F481897

General Info

Members Datasets Scaffolds Average Seq Length
812 620 458 296

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0210545|Ga0436364_0210545_377_1315
Length 312
Sequence MIDAIARTDQEISEVAAELEAAGPRLIDRPERLSWDSRLRTTITVYIPLAIFVIVLLFPFYWMAITAIKPDYEMYDYKTYNPFWVHSPTLHNIEVLLLQTNYPRWLMITMGIAVAATFLSVGSSVLAAYAIERLRFRGAEHAGLLIYLAYLVPPSILFIPLATLIYQFGLFDNPVALILTYPTFLVPFCTWLLIGYFKSIPYELEECALIDGASRLQILRRITLPLAVPGLISAGIFAFTLSWNEFIYALAFIQSTDRKTVPVAILTELVTGDVYQWGALMAGSLLGSIPVALIYSFFVEYYVSSMTGAVKE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
21 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
30 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
31 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
32 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
33 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
34 2643221558 Rhizobium sp. Root149 Isolate Unclassified
35 2643221733 Bosea sp. Root381 Isolate Unclassified
36 2643221736 Bosea sp. Root483D1 Isolate Unclassified
37 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
38 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
39 2718217882 Rhizobium sp. N741 Isolate Nodule
40 2718217927 Rhizobium sp. N324 Isolate Nodule
41 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
42 2718218009 Rhizobium sp. N561 Isolate Nodule
43 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
44 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
45 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
46 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
47 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
48 2718218363 Rhizobium sp. N113 Isolate Nodule
49 2718218365 Rhizobium sp. N731 Isolate Nodule
50 2718218366 Rhizobium sp. N621 Isolate Nodule
51 2718218423 Rhizobium sp. N941 Isolate Nodule
52 2721755514 Rhizobium sp. N6212 Isolate Nodule
53 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
54 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
55 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
56 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
57 2721755809 Rhizobium sp. N541 Isolate Nodule
58 2721755810 Rhizobium sp. N871 Isolate Nodule
59 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
60 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
61 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
62 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
63 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
64 2728369365 Rhizobium sp. N1341 Isolate Nodule
65 2728369397 Rhizobium sp. N1314 Isolate Nodule
66 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
67 2751185800 Brucella pituitosa AA2 Isolate Unclassified
68 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
69 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
70 2791355256 Rhizobium sp. M10 Isolate Nodule
71 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
72 2791355260 Rhizobium sp. L9 Isolate Nodule
73 2791355261 Rhizobium sp. J15 Isolate Nodule
74 2791355262 Rhizobium sp. M1 Isolate Nodule
75 2791355263 Rhizobium chutanense C5 Isolate Nodule
76 2791355264 Rhizobium sp. S9 Isolate Nodule
77 2791355265 Rhizobium sp. H4 Isolate Nodule
78 2791355266 Rhizobium sp. L43 Isolate Nodule
79 2791355267 Rhizobium sp. L18 Isolate Nodule
80 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
81 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
82 2802429633 Rhizobium anhuiense J3 Isolate Nodule
83 2802429634 Rhizobium anhuiense S10 Isolate Nodule
84 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
85 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
86 2802429637 Rhizobium anhuiense C15 Isolate Nodule
87 2818991467 Bosea vestrisii 3192 Isolate Unclassified
88 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
89 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
90 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
91 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
92 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
93 2838048938 Rhizobium pisi 27/80 Isolate Nodule
94 2838061910 Rhizobium phaseoli L15 Isolate Nodule
95 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
96 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
97 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
98 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
99 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
100 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
101 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
102 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
103 2841760612 Bosea sp. Tri-49 Isolate Nodule
104 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
105 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
106 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
107 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
108 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
109 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
110 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
111 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
112 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
113 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
114 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
115 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
116 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
117 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
118 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
119 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
120 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
121 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
122 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
123 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
124 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
125 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
126 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
127 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
128 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
129 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
130 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
131 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
132 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
133 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
134 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
135 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
136 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
137 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
138 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
139 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
140 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
141 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
142 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
143 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
144 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
145 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
146 2842694124 Methylopila sp. R-72369 Isolate Unclassified
147 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
148 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
149 2844104063 Bosea sp. Tri-39 Isolate Nodule
150 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
151 2851182111 Bosea sp. Tri-44 Isolate Nodule
152 2851246043 Bosea sp. Tri-54 Isolate Nodule
153 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
154 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
155 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
156 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
157 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
158 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
159 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
160 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
161 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
162 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
163 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
164 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
165 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
166 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
167 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
168 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
169 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
170 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
171 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
172 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
173 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
174 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
175 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
176 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
177 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
178 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
179 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
180 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
181 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
182 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
183 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
184 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
185 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
186 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
187 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
188 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
189 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
190 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
191 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
192 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
193 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
194 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
195 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
196 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
197 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
198 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
199 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
200 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
201 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
202 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
203 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
204 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
205 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
206 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
207 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
208 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
209 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
210 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
211 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
212 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
213 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
214 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
215 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
216 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
217 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
218 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
219 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
220 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
221 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
222 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
223 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
224 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
225 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
226 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
227 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
228 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
229 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
230 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
231 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
232 2933599457 Rhizobium phaseoli M3 Isolate Nodule
233 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
234 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
235 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
236 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
237 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
238 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
239 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
240 2936381700 Rhizobium chutanense C16 Isolate Unclassified
241 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
242 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
243 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
244 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
245 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
246 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
247 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
248 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
249 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
250 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
251 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
252 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
253 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
254 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
255 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
256 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
257 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
258 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
259 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
260 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
261 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
262 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
263 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
264 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
265 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
266 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
267 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
268 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
269 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
270 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
271 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
272 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
273 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
274 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
275 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
276 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
277 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
278 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
279 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
280 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
281 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
282 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
283 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
284 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
285 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
286 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
287 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
288 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
289 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
290 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
291 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
292 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
293 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
294 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
295 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
296 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
297 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
298 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
299 2996893221 Rhizobium sp. R635 Isolate Nodule
300 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
301 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
302 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
303 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
304 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
305 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
306 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
307 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
308 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
309 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
310 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
311 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
312 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
313 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
314 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
315 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
316 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
317 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
318 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
319 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
320 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
321 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
322 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
323 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
324 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
325 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
326 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
328 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
329 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
330 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
331 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
332 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
333 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
334 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
335 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
336 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
337 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
338 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
339 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
340 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
341 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
342 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
343 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
344 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
345 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
346 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
347 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
348 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
349 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
350 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
351 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
352 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
353 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
354 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
355 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
356 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
357 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
358 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
359 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
360 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
361 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
362 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
363 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
364 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
365 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
366 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
367 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
368 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
369 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
370 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
371 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
372 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
373 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
374 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
375 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
376 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
377 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
378 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
379 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
380 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
381 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
382 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
383 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
384 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
385 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
386 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
387 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
388 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
389 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
390 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
391 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
392 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
393 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
394 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
395 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
396 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
397 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
398 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
399 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
400 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
401 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
402 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
404 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
407 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
409 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
410 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
411 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
412 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
413 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
414 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
415 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
416 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
417 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
449 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
450 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
453 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
454 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
455 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
456 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
457 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
458 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
459 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
460 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
461 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
462 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
463 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
464 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
465 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
466 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
467 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
468 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
469 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
470 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
471 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
472 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
473 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
474 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
475 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
476 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
477 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
478 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
479 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
480 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
481 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
482 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
483 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
484 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
485 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
486 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
487 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
488 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
489 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
490 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
491 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
492 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
493 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
494 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
495 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
496 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
497 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
498 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
499 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
500 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
501 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
502 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
503 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
504 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
505 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
506 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
507 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
508 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
509 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
510 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
511 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
512 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
513 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
514 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
515 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
516 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
517 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
518 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
519 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
520 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
521 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
522 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
523 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
524 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
525 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
526 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
527 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
528 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
529 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
530 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
531 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
532 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
533 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
534 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
537 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
540 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
541 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
542 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
543 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
544 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
545 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
547 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
548 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
549 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
550 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
551 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
552 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
553 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
554 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
555 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
556 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
557 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
558 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
559 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
560 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
561 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
562 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
563 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
564 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
565 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
566 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
567 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
568 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
569 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
570 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
571 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
572 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
573 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
574 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
575 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
576 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
577 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
578 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
579 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
580 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
581 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
582 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
583 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
584 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
585 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
586 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
587 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
588 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
589 8005275841 Rhizobium sp. N4311 Isolate Nodule
590 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
591 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
592 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
593 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
594 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
595 8005382845 Rhizobium sp. R634 Isolate Nodule
596 8005395548 Rhizobium sp. R339 Isolate Nodule
597 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
598 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
599 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
600 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
601 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
602 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
603 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
604 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
605 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
606 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
607 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
608 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
609 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
610 8018176218 Rhizobium sp. N122 Isolate Nodule
611 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
612 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
613 8024501048 Rhizobium sp. H4 Isolate Nodule
614 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
615 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
616 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
617 8056382006 Rhizobium croatiense 13T Isolate Nodule
618 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
619 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
620 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.16
Metatranscriptomes 0.25
Isolates 43.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 38.3
Rhizoplane 1.6
Rhizosphere 33
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000448 3300002739 Bacteria 8533
2 JGI25152J39213_1005931 3300002773 Bacteria 3437
3 JGI25159J45721_1004075 3300002987 Bacteria 4958
4 JGI25159J45721_1008482 3300002987 Bacteria 2818
5 JGI25151J46595_10000458 3300003187 Bacteria 39262
6 JGI25151J46595_10000508 3300003187 Bacteria 36520
7 JGI25406J46586_10000433 3300003203 Bacteria 19355
8 JGI25153J46596_10002535 3300003215 Bacteria 10466
9 JGI25153J46596_10010647 3300003215 Bacteria 4140
10 JGI25153J46596_10014909 3300003215 Bacteria 3199
11 JGI25160J50197_1003716 3300003354 Bacteria 6735
12 JGI25160J50197_1040511 3300003354 Bacteria 1079
13 JGI25161J50226_1000075 3300003374 Bacteria 84775
14 JGI25161J50226_1006294 3300003374 Bacteria 2167
15 JGI25404J52841_10000339 3300003659 Bacteria 6235
16 JGI25404J52841_10016648 3300003659 Bacteria 1595
17 Ga0055542_1003894 3300003762 Bacteria 3838
18 Ga0055526_1000017 3300003771 Bacteria 210613
19 Ga0055526_1005597 3300003771 Bacteria 7157
20 Ga0055526_1024737 3300003771 Bacteria 1951
21 Ga0055524_1000014 3300003775 Bacteria 259417
22 Ga0055524_1010792 3300003775 Bacteria 3614
23 Ga0055528_1000054 3300003790 Bacteria 90334
24 Ga0055528_1002349 3300003790 Bacteria 10235
25 Ga0055540_1000255 3300003792 Bacteria 48177
26 Ga0055540_1025147 3300003792 Bacteria 1464
27 Ga0055531_10016286 3300003794 Bacteria 3216
28 Ga0055531_10046365 3300003794 Bacteria 1195
29 Ga0055543_1000096 3300004625 Bacteria 75972
30 Ga0055543_1000578 3300004625 Bacteria 20193
31 Ga0055543_1008108 3300004625 Bacteria 2356
32 Ga0058862_12352147 3300004803 Bacteria 1728
33 Ga0065165_1000231 3300005262 Bacteria 97237
34 Ga0065165_1007353 3300005262 Bacteria 5443
35 Ga0065165_1011236 3300005262 Bacteria 3763
36 Ga0065715_10161723 3300005293 Bacteria 1620
37 Ga0065707_10039833 3300005295 Bacteria 1392
38 Ga0065707_10117356 3300005295 Bacteria 2213
39 Ga0070683_100440100 3300005329 Bacteria 1244
40 Ga0070683_100473626 3300005329 Bacteria 1196
41 Ga0070683_100492237 3300005329 Bacteria 1171
42 Ga0070680_100034094 3300005336 Bacteria 4105
43 Ga0070680_100064135 3300005336 Bacteria 3011
44 Ga0070680_100098095 3300005336 Bacteria 2430
45 Ga0068868_100011310 3300005338 Bacteria 6497
46 Ga0070691_10003977 3300005341 Bacteria 6687
47 Ga0070669_100400495 3300005353 Bacteria 1123
48 Ga0070669_100666918 3300005353 Bacteria 876
49 Ga0070674_100246652 3300005356 Bacteria 1401
50 Ga0070659_100259525 3300005366 Bacteria 1441
51 Ga0070667_100291403 3300005367 Bacteria 1468
52 Ga0070713_100160398 3300005436 Bacteria 2007
53 Ga0070713_100186107 3300005436 Bacteria 1869
54 Ga0070700_100040608 3300005441 Bacteria 2849
55 Ga0070694_100003712 3300005444 Bacteria 9106
56 Ga0070694_100112115 3300005444 Bacteria 1945
57 Ga0070663_100007767 3300005455 Bacteria 6551
58 Ga0070678_100070667 3300005456 Bacteria 2611
59 Ga0070681_10000393 3300005458 Bacteria 35383
60 Ga0070681_10014505 3300005458 Bacteria 7842
61 Ga0070681_10116057 3300005458 Bacteria 2614
62 Ga0070707_100093884 3300005468 Bacteria 2905
63 Ga0070698_100446600 3300005471 Bacteria 1229
64 Ga0070679_100019403 3300005530 Bacteria 6610
65 Ga0070679_100172761 3300005530 Bacteria 2134
66 Ga0068853_100060577 3300005539 Bacteria 3271
67 Ga0068853_100112670 3300005539 Bacteria 2418
68 Ga0070686_100512241 3300005544 Bacteria 933
69 Ga0070695_100100156 3300005545 Bacteria 1950
70 Ga0070665_100175214 3300005548 Bacteria 2146
71 Ga0070665_100277455 3300005548 Bacteria 1678
72 Ga0070704_100003315 3300005549 Bacteria 9212
73 Ga0068855_100513777 3300005563 Bacteria 1300
74 Ga0070664_100061891 3300005564 Bacteria 3190
75 Ga0070664_100169755 3300005564 Bacteria 1935
76 Ga0068857_100013484 3300005577 Bacteria 7120
77 Ga0068856_100002849 3300005614 Bacteria 17692
78 Ga0068856_100072955 3300005614 Bacteria 3398
79 Ga0068852_100002288 3300005616 Bacteria 13173
80 Ga0068852_100071600 3300005616 Bacteria 3045
81 Ga0068861_100075148 3300005719 Bacteria 2630
82 Ga0068851_10131991 3300005834 Bacteria 1351
83 Ga0068858_100132512 3300005842 Bacteria 2338
84 Ga0081540_1000338 3300005983 Bacteria 48150
85 Ga0081540_1003442 3300005983 Bacteria 12498
86 Ga0081540_1005876 3300005983 Bacteria 9072
87 Ga0081540_1006001 3300005983 Bacteria 8945
88 Ga0081540_1014249 3300005983 Bacteria 5106
89 Ga0081539_10000549 3300005985 Bacteria 77428
90 Ga0070717_10082654 3300006028 Bacteria 2700
91 Ga0075365_10005493 3300006038 Bacteria 6843
92 Ga0075365_10016988 3300006038 Bacteria 4443
93 Ga0075365_10116315 3300006038 Bacteria 1841
94 Ga0075368_10062883 3300006042 Bacteria 1488
95 Ga0075368_10092149 3300006042 Bacteria 1240
96 Ga0075363_100002563 3300006048 Bacteria 7472
97 Ga0075364_10000285 3300006051 Bacteria 24819
98 Ga0075364_10317613 3300006051 Bacteria 1061
99 Ga0075432_10016468 3300006058 Bacteria 2523
100 Ga0075362_10006876 3300006177 Bacteria 4262
101 Ga0075362_10061163 3300006177 Bacteria 1704
102 Ga0075367_10002436 3300006178 Bacteria 8500
103 Ga0075367_10008149 3300006178 Bacteria 5412
104 Ga0075369_10083286 3300006186 Bacteria 1420
105 Ga0075366_10096705 3300006195 Bacteria 1770
106 Ga0075370_10139245 3300006353 Bacteria 1418
107 Ga0075428_100092179 3300006844 Bacteria 3303
108 Ga0075428_100097827 3300006844 Bacteria 3200
109 Ga0075428_100250183 3300006844 Bacteria 1910
110 Ga0075428_100358949 3300006844 Bacteria 1563
111 Ga0075428_100427878 3300006844 Bacteria 1418
112 Ga0075430_100109636 3300006846 Bacteria 2302
113 Ga0075430_100119818 3300006846 Bacteria 2194
114 Ga0075430_100248046 3300006846 Bacteria 1475
115 Ga0075430_100275755 3300006846 Bacteria 1391
116 Ga0075431_100004249 3300006847 Bacteria 14032
117 Ga0075431_100015726 3300006847 Bacteria 7672
118 Ga0075431_100247157 3300006847 Bacteria 1813
119 Ga0075431_100342482 3300006847 Bacteria 1504
120 Ga0075434_100116694 3300006871 Bacteria 2682
121 Ga0075429_100073335 3300006880 Bacteria 2982
122 Ga0105240_10011032 3300009093 Bacteria 12637
123 Ga0105240_10097351 3300009093 Bacteria 3585
124 Ga0105240_10119069 3300009093 Bacteria 3181
125 Ga0105245_10214159 3300009098 Bacteria 1855
126 Ga0114129_10042219 3300009147 Bacteria 6420
127 Ga0114129_10228326 3300009147 Bacteria 2508
128 Ga0105243_10108107 3300009148 Bacteria 2321
129 Ga0105243_10342701 3300009148 Bacteria 1369
130 Ga0105241_10297806 3300009174 Bacteria 1383
131 Ga0123341_1000012 3300009765 Bacteria 105056
132 Ga0123342_1012643 3300009766 Bacteria 8727
133 Ga0105028_108689 3300009993 Bacteria 1063
134 Ga0105239_10089511 3300010375 Bacteria 3394
135 Ga0105239_10523033 3300010375 Bacteria 1350
136 Ga0105246_10032074 3300011119 Bacteria 3481
137 Ga0105246_10188245 3300011119 Bacteria 1595
138 Ga0157370_10023801 3300013104 Bacteria 6076
139 Ga0157370_10211933 3300013104 Bacteria 1795
140 Ga0157370_10314929 3300013104 Bacteria 1444
141 Ga0163162_10222678 3300013306 Bacteria 2016
142 Ga0163162_10423863 3300013306 Bacteria 1463
143 Ga0157372_10517315 3300013307 Bacteria 1391
144 Ga0157375_10073454 3300013308 Bacteria 3439
145 Ga0163163_10321085 3300014325 Bacteria 1602
146 Ga0157380_10007607 3300014326 Bacteria 7700
147 Ga0157380_10590924 3300014326 Bacteria 1097
148 Ga0182008_10039986 3300014497 Bacteria 2342
149 Ga0157376_10215584 3300014969 Bacteria 1775
150 Ga0206350_11027389 3300020080 Bacteria 1104
151 Ga0213873_10032919 3300021358 Bacteria 1298
152 Ga0213874_10003165 3300021377 Bacteria 3626
153 Ga0213876_10006880 3300021384 Bacteria 6200
154 Ga0213876_10009074 3300021384 Bacteria 5355
155 Ga0213876_10058498 3300021384 Bacteria 2035
156 Ga0213875_10001033 3300021388 Bacteria 19652
157 Ga0213875_10004683 3300021388 Bacteria 7452
158 Ga0213875_10059905 3300021388 Bacteria 1781
159 Ga0209436_100035 3300025208 Bacteria 79010
160 Ga0209563_104900 3300025230 Bacteria 2497
161 Ga0207425_1002132 3300025245 Bacteria 7266
162 Ga0207425_1012579 3300025245 Bacteria 1981
163 Ga0209677_101018 3300025253 Bacteria 13392
164 Ga0209148_1000475 3300025254 Bacteria 42476
165 Ga0209129_1003154 3300025258 Bacteria 7387
166 Ga0209129_1005382 3300025258 Bacteria 4560
167 Ga0209455_1001935 3300025272 Bacteria 8555
168 Ga0209673_1000067 3300025273 Bacteria 249077
169 Ga0209673_1000750 3300025273 Bacteria 44330
170 Ga0209673_1001376 3300025273 Bacteria 23910
171 Ga0209130_1000031 3300025284 Bacteria 322932
172 Ga0209130_1000467 3300025284 Bacteria 41801
173 Ga0209675_1002662 3300025291 Bacteria 9016
174 Ga0209025_1000017 3300025294 Bacteria 768983
175 Ga0209025_1000099 3300025294 Bacteria 231353
176 Ga0209025_1000397 3300025294 Bacteria 89703
177 Ga0209564_1000031 3300025295 Bacteria 494703
178 Ga0209564_1000082 3300025295 Bacteria 261494
179 Ga0209564_1000092 3300025295 Bacteria 249018
180 Ga0209564_1000511 3300025295 Bacteria 63773
181 Ga0209564_1000925 3300025295 Bacteria 38190
182 Ga0209564_1022634 3300025295 Bacteria 2212
183 Ga0209758_1000504 3300025297 Bacteria 63308
184 Ga0209758_1000585 3300025297 Bacteria 56861
185 Ga0209758_1001602 3300025297 Bacteria 25857
186 Ga0209758_1005532 3300025297 Bacteria 9647
187 Ga0209758_1007908 3300025297 Bacteria 7058
188 Ga0209758_1019714 3300025297 Bacteria 3235
189 Ga0209050_1004942 3300025298 Bacteria 8693
190 Ga0209256_1000033 3300025299 Bacteria 393924
191 Ga0209256_1000170 3300025299 Bacteria 130504
192 Ga0209256_1000181 3300025299 Bacteria 123624
193 Ga0209256_1004342 3300025299 Bacteria 8997
194 Ga0209256_1015056 3300025299 Bacteria 2732
195 Ga0209256_1022722 3300025299 Bacteria 1891
196 Ga0207426_1000042 3300025302 Bacteria 433289
197 Ga0207426_1000065 3300025302 Bacteria 353625
198 Ga0207426_1000355 3300025302 Bacteria 83450
199 Ga0207426_1012996 3300025302 Bacteria 3104
200 Ga0209051_1000062 3300025303 Bacteria 251081
201 Ga0209051_1009790 3300025303 Bacteria 4909
202 Ga0209257_1000376 3300025304 Bacteria 89065
203 Ga0209257_1000970 3300025304 Bacteria 39244
204 Ga0209257_1037430 3300025304 Bacteria 1479
205 Ga0207705_10225043 3300025909 Bacteria 1426
206 Ga0207707_10100127 3300025912 Bacteria 2533
207 Ga0207707_10425776 3300025912 Bacteria 1137
208 Ga0207695_10000008 3300025913 Bacteria 1058268
209 Ga0207695_10087976 3300025913 Bacteria 3128
210 Ga0207671_10010828 3300025914 Bacteria 7480
211 Ga0207662_10197196 3300025918 Bacteria 1302
212 Ga0207657_10060743 3300025919 Bacteria 3243
213 Ga0207652_10075415 3300025921 Bacteria 2939
214 Ga0207652_10119480 3300025921 Bacteria 2344
215 Ga0207652_10326275 3300025921 Bacteria 1386
216 Ga0207652_10469754 3300025921 Bacteria 1133
217 Ga0207646_10053281 3300025922 Bacteria 3619
218 Ga0207646_10078849 3300025922 Bacteria 2944
219 Ga0207659_10142049 3300025926 Bacteria 1865
220 Ga0207687_10071054 3300025927 Bacteria 2486
221 Ga0207700_10010378 3300025928 Bacteria 5873
222 Ga0207700_10276604 3300025928 Bacteria 1443
223 Ga0207664_10343807 3300025929 Bacteria 1319
224 Ga0207690_10222726 3300025932 Bacteria 1444
225 Ga0207661_10281098 3300025944 Bacteria 1487
226 Ga0207679_10018807 3300025945 Bacteria 4635
227 Ga0207679_10299600 3300025945 Bacteria 1385
228 Ga0207667_10049571 3300025949 Bacteria 4434
229 Ga0207712_10190524 3300025961 Bacteria 1618
230 Ga0207640_10144624 3300025981 Bacteria 1738
231 Ga0207658_10028464 3300025986 Bacteria 3935
232 Ga0207677_10012388 3300026023 Bacteria 4900
233 Ga0207677_10414397 3300026023 Bacteria 1146
234 Ga0207639_10105232 3300026041 Bacteria 2289
235 Ga0207639_10124095 3300026041 Bacteria 2127
236 Ga0207639_10290016 3300026041 Bacteria 1442
237 Ga0207678_10020039 3300026067 Bacteria 5876
238 Ga0207708_10058747 3300026075 Bacteria 2934
239 Ga0207702_10000325 3300026078 Bacteria 54690
240 Ga0207702_10053185 3300026078 Bacteria 3427
241 Ga0207676_10145019 3300026095 Bacteria 2038
242 Ga0207674_10149448 3300026116 Bacteria 2293
243 Ga0207675_100177673 3300026118 Bacteria 2037
244 Ga0207683_10099071 3300026121 Bacteria 2601
245 Ga0207698_10033601 3300026142 Bacteria 3729
246 Ga0209813_10073571 3300027866 Bacteria 1116
247 Ga0207428_10059159 3300027907 Bacteria 3039
248 Ga0207428_10074571 3300027907 Bacteria 2661
249 Ga0268266_10003379 3300028379 Bacteria 15975
250 Ga0268266_10087468 3300028379 Bacteria 2726
251 Ga0268265_10178697 3300028380 Bacteria 1822
252 Ga0307513_10213258 3300031456 Bacteria 1760
253 Ga0307513_10269250 3300031456 Bacteria 1488
254 Ga0265314_10010424 3300031711 Bacteria 7753
255 Ga0307516_10023182 3300031730 Bacteria 6367
256 Ga0307516_10196893 3300031730 Bacteria 1737
257 Ga0307516_10393820 3300031730 Bacteria 1045
258 Ga0307510_10008141 3300033180 Bacteria 12485
259 Ga0373955_0043094 3300035172 Bacteria 2426
260 Ga0373937_0191104 3300036401 Bacteria 1924
261 Ga0373937_0274478 3300036401 Bacteria 1591
262 Ga0395899_0005619 3300037312 Bacteria 9731
263 Ga0395899_0013520 3300037312 Bacteria 6240
264 Ga0395900_0003232 3300037418 Bacteria 17642
265 Ga0395900_0008561 3300037418 Bacteria 10519
266 Ga0395900_0018325 3300037418 Bacteria 7142
267 Ga0395900_0529655 3300037418 Bacteria 1125
268 Ga0395898_0007511 3300037466 Bacteria 11584
269 Ga0395898_0009099 3300037466 Bacteria 10459
270 Ga0395905_0014555 3300037471 Bacteria 7504
271 Ga0436364_0063930 3300037853 Bacteria 4672
272 Ga0436364_0103156 3300037853 Bacteria 17490
273 Ga0436364_0210545 3300037853 Bacteria 2008
274 Ga0436364_0533917 3300037853 Bacteria 9986
275 Ga0436364_0642169 3300037853 Bacteria 25731
276 Ga0436364_0659865 3300037853 Bacteria 47070
277 Ga0436364_0674187 3300037853 Bacteria 9456
278 Ga0436364_1379234 3300037853 Bacteria 5061
279 Ga0395901_0011181 3300038443 Bacteria 9096
280 Ga0395901_0012192 3300038443 Bacteria 8723
281 Ga0395901_0159895 3300038443 Bacteria 2366
282 Ga0395901_0456464 3300038443 Bacteria 1306
283 Ga0436365_0138565 3300039437 Bacteria 8501
284 Ga0436365_0481731 3300039437 Bacteria 2890
285 Ga0436365_0712519 3300039437 Bacteria 10286
286 Ga0436365_0879300 3300039437 Bacteria 3197
287 Ga0436365_1535876 3300039437 Bacteria 20439
288 Ga0436365_1736919 3300039437 Bacteria 6655
289 Ga0436360_0178193 3300039438 Bacteria 6576
290 Ga0436360_1090709 3300039438 Bacteria 1837
291 Ga0436361_0606306 3300039447 Bacteria 2508
292 Ga0436363_0282535 3300039450 Bacteria 16541
293 Ga0436363_0472610 3300039450 Bacteria 6308
294 Ga0436363_1477180 3300039450 Bacteria 2712
295 Ga0436362_0822437 3300039453 Bacteria 5872
296 Ga0439453_0001749 3300041408 Bacteria 2864
297 Ga0451802_0956542 3300041460 Bacteria 1297
298 Ga0451837_1690335 3300041494 Bacteria 1347
299 Ga0451839_0668746 3300041496 Bacteria 1848
300 Ga0451841_0665146 3300041498 Bacteria 1343
301 Ga0451841_0873827 3300041498 Bacteria 1077
302 Ga0451847_0365642 3300041503 Bacteria 1261
303 Ga0451847_0833553 3300041503 Bacteria 3861
304 Ga0451849_0492377 3300041505 Bacteria 3337
305 Ga0451843_0493458 3300041509 Bacteria 1825
306 Ga0451843_1370099 3300041509 Bacteria 1299
307 Ga0451853_2198736 3300041512 Bacteria 5299
308 Ga0439458_0027395 3300042157 Bacteria 1344
309 Ga0439464_0028317 3300042439 Bacteria 1561
310 Ga0451577_0013112 3300042876 Bacteria 7769
311 Ga0466961_0000154 3300044693 Bacteria 46518
312 Ga0466963_0044844 3300044694 Bacteria 2911
313 Ga0466963_0145165 3300044694 Bacteria 1646
314 Ga0466970_0024331 3300044765 Bacteria 3165
315 Ga0451576_0000231 3300045051 Bacteria 136040
316 Ga0466967_0008224 3300045976 Bacteria 7620
317 Ga0495638_0000475 3300046460 Bacteria 48300
318 Ga0495638_0017603 3300046460 Bacteria 4760
319 Ga0495651_0017859 3300046462 Bacteria 5492
320 Ga0495664_0077379 3300046477 Bacteria 1992
321 Ga0495585_0058598 3300046492 Bacteria 2124
322 Ga0495607_0021279 3300046501 Bacteria 4083
323 Ga0495583_0117562 3300046506 Bacteria 1122
324 Ga0495610_0068843 3300046512 Bacteria 1657
325 Ga0495632_0054675 3300046519 Bacteria 1956
326 Ga0495644_0047074 3300046523 Bacteria 1621
327 Ga0495640_0145381 3300046533 Bacteria 1526
328 Ga0495597_0018419 3300046542 Bacteria 3277
329 Ga0495645_0029087 3300046543 Bacteria 4016
330 Ga0495668_0091160 3300046616 Bacteria 1670
331 Ga0495625_0065986 3300046660 Bacteria 2550
332 Ga0495625_0149096 3300046660 Bacteria 1573
333 Ga0495670_0079396 3300046691 Bacteria 1670
334 Ga0495589_0196969 3300046794 Bacteria 952
335 Ga0495660_0133140 3300046810 Bacteria 1245
336 Ga0495604_0157604 3300047317 Bacteria 1607
337 Ga0495680_0209890 3300047322 Bacteria 1394
338 Ga0495683_0074182 3300047323 Bacteria 1668
339 Ga0495687_097650 3300047443 Bacteria 1110
340 Ga0495685_063961 3300047447 Bacteria 1238
341 Ga0495681_0119790 3300047470 Bacteria 1131
342 Ga0495686_0038269 3300047472 Bacteria 3068
343 Ga0496100_0020009 3300048903 Bacteria 4006
344 Ga0496102_0202039 3300048905 Bacteria 1873
345 Ga0496103_0073279 3300048906 Bacteria 2145
346 Ga0496104_0082985 3300048907 Bacteria 3056
347 Ga0496105_0021632 3300048908 Bacteria 5205
348 Ga0496107_0015042 3300048910 Bacteria 5421
349 Ga0496108_0075698 3300048911 Bacteria 2844
350 Ga0496110_0043688 3300048913 Bacteria 3913
351 Ga0496111_0032362 3300048914 Bacteria 3728
352 Ga0496112_0088237 3300048915 Bacteria 3069
353 Ga0496114_0019685 3300048917 Bacteria 5470
354 Ga0496115_0002706 3300048918 Bacteria 12727
355 Ga0496116_0009436 3300048919 Bacteria 8312
356 Ga0496117_0017924 3300048920 Bacteria 5895
357 Ga0496117_0071594 3300048920 Bacteria 2322
358 Ga0496117_0087353 3300048920 Bacteria 2022
359 Ga0496118_0002068 3300048921 Bacteria 28261
360 Ga0496118_0028344 3300048921 Bacteria 4718
361 Ga0496119_0008868 3300048922 Bacteria 8749
362 Ga0496120_0276800 3300048923 Bacteria 777
363 Ga0496121_0000406 3300048924 Bacteria 85761
364 Ga0496122_0023409 3300048925 Bacteria 5447
365 Ga0496122_0026726 3300048925 Bacteria 4964
366 Ga0496125_0000145 3300048928 Bacteria 156267
367 Ga0496125_0000471 3300048928 Bacteria 71765
368 Ga0496125_0010847 3300048928 Bacteria 9172
369 Ga0501031_0013786 3300049568 Bacteria 5269
370 Ga0501033_0010498 3300049570 Bacteria 7103
371 Ga0501034_0022087 3300049571 Bacteria 6482
372 Ga0501034_0036019 3300049571 Bacteria 5016
373 Ga0501034_0096432 3300049571 Bacteria 2953
374 Ga0501034_0145736 3300049571 Bacteria 2345
375 Ga0501036_0666533 3300049572 Bacteria 861
376 Ga0501037_0000107 3300049573 Bacteria 78666
377 Ga0501037_0093876 3300049573 Bacteria 2169
378 Ga0501037_0186493 3300049573 Bacteria 1470
379 Ga0501038_0027545 3300049574 Bacteria 5056
380 Ga0501038_0028509 3300049574 Bacteria 4961
381 Ga0501038_0098912 3300049574 Bacteria 2432
382 Ga0501043_0000005 3300049579 Bacteria 254466
383 Ga0501043_0067753 3300049579 Bacteria 2803
384 Ga0501046_0191968 3300049580 Bacteria 1523
385 Ga0501047_0061392 3300049581 Bacteria 3627
386 Ga0501069_0000033 3300049585 Bacteria 92477
387 Ga0501070_0000913 3300049586 Bacteria 26864
388 Ga0501073_0060391 3300049589 Bacteria 2646
389 Ga0501074_0000571 3300049590 Bacteria 22782
390 Ga0501076_0176737 3300049592 Bacteria 1740
391 Ga0501083_0000355 3300049744 Bacteria 29001
392 Ga0501083_0028777 3300049744 Bacteria 3827
393 Ga0501035_0000086 3300049822 Bacteria 115822
394 Ga0501035_0228322 3300049822 Bacteria 1587
395 Ga0501044_0000223 3300049823 Bacteria 71752
396 Ga0501044_0018528 3300049823 Bacteria 7459
397 Ga0501044_0072326 3300049823 Bacteria 3506
398 Ga0501044_0107423 3300049823 Bacteria 2802
399 Ga0501044_0114589 3300049823 Bacteria 2701
400 Ga0501045_0099903 3300049824 Bacteria 2148
401 nmdc:mga03683_70184_c1 3300050489 Bacteria 1496
402 nmdc:mga03683_70474_c1 3300050489 Bacteria 1494
403 nmdc:mga03n38_10745_c1 3300050490 Bacteria 3383
404 nmdc:mga03n38_157664_c1 3300050490 Bacteria 1147
405 nmdc:mga00v17_104960_c1 3300050491 Bacteria 1787
406 nmdc:mga00v17_14_c1 3300050491 Bacteria 126589
407 nmdc:mga0yw44_112489_c1 3300050492 Bacteria 1746
408 nmdc:mga0yw44_250837_c1 3300050492 Bacteria 1178
409 nmdc:mga0yw44_3294_c1 3300050492 Bacteria 7137
410 nmdc:mga0yw44_7443_c1 3300050492 Bacteria 5387
411 nmdc:mga0k408_45159_c1 3300050493 Bacteria 1269
412 nmdc:mga06z11_11047_c1 3300050494 Bacteria 3876
413 nmdc:mga06z11_160131_c1 3300050494 Bacteria 1286
414 nmdc:mga05p37_106889_c1 3300050507 Bacteria 3443
415 nmdc:mga09592_188763_c1 3300050508 Bacteria 1784
416 nmdc:mga09592_45885_c1 3300050508 Bacteria 3680
417 nmdc:mga09592_53176_c1 3300050508 Bacteria 2063
418 nmdc:mga0qj67_132735_c1 3300050509 Bacteria 2017
419 nmdc:mga0qj67_238091_c1 3300050509 Bacteria 1477
420 nmdc:mga0qj67_27792_c1 3300050509 Bacteria 4386
421 nmdc:mga0qj67_51412_c1 3300050509 Bacteria 1770
422 nmdc:mga06r32_12511_c1 3300050510 Bacteria 7658
423 nmdc:mga06r32_235229_c1 3300050510 Bacteria 1820
424 nmdc:mga06r32_245293_c1 3300050510 Bacteria 1779
425 nmdc:mga06r32_4390_c1 3300050510 Bacteria 12611
426 nmdc:mga06r32_941408_c1 3300050510 Bacteria 819
427 nmdc:mga08y16_230140_c1 3300050511 Bacteria 1917
428 nmdc:mga08y16_438965_c1 3300050511 Bacteria 1333
429 nmdc:mga08y16_545866_c1 3300050511 Bacteria 1173
430 nmdc:mga08y16_76334_c1 3300050511 Bacteria 3493
431 nmdc:mga0sz30_74628_c1 3300050516 Bacteria 1463
432 Ga0500578_0249768 3300053086 Bacteria 1069
433 Ga0500643_000035 3300053087 Bacteria 184794
434 Ga0500644_0060791 3300053088 Bacteria 1330
435 Ga0500641_0066828 3300053096 Bacteria 1506
436 Ga0500555_006777 3300053103 Bacteria 3256
437 Ga0500562_022839 3300053108 Bacteria 1631
438 Ga0500569_002841 3300053109 Bacteria 3462
439 Ga0500569_046106 3300053109 Bacteria 1297
440 Ga0500595_001183 3300053119 Bacteria 14392
441 Ga0500595_002181 3300053119 Bacteria 9945
442 Ga0500658_0002498 3300053134 Bacteria 7116
443 Ga0500658_0044689 3300053134 Bacteria 1788
444 Ga0500568_0001438 3300053139 Bacteria 15421
445 Ga0500568_0016475 3300053139 Bacteria 3285
446 Ga0500568_0143808 3300053139 Bacteria 883
447 Ga0500577_0033238 3300053142 Bacteria 1821
448 Ga0500616_0000472 3300053153 Bacteria 52191
449 Ga0500616_0026922 3300053153 Bacteria 3178
450 Ga0500634_0000507 3300053161 Bacteria 12661
451 Ga0500634_0073408 3300053161 Bacteria 1784
452 Ga0500638_009653 3300053162 Bacteria 4187
453 Ga0500636_0001753 3300053177 Bacteria 11889
454 Ga0500637_0000138 3300053178 Bacteria 26740
455 Ga0500609_000759 3300053731 Bacteria 4841
456 Ga0500601_000712 3300053737 Bacteria 4407
457 Ga0500661_000130 3300055283 Bacteria 12645
458 Ga0466962_0101240 3300061719 Bacteria 1383

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100666918 Ga0070669_1006669181 250
2 3300035172 Ga0373955_0043094 Ga0373955_0043094_1660_2412 250
3 3300036401 Ga0373937_0191104 Ga0373937_0191104_16_768 250
4 3300044694 Ga0466963_0044844 Ga0466963_0044844_35_787 250
5 3300048905 Ga0496102_0202039 Ga0496102_0202039_24_776 250
6 3300048920 Ga0496117_0087353 Ga0496117_0087353_19_771 250
7 3300048923 Ga0496120_0276800 Ga0496120_0276800_14_766 250
8 3300049572 Ga0501036_0666533 Ga0501036_0666533_11_763 250
9 3300050510 nmdc:mga06r32_941408_c1 nmdc:mga06r32_941408_c1_12_764 250
10 3300053139 Ga0500568_0143808 Ga0500568_0143808_36_788 250
11 3300037853 Ga0436364_0674187 Ga0436364_0674187_2222_3004 260
12 iso_pu_bacteria 2881155292 2881156999 260
13 3300005468 Ga0070707_100093884 Ga0070707_1000938843 261
14 3300025922 Ga0207646_10053281 Ga0207646_100532813 261
15 3300005544 Ga0070686_100512241 Ga0070686_1005122411 266
16 3300041498 Ga0451841_0873827 Ga0451841_0873827_250_1059 269
17 3300046523 Ga0495644_0047074 Ga0495644_0047074_413_1234 270
18 3300048908 Ga0496105_0021632 Ga0496105_0021632_4383_5195 270
19 iso_pu_bacteria 2876406927 2876410527 274
20 3300049573 Ga0501037_0093876 Ga0501037_0093876_1330_2157 275
21 3300025921 Ga0207652_10469754 Ga0207652_104697542 277
22 3300005295 Ga0065707_10039833 Ga0065707_100398331 279
23 3300049592 Ga0501076_0176737 Ga0501076_0176737_547_1449 279
24 3300049824 Ga0501045_0099903 Ga0501045_0099903_1037_1939 279
25 3300050511 nmdc:mga08y16_438965_c1 nmdc:mga08y16_438965_c1_453_1319 279
26 3300005295 Ga0065707_10117356 Ga0065707_101173562 280
27 3300005458 Ga0070681_10000393 Ga0070681_1000039332 280
28 3300009174 Ga0105241_10297806 Ga0105241_102978062 280
29 3300025918 Ga0207662_10197196 Ga0207662_101971962 280
30 3300050489 nmdc:mga03683_70184_c1 nmdc:mga03683_70184_c1_560_1402 280
31 3300009093 Ga0105240_10011032 Ga0105240_100110327 281
32 3300025922 Ga0207646_10078849 Ga0207646_100788493 281
33 3300053096 Ga0500641_0066828 Ga0500641_0066828_622_1467 281
34 3300053109 Ga0500569_002841 Ga0500569_002841_2353_3198 281
35 3300046810 Ga0495660_0133140 Ga0495660_0133140_197_1075 284
36 3300053153 Ga0500616_0026922 Ga0500616_0026922_872_1750 284
37 iso_pu_bacteria 2713897090 2715501879 286
38 iso_pu_bacteria 3005710791 3005715184 286
39 3300005983 Ga0081540_1006001 Ga0081540_10060012 287
40 iso_pu_bacteria 2511231028 2511394989 287
41 iso_pu_bacteria 2842775625 2842777250 287
42 iso_pu_bacteria 2874628541 2874632158 287
43 iso_pu_bacteria 2883577096 2883577390 287
44 iso_pu_bacteria 2888388044 2888393539 287
45 iso_pu_bacteria 3005594810 3005599513 287
46 iso_pu_bacteria 8056967851 8056968301 287
47 3300050509 nmdc:mga0qj67_238091_c1 nmdc:mga0qj67_238091_c1_388_1275 289
48 3300050510 nmdc:mga06r32_245293_c1 nmdc:mga06r32_245293_c1_499_1386 289
49 3300053177 Ga0500636_0001753 Ga0500636_0001753_2424_3302 289
50 3300009993 Ga0105028_108689 Ga0105028_1086891 290
51 3300042876 Ga0451577_0013112 Ga0451577_0013112_6289_7161 290
52 3300003762 Ga0055542_1003894 Ga0055542_10038944 291
53 3300004625 Ga0055543_1008108 Ga0055543_10081082 291
54 3300005262 Ga0065165_1000231 Ga0065165_10002314 291
55 3300005366 Ga0070659_100259525 Ga0070659_1002595252 291
56 3300005616 Ga0068852_100002288 Ga0068852_1000022886 291
57 3300005834 Ga0068851_10131991 Ga0068851_101319912 291
58 3300005983 Ga0081540_1005876 Ga0081540_10058765 291
59 3300006038 Ga0075365_10116315 Ga0075365_101163151 291
60 3300025230 Ga0209563_104900 Ga0209563_1049002 291
61 3300025253 Ga0209677_101018 Ga0209677_1010188 291
62 3300025254 Ga0209148_1000475 Ga0209148_100047527 291
63 3300025272 Ga0209455_1001935 Ga0209455_10019356 291
64 3300025297 Ga0209758_1007908 Ga0209758_10079086 291
65 3300025297 Ga0209758_1019714 Ga0209758_10197142 291
66 3300025913 Ga0207695_10000008 Ga0207695_1000000854 291
67 3300025914 Ga0207671_10010828 Ga0207671_100108285 291
68 3300025932 Ga0207690_10222726 Ga0207690_102227262 291
69 3300025981 Ga0207640_10144624 Ga0207640_101446242 291
70 3300026041 Ga0207639_10290016 Ga0207639_102900162 291
71 3300026067 Ga0207678_10020039 Ga0207678_100200392 291
72 3300033180 Ga0307510_10008141 Ga0307510_1000814112 291
73 3300037312 Ga0395899_0013520 Ga0395899_0013520_594_1481 291
74 3300038443 Ga0395901_0011181 Ga0395901_0011181_1169_2056 291
75 3300044693 Ga0466961_0000154 Ga0466961_0000154_33709_34584 291
76 3300046506 Ga0495583_0117562 Ga0495583_0117562_91_966 291
77 3300047323 Ga0495683_0074182 Ga0495683_0074182_230_1105 291
78 3300049568 Ga0501031_0013786 Ga0501031_0013786_2002_2892 291
79 3300049570 Ga0501033_0010498 Ga0501033_0010498_6009_6899 291
80 3300049571 Ga0501034_0096432 Ga0501034_0096432_89_985 291
81 3300049573 Ga0501037_0000107 Ga0501037_0000107_23206_24096 291
82 3300049573 Ga0501037_0186493 Ga0501037_0186493_208_1104 291
83 3300049579 Ga0501043_0000005 Ga0501043_0000005_244811_245701 291
84 3300049585 Ga0501069_0000033 Ga0501069_0000033_82777_83667 291
85 3300049586 Ga0501070_0000913 Ga0501070_0000913_1428_2318 291
86 3300049589 Ga0501073_0060391 Ga0501073_0060391_1721_2611 291
87 3300049590 Ga0501074_0000571 Ga0501074_0000571_13126_14016 291
88 3300049744 Ga0501083_0000355 Ga0501083_0000355_4378_5268 291
89 3300049822 Ga0501035_0000086 Ga0501035_0000086_106122_107012 291
90 3300049823 Ga0501044_0000223 Ga0501044_0000223_37079_37969 291
91 3300049823 Ga0501044_0018528 Ga0501044_0018528_1511_2407 291
92 3300050492 nmdc:mga0yw44_250837_c1 nmdc:mga0yw44_250837_c1_84_959 291
93 3300053086 Ga0500578_0249768 Ga0500578_0249768_17_892 291
94 3300053087 Ga0500643_000035 Ga0500643_000035_79891_80766 291
95 3300053103 Ga0500555_006777 Ga0500555_006777_1766_2641 291
96 3300053142 Ga0500577_0033238 Ga0500577_0033238_610_1485 291
97 3300053161 Ga0500634_0073408 Ga0500634_0073408_892_1767 291
98 3300053731 Ga0500609_000759 Ga0500609_000759_1801_2676 291
99 3300053737 Ga0500601_000712 Ga0500601_000712_208_1083 291
100 iso_pu_bacteria 2882632389 2882633809 291
101 3300005564 Ga0070664_100061891 Ga0070664_1000618913 292
102 3300005614 Ga0068856_100072955 Ga0068856_1000729553 292
103 3300005616 Ga0068852_100071600 Ga0068852_1000716002 292
104 3300010375 Ga0105239_10089511 Ga0105239_100895111 292
105 3300013307 Ga0157372_10517315 Ga0157372_105173152 292
106 3300021388 Ga0213875_10001033 Ga0213875_1000103314 292
107 3300025302 Ga0207426_1012996 Ga0207426_10129965 292
108 3300025919 Ga0207657_10060743 Ga0207657_100607433 292
109 3300025944 Ga0207661_10281098 Ga0207661_102810982 292
110 3300025945 Ga0207679_10018807 Ga0207679_100188073 292
111 3300026116 Ga0207674_10149448 Ga0207674_101494482 292
112 3300026142 Ga0207698_10033601 Ga0207698_100336013 292
113 3300037312 Ga0395899_0005619 Ga0395899_0005619_8240_9136 292
114 3300037418 Ga0395900_0003232 Ga0395900_0003232_1490_2386 292
115 3300037418 Ga0395900_0008561 Ga0395900_0008561_4389_5282 292
116 3300037466 Ga0395898_0009099 Ga0395898_0009099_8422_9318 292
117 3300037853 Ga0436364_0642169 Ga0436364_0642169_15195_16088 292
118 3300037853 Ga0436364_0659865 Ga0436364_0659865_17386_18267 292
119 3300038443 Ga0395901_0012192 Ga0395901_0012192_1311_2207 292
120 3300039447 Ga0436361_0606306 Ga0436361_0606306_1444_2346 292
121 3300045976 Ga0466967_0008224 Ga0466967_0008224_1515_2411 292
122 iso_pu_bacteria 2828305725 2828310327 292
123 iso_pu_bacteria 2894817345 2894822088 292
124 iso_pu_bacteria 8055909800 8055916096 292
125 3300005336 Ga0070680_100098095 Ga0070680_1000980952 293
126 3300005548 Ga0070665_100175214 Ga0070665_1001752142 293
127 3300021358 Ga0213873_10032919 Ga0213873_100329192 293
128 3300021377 Ga0213874_10003165 Ga0213874_100031653 293
129 3300021384 Ga0213876_10006880 Ga0213876_100068809 293
130 3300021384 Ga0213876_10009074 Ga0213876_100090742 293
131 3300021384 Ga0213876_10058498 Ga0213876_100584982 293
132 3300021388 Ga0213875_10059905 Ga0213875_100599053 293
133 3300028379 Ga0268266_10087468 Ga0268266_100874682 293
134 3300037853 Ga0436364_1379234 Ga0436364_1379234_1479_2378 293
135 3300039437 Ga0436365_0138565 Ga0436365_0138565_7534_8433 293
136 3300039437 Ga0436365_0712519 Ga0436365_0712519_9344_10243 293
137 3300039437 Ga0436365_1535876 Ga0436365_1535876_8400_9299 293
138 3300039437 Ga0436365_1736919 Ga0436365_1736919_1760_2662 293
139 3300039450 Ga0436363_0282535 Ga0436363_0282535_8541_9440 293
140 3300039450 Ga0436363_0472610 Ga0436363_0472610_228_1127 293
141 3300039453 Ga0436362_0822437 Ga0436362_0822437_4565_5464 293
142 3300053139 Ga0500568_0016475 Ga0500568_0016475_1015_1914 293
143 iso_pu_bacteria 2503198000 2503200951 293
144 iso_pu_bacteria 2509276018 2509369537 293
145 iso_pu_bacteria 2510065059 2510319291 293
146 iso_pu_bacteria 2513237305 2514423072 293
147 iso_pu_bacteria 2597489875 2597814606 293
148 iso_pu_bacteria 2643221733 2644730069 293
149 iso_pu_bacteria 2643221736 2644746170 293
150 iso_pu_bacteria 2687453392 2688597244 293
151 iso_pu_bacteria 2721755686 2723577073 293
152 iso_pu_bacteria 2818991467 2819720105 293
153 iso_pu_bacteria 2841760612 2841766118 293
154 iso_pu_bacteria 2844009547 2844012627 293
155 iso_pu_bacteria 2844104063 2844105884 293
156 iso_pu_bacteria 2851182111 2851186382 293
157 iso_pu_bacteria 2851246043 2851246240 293
158 iso_pu_bacteria 2856328259 2856334866 293
159 iso_pu_bacteria 2856334872 2856341583 293
160 iso_pu_bacteria 2856342000 2856347706 293
161 iso_pu_bacteria 2856349417 2856352999 293
162 iso_pu_bacteria 2856356410 2856362010 293
163 iso_pu_bacteria 2857367948 2857373248 293
164 iso_pu_bacteria 2869169390 2869171175 293
165 iso_pu_bacteria 2869234852 2869238807 293
166 iso_pu_bacteria 2869242130 2869248133 293
167 iso_pu_bacteria 2869249662 2869251560 293
168 iso_pu_bacteria 2869256925 2869260095 293
169 iso_pu_bacteria 2869264136 2869271068 293
170 iso_pu_bacteria 2869271264 2869277774 293
171 iso_pu_bacteria 2871435913 2871436915 293
172 iso_pu_bacteria 2871451962 2871454630 293
173 iso_pu_bacteria 2871459585 2871465715 293
174 iso_pu_bacteria 2871481445 2871487692 293
175 iso_pu_bacteria 2871488783 2871493618 293
176 iso_pu_bacteria 2871495908 2871497151 293
177 iso_pu_bacteria 2874109183 2874110346 293
178 iso_pu_bacteria 2874116593 2874122791 293
179 iso_pu_bacteria 2874131515 2874137122 293
180 iso_pu_bacteria 2874162495 2874167956 293
181 iso_pu_bacteria 2876386047 2876389737 293
182 iso_pu_bacteria 2876399893 2876402861 293
183 iso_pu_bacteria 2876420981 2876427447 293
184 iso_pu_bacteria 2878730984 2878737482 293
185 iso_pu_bacteria 2878753008 2878756191 293
186 iso_pu_bacteria 2878760144 2878761372 293
187 iso_pu_bacteria 2878767105 2878768339 293
188 iso_pu_bacteria 2878774303 2878775068 293
189 iso_pu_bacteria 2878781027 2878783594 293
190 iso_pu_bacteria 2881845957 2881851600 293
191 iso_pu_bacteria 2881853255 2881860304 293
192 iso_pu_bacteria 2881861095 2881864925 293
193 iso_pu_bacteria 2882912400 2882918125 293
194 iso_pu_bacteria 2885318864 2885321319 293
195 iso_pu_bacteria 2885342637 2885343950 293
196 iso_pu_bacteria 2885350715 2885352797 293
197 iso_pu_bacteria 2888343758 2888348047 293
198 iso_pu_bacteria 2888350351 2888356719 293
199 iso_pu_bacteria 2889016732 2889023299 293
200 iso_pu_bacteria 2894772417 2894776640 293
201 iso_pu_bacteria 2903492973 2903502878 293
202 iso_pu_bacteria 2903540706 2903541946 293
203 iso_pu_bacteria 2906354277 2906363078 293
204 iso_pu_bacteria 2906363423 2906364668 293
205 iso_pu_bacteria 2906370794 2906376936 293
206 iso_pu_bacteria 2906386501 2906389595 293
207 iso_pu_bacteria 2906393657 2906401129 293
208 iso_pu_bacteria 2906401398 2906401782 293
209 iso_pu_bacteria 2906408224 2906411357 293
210 iso_pu_bacteria 2917699015 2917703899 293
211 iso_pu_bacteria 2922130491 2922135486 293
212 iso_pu_bacteria 2922151315 2922155928 293
213 iso_pu_bacteria 2922172374 2922177625 293
214 iso_pu_bacteria 2922178524 2922179333 293
215 iso_pu_bacteria 2922185730 2922192520 293
216 iso_pu_bacteria 2924710171 2924716945 293
217 iso_pu_bacteria 2924733363 2924737865 293
218 iso_pu_bacteria 2924741084 2924742681 293
219 iso_pu_bacteria 2924748358 2924749427 293
220 iso_pu_bacteria 2924754689 2924757664 293
221 iso_pu_bacteria 2924784321 2924787761 293
222 iso_pu_bacteria 2929199973 2929202996 293
223 iso_pu_bacteria 2935769743 2935773905 293
224 iso_pu_bacteria 2935785616 2935788659 293
225 iso_pu_bacteria 2935793552 2935795715 293
226 iso_pu_bacteria 2937861824 2937862656 293
227 iso_pu_bacteria 2937868953 2937870048 293
228 iso_pu_bacteria 2937980651 2937981210 293
229 iso_pu_bacteria 2937994558 2937995802 293
230 iso_pu_bacteria 2958100919 2958105499 293
231 iso_pu_bacteria 2958108152 2958115082 293
232 iso_pu_bacteria 2958122699 2958129824 293
233 iso_pu_bacteria 2958158011 2958158293 293
234 iso_pu_bacteria 2958165035 2958166274 293
235 iso_pu_bacteria 2958172287 2958178763 293
236 iso_pu_bacteria 2961127735 2961129930 293
237 iso_pu_bacteria 2961163497 2961164736 293
238 iso_pu_bacteria 2961170736 2961172479 293
239 iso_pu_bacteria 2961183825 2961184365 293
240 iso_pu_bacteria 2965018300 2965019562 293
241 iso_pu_bacteria 2965025482 2965027621 293
242 iso_pu_bacteria 2965032056 2965036221 293
243 iso_pu_bacteria 2965040258 2965043330 293
244 iso_pu_bacteria 2965047637 2965049654 293
245 iso_pu_bacteria 2965089291 2965090548 293
246 iso_pu_bacteria 2965102966 2965107374 293
247 iso_pu_bacteria 2965110997 2965111228 293
248 iso_pu_bacteria 2965119406 2965119757 293
249 iso_pu_bacteria 2967996073 2967997695 293
250 iso_pu_bacteria 2968003550 2968008346 293
251 iso_pu_bacteria 2968138860 2968141126 293
252 iso_pu_bacteria 2968171901 2968173138 293
253 iso_pu_bacteria 2970489779 2970495187 293
254 iso_pu_bacteria 2970503327 2970505073 293
255 iso_pu_bacteria 2970524798 2970531949 293
256 iso_pu_bacteria 2970540015 2970547656 293
257 iso_pu_bacteria 2970547951 2970552322 293
258 iso_pu_bacteria 2970554993 2970556228 293
259 iso_pu_bacteria 2970619444 2970626597 293
260 iso_pu_bacteria 2970627176 2970627861 293
261 iso_pu_bacteria 2977821940 2977825372 293
262 iso_pu_bacteria 2977828996 2977832682 293
263 iso_pu_bacteria 2977851361 2977852029 293
264 iso_pu_bacteria 2977872689 2977873863 293
265 iso_pu_bacteria 2977898635 2977905078 293
266 iso_pu_bacteria 2977907340 2977914961 293
267 iso_pu_bacteria 2977915119 2977916508 293
268 iso_pu_bacteria 2977935797 2977941666 293
269 iso_pu_bacteria 2977950692 2977951032 293
270 iso_pu_bacteria 2977957713 2977960464 293
271 iso_pu_bacteria 2977971508 2977974932 293
272 iso_pu_bacteria 2979710463 2979716026 293
273 iso_pu_bacteria 2979742915 2979750769 293
274 iso_pu_bacteria 2979764755 2979769648 293
275 iso_pu_bacteria 2979772303 2979779733 293
276 iso_pu_bacteria 2979793036 2979797187 293
277 iso_pu_bacteria 2979808191 2979809794 293
278 iso_pu_bacteria 2987645492 2987648178 293
279 iso_pu_bacteria 2987659509 2987660745 293
280 iso_pu_bacteria 2987673487 2987680946 293
281 iso_pu_bacteria 2996386984 2996390031 293
282 iso_pu_bacteria 3004188549 3004189793 293
283 iso_pu_bacteria 3004195979 3004203512 293
284 iso_pu_bacteria 3004232784 3004235875 293
285 iso_pu_bacteria 3004239961 3004243286 293
286 iso_pu_bacteria 3004248173 3004253659 293
287 iso_pu_bacteria 3004268573 3004273896 293
288 iso_pu_bacteria 649633066 649871797 293
289 iso_pu_bacteria 8004300914 8004302835 293
290 iso_pu_bacteria 8004312739 8004312760 293
291 iso_pu_bacteria 8004361976 8004365152 293
292 iso_pu_bacteria 8004374579 8004377780 293
293 iso_pu_bacteria 8004395343 8004397839 293
294 iso_pu_bacteria 8004695233 8004702367 293
295 iso_pu_bacteria 8004727605 8004731568 293
296 iso_pu_bacteria 8055617313 8055622158 293
297 iso_pu_bacteria 8057529695 8057531534 293
298 3300002987 JGI25159J45721_1008482 JGI25159J45721_10084823 294
299 3300003187 JGI25151J46595_10000458 JGI25151J46595_1000045814 294
300 3300003354 JGI25160J50197_1003716 JGI25160J50197_10037162 294
301 3300005336 Ga0070680_100064135 Ga0070680_1000641352 294
302 3300005458 Ga0070681_10014505 Ga0070681_100145058 294
303 3300005530 Ga0070679_100172761 Ga0070679_1001727612 294
304 3300005563 Ga0068855_100513777 Ga0068855_1005137772 294
305 3300005842 Ga0068858_100132512 Ga0068858_1001325122 294
306 3300013104 Ga0157370_10211933 Ga0157370_102119332 294
307 3300025284 Ga0209130_1000467 Ga0209130_10004673 294
308 3300025294 Ga0209025_1000099 Ga0209025_100009924 294
309 3300025297 Ga0209758_1001602 Ga0209758_100160218 294
310 3300025302 Ga0207426_1000065 Ga0207426_1000065148 294
311 3300025912 Ga0207707_10425776 Ga0207707_104257761 294
312 3300025921 Ga0207652_10075415 Ga0207652_100754151 294
313 3300026041 Ga0207639_10105232 Ga0207639_101052322 294
314 3300028379 Ga0268266_10003379 Ga0268266_100033792 294
315 3300031730 Ga0307516_10023182 Ga0307516_100231823 294
316 3300046533 Ga0495640_0145381 Ga0495640_0145381_513_1400 294
317 3300049579 Ga0501043_0067753 Ga0501043_0067753_174_1076 294
318 3300049580 Ga0501046_0191968 Ga0501046_0191968_163_1065 294
319 3300049823 Ga0501044_0107423 Ga0501044_0107423_1352_2254 294
320 3300053088 Ga0500644_0060791 Ga0500644_0060791_318_1220 294
321 3300053119 Ga0500595_001183 Ga0500595_001183_8698_9591 294
322 3300053162 Ga0500638_009653 Ga0500638_009653_335_1228 294
323 3300053178 Ga0500637_0000138 Ga0500637_0000138_20849_21742 294
324 3300055283 Ga0500661_000130 Ga0500661_000130_3293_4186 294
325 iso_pu_bacteria 2996310559 2996316207 294
326 3300003203 JGI25406J46586_10000433 JGI25406J46586_1000043313 295
327 3300003794 Ga0055531_10046365 Ga0055531_100463652 295
328 3300005329 Ga0070683_100473626 Ga0070683_1004736262 295
329 3300005338 Ga0068868_100011310 Ga0068868_1000113104 295
330 3300005341 Ga0070691_10003977 Ga0070691_100039771 295
331 3300005353 Ga0070669_100400495 Ga0070669_1004004952 295
332 3300005356 Ga0070674_100246652 Ga0070674_1002466521 295
333 3300005444 Ga0070694_100003712 Ga0070694_10000371210 295
334 3300005444 Ga0070694_100112115 Ga0070694_1001121153 295
335 3300005455 Ga0070663_100007767 Ga0070663_1000077673 295
336 3300005471 Ga0070698_100446600 Ga0070698_1004466001 295
337 3300005539 Ga0068853_100112670 Ga0068853_1001126702 295
338 3300005545 Ga0070695_100100156 Ga0070695_1001001561 295
339 3300005549 Ga0070704_100003315 Ga0070704_1000033153 295
340 3300005564 Ga0070664_100169755 Ga0070664_1001697552 295
341 3300005614 Ga0068856_100002849 Ga0068856_10000284914 295
342 3300005719 Ga0068861_100075148 Ga0068861_1000751482 295
343 3300005983 Ga0081540_1000338 Ga0081540_100033839 295
344 3300005985 Ga0081539_10000549 Ga0081539_1000054928 295
345 3300006048 Ga0075363_100002563 Ga0075363_1000025634 295
346 3300006178 Ga0075367_10002436 Ga0075367_100024365 295
347 3300006844 Ga0075428_100097827 Ga0075428_1000978272 295
348 3300006846 Ga0075430_100109636 Ga0075430_1001096362 295
349 3300006847 Ga0075431_100004249 Ga0075431_10000424910 295
350 3300006871 Ga0075434_100116694 Ga0075434_1001166942 295
351 3300009098 Ga0105245_10214159 Ga0105245_102141592 295
352 3300009147 Ga0114129_10042219 Ga0114129_100422193 295
353 3300009148 Ga0105243_10342701 Ga0105243_103427012 295
354 3300011119 Ga0105246_10032074 Ga0105246_100320743 295
355 3300013306 Ga0163162_10222678 Ga0163162_102226782 295
356 3300013308 Ga0157375_10073454 Ga0157375_100734542 295
357 3300014325 Ga0163163_10321085 Ga0163163_103210852 295
358 3300014969 Ga0157376_10215584 Ga0157376_102155842 295
359 3300021388 Ga0213875_10004683 Ga0213875_100046836 295
360 3300025304 Ga0209257_1000376 Ga0209257_100037632 295
361 3300025909 Ga0207705_10225043 Ga0207705_102250432 295
362 3300025921 Ga0207652_10326275 Ga0207652_103262752 295
363 3300025926 Ga0207659_10142049 Ga0207659_101420493 295
364 3300025927 Ga0207687_10071054 Ga0207687_100710542 295
365 3300025929 Ga0207664_10343807 Ga0207664_103438072 295
366 3300025945 Ga0207679_10299600 Ga0207679_102996002 295
367 3300025961 Ga0207712_10190524 Ga0207712_101905242 295
368 3300026023 Ga0207677_10012388 Ga0207677_100123883 295
369 3300026078 Ga0207702_10000325 Ga0207702_1000032559 295
370 3300026095 Ga0207676_10145019 Ga0207676_101450192 295
371 3300026118 Ga0207675_100177673 Ga0207675_1001776731 295
372 3300031711 Ga0265314_10010424 Ga0265314_100104242 295
373 3300031730 Ga0307516_10196893 Ga0307516_101968931 295
374 3300031730 Ga0307516_10393820 Ga0307516_103938201 295
375 3300037853 Ga0436364_0103156 Ga0436364_0103156_14844_15755 295
376 3300037853 Ga0436364_0533917 Ga0436364_0533917_6792_7688 295
377 3300038443 Ga0395901_0456464 Ga0395901_0456464_77_973 295
378 3300039437 Ga0436365_0879300 Ga0436365_0879300_2069_2980 295
379 3300039438 Ga0436360_1090709 Ga0436360_1090709_200_1099 295
380 3300039450 Ga0436363_1477180 Ga0436363_1477180_382_1278 295
381 3300041408 Ga0439453_0001749 Ga0439453_0001749_501_1400 295
382 3300045051 Ga0451576_0000231 Ga0451576_0000231_89382_90278 295
383 3300048903 Ga0496100_0020009 Ga0496100_0020009_2672_3568 295
384 3300048906 Ga0496103_0073279 Ga0496103_0073279_360_1256 295
385 3300048907 Ga0496104_0082985 Ga0496104_0082985_1063_1959 295
386 3300048910 Ga0496107_0015042 Ga0496107_0015042_1202_2098 295
387 3300048911 Ga0496108_0075698 Ga0496108_0075698_119_1015 295
388 3300048913 Ga0496110_0043688 Ga0496110_0043688_2371_3267 295
389 3300048914 Ga0496111_0032362 Ga0496111_0032362_1675_2571 295
390 3300048915 Ga0496112_0088237 Ga0496112_0088237_805_1701 295
391 3300048917 Ga0496114_0019685 Ga0496114_0019685_1090_1986 295
392 3300048918 Ga0496115_0002706 Ga0496115_0002706_7551_8447 295
393 3300049571 Ga0501034_0036019 Ga0501034_0036019_3841_4749 295
394 3300050490 nmdc:mga03n38_10745_c1 nmdc:mga03n38_10745_c1_511_1407 295
395 3300050494 nmdc:mga06z11_11047_c1 nmdc:mga06z11_11047_c1_2651_3547 295
396 3300050509 nmdc:mga0qj67_27792_c1 nmdc:mga0qj67_27792_c1_285_1187 295
397 3300050510 nmdc:mga06r32_12511_c1 nmdc:mga06r32_12511_c1_4071_4973 295
398 3300050511 nmdc:mga08y16_230140_c1 nmdc:mga08y16_230140_c1_646_1545 295
399 3300050511 nmdc:mga08y16_545866_c1 nmdc:mga08y16_545866_c1_205_1104 295
400 iso_pu_bacteria 2508501050 2508728166 295
401 iso_pu_bacteria 2509276021 2509385617 295
402 iso_pu_bacteria 2509276033 2509448335 295
403 iso_pu_bacteria 2510065019 2510136429 295
404 iso_pu_bacteria 2510461076 2510892308 295
405 iso_pu_bacteria 2510917030 2511198102 295
406 iso_pu_bacteria 2513237084 2513568058 295
407 iso_pu_bacteria 2513237085 2513578388 295
408 iso_pu_bacteria 2513237093 2513630999 295
409 iso_pu_bacteria 2513237103 2513711081 295
410 iso_pu_bacteria 2513237159 2513999351 295
411 iso_pu_bacteria 2513237162 2514021105 295
412 iso_pu_bacteria 2515154113 2515632215 295
413 iso_pu_bacteria 2515154114 2515643533 295
414 iso_pu_bacteria 2515154116 2515658332 295
415 iso_pu_bacteria 2515154134 2515738118 295
416 iso_pu_bacteria 2516653077 2517041200 295
417 iso_pu_bacteria 2516653085 2517080174 295
418 iso_pu_bacteria 2517093000 2517098175 295
419 iso_pu_bacteria 2517287029 2517410062 295
420 iso_pu_bacteria 2585427526 2585525578 295
421 iso_pu_bacteria 2585427528 2585538689 295
422 iso_pu_bacteria 2585427593 2585836642 295
423 iso_pu_bacteria 2615840624 2616294743 295
424 iso_pu_bacteria 2643221558 2643814631 295
425 iso_pu_bacteria 2718217882 2719184499 295
426 iso_pu_bacteria 2718217997 2719668392 295
427 iso_pu_bacteria 2718218009 2719728519 295
428 iso_pu_bacteria 2718218199 2720489085 295
429 iso_pu_bacteria 2718218232 2720609777 295
430 iso_pu_bacteria 2718218233 2720617209 295
431 iso_pu_bacteria 2718218235 2720628350 295
432 iso_pu_bacteria 2718218269 2720772304 295
433 iso_pu_bacteria 2718218363 2721144207 295
434 iso_pu_bacteria 2718218365 2721156305 295
435 iso_pu_bacteria 2718218366 2721161582 295
436 iso_pu_bacteria 2721755514 2722842727 295
437 iso_pu_bacteria 2721755556 2723029725 295
438 iso_pu_bacteria 2721755684 2723564094 295
439 iso_pu_bacteria 2721755685 2723570212 295
440 iso_pu_bacteria 2721755810 2724041544 295
441 iso_pu_bacteria 2721755819 2724092333 295
442 iso_pu_bacteria 2721755822 2724101759 295
443 iso_pu_bacteria 2721755823 2724112709 295
444 iso_pu_bacteria 2724679232 2725947834 295
445 iso_pu_bacteria 2728369352 2730110258 295
446 iso_pu_bacteria 2728369365 2730160615 295
447 iso_pu_bacteria 2728369397 2730295838 295
448 iso_pu_bacteria 2738541333 2739034112 295
449 iso_pu_bacteria 2758568016 2758637829 295
450 iso_pu_bacteria 2765235942 2766065111 295
451 iso_pu_bacteria 2791355256 2793297445 295
452 iso_pu_bacteria 2791355259 2793317318 295
453 iso_pu_bacteria 2791355260 2793323110 295
454 iso_pu_bacteria 2791355261 2793329872 295
455 iso_pu_bacteria 2791355262 2793336602 295
456 iso_pu_bacteria 2791355264 2793345379 295
457 iso_pu_bacteria 2791355265 2793354924 295
458 iso_pu_bacteria 2791355266 2793358163 295
459 iso_pu_bacteria 2802429605 2805927144 295
460 iso_pu_bacteria 2802429606 2805934430 295
461 iso_pu_bacteria 2802429633 2806042909 295
462 iso_pu_bacteria 2802429634 2806050862 295
463 iso_pu_bacteria 2802429635 2806057970 295
464 iso_pu_bacteria 2802429636 2806065317 295
465 iso_pu_bacteria 2802429637 2806076800 295
466 iso_pu_bacteria 2835312727 2835316039 295
467 iso_pu_bacteria 2838016132 2838016391 295
468 iso_pu_bacteria 2838022645 2838028328 295
469 iso_pu_bacteria 2838048938 2838049498 295
470 iso_pu_bacteria 2838061910 2838065227 295
471 iso_pu_bacteria 2838068647 2838068927 295
472 iso_pu_bacteria 2838668709 2838669552 295
473 iso_pu_bacteria 2838680041 2838686244 295
474 iso_pu_bacteria 2838686498 2838687469 295
475 iso_pu_bacteria 2838701080 2838701924 295
476 iso_pu_bacteria 2838707686 2838713951 295
477 iso_pu_bacteria 2838729681 2838734119 295
478 iso_pu_bacteria 2838742623 2838746571 295
479 iso_pu_bacteria 2841851746 2841854019 295
480 iso_pu_bacteria 2841864319 2841869339 295
481 iso_pu_bacteria 2842077413 2842083349 295
482 iso_pu_bacteria 2842110456 2842116732 295
483 iso_pu_bacteria 2842118031 2842124296 295
484 iso_pu_bacteria 2842156927 2842159614 295
485 iso_pu_bacteria 2842163707 2842164063 295
486 iso_pu_bacteria 2842180545 2842182816 295
487 iso_pu_bacteria 2842192696 2842198539 295
488 iso_pu_bacteria 2842198810 2842204304 295
489 iso_pu_bacteria 2842205361 2842209371 295
490 iso_pu_bacteria 2842217011 2842221591 295
491 iso_pu_bacteria 2842229732 2842232527 295
492 iso_pu_bacteria 2842237096 2842243368 295
493 iso_pu_bacteria 2842243621 2842247230 295
494 iso_pu_bacteria 2842250916 2842251653 295
495 iso_pu_bacteria 2842257432 2842259083 295
496 iso_pu_bacteria 2842264693 2842265263 295
497 iso_pu_bacteria 2842271015 2842272497 295
498 iso_pu_bacteria 2842278818 2842282585 295
499 iso_pu_bacteria 2842291075 2842297550 295
500 iso_pu_bacteria 2842304105 2842309831 295
501 iso_pu_bacteria 2842311132 2842313404 295
502 iso_pu_bacteria 2842317721 2842323361 295
503 iso_pu_bacteria 2842341865 2842344113 295
504 iso_pu_bacteria 2842370503 2842376579 295
505 iso_pu_bacteria 2842377471 2842383832 295
506 iso_pu_bacteria 2842384541 2842390975 295
507 iso_pu_bacteria 2842402390 2842405726 295
508 iso_pu_bacteria 2842409023 2842412310 295
509 iso_pu_bacteria 2842415677 2842418956 295
510 iso_pu_bacteria 2842422224 2842423073 295
511 iso_pu_bacteria 2842428310 2842428684 295
512 iso_pu_bacteria 2842434925 2842435297 295
513 iso_pu_bacteria 2842441272 2842441840 295
514 iso_pu_bacteria 2842447887 2842448114 295
515 iso_pu_bacteria 2842462802 2842463108 295
516 iso_pu_bacteria 2842469257 2842469628 295
517 iso_pu_bacteria 2842489311 2842489630 295
518 iso_pu_bacteria 2842495871 2842500462 295
519 iso_pu_bacteria 2842521101 2842525143 295
520 iso_pu_bacteria 2844454524 2844460465 295
521 iso_pu_bacteria 2854896431 2854899956 295
522 iso_pu_bacteria 2857516855 2857518030 295
523 iso_pu_bacteria 2894232714 2894237774 295
524 iso_pu_bacteria 2919100787 2919102789 295
525 iso_pu_bacteria 2933570622 2933576273 295
526 iso_pu_bacteria 2933586486 2933592948 295
527 iso_pu_bacteria 2933599457 2933599595 295
528 iso_pu_bacteria 2935894831 2935900993 295
529 iso_pu_bacteria 2935901341 2935903164 295
530 iso_pu_bacteria 2936367885 2936374399 295
531 iso_pu_bacteria 2936375103 2936378759 295
532 iso_pu_bacteria 2996893221 2996894491 295
533 iso_pu_bacteria 3005409236 3005413507 295
534 iso_pu_bacteria 3005445848 3005452049 295
535 iso_pu_bacteria 8005282627 8005287613 295
536 iso_pu_bacteria 8005289223 8005295520 295
537 iso_pu_bacteria 8005301065 8005306310 295
538 iso_pu_bacteria 8005307578 8005307933 295
539 iso_pu_bacteria 8005376324 8005379798 295
540 iso_pu_bacteria 8005382845 8005383403 295
541 iso_pu_bacteria 8005395548 8005398997 295
542 iso_pu_bacteria 8005430974 8005431769 295
543 iso_pu_bacteria 8005497431 8005502600 295
544 iso_pu_bacteria 8005556819 8005562360 295
545 iso_pu_bacteria 8005563573 8005565522 295
546 iso_pu_bacteria 8005570704 8005575762 295
547 iso_pu_bacteria 8005619151 8005623807 295
548 iso_pu_bacteria 8005626139 8005626366 295
549 iso_pu_bacteria 8005668836 8005674029 295
550 iso_pu_bacteria 8005688590 8005693994 295
551 iso_pu_bacteria 8018127388 8018131905 295
552 iso_pu_bacteria 8018163183 8018165502 295
553 iso_pu_bacteria 8023680758 8023688085 295
554 iso_pu_bacteria 8024479707 8024485040 295
555 iso_pu_bacteria 8024501048 8024507170 295
556 iso_pu_bacteria 8056375014 8056375043 295
557 iso_pu_bacteria 8056382006 8056382491 295
558 iso_pu_bacteria 8057874678 8057878015 295
559 3300003659 JGI25404J52841_10000339 JGI25404J52841_100003398 296
560 3300003659 JGI25404J52841_10016648 JGI25404J52841_100166482 296
561 3300005293 Ga0065715_10161723 Ga0065715_101617232 296
562 3300005336 Ga0070680_100034094 Ga0070680_1000340944 296
563 3300005367 Ga0070667_100291403 Ga0070667_1002914032 296
564 3300005458 Ga0070681_10116057 Ga0070681_101160573 296
565 3300005530 Ga0070679_100019403 Ga0070679_1000194035 296
566 3300005539 Ga0068853_100060577 Ga0068853_1000605773 296
567 3300005548 Ga0070665_100277455 Ga0070665_1002774552 296
568 3300005577 Ga0068857_100013484 Ga0068857_1000134843 296
569 3300005983 Ga0081540_1003442 Ga0081540_10034423 296
570 3300005983 Ga0081540_1014249 Ga0081540_10142491 296
571 3300006042 Ga0075368_10092149 Ga0075368_100921491 296
572 3300006051 Ga0075364_10317613 Ga0075364_103176132 296
573 3300006177 Ga0075362_10061163 Ga0075362_100611632 296
574 3300006186 Ga0075369_10083286 Ga0075369_100832862 296
575 3300006844 Ga0075428_100092179 Ga0075428_1000921792 296
576 3300006844 Ga0075428_100250183 Ga0075428_1002501832 296
577 3300006844 Ga0075428_100358949 Ga0075428_1003589491 296
578 3300006844 Ga0075428_100427878 Ga0075428_1004278782 296
579 3300006846 Ga0075430_100119818 Ga0075430_1001198182 296
580 3300006846 Ga0075430_100248046 Ga0075430_1002480462 296
581 3300006846 Ga0075430_100275755 Ga0075430_1002757552 296
582 3300006847 Ga0075431_100015726 Ga0075431_1000157265 296
583 3300006847 Ga0075431_100247157 Ga0075431_1002471572 296
584 3300006847 Ga0075431_100342482 Ga0075431_1003424822 296
585 3300006880 Ga0075429_100073335 Ga0075429_1000733353 296
586 3300009093 Ga0105240_10097351 Ga0105240_100973513 296
587 3300009147 Ga0114129_10228326 Ga0114129_102283262 296
588 3300010375 Ga0105239_10523033 Ga0105239_105230332 296
589 3300013104 Ga0157370_10023801 Ga0157370_100238012 296
590 3300013104 Ga0157370_10314929 Ga0157370_103149292 296
591 3300013306 Ga0163162_10423863 Ga0163162_104238632 296
592 3300025912 Ga0207707_10100127 Ga0207707_101001272 296
593 3300025913 Ga0207695_10087976 Ga0207695_100879763 296
594 3300025921 Ga0207652_10119480 Ga0207652_101194802 296
595 3300025949 Ga0207667_10049571 Ga0207667_100495711 296
596 3300025986 Ga0207658_10028464 Ga0207658_100284645 296
597 3300026041 Ga0207639_10124095 Ga0207639_101240951 296
598 3300026078 Ga0207702_10053185 Ga0207702_100531854 296
599 3300027907 Ga0207428_10059159 Ga0207428_100591592 296
600 3300028380 Ga0268265_10178697 Ga0268265_101786972 296
601 3300031456 Ga0307513_10213258 Ga0307513_102132582 296
602 3300031456 Ga0307513_10269250 Ga0307513_102692503 296
603 3300037418 Ga0395900_0018325 Ga0395900_0018325_6042_6944 296
604 3300037418 Ga0395900_0529655 Ga0395900_0529655_189_1082 296
605 3300037466 Ga0395898_0007511 Ga0395898_0007511_7073_7975 296
606 3300037853 Ga0436364_0063930 Ga0436364_0063930_1044_1952 296
607 3300038443 Ga0395901_0159895 Ga0395901_0159895_797_1690 296
608 3300039437 Ga0436365_0481731 Ga0436365_0481731_1841_2749 296
609 3300039438 Ga0436360_0178193 Ga0436360_0178193_2476_3384 296
610 3300041460 Ga0451802_0956542 Ga0451802_0956542_325_1239 296
611 3300042157 Ga0439458_0027395 Ga0439458_0027395_108_1001 296
612 3300042439 Ga0439464_0028317 Ga0439464_0028317_150_1043 296
613 3300046477 Ga0495664_0077379 Ga0495664_0077379_564_1478 296
614 3300046543 Ga0495645_0029087 Ga0495645_0029087_2903_3817 296
615 3300047443 Ga0495687_097650 Ga0495687_097650_30_938 296
616 3300048924 Ga0496121_0000406 Ga0496121_0000406_18737_19642 296
617 3300049574 Ga0501038_0027545 Ga0501038_0027545_2481_3380 296
618 3300049574 Ga0501038_0028509 Ga0501038_0028509_3196_4110 296
619 3300049822 Ga0501035_0228322 Ga0501035_0228322_290_1204 296
620 3300049823 Ga0501044_0072326 Ga0501044_0072326_1319_2233 296
621 3300050491 nmdc:mga00v17_104960_c1 nmdc:mga00v17_104960_c1_610_1509 296
622 3300050492 nmdc:mga0yw44_112489_c1 nmdc:mga0yw44_112489_c1_390_1283 296
623 3300050492 nmdc:mga0yw44_7443_c1 nmdc:mga0yw44_7443_c1_1055_1954 296
624 3300050493 nmdc:mga0k408_45159_c1 nmdc:mga0k408_45159_c1_18_932 296
625 3300050507 nmdc:mga05p37_106889_c1 nmdc:mga05p37_106889_c1_1431_2345 296
626 3300050508 nmdc:mga09592_188763_c1 nmdc:mga09592_188763_c1_532_1446 296
627 3300050508 nmdc:mga09592_45885_c1 nmdc:mga09592_45885_c1_1236_2150 296
628 3300050508 nmdc:mga09592_53176_c1 nmdc:mga09592_53176_c1_948_1862 296
629 3300050509 nmdc:mga0qj67_132735_c1 nmdc:mga0qj67_132735_c1_981_1895 296
630 3300050509 nmdc:mga0qj67_51412_c1 nmdc:mga0qj67_51412_c1_575_1489 296
631 3300050510 nmdc:mga06r32_235229_c1 nmdc:mga06r32_235229_c1_540_1454 296
632 3300050510 nmdc:mga06r32_4390_c1 nmdc:mga06r32_4390_c1_6448_7362 296
633 3300050511 nmdc:mga08y16_76334_c1 nmdc:mga08y16_76334_c1_1163_2077 296
634 iso_pu_bacteria 2508501127 2509144701 296
635 iso_pu_bacteria 2513237087 2513591257 296
636 iso_pu_bacteria 2751185800 2753361093 296
637 iso_pu_bacteria 2842694124 2842695716 296
638 iso_pu_bacteria 2924762789 2924765984 296
639 iso_pu_bacteria 2987666974 2987668500 296
640 iso_pu_bacteria 639633055 639644988 296
641 3300003771 Ga0055526_1000017 Ga0055526_1000017111 297
642 3300003775 Ga0055524_1000014 Ga0055524_100001457 297
643 3300003775 Ga0055524_1010792 Ga0055524_10107922 297
644 3300005329 Ga0070683_100492237 Ga0070683_1004922372 297
645 3300005436 Ga0070713_100160398 Ga0070713_1001603981 297
646 3300005436 Ga0070713_100186107 Ga0070713_1001861072 297
647 3300006028 Ga0070717_10082654 Ga0070717_100826542 297
648 3300014326 Ga0157380_10590924 Ga0157380_105909241 297
649 3300014497 Ga0182008_10039986 Ga0182008_100399862 297
650 3300020080 Ga0206350_11027389 Ga0206350_110273891 297
651 3300025291 Ga0209675_1002662 Ga0209675_10026629 297
652 3300025294 Ga0209025_1000017 Ga0209025_100001768 297
653 3300025295 Ga0209564_1000031 Ga0209564_100003196 297
654 3300025295 Ga0209564_1000082 Ga0209564_1000082170 297
655 3300025299 Ga0209256_1000033 Ga0209256_1000033291 297
656 3300025299 Ga0209256_1000181 Ga0209256_100018175 297
657 3300025928 Ga0207700_10010378 Ga0207700_100103783 297
658 3300025928 Ga0207700_10276604 Ga0207700_102766042 297
659 3300026023 Ga0207677_10414397 Ga0207677_104143971 297
660 3300048920 Ga0496117_0017924 Ga0496117_0017924_4138_5040 297
661 3300048920 Ga0496117_0071594 Ga0496117_0071594_894_1799 297
662 3300048922 Ga0496119_0008868 Ga0496119_0008868_989_1900 297
663 3300048925 Ga0496122_0023409 Ga0496122_0023409_1560_2471 297
664 3300048928 Ga0496125_0000471 Ga0496125_0000471_35109_36020 297
665 3300049571 Ga0501034_0022087 Ga0501034_0022087_460_1362 297
666 3300053119 Ga0500595_002181 Ga0500595_002181_4177_5088 297
667 iso_pu_bacteria 2791355263 2793344511 297
668 iso_pu_bacteria 2936381700 2936386549 297
669 3300004803 Ga0058862_12352147 Ga0058862_123521472 298
670 3300005329 Ga0070683_100440100 Ga0070683_1004401002 298
671 3300005456 Ga0070678_100070667 Ga0070678_1000706673 298
672 3300009093 Ga0105240_10119069 Ga0105240_101190692 298
673 3300026121 Ga0207683_10099071 Ga0207683_100990711 298
674 3300036401 Ga0373937_0274478 Ga0373937_0274478_151_1074 298
675 3300037853 Ga0436364_0210545 Ga0436364_0210545_377_1315 298
676 3300044694 Ga0466963_0145165 Ga0466963_0145165_16_954 298
677 3300046462 Ga0495651_0017859 Ga0495651_0017859_3166_4089 298
678 3300047317 Ga0495604_0157604 Ga0495604_0157604_591_1514 298
679 3300047322 Ga0495680_0209890 Ga0495680_0209890_153_1076 298
680 3300048928 Ga0496125_0000145 Ga0496125_0000145_60579_61487 298
681 3300053161 Ga0500634_0000507 Ga0500634_0000507_11204_12100 298
682 3300002739 JGI25158J39367_1000448 JGI25158J39367_10004482 299
683 3300002773 JGI25152J39213_1005931 JGI25152J39213_10059313 299
684 3300002987 JGI25159J45721_1004075 JGI25159J45721_10040752 299
685 3300003187 JGI25151J46595_10000508 JGI25151J46595_1000050826 299
686 3300003215 JGI25153J46596_10002535 JGI25153J46596_1000253511 299
687 3300003215 JGI25153J46596_10010647 JGI25153J46596_100106473 299
688 3300003215 JGI25153J46596_10014909 JGI25153J46596_100149093 299
689 3300003354 JGI25160J50197_1040511 JGI25160J50197_10405111 299
690 3300003374 JGI25161J50226_1000075 JGI25161J50226_100007554 299
691 3300003374 JGI25161J50226_1006294 JGI25161J50226_10062942 299
692 3300003771 Ga0055526_1005597 Ga0055526_10055973 299
693 3300003771 Ga0055526_1024737 Ga0055526_10247372 299
694 3300003790 Ga0055528_1000054 Ga0055528_100005460 299
695 3300003790 Ga0055528_1002349 Ga0055528_10023492 299
696 3300003792 Ga0055540_1000255 Ga0055540_100025521 299
697 3300003792 Ga0055540_1025147 Ga0055540_10251472 299
698 3300003794 Ga0055531_10016286 Ga0055531_100162861 299
699 3300004625 Ga0055543_1000096 Ga0055543_100009644 299
700 3300004625 Ga0055543_1000578 Ga0055543_10005784 299
701 3300005262 Ga0065165_1007353 Ga0065165_10073532 299
702 3300005262 Ga0065165_1011236 Ga0065165_10112364 299
703 3300005441 Ga0070700_100040608 Ga0070700_1000406081 299
704 3300006038 Ga0075365_10005493 Ga0075365_100054932 299
705 3300006038 Ga0075365_10016988 Ga0075365_100169883 299
706 3300006042 Ga0075368_10062883 Ga0075368_100628832 299
707 3300006051 Ga0075364_10000285 Ga0075364_100002852 299
708 3300006058 Ga0075432_10016468 Ga0075432_100164683 299
709 3300006177 Ga0075362_10006876 Ga0075362_100068761 299
710 3300006178 Ga0075367_10008149 Ga0075367_100081497 299
711 3300006195 Ga0075366_10096705 Ga0075366_100967052 299
712 3300006353 Ga0075370_10139245 Ga0075370_101392451 299
713 3300009148 Ga0105243_10108107 Ga0105243_101081072 299
714 3300009765 Ga0123341_1000012 Ga0123341_100001246 299
715 3300009766 Ga0123342_1012643 Ga0123342_101264311 299
716 3300011119 Ga0105246_10188245 Ga0105246_101882452 299
717 3300014326 Ga0157380_10007607 Ga0157380_100076072 299
718 3300025208 Ga0209436_100035 Ga0209436_10003515 299
719 3300025245 Ga0207425_1002132 Ga0207425_10021324 299
720 3300025245 Ga0207425_1012579 Ga0207425_10125792 299
721 3300025258 Ga0209129_1003154 Ga0209129_10031543 299
722 3300025258 Ga0209129_1005382 Ga0209129_10053822 299
723 3300025273 Ga0209673_1000067 Ga0209673_1000067172 299
724 3300025273 Ga0209673_1000750 Ga0209673_100075024 299
725 3300025273 Ga0209673_1001376 Ga0209673_100137624 299
726 3300025284 Ga0209130_1000031 Ga0209130_1000031189 299
727 3300025294 Ga0209025_1000397 Ga0209025_100039774 299
728 3300025295 Ga0209564_1000092 Ga0209564_1000092172 299
729 3300025295 Ga0209564_1000511 Ga0209564_10005117 299
730 3300025295 Ga0209564_1000925 Ga0209564_10009256 299
731 3300025295 Ga0209564_1022634 Ga0209564_10226342 299
732 3300025297 Ga0209758_1000504 Ga0209758_100050440 299
733 3300025297 Ga0209758_1000585 Ga0209758_100058511 299
734 3300025297 Ga0209758_1005532 Ga0209758_10055328 299
735 3300025298 Ga0209050_1004942 Ga0209050_10049427 299
736 3300025299 Ga0209256_1000170 Ga0209256_1000170112 299
737 3300025299 Ga0209256_1004342 Ga0209256_10043428 299
738 3300025299 Ga0209256_1015056 Ga0209256_10150563 299
739 3300025299 Ga0209256_1022722 Ga0209256_10227222 299
740 3300025302 Ga0207426_1000042 Ga0207426_1000042221 299
741 3300025302 Ga0207426_1000355 Ga0207426_100035565 299
742 3300025303 Ga0209051_1000062 Ga0209051_100006266 299
743 3300025303 Ga0209051_1009790 Ga0209051_10097903 299
744 3300025304 Ga0209257_1000970 Ga0209257_100097019 299
745 3300025304 Ga0209257_1037430 Ga0209257_10374301 299
746 3300026075 Ga0207708_10058747 Ga0207708_100587471 299
747 3300027866 Ga0209813_10073571 Ga0209813_100735711 299
748 3300027907 Ga0207428_10074571 Ga0207428_100745713 299
749 3300037471 Ga0395905_0014555 Ga0395905_0014555_2504_3403 299
750 3300041494 Ga0451837_1690335 Ga0451837_1690335_340_1242 299
751 3300041496 Ga0451839_0668746 Ga0451839_0668746_252_1154 299
752 3300041498 Ga0451841_0665146 Ga0451841_0665146_217_1119 299
753 3300041503 Ga0451847_0365642 Ga0451847_0365642_217_1119 299
754 3300041503 Ga0451847_0833553 Ga0451847_0833553_422_1324 299
755 3300041505 Ga0451849_0492377 Ga0451849_0492377_2104_3006 299
756 3300041509 Ga0451843_0493458 Ga0451843_0493458_217_1119 299
757 3300041509 Ga0451843_1370099 Ga0451843_1370099_380_1282 299
758 3300041512 Ga0451853_2198736 Ga0451853_2198736_1612_2511 299
759 3300044765 Ga0466970_0024331 Ga0466970_0024331_651_1550 299
760 3300046460 Ga0495638_0000475 Ga0495638_0000475_3704_4603 299
761 3300046460 Ga0495638_0017603 Ga0495638_0017603_347_1249 299
762 3300046492 Ga0495585_0058598 Ga0495585_0058598_170_1072 299
763 3300046501 Ga0495607_0021279 Ga0495607_0021279_2941_3843 299
764 3300046512 Ga0495610_0068843 Ga0495610_0068843_312_1214 299
765 3300046519 Ga0495632_0054675 Ga0495632_0054675_469_1371 299
766 3300046542 Ga0495597_0018419 Ga0495597_0018419_591_1493 299
767 3300046616 Ga0495668_0091160 Ga0495668_0091160_138_1040 299
768 3300046660 Ga0495625_0065986 Ga0495625_0065986_1005_1907 299
769 3300046660 Ga0495625_0149096 Ga0495625_0149096_562_1464 299
770 3300046691 Ga0495670_0079396 Ga0495670_0079396_226_1128 299
771 3300046794 Ga0495589_0196969 Ga0495589_0196969_24_923 299
772 3300047447 Ga0495685_063961 Ga0495685_063961_288_1190 299
773 3300047470 Ga0495681_0119790 Ga0495681_0119790_37_939 299
774 3300047472 Ga0495686_0038269 Ga0495686_0038269_398_1300 299
775 3300048919 Ga0496116_0009436 Ga0496116_0009436_4538_5437 299
776 3300048921 Ga0496118_0002068 Ga0496118_0002068_5980_6879 299
777 3300048921 Ga0496118_0028344 Ga0496118_0028344_3328_4227 299
778 3300048925 Ga0496122_0026726 Ga0496122_0026726_720_1619 299
779 3300048928 Ga0496125_0010847 Ga0496125_0010847_5897_6796 299
780 3300049571 Ga0501034_0145736 Ga0501034_0145736_1256_2155 299
781 3300049574 Ga0501038_0098912 Ga0501038_0098912_326_1225 299
782 3300049581 Ga0501047_0061392 Ga0501047_0061392_1709_2608 299
783 3300049744 Ga0501083_0028777 Ga0501083_0028777_2542_3441 299
784 3300049823 Ga0501044_0114589 Ga0501044_0114589_1336_2235 299
785 3300050489 nmdc:mga03683_70474_c1 nmdc:mga03683_70474_c1_372_1271 299
786 3300050490 nmdc:mga03n38_157664_c1 nmdc:mga03n38_157664_c1_139_1038 299
787 3300050491 nmdc:mga00v17_14_c1 nmdc:mga00v17_14_c1_103231_104139 299
788 3300050492 nmdc:mga0yw44_3294_c1 nmdc:mga0yw44_3294_c1_243_1142 299
789 3300050494 nmdc:mga06z11_160131_c1 nmdc:mga06z11_160131_c1_174_1073 299
790 3300050516 nmdc:mga0sz30_74628_c1 nmdc:mga0sz30_74628_c1_320_1219 299
791 3300053108 Ga0500562_022839 Ga0500562_022839_512_1411 299
792 3300053109 Ga0500569_046106 Ga0500569_046106_330_1232 299
793 3300053134 Ga0500658_0002498 Ga0500658_0002498_5206_6108 299
794 3300053134 Ga0500658_0044689 Ga0500658_0044689_640_1539 299
795 3300053139 Ga0500568_0001438 Ga0500568_0001438_340_1239 299
796 3300053153 Ga0500616_0000472 Ga0500616_0000472_7543_8442 299
797 3300061719 Ga0466962_0101240 Ga0466962_0101240_86_985 299
798 iso_pu_bacteria 2529292951 2530644670 299
799 iso_pu_bacteria 2718217927 2719388562 299
800 iso_pu_bacteria 2718217927 2719388581 299
801 iso_pu_bacteria 2718218423 2721403187 299
802 iso_pu_bacteria 2718218423 2721403206 299
803 iso_pu_bacteria 2721755809 2724035544 299
804 iso_pu_bacteria 2721755809 2724035563 299
805 iso_pu_bacteria 2791355267 2793369827 299
806 iso_pu_bacteria 2838042994 2838045839 299
807 iso_pu_bacteria 2842395702 2842396473 299
808 iso_pu_bacteria 8005275841 8005277278 299
809 iso_pu_bacteria 8005275841 8005277297 299
810 iso_pu_bacteria 8005695170 8005701816 299
811 iso_pu_bacteria 8018150411 8018150446 299
812 iso_pu_bacteria 8018176218 8018182373 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

120

308

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8822 28 284
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8655 28 284
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8509 27 294
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8488 24 284
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.848 26 294
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9257 28 284 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9167 28 290 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9126 28 290 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9101 28 290 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9008 14 284 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A660RIG7-F1-model_v4 Carbohydrate ABC transporter permease 0.9644 36 284 GO:0005886
GO:0055085
AF-A0A1F7MT14-F1-model_v4 Sugar ABC transporter permease 0.9602 27 273 GO:0005886
GO:0055085
AF-A0A660RIG7-F1-model_v4 Carbohydrate ABC transporter permease 0.9494 36 284 GO:0005886
GO:0055085
AF-A0A2V6RI67-F1-model_v4 Sugar ABC transporter permease 0.9484 70 295 GO:0005886
GO:0055085
AF-A0A023XWK9-F1-model_v4 deleted 0.9449 37 299

Feature Viewer

pLDDT pTM Quality
81.68 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map