1225 | 299 |
| 782 | 3300049581 | Ga0501047_0061392 | Ga0501047_0061392_1709_2608 | 299 |
| 783 | 3300049744 | Ga0501083_0028777 | Ga0501083_0028777_2542_3441 | 299 |
| 784 | 3300049823 | Ga0501044_0114589 | Ga0501044_0114589_1336_2235 | 299 |
| 785 | 3300050489 | nmdc:mga03683_70474_c1 | nmdc:mga03683_70474_c1_372_1271 | 299 |
| 786 | 3300050490 | nmdc:mga03n38_157664_c1 | nmdc:mga03n38_157664_c1_139_1038 | 299 |
| 787 | 3300050491 | nmdc:mga00v17_14_c1 | nmdc:mga00v17_14_c1_103231_104139 | 299 |
| 788 | 3300050492 | nmdc:mga0yw44_3294_c1 | nmdc:mga0yw44_3294_c1_243_1142 | 299 |
| 789 | 3300050494 | nmdc:mga06z11_160131_c1 | nmdc:mga06z11_160131_c1_174_1073 | 299 |
| 790 | 3300050516 | nmdc:mga0sz30_74628_c1 | nmdc:mga0sz30_74628_c1_320_1219 | 299 |
| 791 | 3300053108 | Ga0500562_022839 | Ga0500562_022839_512_1411 | 299 |
| 792 | 3300053109 | Ga0500569_046106 | Ga0500569_046106_330_1232 | 299 |
| 793 | 3300053134 | Ga0500658_0002498 | Ga0500658_0002498_5206_6108 | 299 |
| 794 | 3300053134 | Ga0500658_0044689 | Ga0500658_0044689_640_1539 | 299 |
| 795 | 3300053139 | Ga0500568_0001438 | Ga0500568_0001438_340_1239 | 299 |
| 796 | 3300053153 | Ga0500616_0000472 | Ga0500616_0000472_7543_8442 | 299 |
| 797 | 3300061719 | Ga0466962_0101240 | Ga0466962_0101240_86_985 | 299 |
| 798 | iso_pu_bacteria | 2529292951 | 2530644670 | 299 |
| 799 | iso_pu_bacteria | 2718217927 | 2719388562 | 299 |
| 800 | iso_pu_bacteria | 2718217927 | 2719388581 | 299 |
| 801 | iso_pu_bacteria | 2718218423 | 2721403187 | 299 |
| 802 | iso_pu_bacteria | 2718218423 | 2721403206 | 299 |
| 803 | iso_pu_bacteria | 2721755809 | 2724035544 | 299 |
| 804 | iso_pu_bacteria | 2721755809 | 2724035563 | 299 |
| 805 | iso_pu_bacteria | 2791355267 | 2793369827 | 299 |
| 806 | iso_pu_bacteria | 2838042994 | 2838045839 | 299 |
| 807 | iso_pu_bacteria | 2842395702 | 2842396473 | 299 |
| 808 | iso_pu_bacteria | 8005275841 | 8005277278 | 299 |
| 809 | iso_pu_bacteria | 8005275841 | 8005277297 | 299 |
| 810 | iso_pu_bacteria | 8005695170 | 8005701816 | 299 |
| 811 | iso_pu_bacteria | 8018150411 | 8018150446 | 299 |
| 812 | iso_pu_bacteria | 8018176218 | 8018182373 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
120
308
0.84
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8822 | 28 | 284 |
| 3rlf-assembly1.cif.gz_G | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.8655 | 28 | 284 |
| 8ja7-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8509 | 27 | 294 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.8488 | 24 | 284 |
| 7cad-assembly1.cif.gz_B | mycobacterium smegmatis sugabc complex | 0.848 | 26 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9257 | 28 | 284 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9167 | 28 | 290 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9126 | 28 | 290 | 1.10.3720.10 |
| af_P9WG01_5_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9101 | 28 | 290 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9008 | 14 | 284 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660RIG7-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9644 | 36 | 284 |
GO:0005886
GO:0055085 |
| AF-A0A1F7MT14-F1-model_v4 | Sugar ABC transporter permease | 0.9602 | 27 | 273 |
GO:0005886
GO:0055085 |
| AF-A0A660RIG7-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9494 | 36 | 284 |
GO:0005886
GO:0055085 |
| AF-A0A2V6RI67-F1-model_v4 | Sugar ABC transporter permease | 0.9484 | 70 | 295 |
GO:0005886
GO:0055085 |
| AF-A0A023XWK9-F1-model_v4 | deleted | 0.9449 | 37 | 299 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar