F481716

General Info

Members Datasets Scaffolds Average Seq Length
808 541 614 110

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12087974|Ga0105249_120879741
Length 125
Sequence MMQTIEAAVVSTVLRTLADPTRRAVFERIATSDEITVAELTRGSGVTQGAISQHLKSLKQAGLVTERPAGRNVYYRAQPEGLAPLRDWLSFYERFWTSRLDVLEQLLRKEDERHSSAPPKKGDDQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2643221618 Ensifer sp. Root231 Isolate Unclassified
19 2643221626 Ensifer sp. Root31 Isolate Unclassified
20 2643221655 Ensifer sp. Root1252 Isolate Unclassified
21 2643221659 Ensifer sp. Root127 Isolate Unclassified
22 2643221698 Ensifer sp. Root142 Isolate Unclassified
23 2643221712 Ensifer sp. Root258 Isolate Unclassified
24 2643221736 Bosea sp. Root483D1 Isolate Unclassified
25 2718218365 Rhizobium sp. N731 Isolate Nodule
26 2728369397 Rhizobium sp. N1314 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
53 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
54 2841760612 Bosea sp. Tri-49 Isolate Nodule
55 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
56 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
57 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
58 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
59 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
60 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
61 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
62 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
63 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
64 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
65 2844104063 Bosea sp. Tri-39 Isolate Nodule
66 2844163670 Ensifer sp. 1H6 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2851246043 Bosea sp. Tri-54 Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
83 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
84 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
85 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
86 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
90 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
91 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
92 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
93 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
94 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
95 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
96 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
97 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
98 2922368715
99 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
100 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
101 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
102 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
103 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
104 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
105 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
106 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
107 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
108 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
109 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
110 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
111 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
112 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
113 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
114 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
115 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
116 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
117 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
118 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
119 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
120 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
121 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
122 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
123 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
124 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
125 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
126 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
127 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
128 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
129 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
130 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
131 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
132 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
133 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
134 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
135 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
136 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
137 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
138 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
139 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
140 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
141 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
142 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
143 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
144 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
145 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
146 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
147 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
148 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
149 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
150 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
151 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
152 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
153 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
154 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
155 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
156 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
157 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
158 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
159 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
160 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
161 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
162 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
163 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
164 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
165 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
166 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
167 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
168 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
169 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
170 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
171 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
172 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
173 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
174 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
175 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
176 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
177 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
178 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
179 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
180 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
181 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
182 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
183 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
184 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
185 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
186 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
187 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
188 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
189 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
190 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
191 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
192 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
193 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
194 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
195 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
196 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
197 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
198 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
199 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
200 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
201 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
202 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
203 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
204 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
205 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
206 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
207 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
208 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
209 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
210 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
211 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
212 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
213 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
214 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
215 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
216 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
217 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
218 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
219 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
220 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
221 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
222 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
223 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
224 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
225 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
226 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
227 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
228 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
229 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
231 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
232 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
233 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
234 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
235 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
236 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
237 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
238 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
239 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
240 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
241 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
242 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
243 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
244 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
245 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
246 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
247 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
248 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
249 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
250 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
251 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
252 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
253 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
254 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
255 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
256 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
257 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
258 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
259 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
260 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
261 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
262 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
263 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
264 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
265 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
266 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
267 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
268 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
271 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
275 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
278 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
322 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
323 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
324 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
325 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
326 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
330 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
331 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
332 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
333 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
334 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
335 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
336 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
337 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
338 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
339 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
340 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
341 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
342 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
343 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
350 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
351 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
352 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
353 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
354 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
355 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
356 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
357 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
358 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
359 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
360 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
361 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
362 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
363 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
364 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
365 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
366 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
367 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
368 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
369 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
370 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
371 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
372 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
373 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
374 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
375 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
376 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
377 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
378 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
379 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
380 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
381 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
382 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
383 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
384 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
385 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
386 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
387 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
388 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
389 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
390 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
391 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
392 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
393 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
394 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
398 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
399 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
402 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
403 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
404 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
405 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
406 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
407 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
417 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
418 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
419 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
424 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
428 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
429 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
430 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
431 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
432 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
437 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
438 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
439 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
440 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
441 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
442 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
443 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
444 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
445 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
446 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
447 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
448 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
449 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
450 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
451 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
452 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
453 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
466 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
467 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
470 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
471 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
472 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
473 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
474 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
477 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
478 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
479 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
482 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
483 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
487 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
488 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
489 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
492 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
493 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
494 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
495 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
496 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
506 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
507 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
508 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
509 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
510 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
511 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
512 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
513 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
514 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
515 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
516 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
517 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
518 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
519 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
520 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
521 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
522 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
523 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
524 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
525 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
526 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
527 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
528 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
529 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
530 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
531 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
532 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
533 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
534 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
535 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
536 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
537 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
538 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
539 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
540 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
541 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.08
Metatranscriptomes 0
Isolates 23.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.57
Nodule 18.81
Rhizoplane 5.45
Rhizosphere 44.93
Stem 0
Stem Tuber 0
Unclassified 13.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C9286 2010549000 Bacteria 1292
2 JGI24739J22299_10080875 3300001989 Bacteria 998
3 JGI24735J21928_10182759 3300002067 Bacteria 607
4 JGI25151J46595_10034751 3300003187 Bacteria 1923
5 JGI25153J46596_10000920 3300003215 Bacteria 17882
6 JGI25153J46596_10001125 3300003215 Bacteria 16201
7 JGI25153J46596_10002262 3300003215 Bacteria 11217
8 JGI25153J46596_10056866 3300003215 Bacteria 1085
9 rootH2_10037340 3300003320 Bacteria 4917
10 rootH1_10023157 3300003323 Bacteria 11483
11 rootH1_10082836 3300003323 Bacteria 1335
12 JGI25160J50197_1000504 3300003354 Bacteria 23228
13 JGI25160J50197_1034350 3300003354 Bacteria 1260
14 Ga0055542_1021755 3300003762 Bacteria 920
15 Ga0055526_1054742 3300003771 Bacteria 884
16 Ga0055534_1027789 3300003784 Bacteria 891
17 Ga0055530_10007145 3300003791 Bacteria 4781
18 Ga0055531_10004813 3300003794 Bacteria 8062
19 Ga0055531_10010973 3300003794 Bacteria 4432
20 Ga0055531_10047828 3300003794 Bacteria 1160
21 Ga0055543_1029488 3300004625 Bacteria 963
22 Ga0065165_1000278 3300005262 Bacteria 87353
23 Ga0065165_1002349 3300005262 Bacteria 16429
24 Ga0065165_1064628 3300005262 Bacteria 990
25 Ga0070658_10230315 3300005327 Bacteria 1569
26 Ga0070658_10426009 3300005327 Bacteria 1142
27 Ga0070670_100449246 3300005331 Bacteria 1142
28 Ga0070670_101958049 3300005331 Bacteria 540
29 Ga0070666_10301582 3300005335 Bacteria 1141
30 Ga0070682_100834730 3300005337 Bacteria 752
31 Ga0068868_100260338 3300005338 Bacteria 1462
32 Ga0070660_100090206 3300005339 Bacteria 2416
33 Ga0070660_100535887 3300005339 Bacteria 976
34 Ga0070687_101467247 3300005343 Bacteria 512
35 Ga0070661_100223681 3300005344 Bacteria 1444
36 Ga0070668_100026997 3300005347 Bacteria 4359
37 Ga0070668_100164454 3300005347 Bacteria 1802
38 Ga0070668_102051535 3300005347 Bacteria 528
39 Ga0070671_100034351 3300005355 Bacteria 4197
40 Ga0070671_100095040 3300005355 Bacteria 2498
41 Ga0070671_100212039 3300005355 Bacteria 1643
42 Ga0070673_100549704 3300005364 Bacteria 1049
43 Ga0070659_100125344 3300005366 Bacteria 2083
44 Ga0070667_100300318 3300005367 Bacteria 1446
45 Ga0070663_100167747 3300005455 Bacteria 1695
46 Ga0070663_100279293 3300005455 Bacteria 1330
47 Ga0070663_101287135 3300005455 Bacteria 645
48 Ga0070678_100102649 3300005456 Bacteria 2220
49 Ga0070662_100048293 3300005457 Bacteria 3066
50 Ga0070662_100131977 3300005457 Bacteria 1927
51 Ga0070681_10082606 3300005458 Bacteria 3167
52 Ga0070679_101237795 3300005530 Bacteria 692
53 Ga0070684_101002342 3300005535 Bacteria 784
54 Ga0070684_101256490 3300005535 Bacteria 697
55 Ga0070697_100055346 3300005536 Bacteria 3225
56 Ga0068853_100670497 3300005539 Bacteria 988
57 Ga0068853_100693682 3300005539 Bacteria 971
58 Ga0070696_101527513 3300005546 Bacteria 572
59 Ga0070665_100768901 3300005548 Bacteria 976
60 Ga0070665_100834317 3300005548 Bacteria 935
61 Ga0068855_100025743 3300005563 Bacteria 7035
62 Ga0068855_100150995 3300005563 Bacteria 2642
63 Ga0068855_101000110 3300005563 Bacteria 879
64 Ga0070664_100620956 3300005564 Bacteria 1003
65 Ga0070664_101418207 3300005564 Bacteria 657
66 Ga0068857_100285909 3300005577 Bacteria 1518
67 Ga0068854_100322525 3300005578 Bacteria 1256
68 Ga0068854_100487372 3300005578 Bacteria 1036
69 Ga0068854_101792683 3300005578 Bacteria 563
70 Ga0068856_100189953 3300005614 Bacteria 2068
71 Ga0068856_100429825 3300005614 Bacteria 1341
72 Ga0068856_101187176 3300005614 Bacteria 780
73 Ga0068852_100030886 3300005616 Bacteria 4414
74 Ga0068852_100304950 3300005616 Bacteria 1542
75 Ga0068852_102094699 3300005616 Bacteria 587
76 Ga0068859_100500733 3300005617 Bacteria 1310
77 Ga0068864_100176401 3300005618 Bacteria 1951
78 Ga0068861_102300670 3300005719 Bacteria 541
79 Ga0068851_10190163 3300005834 Bacteria 1141
80 Ga0068863_100361821 3300005841 Bacteria 1414
81 Ga0068863_101416724 3300005841 Bacteria 703
82 Ga0068858_100808582 3300005842 Bacteria 915
83 Ga0068858_100955076 3300005842 Bacteria 839
84 Ga0068858_101301050 3300005842 Bacteria 715
85 Ga0068860_100154260 3300005843 Bacteria 2213
86 Ga0068860_100466678 3300005843 Bacteria 1257
87 Ga0068860_100971742 3300005843 Bacteria 867
88 Ga0068862_100722053 3300005844 Bacteria 967
89 Ga0081538_10189026 3300005981 Bacteria 868
90 Ga0081540_1109605 3300005983 Bacteria 1170
91 Ga0081539_10007629 3300005985 Bacteria 9762
92 Ga0081539_10012883 3300005985 Bacteria 6370
93 Ga0070717_11632077 3300006028 Bacteria 584
94 Ga0075365_10039463 3300006038 Bacteria 3074
95 Ga0075365_10052571 3300006038 Bacteria 2695
96 Ga0075365_10075845 3300006038 Bacteria 2270
97 Ga0075365_10632402 3300006038 Bacteria 757
98 Ga0075365_10650661 3300006038 Bacteria 745
99 Ga0075368_10007174 3300006042 Bacteria 3927
100 Ga0075363_100001650 3300006048 Bacteria 8628
101 Ga0075363_100265970 3300006048 Bacteria 990
102 Ga0075364_10160045 3300006051 Bacteria 1520
103 Ga0075362_10056719 3300006177 Bacteria 1764
104 Ga0075367_10111355 3300006178 Bacteria 1680
105 Ga0075367_10116181 3300006178 Bacteria 1646
106 Ga0075367_10159833 3300006178 Bacteria 1401
107 Ga0075367_10485205 3300006178 Bacteria 784
108 Ga0075369_10019487 3300006186 Bacteria 2770
109 Ga0075369_10038153 3300006186 Bacteria 2049
110 Ga0075369_10049252 3300006186 Bacteria 1819
111 Ga0075369_10099972 3300006186 Bacteria 1301
112 Ga0075366_10249464 3300006195 Bacteria 1082
113 Ga0075366_10892764 3300006195 Bacteria 554
114 Ga0075366_10906387 3300006195 Bacteria 549
115 Ga0097621_100215853 3300006237 Bacteria 1670
116 Ga0075370_10051002 3300006353 Bacteria 2347
117 Ga0068871_102109783 3300006358 Bacteria 537
118 Ga0097620_100500698 3300006931 Bacteria 1310
119 Ga0099824_1016622 3300006942 Bacteria 6617
120 Ga0099823_1027325 3300006944 Bacteria 4980
121 Ga0099795_10191363 3300007788 Bacteria 859
122 Ga0105240_10002229 3300009093 Bacteria 31523
123 Ga0105240_10082573 3300009093 Bacteria 3946
124 Ga0105240_12251048 3300009093 Bacteria 565
125 Ga0105245_11967275 3300009098 Bacteria 638
126 Ga0105245_13090658 3300009098 Bacteria 516
127 Ga0105247_10123462 3300009101 Bacteria 1680
128 Ga0105243_10048108 3300009148 Bacteria 3360
129 Ga0105241_10089422 3300009174 Bacteria 2426
130 Ga0105241_10128044 3300009174 Bacteria 2052
131 Ga0105241_10424439 3300009174 Bacteria 1171
132 Ga0105242_10440098 3300009176 Bacteria 1226
133 Ga0105248_10033433 3300009177 Bacteria 5745
134 Ga0105248_10099852 3300009177 Bacteria 3270
135 Ga0105248_10943174 3300009177 Bacteria 975
136 Ga0105248_11799650 3300009177 Bacteria 695
137 Ga0105248_13231138 3300009177 Bacteria 518
138 Ga0105237_10035674 3300009545 Bacteria 5031
139 Ga0105237_10274451 3300009545 Bacteria 1689
140 Ga0105237_11240748 3300009545 Bacteria 752
141 Ga0105238_10755742 3300009551 Bacteria 986
142 Ga0105238_10820238 3300009551 Bacteria 946
143 Ga0105238_11863117 3300009551 Bacteria 634
144 Ga0105238_12227338 3300009551 Bacteria 583
145 Ga0105238_12995031 3300009551 Bacteria 507
146 Ga0105249_10310925 3300009553 Bacteria 1584
147 Ga0105249_12087974 3300009553 Bacteria 639
148 Ga0099796_10466465 3300010159 Bacteria 563
149 Ga0105239_10022884 3300010375 Bacteria 6889
150 Ga0105239_10238225 3300010375 Bacteria 2042
151 Ga0105239_10439169 3300010375 Bacteria 1480
152 Ga0105239_10626918 3300010375 Bacteria 1227
153 Ga0105239_10667163 3300010375 Bacteria 1188
154 Ga0105239_11797712 3300010375 Bacteria 710
155 Ga0105246_10041441 3300011119 Bacteria 3112
156 Ga0157370_10115884 3300013104 Bacteria 2503
157 Ga0157370_11182077 3300013104 Bacteria 690
158 Ga0157369_10707693 3300013105 Bacteria 1037
159 Ga0157369_10757107 3300013105 Bacteria 999
160 Ga0157369_10876278 3300013105 Bacteria 921
161 Ga0157374_10368990 3300013296 Bacteria 1428
162 Ga0157378_11211786 3300013297 Bacteria 794
163 Ga0157378_11897925 3300013297 Bacteria 645
164 Ga0163162_11785283 3300013306 Bacteria 703
165 Ga0157372_12503103 3300013307 Bacteria 592
166 Ga0157375_10278080 3300013308 Bacteria 1837
167 Ga0157375_10744496 3300013308 Bacteria 1132
168 Ga0163163_10138673 3300014325 Bacteria 2474
169 Ga0163163_10153121 3300014325 Bacteria 2349
170 Ga0163163_10232514 3300014325 Bacteria 1892
171 Ga0182008_10290928 3300014497 Bacteria 852
172 Ga0157379_10386935 3300014968 Bacteria 1284
173 Ga0157379_11232481 3300014968 Bacteria 720
174 Ga0157376_10408002 3300014969 Bacteria 1315
175 Ga0182005_1211335 3300015265 Bacteria 587
176 Ga0163161_10584685 3300017792 Bacteria 919
177 Ga0163161_10656866 3300017792 Bacteria 869
178 Ga0214544_1000020 3300021320 Bacteria 178560
179 Ga0214544_1033003 3300021320 Bacteria 1565
180 Ga0214544_1037219 3300021320 Bacteria 1210
181 Ga0214542_1000024 3300021321 Bacteria 191218
182 Ga0214542_1040209 3300021321 Bacteria 1210
183 Ga0214545_1000011 3300021324 Bacteria 190550
184 Ga0214543_1000033 3300021327 Bacteria 190419
185 Ga0214543_1047985 3300021327 Bacteria 903
186 Ga0213876_10717198 3300021384 Bacteria 532
187 Ga0207425_1027894 3300025245 Bacteria 1149
188 Ga0209677_105274 3300025253 Bacteria 3422
189 Ga0209148_1000574 3300025254 Bacteria 34124
190 Ga0209233_1004212 3300025261 Bacteria 4931
191 Ga0209233_1010224 3300025261 Bacteria 2822
192 Ga0209455_1000834 3300025272 Bacteria 16636
193 Ga0209455_1050977 3300025272 Bacteria 579
194 Ga0209025_1001616 3300025294 Bacteria 28163
195 Ga0209025_1041117 3300025294 Bacteria 1986
196 Ga0209564_1029379 3300025295 Bacteria 1731
197 Ga0209758_1000065 3300025297 Bacteria 306288
198 Ga0209758_1000498 3300025297 Bacteria 64011
199 Ga0209758_1000560 3300025297 Bacteria 58586
200 Ga0209758_1014068 3300025297 Bacteria 4296
201 Ga0209758_1164100 3300025297 Bacteria 549
202 Ga0209050_1000173 3300025298 Bacteria 149800
203 Ga0209256_1011226 3300025299 Bacteria 3613
204 Ga0209256_1116341 3300025299 Bacteria 530
205 Ga0207426_1000721 3300025302 Bacteria 38161
206 Ga0207426_1000728 3300025302 Bacteria 37754
207 Ga0207426_1100856 3300025302 Bacteria 746
208 Ga0209051_1092645 3300025303 Bacteria 835
209 Ga0209257_1000196 3300025304 Bacteria 149656
210 Ga0209257_1001031 3300025304 Bacteria 37368
211 Ga0209257_1021240 3300025304 Bacteria 2367
212 Ga0209257_1035331 3300025304 Bacteria 1548
213 Ga0207697_10021892 3300025315 Bacteria 2619
214 Ga0207656_10729292 3300025321 Bacteria 508
215 Ga0207710_10121717 3300025900 Bacteria 1247
216 Ga0207710_10304419 3300025900 Bacteria 806
217 Ga0207688_11036869 3300025901 Bacteria 518
218 Ga0207680_10086878 3300025903 Bacteria 1979
219 Ga0207680_10324419 3300025903 Bacteria 1077
220 Ga0207647_10011713 3300025904 Bacteria 6138
221 Ga0207647_10334274 3300025904 Bacteria 859
222 Ga0207705_10027327 3300025909 Bacteria 4070
223 Ga0207705_10095723 3300025909 Bacteria 2179
224 Ga0207684_10340970 3300025910 Bacteria 1291
225 Ga0207654_10020949 3300025911 Bacteria 3472
226 Ga0207654_10050199 3300025911 Bacteria 2396
227 Ga0207654_10067495 3300025911 Bacteria 2113
228 Ga0207654_10361558 3300025911 Bacteria 1001
229 Ga0207707_10094516 3300025912 Bacteria 2612
230 Ga0207695_10000029 3300025913 Bacteria 548364
231 Ga0207695_10023959 3300025913 Bacteria 6884
232 Ga0207695_10393373 3300025913 Bacteria 1271
233 Ga0207671_10003068 3300025914 Bacteria 17080
234 Ga0207662_11022588 3300025918 Bacteria 587
235 Ga0207657_10135966 3300025919 Bacteria 2011
236 Ga0207657_11433002 3300025919 Bacteria 518
237 Ga0207649_10054356 3300025920 Bacteria 2492
238 Ga0207649_11134007 3300025920 Bacteria 617
239 Ga0207694_10308585 3300025924 Bacteria 1304
240 Ga0207694_10532211 3300025924 Bacteria 985
241 Ga0207694_10690806 3300025924 Bacteria 860
242 Ga0207650_10885012 3300025925 Bacteria 758
243 Ga0207659_10693112 3300025926 Bacteria 872
244 Ga0207687_10204343 3300025927 Bacteria 1546
245 Ga0207687_10514698 3300025927 Bacteria 1000
246 Ga0207644_10009377 3300025931 Bacteria 6429
247 Ga0207644_10303418 3300025931 Bacteria 1287
248 Ga0207644_10339800 3300025931 Bacteria 1217
249 Ga0207706_10180298 3300025933 Bacteria 1855
250 Ga0207706_11548871 3300025933 Bacteria 539
251 Ga0207709_10792011 3300025935 Bacteria 765
252 Ga0207665_10285229 3300025939 Bacteria 1230
253 Ga0207691_10316872 3300025940 Bacteria 1338
254 Ga0207711_10123427 3300025941 Bacteria 2314
255 Ga0207711_10176615 3300025941 Bacteria 1940
256 Ga0207711_10378230 3300025941 Bacteria 1314
257 Ga0207679_10265107 3300025945 Bacteria 1467
258 Ga0207679_12135175 3300025945 Bacteria 509
259 Ga0207667_10103609 3300025949 Bacteria 2935
260 Ga0207667_10825017 3300025949 Bacteria 923
261 Ga0207712_11450369 3300025961 Bacteria 614
262 Ga0207668_10257924 3300025972 Bacteria 1419
263 Ga0207668_10351653 3300025972 Bacteria 1232
264 Ga0207640_10530660 3300025981 Bacteria 985
265 Ga0207640_10784450 3300025981 Bacteria 824
266 Ga0207640_11341075 3300025981 Bacteria 640
267 Ga0207640_11513376 3300025981 Bacteria 603
268 Ga0207658_10068331 3300025986 Bacteria 2681
269 Ga0207658_10370661 3300025986 Bacteria 1252
270 Ga0207658_10520135 3300025986 Bacteria 1062
271 Ga0207658_10810689 3300025986 Bacteria 850
272 Ga0207658_11737019 3300025986 Bacteria 570
273 Ga0207703_10181815 3300026035 Bacteria 1856
274 Ga0207703_10729068 3300026035 Bacteria 944
275 Ga0207639_10304814 3300026041 Bacteria 1409
276 Ga0207639_11061557 3300026041 Bacteria 759
277 Ga0207639_11507003 3300026041 Bacteria 631
278 Ga0207639_11520168 3300026041 Bacteria 628
279 Ga0207678_10066105 3300026067 Bacteria 3105
280 Ga0207678_10707327 3300026067 Bacteria 887
281 Ga0207702_10207401 3300026078 Bacteria 1820
282 Ga0207702_10216281 3300026078 Bacteria 1784
283 Ga0207702_10276208 3300026078 Bacteria 1586
284 Ga0207641_10254720 3300026088 Bacteria 1641
285 Ga0207676_10053941 3300026095 Bacteria 3148
286 Ga0207674_10117439 3300026116 Bacteria 2631
287 Ga0207675_100544898 3300026118 Bacteria 1159
288 Ga0207683_10051407 3300026121 Bacteria 3610
289 Ga0207698_10086772 3300026142 Bacteria 2546
290 Ga0207698_11996904 3300026142 Bacteria 594
291 Ga0207698_12213536 3300026142 Bacteria 562
292 Ga0209389_1000011 3300027296 Bacteria 223265
293 Ga0209389_1000025 3300027296 Bacteria 149588
294 Ga0209589_1000066 3300027357 Bacteria 100795
295 Ga0209489_100017 3300027361 Bacteria 223265
296 Ga0209489_100030 3300027361 Bacteria 185999
297 Ga0209700_100027 3300027363 Bacteria 223462
298 Ga0209813_10018694 3300027866 Bacteria 1917
299 Ga0268266_10216436 3300028379 Bacteria 1759
300 Ga0268266_11181599 3300028379 Bacteria 740
301 Ga0268265_10648204 3300028380 Bacteria 1015
302 Ga0268264_10221943 3300028381 Bacteria 1740
303 Ga0268264_11730696 3300028381 Bacteria 635
304 Ga0307517_10031603 3300028786 Bacteria 6155
305 Ga0316177_1161710 3300030731 Bacteria 651
306 Ga0316177_1194283 3300030731 Bacteria 1655
307 Ga0316180_1185350 3300030736 Bacteria 2733
308 Ga0316181_1269212 3300030744 Bacteria 728
309 Ga0316182_1089562 3300030745 Bacteria 1211
310 Ga0307513_10003074 3300031456 Bacteria 22759
311 Ga0307508_10755496 3300031616 Bacteria 586
312 Ga0307516_10082010 3300031730 Bacteria 3067
313 Ga0307405_10782352 3300031731 Bacteria 798
314 Ga0307412_10286706 3300031911 Bacteria 1295
315 Ga0307412_10741324 3300031911 Bacteria 847
316 Ga0307412_11312568 3300031911 Bacteria 652
317 Ga0307416_100222438 3300032002 Bacteria 1812
318 Ga0307416_100718263 3300032002 Bacteria 1090
319 Ga0307416_102016514 3300032002 Bacteria 680
320 Ga0307416_102149545 3300032002 Bacteria 660
321 Ga0307416_102298020 3300032002 Bacteria 640
322 Ga0307414_10058278 3300032004 Bacteria 2720
323 Ga0307414_10356818 3300032004 Bacteria 1257
324 Ga0307414_11356899 3300032004 Bacteria 660
325 Ga0307411_10060445 3300032005 Bacteria 2517
326 Ga0307415_100308769 3300032126 Bacteria 1314
327 Ga0307415_100515087 3300032126 Bacteria 1049
328 Ga0307510_10018544 3300033180 Bacteria 8187
329 Ga0307510_10049877 3300033180 Bacteria 4448
330 Ga0307510_10156576 3300033180 Bacteria 1884
331 Ga0395905_0019296 3300037471 Bacteria 6464
332 Ga0395905_0583896 3300037471 Bacteria 1019
333 Ga0436364_0628597 3300037853 Bacteria 1050
334 Ga0436364_0758834 3300037853 Bacteria 595
335 Ga0395901_0112041 3300038443 Bacteria 2866
336 Ga0436365_0903985 3300039437 Bacteria 558
337 Ga0436365_1551576 3300039437 Bacteria 651
338 Ga0436361_0888239 3300039447 Bacteria 6345
339 Ga0439436_0000605 3300041404 Bacteria 9500
340 Ga0439438_124292 3300041405 Bacteria 620
341 Ga0439439_0006362 3300041406 Bacteria 2730
342 Ga0439465_0001602 3300041413 Bacteria 7363
343 Ga0439465_0022870 3300041413 Bacteria 1965
344 Ga0451791_0384925 3300041451 Bacteria 1350
345 Ga0451793_0966425 3300041452 Bacteria 638
346 Ga0451802_2124237 3300041460 Bacteria 910
347 Ga0451841_0728594 3300041498 Bacteria 575
348 Ga0451849_0710854 3300041505 Bacteria 631
349 Ga0451851_1128638 3300041507 Bacteria 514
350 Ga0451853_1629056 3300041512 Bacteria 690
351 Ga0439448_0027589 3300042005 Bacteria 1790
352 Ga0439449_0018394 3300042007 Bacteria 2623
353 Ga0439452_085394 3300042010 Bacteria 685
354 Ga0439455_0007379 3300042012 Bacteria 2322
355 Ga0439457_009322 3300042014 Bacteria 2289
356 Ga0450906_000256 3300042145 Bacteria 10256
357 Ga0450907_048480 3300042146 Bacteria 729
358 Ga0450910_010689 3300042147 Bacteria 1311
359 Ga0450909_032558 3300042185 Bacteria 792
360 Ga0439434_0140271 3300042435 Bacteria 796
361 Ga0450918_003752 3300042531 Bacteria 2804
362 Ga0466969_0014853 3300044656 Bacteria 4088
363 Ga0466972_0051607 3300044658 Bacteria 1983
364 Ga0466972_0421416 3300044658 Bacteria 626
365 Ga0466965_0047899 3300044683 Bacteria 2116
366 Ga0466966_0001348 3300044684 Bacteria 15776
367 Ga0466961_0000120 3300044693 Bacteria 52569
368 Ga0466961_0516478 3300044693 Bacteria 721
369 Ga0466963_0011705 3300044694 Bacteria 5348
370 Ga0466964_0122591 3300044706 Bacteria 1174
371 Ga0466964_0268634 3300044706 Bacteria 848
372 Ga0466964_0313606 3300044706 Bacteria 795
373 Ga0466968_0003277 3300044735 Bacteria 5966
374 Ga0466960_0018574 3300044901 Bacteria 3050
375 Ga0466960_0235957 3300044901 Bacteria 1011
376 Ga0466959_0108014 3300045049 Bacteria 1988
377 Ga0466959_0117008 3300045049 Bacteria 1898
378 Ga0466967_0041384 3300045976 Bacteria 3972
379 Ga0495629_0004834 3300046459 Bacteria 10101
380 Ga0495638_0004073 3300046460 Bacteria 11197
381 Ga0495651_0358019 3300046462 Bacteria 962
382 Ga0495650_0248396 3300046471 Bacteria 606
383 Ga0495580_0411540 3300046472 Bacteria 911
384 Ga0495605_0096450 3300046474 Bacteria 1364
385 Ga0495605_0167246 3300046474 Bacteria 973
386 Ga0495662_0177843 3300046476 Bacteria 1049
387 Ga0495664_0155960 3300046477 Bacteria 1385
388 Ga0495585_0204208 3300046492 Bacteria 1005
389 Ga0495596_0150544 3300046500 Bacteria 904
390 Ga0495607_0214652 3300046501 Bacteria 945
391 Ga0495583_0140772 3300046506 Bacteria 1004
392 Ga0495606_0014314 3300046507 Bacteria 6204
393 Ga0495606_0054446 3300046507 Bacteria 2591
394 Ga0495606_0113453 3300046507 Bacteria 1631
395 Ga0495606_0339592 3300046507 Bacteria 801
396 Ga0495610_0074032 3300046512 Bacteria 1581
397 Ga0495616_0071766 3300046513 Bacteria 1673
398 Ga0495616_0148793 3300046513 Bacteria 1061
399 Ga0495618_0089914 3300046514 Bacteria 1964
400 Ga0495628_0230964 3300046516 Bacteria 1387
401 Ga0495630_0732728 3300046517 Bacteria 756
402 Ga0495643_0076606 3300046522 Bacteria 1748
403 Ga0495648_0030954 3300046524 Bacteria 3531
404 Ga0495648_0040932 3300046524 Bacteria 2932
405 Ga0495648_0069995 3300046524 Bacteria 2040
406 Ga0495648_0135996 3300046524 Bacteria 1300
407 Ga0495666_0145146 3300046526 Bacteria 1105
408 Ga0495642_0016284 3300046528 Bacteria 2896
409 Ga0495652_0017641 3300046529 Bacteria 6370
410 Ga0495665_0499674 3300046531 Bacteria 613
411 Ga0495640_0280720 3300046533 Bacteria 1037
412 Ga0495597_0259918 3300046542 Bacteria 680
413 Ga0495622_0031173 3300046557 Bacteria 2492
414 Ga0495668_0014834 3300046616 Bacteria 4561
415 Ga0495668_0083471 3300046616 Bacteria 1752
416 Ga0495668_0110449 3300046616 Bacteria 1504
417 Ga0495634_0513388 3300046642 Bacteria 702
418 Ga0495611_0026685 3300046648 Bacteria 2521
419 Ga0495625_0005726 3300046660 Bacteria 11236
420 Ga0495625_0008262 3300046660 Bacteria 8898
421 Ga0495625_0282428 3300046660 Bacteria 1068
422 Ga0495625_0554945 3300046660 Bacteria 695
423 Ga0495625_0805503 3300046660 Bacteria 546
424 Ga0495635_0046740 3300046663 Bacteria 2985
425 Ga0495661_0234390 3300046665 Bacteria 945
426 Ga0495588_0202712 3300046674 Bacteria 1048
427 Ga0495588_0371934 3300046674 Bacteria 751
428 Ga0495657_0328671 3300046675 Bacteria 907
429 Ga0495646_0212150 3300046680 Bacteria 1050
430 Ga0495658_0123202 3300046683 Bacteria 1570
431 Ga0495669_0007293 3300046684 Bacteria 4632
432 Ga0495669_0376333 3300046684 Bacteria 687
433 Ga0495624_0061882 3300046690 Bacteria 2343
434 Ga0495670_0530829 3300046691 Bacteria 640
435 Ga0495671_0220428 3300046692 Bacteria 918
436 Ga0495649_0182836 3300046694 Bacteria 1093
437 Ga0495649_0260970 3300046694 Bacteria 888
438 Ga0495649_0367849 3300046694 Bacteria 725
439 Ga0495649_0460802 3300046694 Bacteria 634
440 Ga0495589_0124374 3300046794 Bacteria 1241
441 Ga0495600_0933889 3300046809 Bacteria 510
442 Ga0495604_0070415 3300047317 Bacteria 2648
443 Ga0495604_0172143 3300047317 Bacteria 1521
444 Ga0495672_0405426 3300047320 Bacteria 623
445 Ga0495683_0021360 3300047323 Bacteria 3336
446 Ga0495683_0281248 3300047323 Bacteria 720
447 Ga0495687_011038 3300047443 Bacteria 4891
448 Ga0495687_144991 3300047443 Bacteria 820
449 Ga0495677_0218506 3300047445 Bacteria 742
450 Ga0495673_0078367 3300047469 Bacteria 1374
451 Ga0495681_0122985 3300047470 Bacteria 1112
452 Ga0495686_0011106 3300047472 Bacteria 6362
453 Ga0495686_0017861 3300047472 Bacteria 4770
454 Ga0495686_0157905 3300047472 Bacteria 1327
455 Ga0495686_0269320 3300047472 Bacteria 951
456 Ga0495593_0114662 3300047673 Bacteria 1374
457 Ga0495602_0116479 3300048088 Bacteria 2159
458 Ga0495602_0239731 3300048088 Bacteria 1357
459 Ga0495614_0545223 3300048089 Bacteria 554
460 Ga0495626_0129938 3300048091 Bacteria 1076
461 Ga0496100_0225421 3300048903 Bacteria 1377
462 Ga0496100_1057565 3300048903 Bacteria 639
463 Ga0496101_0121402 3300048904 Bacteria 1976
464 Ga0496101_0341634 3300048904 Unclassified 1176
465 Ga0496101_0465456 3300048904 Bacteria 998
466 Ga0496102_0034116 3300048905 Bacteria 4576
467 Ga0496102_0209752 3300048905 Bacteria 1837
468 Ga0496102_0321878 3300048905 Bacteria 1457
469 Ga0496103_0002701 3300048906 Bacteria 11067
470 Ga0496104_0075514 3300048907 Bacteria 3209
471 Ga0496104_0453246 3300048907 Bacteria 1194
472 Ga0496104_0617030 3300048907 Bacteria 994
473 Ga0496104_1186332 3300048907 Bacteria 667
474 Ga0496105_0145330 3300048908 Bacteria 1950
475 Ga0496105_0544021 3300048908 Bacteria 907
476 Ga0496105_0743588 3300048908 Bacteria 750
477 Ga0496106_0197483 3300048909 Bacteria 1600
478 Ga0496107_0391746 3300048910 Bacteria 1033
479 Ga0496107_0425422 3300048910 Bacteria 987
480 Ga0496108_0083771 3300048911 Bacteria 2705
481 Ga0496108_0144795 3300048911 Bacteria 2048
482 Ga0496108_1301059 3300048911 Bacteria 611
483 Ga0496108_1644775 3300048911 Bacteria 530
484 Ga0496109_0020224 3300048912 Bacteria 5880
485 Ga0496109_0732158 3300048912 Bacteria 927
486 Ga0496110_0092863 3300048913 Bacteria 2701
487 Ga0496110_1293961 3300048913 Bacteria 638
488 Ga0496111_0215895 3300048914 Bacteria 1425
489 Ga0496112_0134434 3300048915 Bacteria 2443
490 Ga0496112_0156335 3300048915 Bacteria 2247
491 Ga0496112_0849698 3300048915 Bacteria 836
492 Ga0496112_1080722 3300048915 Bacteria 721
493 Ga0496113_0111091 3300048916 Bacteria 2134
494 Ga0496113_0156872 3300048916 Bacteria 1798
495 Ga0496113_0178795 3300048916 Bacteria 1682
496 Ga0496114_0422794 3300048917 Bacteria 1180
497 Ga0496114_0650782 3300048917 Bacteria 927
498 Ga0496114_0962835 3300048917 Bacteria 736
499 Ga0496115_0199085 3300048918 Bacteria 1655
500 Ga0496115_0226271 3300048918 Bacteria 1543
501 Ga0496116_0005222 3300048919 Bacteria 12153
502 Ga0496116_0112814 3300048919 Bacteria 1592
503 Ga0496117_0102014 3300048920 Unclassified 1812
504 Ga0496117_0320548 3300048920 Bacteria 812
505 Ga0496117_0345597 3300048920 Bacteria 770
506 Ga0496118_0018021 3300048921 Bacteria 6394
507 Ga0496118_0068786 3300048921 Bacteria 2569
508 Ga0496118_0079870 3300048921 Bacteria 2305
509 Ga0496118_0128153 3300048921 Bacteria 1636
510 Ga0496118_0297806 3300048921 Bacteria 887
511 Ga0496119_0011409 3300048922 Bacteria 7362
512 Ga0496119_0141423 3300048922 Bacteria 1299
513 Ga0496120_0194813 3300048923 Bacteria 985
514 Ga0496121_0029418 3300048924 Bacteria 5079
515 Ga0496121_0034794 3300048924 Bacteria 4527
516 Ga0496121_0074310 3300048924 Bacteria 2720
517 Ga0496121_0199386 3300048924 Bacteria 1428
518 Ga0496121_0267977 3300048924 Bacteria 1175
519 Ga0496121_0340794 3300048924 Bacteria 1002
520 Ga0496122_0036120 3300048925 Bacteria 4004
521 Ga0496122_0274083 3300048925 Bacteria 927
522 Ga0496122_0318389 3300048925 Bacteria 829
523 Ga0496123_0040182 3300048926 Bacteria 3262
524 Ga0496124_0000072 3300048927 Bacteria 219914
525 Ga0496124_0537839 3300048927 Bacteria 774
526 Ga0496125_0016125 3300048928 Bacteria 7189
527 Ga0496125_0069446 3300048928 Bacteria 2765
528 Ga0496125_0094222 3300048928 Bacteria 2232
529 Ga0496125_0185179 3300048928 Bacteria 1382
530 Ga0496125_0264126 3300048928 Bacteria 1077
531 Ga0496126_0048730 3300048929 Bacteria 3870
532 Ga0496126_0063564 3300048929 Bacteria 3309
533 Ga0496126_1015894 3300048929 Bacteria 621
534 Ga0495682_0051280 3300049460 Bacteria 1501
535 Ga0495682_0064472 3300049460 Bacteria 1321
536 Ga0501257_233758 3300049686 Bacteria 540
537 nmdc:mga03683_57034_c1 3300050489 Bacteria 1643
538 nmdc:mga00v17_114811_c1 3300050491 Bacteria 1711
539 nmdc:mga00v17_228874_c1 3300050491 Bacteria 1204
540 nmdc:mga00v17_908014_c1 3300050491 Bacteria 557
541 nmdc:mga0yw44_106066_c1 3300050492 Bacteria 1795
542 nmdc:mga0yw44_360835_c1 3300050492 Bacteria 979
543 nmdc:mga0yw44_585087_c1 3300050492 Bacteria 758
544 nmdc:mga0yw44_64951_c1 3300050492 Bacteria 2247
545 nmdc:mga0k408_232439_c1 3300050493 Bacteria 1100
546 nmdc:mga0k408_33345_c1 3300050493 Bacteria 2945
547 nmdc:mga06z11_472901_c1 3300050494 Bacteria 758
548 nmdc:mga06z11_572403_c1 3300050494 Bacteria 686
549 nmdc:mga06z11_73991_c1 3300050494 Bacteria 1810
550 nmdc:mga04h51_22238_c1 3300050495 Bacteria 1917
551 nmdc:mga07m45_149174_c1 3300050496 Bacteria 1356
552 nmdc:mga0sz30_116467_c1 3300050516 Bacteria 1173
553 nmdc:mga0sz30_169577_c1 3300050516 Bacteria 968
554 nmdc:mga0sz30_89222_c1 3300050516 Bacteria 1340
555 Ga0495601_0118402 3300053077 Bacteria 1719
556 Ga0495601_0659881 3300053077 Bacteria 669
557 Ga0500610_0270227 3300053079 Bacteria 770
558 Ga0500635_0151170 3300053080 Bacteria 886
559 Ga0495619_0088055 3300053085 Bacteria 2100
560 Ga0495619_0553196 3300053085 Bacteria 789
561 Ga0500578_0044563 3300053086 Bacteria 2847
562 Ga0500578_0172036 3300053086 Bacteria 1339
563 Ga0500643_010912 3300053087 Bacteria 3351
564 Ga0500646_0011329 3300053090 Bacteria 2293
565 Ga0500647_0004379 3300053091 Bacteria 5676
566 Ga0500647_0268564 3300053091 Bacteria 742
567 Ga0500583_0010304 3300053092 Bacteria 3462
568 Ga0500651_0245269 3300053093 Bacteria 1043
569 Ga0500651_0271807 3300053093 Bacteria 980
570 Ga0500651_0626987 3300053093 Bacteria 581
571 Ga0500566_0000537 3300053094 Bacteria 21255
572 Ga0500566_0469572 3300053094 Bacteria 547
573 Ga0500555_043595 3300053103 Bacteria 1243
574 Ga0500562_010786 3300053108 Bacteria 2318
575 Ga0500562_012893 3300053108 Bacteria 2128
576 Ga0500569_003017 3300053109 Bacteria 3384
577 Ga0500569_122683 3300053109 Bacteria 866
578 Ga0500594_0226498 3300053118 Bacteria 619
579 Ga0500595_020891 3300053119 Bacteria 2346
580 Ga0500597_290518 3300053120 Bacteria 656
581 Ga0500607_011476 3300053121 Bacteria 5240
582 Ga0500652_288713 3300053131 Bacteria 638
583 Ga0500655_002911 3300053133 Bacteria 3110
584 Ga0500655_020508 3300053133 Bacteria 1235
585 Ga0500655_022495 3300053133 Bacteria 1187
586 Ga0500559_0013563 3300053136 Bacteria 3449
587 Ga0500559_0172098 3300053136 Bacteria 1018
588 Ga0500559_0247820 3300053136 Bacteria 839
589 Ga0500568_0341257 3300053139 Bacteria 543
590 Ga0500577_0025487 3300053142 Bacteria 2002
591 Ga0500577_0066795 3300053142 Bacteria 1400
592 Ga0500577_0496991 3300053142 Bacteria 533
593 Ga0500588_0087037 3300053146 Bacteria 1056
594 Ga0500588_0255444 3300053146 Bacteria 659
595 Ga0500604_0008860 3300053151 Bacteria 2673
596 Ga0500616_0021935 3300053153 Bacteria 3571
597 Ga0500616_0109210 3300053153 Bacteria 1339
598 Ga0500619_023059 3300053154 Bacteria 1814
599 Ga0500622_0009099 3300053156 Bacteria 5515
600 Ga0500622_0284660 3300053156 Bacteria 711
601 Ga0500633_0013201 3300053160 Bacteria 2307
602 Ga0500636_0000076 3300053177 Bacteria 48321
603 Ga0500636_0050783 3300053177 Bacteria 2439
604 Ga0500636_0146857 3300053177 Bacteria 1299
605 Ga0500649_049044 3300053722 Bacteria 1776
606 Ga0500625_007870 3300053729 Bacteria 4661
607 Ga0500645_006515 3300053730 Bacteria 4153
608 Ga0500645_012980 3300053730 Bacteria 2683
609 Ga0500645_094686 3300053730 Bacteria 845
610 Ga0500645_143227 3300053730 Bacteria 661
611 Ga0500596_083865 3300053735 Bacteria 558
612 Ga0500599_000490 3300053736 Bacteria 4119
613 Ga0500601_000249 3300053737 Bacteria 10384
614 Ga0500661_013992 3300055283 Bacteria 1445

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015265 Ga0182005_1211335 Ga0182005_12113351 91
2 iso_pu_bacteria 8016613128 8016621579 91
3 3300025940 Ga0207691_10316872 Ga0207691_103168723 92
4 3300053735 Ga0500596_083865 Ga0500596_083865_230_541 92
5 3300005563 Ga0068855_101000110 Ga0068855_1010001102 94
6 iso_pu_bacteria 2513237159 2513998010 94
7 iso_pu_bacteria 2617270735 2617353083 94
8 iso_pu_bacteria 2643221618 2644103706 94
9 iso_pu_bacteria 2643221626 2644144585 94
10 iso_pu_bacteria 2643221655 2644306636 94
11 iso_pu_bacteria 2643221659 2644330826 94
12 iso_pu_bacteria 2643221698 2644542368 94
13 iso_pu_bacteria 2643221712 2644612247 94
14 iso_pu_bacteria 2643221736 2644747112 94
15 iso_pu_bacteria 2718218365 2721157539 94
16 iso_pu_bacteria 2728369397 2730297171 94
17 iso_pu_bacteria 2765235802 2765464044 94
18 iso_pu_bacteria 2838022645 2838027774 94
19 iso_pu_bacteria 2841760612 2841762242 94
20 iso_pu_bacteria 2842198810 2842203670 94
21 iso_pu_bacteria 2842521101 2842523115 94
22 iso_pu_bacteria 2844104063 2844109780 94
23 iso_pu_bacteria 2844163670 2844170018 94
24 iso_pu_bacteria 2851246043 2851248255 94
25 iso_pu_bacteria 2904578770 2904579310 94
26 iso_pu_bacteria 2919119836 2919121864 94
27 iso_pu_bacteria 2996310559 2996312992 94
28 iso_pu_bacteria 3002141150 3002142859 94
29 iso_pu_bacteria 8005301065 8005304196 94
30 iso_pu_bacteria 8005688590 8005690620 94
31 iso_pu_bacteria 8019648815 8019656473 94
32 iso_pu_bacteria 8024486573 8024490075 94
33 iso_pu_bacteria 8057529695 8057535647 94
34 3300053108 Ga0500562_010786 Ga0500562_010786_551_874 96
35 iso_pu_bacteria 2507262055 2507510023 96
36 iso_pu_bacteria 2508501009 2508544025 96
37 iso_pu_bacteria 2508501042 2508698041 96
38 iso_pu_bacteria 2511231028 2511397573 96
39 iso_pu_bacteria 2513237092 2513628184 96
40 iso_pu_bacteria 2513237094 2513643553 96
41 iso_pu_bacteria 2513237095 2513649011 96
42 iso_pu_bacteria 2513237102 2513702557 96
43 iso_pu_bacteria 2513237139 2513878127 96
44 iso_pu_bacteria 2513237161 2514012577 96
45 iso_pu_bacteria 2524023205 2524439049 96
46 iso_pu_bacteria 2528768022 2528849596 96
47 iso_pu_bacteria 2617270741 2617378946 96
48 iso_pu_bacteria 2744054633 2745078838 96
49 iso_pu_bacteria 2791355196 2793059998 96
50 iso_pu_bacteria 2802429603 2805920088 96
51 iso_pu_bacteria 2816332527 2818241585 96
52 iso_pu_bacteria 2824600985 2824605611 96
53 iso_pu_bacteria 2824609381 2824609861 96
54 iso_pu_bacteria 2824617872 2824625353 96
55 iso_pu_bacteria 2824626560 2824633840 96
56 iso_pu_bacteria 2824635225 2824641556 96
57 iso_pu_bacteria 2824644064 2824649785 96
58 iso_pu_bacteria 2824653114 2824655740 96
59 iso_pu_bacteria 2824661429 2824669449 96
60 iso_pu_bacteria 2824671348 2824674197 96
61 iso_pu_bacteria 2824679649 2824686181 96
62 iso_pu_bacteria 2824687955 2824693023 96
63 iso_pu_bacteria 2824696289 2824698906 96
64 iso_pu_bacteria 2824704595 2824711485 96
65 iso_pu_bacteria 2824714736 2824720962 96
66 iso_pu_bacteria 2824723954 2824729001 96
67 iso_pu_bacteria 2824732956 2824739207 96
68 iso_pu_bacteria 2824746037 2824752363 96
69 iso_pu_bacteria 2824753945 2824758036 96
70 iso_pu_bacteria 2824763712 2824766174 96
71 iso_pu_bacteria 2824773399 2824781057 96
72 iso_pu_bacteria 2838122688 2838127536 96
73 iso_pu_bacteria 2841941048 2841941511 96
74 iso_pu_bacteria 2841949485 2841952475 96
75 iso_pu_bacteria 2841966195 2841967654 96
76 iso_pu_bacteria 2841974524 2841982179 96
77 iso_pu_bacteria 2841983080 2841986497 96
78 iso_pu_bacteria 2842038055 2842038262 96
79 iso_pu_bacteria 2842045827 2842048793 96
80 iso_pu_bacteria 2847930680 2847934531 96
81 iso_pu_bacteria 2849076700 2849080681 96
82 iso_pu_bacteria 2857509624 2857509957 96
83 iso_pu_bacteria 2874590934 2874596769 96
84 iso_pu_bacteria 2874612657 2874618229 96
85 iso_pu_bacteria 2874620515 2874623218 96
86 iso_pu_bacteria 2874645413 2874653001 96
87 iso_pu_bacteria 2876761206 2876766686 96
88 iso_pu_bacteria 2876771140 2876776935 96
89 iso_pu_bacteria 2876818435 2876825315 96
90 iso_pu_bacteria 2879074833 2879081072 96
91 iso_pu_bacteria 2879083081 2879089722 96
92 iso_pu_bacteria 2879099564 2879107736 96
93 iso_pu_bacteria 2879127579 2879130810 96
94 iso_pu_bacteria 2879142872 2879147600 96
95 iso_pu_bacteria 2881364244 2881365669 96
96 iso_pu_bacteria 2881665667 2881671728 96
97 iso_pu_bacteria 2885366525 2885368940 96
98 iso_pu_bacteria 2885409591 2885414471 96
99 iso_pu_bacteria 2888378607 2888382468 96
100 iso_pu_bacteria 2888419890 2888423048 96
101 iso_pu_bacteria 2904666416 2904670038 96
102 iso_pu_bacteria 2904711408 2904718474 96
103 iso_pu_bacteria 2906643746 2906649925 96
104 iso_pu_bacteria 2908775508 2908778716 96
105 iso_pu_bacteria 2922368715 2922375498 96
106 iso_pu_bacteria 2922393267 2922394989 96
107 iso_pu_bacteria 2929615660 2929616233 96
108 iso_pu_bacteria 2929624759 2929624977 96
109 iso_pu_bacteria 2932784394 2932787100 96
110 iso_pu_bacteria 2932809354 2932811295 96
111 iso_pu_bacteria 2932818245 2932819832 96
112 iso_pu_bacteria 2932828146 2932832310 96
113 iso_pu_bacteria 2933577622 2933578483 96
114 iso_pu_bacteria 2935608549 2935611072 96
115 iso_pu_bacteria 2935616580 2935619020 96
116 iso_pu_bacteria 2935638405 2935643163 96
117 iso_pu_bacteria 2935648319 2935648509 96
118 iso_pu_bacteria 2935656913 2935657503 96
119 iso_pu_bacteria 2935665750 2935669789 96
120 iso_pu_bacteria 2935684952 2935693110 96
121 iso_pu_bacteria 2935694250 2935695399 96
122 iso_pu_bacteria 2935703347 2935709492 96
123 iso_pu_bacteria 2935713505 2935719718 96
124 iso_pu_bacteria 2935722832 2935729515 96
125 iso_pu_bacteria 2935732158 2935739601 96
126 iso_pu_bacteria 2935741537 2935748639 96
127 iso_pu_bacteria 2935750917 2935756774 96
128 iso_pu_bacteria 2935760218 2935761238 96
129 iso_pu_bacteria 2935769743 2935771487 96
130 iso_pu_bacteria 2935777560 2935779176 96
131 iso_pu_bacteria 2935785616 2935790855 96
132 iso_pu_bacteria 2935793552 2935799204 96
133 iso_pu_bacteria 2935801545 2935807307 96
134 iso_pu_bacteria 2935810662 2935812446 96
135 iso_pu_bacteria 2935819856 2935820557 96
136 iso_pu_bacteria 2935827899 2935832693 96
137 iso_pu_bacteria 2935837841 2935839228 96
138 iso_pu_bacteria 2935847175 2935849434 96
139 iso_pu_bacteria 2935855204 2935857385 96
140 iso_pu_bacteria 2935864058 2935864914 96
141 iso_pu_bacteria 2935873716 2935876692 96
142 iso_pu_bacteria 2935908558 2935911792 96
143 iso_pu_bacteria 2935916978 2935919447 96
144 iso_pu_bacteria 2935926038 2935928821 96
145 iso_pu_bacteria 2935934488 2935938466 96
146 iso_pu_bacteria 2935942939 2935945642 96
147 iso_pu_bacteria 2935951376 2935954751 96
148 iso_pu_bacteria 2935959822 2935963350 96
149 iso_pu_bacteria 2935967501 2935970638 96
150 iso_pu_bacteria 2935984226 2935987865 96
151 iso_pu_bacteria 2935992306 2935998957 96
152 iso_pu_bacteria 2936002035 2936008285 96
153 iso_pu_bacteria 2936011229 2936011419 96
154 iso_pu_bacteria 2936019824 2936020014 96
155 iso_pu_bacteria 2936028420 2936028610 96
156 iso_pu_bacteria 2936037263 2936039039 96
157 iso_pu_bacteria 2936046547 2936046737 96
158 iso_pu_bacteria 2936055302 2936058388 96
159 iso_pu_bacteria 2940556831 2940562688 96
160 iso_pu_bacteria 2941531003 2941536380 96
161 iso_pu_bacteria 2941538514 2941539918 96
162 iso_pu_bacteria 3005483717 3005487940 96
163 iso_pu_bacteria 3005506211 3005508738 96
164 iso_pu_bacteria 3005587118 3005589448 96
165 iso_pu_bacteria 3005594810 3005597476 96
166 iso_pu_bacteria 3005718088 3005720912 96
167 iso_pu_bacteria 8006926726 8006930237 96
168 iso_pu_bacteria 8016511872 8016515106 96
169 iso_pu_bacteria 8016522445 8016522895 96
170 iso_pu_bacteria 8016530956 8016536356 96
171 iso_pu_bacteria 8016539877 8016540632 96
172 iso_pu_bacteria 8016548790 8016552611 96
173 iso_pu_bacteria 8016557553 8016560990 96
174 iso_pu_bacteria 8016566248 8016574717 96
175 iso_pu_bacteria 8016575299 8016578792 96
176 iso_pu_bacteria 8016595262 8016598853 96
177 iso_pu_bacteria 8016603502 8016612224 96
178 iso_pu_bacteria 8016622563 8016628379 96
179 iso_pu_bacteria 8016630954 8016632577 96
180 iso_pu_bacteria 8017057580 8017061347 96
181 iso_pu_bacteria 8019530166 8019536076 96
182 iso_pu_bacteria 8019538911 8019543394 96
183 iso_pu_bacteria 8019547302 8019555460 96
184 iso_pu_bacteria 8019576017 8019580818 96
185 iso_pu_bacteria 8019586578 8019588555 96
186 iso_pu_bacteria 8019608314 8019615770 96
187 iso_pu_bacteria 8019678201 8019682756 96
188 iso_pu_bacteria 8019687851 8019688444 96
189 iso_pu_bacteria 8055742211 8055747880 96
190 iso_pu_bacteria 8056967851 8056969541 96
191 3300039447 Ga0436361_0888239 Ga0436361_0888239_2356_2682 97
192 3300003187 JGI25151J46595_10034751 JGI25151J46595_100347512 98
193 3300003784 Ga0055534_1027789 Ga0055534_10277892 98
194 3300003791 Ga0055530_10007145 Ga0055530_100071457 98
195 3300003794 Ga0055531_10010973 Ga0055531_100109733 98
196 3300005327 Ga0070658_10230315 Ga0070658_102303153 98
197 3300005331 Ga0070670_100449246 Ga0070670_1004492462 98
198 3300005339 Ga0070660_100535887 Ga0070660_1005358872 98
199 3300005355 Ga0070671_100095040 Ga0070671_1000950402 98
200 3300005355 Ga0070671_100212039 Ga0070671_1002120392 98
201 3300005367 Ga0070667_100300318 Ga0070667_1003003182 98
202 3300005456 Ga0070678_100102649 Ga0070678_1001026494 98
203 3300005457 Ga0070662_100048293 Ga0070662_1000482932 98
204 3300005458 Ga0070681_10082606 Ga0070681_100826063 98
205 3300005535 Ga0070684_101002342 Ga0070684_1010023422 98
206 3300005536 Ga0070697_100055346 Ga0070697_1000553464 98
207 3300005539 Ga0068853_100693682 Ga0068853_1006936822 98
208 3300005548 Ga0070665_100768901 Ga0070665_1007689012 98
209 3300005563 Ga0068855_100025743 Ga0068855_1000257435 98
210 3300005564 Ga0070664_100620956 Ga0070664_1006209562 98
211 3300005578 Ga0068854_100487372 Ga0068854_1004873723 98
212 3300005614 Ga0068856_100189953 Ga0068856_1001899533 98
213 3300005618 Ga0068864_100176401 Ga0068864_1001764012 98
214 3300005841 Ga0068863_100361821 Ga0068863_1003618213 98
215 3300005842 Ga0068858_100955076 Ga0068858_1009550762 98
216 3300005842 Ga0068858_101301050 Ga0068858_1013010502 98
217 3300005843 Ga0068860_100154260 Ga0068860_1001542602 98
218 3300005985 Ga0081539_10007629 Ga0081539_1000762916 98
219 3300005985 Ga0081539_10012883 Ga0081539_100128835 98
220 3300006038 Ga0075365_10075845 Ga0075365_100758454 98
221 3300006178 Ga0075367_10159833 Ga0075367_101598332 98
222 3300006186 Ga0075369_10038153 Ga0075369_100381531 98
223 3300006186 Ga0075369_10049252 Ga0075369_100492522 98
224 3300006195 Ga0075366_10906387 Ga0075366_109063871 98
225 3300006237 Ga0097621_100215853 Ga0097621_1002158533 98
226 3300007788 Ga0099795_10191363 Ga0099795_101913632 98
227 3300009093 Ga0105240_10002229 Ga0105240_1000222916 98
228 3300009093 Ga0105240_10082573 Ga0105240_100825733 98
229 3300009098 Ga0105245_11967275 Ga0105245_119672751 98
230 3300009177 Ga0105248_10033433 Ga0105248_100334332 98
231 3300009177 Ga0105248_11799650 Ga0105248_117996501 98
232 3300009545 Ga0105237_11240748 Ga0105237_112407482 98
233 3300009551 Ga0105238_10755742 Ga0105238_107557422 98
234 3300010159 Ga0099796_10466465 Ga0099796_104664651 98
235 3300010375 Ga0105239_10667163 Ga0105239_106671632 98
236 3300013104 Ga0157370_10115884 Ga0157370_101158843 98
237 3300013105 Ga0157369_10757107 Ga0157369_107571072 98
238 3300013297 Ga0157378_11211786 Ga0157378_112117862 98
239 3300013306 Ga0163162_11785283 Ga0163162_117852831 98
240 3300013308 Ga0157375_10278080 Ga0157375_102780802 98
241 3300014325 Ga0163163_10232514 Ga0163163_102325142 98
242 3300014968 Ga0157379_10386935 Ga0157379_103869351 98
243 3300014969 Ga0157376_10408002 Ga0157376_104080022 98
244 3300017792 Ga0163161_10584685 Ga0163161_105846852 98
245 3300025294 Ga0209025_1001616 Ga0209025_100161612 98
246 3300025294 Ga0209025_1041117 Ga0209025_10411173 98
247 3300025298 Ga0209050_1000173 Ga0209050_1000173132 98
248 3300025304 Ga0209257_1000196 Ga0209257_1000196132 98
249 3300025304 Ga0209257_1035331 Ga0209257_10353312 98
250 3300025903 Ga0207680_10086878 Ga0207680_100868781 98
251 3300025909 Ga0207705_10095723 Ga0207705_100957232 98
252 3300025910 Ga0207684_10340970 Ga0207684_103409701 98
253 3300025912 Ga0207707_10094516 Ga0207707_100945162 98
254 3300025913 Ga0207695_10023959 Ga0207695_100239596 98
255 3300025913 Ga0207695_10393373 Ga0207695_103933733 98
256 3300025924 Ga0207694_10308585 Ga0207694_103085851 98
257 3300025925 Ga0207650_10885012 Ga0207650_108850122 98
258 3300025931 Ga0207644_10303418 Ga0207644_103034182 98
259 3300025931 Ga0207644_10339800 Ga0207644_103398002 98
260 3300025933 Ga0207706_10180298 Ga0207706_101802982 98
261 3300025941 Ga0207711_10176615 Ga0207711_101766152 98
262 3300025945 Ga0207679_10265107 Ga0207679_102651072 98
263 3300025945 Ga0207679_12135175 Ga0207679_121351751 98
264 3300025949 Ga0207667_10103609 Ga0207667_101036095 98
265 3300025981 Ga0207640_10530660 Ga0207640_105306602 98
266 3300025986 Ga0207658_10370661 Ga0207658_103706612 98
267 3300025986 Ga0207658_10520135 Ga0207658_105201352 98
268 3300025986 Ga0207658_10810689 Ga0207658_108106892 98
269 3300026035 Ga0207703_10729068 Ga0207703_107290681 98
270 3300026078 Ga0207702_10216281 Ga0207702_102162813 98
271 3300026095 Ga0207676_10053941 Ga0207676_100539413 98
272 3300026121 Ga0207683_10051407 Ga0207683_100514073 98
273 3300028379 Ga0268266_10216436 Ga0268266_102164362 98
274 3300028381 Ga0268264_11730696 Ga0268264_117306961 98
275 3300028786 Ga0307517_10031603 Ga0307517_100316035 98
276 3300030731 Ga0316177_1161710 Ga0316177_11617102 98
277 3300030731 Ga0316177_1194283 Ga0316177_11942833 98
278 3300030736 Ga0316180_1185350 Ga0316180_11853506 98
279 3300030744 Ga0316181_1269212 Ga0316181_12692122 98
280 3300030745 Ga0316182_1089562 Ga0316182_10895622 98
281 3300031456 Ga0307513_10003074 Ga0307513_1000307421 98
282 3300031616 Ga0307508_10755496 Ga0307508_107554961 98
283 3300031730 Ga0307516_10082010 Ga0307516_100820103 98
284 3300031731 Ga0307405_10782352 Ga0307405_107823522 98
285 3300031911 Ga0307412_10286706 Ga0307412_102867062 98
286 3300031911 Ga0307412_10741324 Ga0307412_107413241 98
287 3300031911 Ga0307412_11312568 Ga0307412_113125681 98
288 3300032002 Ga0307416_100718263 Ga0307416_1007182631 98
289 3300032002 Ga0307416_102149545 Ga0307416_1021495452 98
290 3300032004 Ga0307414_10058278 Ga0307414_100582784 98
291 3300032004 Ga0307414_10356818 Ga0307414_103568182 98
292 3300032004 Ga0307414_11356899 Ga0307414_113568992 98
293 3300032005 Ga0307411_10060445 Ga0307411_100604453 98
294 3300033180 Ga0307510_10156576 Ga0307510_101565763 98
295 3300037471 Ga0395905_0583896 Ga0395905_0583896_186_515 98
296 3300041404 Ga0439436_0000605 Ga0439436_0000605_8902_9231 98
297 3300041405 Ga0439438_124292 Ga0439438_124292_243_572 98
298 3300041406 Ga0439439_0006362 Ga0439439_0006362_2247_2576 98
299 3300041413 Ga0439465_0001602 Ga0439465_0001602_401_730 98
300 3300041505 Ga0451849_0710854 Ga0451849_0710854_174_503 98
301 3300041507 Ga0451851_1128638 Ga0451851_1128638_42_371 98
302 3300041512 Ga0451853_1629056 Ga0451853_1629056_242_571 98
303 3300042005 Ga0439448_0027589 Ga0439448_0027589_1289_1618 98
304 3300042007 Ga0439449_0018394 Ga0439449_0018394_1301_1630 98
305 3300042010 Ga0439452_085394 Ga0439452_085394_58_387 98
306 3300042012 Ga0439455_0007379 Ga0439455_0007379_684_1013 98
307 3300042014 Ga0439457_009322 Ga0439457_009322_25_354 98
308 3300042145 Ga0450906_000256 Ga0450906_000256_6549_6878 98
309 3300042146 Ga0450907_048480 Ga0450907_048480_173_502 98
310 3300042147 Ga0450910_010689 Ga0450910_010689_76_405 98
311 3300042185 Ga0450909_032558 Ga0450909_032558_118_447 98
312 3300042435 Ga0439434_0140271 Ga0439434_0140271_130_459 98
313 3300042531 Ga0450918_003752 Ga0450918_003752_1112_1441 98
314 3300044658 Ga0466972_0421416 Ga0466972_0421416_229_558 98
315 3300045049 Ga0466959_0117008 Ga0466959_0117008_711_1040 98
316 3300046477 Ga0495664_0155960 Ga0495664_0155960_315_644 98
317 3300046506 Ga0495583_0140772 Ga0495583_0140772_130_459 98
318 3300046507 Ga0495606_0339592 Ga0495606_0339592_177_506 98
319 3300046524 Ga0495648_0040932 Ga0495648_0040932_415_744 98
320 3300046526 Ga0495666_0145146 Ga0495666_0145146_50_379 98
321 3300046528 Ga0495642_0016284 Ga0495642_0016284_258_587 98
322 3300046616 Ga0495668_0014834 Ga0495668_0014834_3300_3629 98
323 3300046648 Ga0495611_0026685 Ga0495611_0026685_1746_2075 98
324 3300046660 Ga0495625_0005726 Ga0495625_0005726_3276_3605 98
325 3300046660 Ga0495625_0008262 Ga0495625_0008262_3721_4050 98
326 3300046660 Ga0495625_0282428 Ga0495625_0282428_40_369 98
327 3300046660 Ga0495625_0805503 Ga0495625_0805503_103_432 98
328 3300046675 Ga0495657_0328671 Ga0495657_0328671_357_686 98
329 3300046683 Ga0495658_0123202 Ga0495658_0123202_404_733 98
330 3300046684 Ga0495669_0007293 Ga0495669_0007293_2488_2817 98
331 3300046684 Ga0495669_0376333 Ga0495669_0376333_122_451 98
332 3300046691 Ga0495670_0530829 Ga0495670_0530829_198_527 98
333 3300046809 Ga0495600_0933889 Ga0495600_0933889_151_480 98
334 3300047317 Ga0495604_0172143 Ga0495604_0172143_477_806 98
335 3300047445 Ga0495677_0218506 Ga0495677_0218506_327_656 98
336 3300047470 Ga0495681_0122985 Ga0495681_0122985_381_710 98
337 3300047472 Ga0495686_0011106 Ga0495686_0011106_2909_3247 98
338 3300047472 Ga0495686_0017861 Ga0495686_0017861_658_987 98
339 3300048088 Ga0495602_0116479 Ga0495602_0116479_294_623 98
340 3300048903 Ga0496100_1057565 Ga0496100_1057565_53_382 98
341 3300048904 Ga0496101_0341634 Ga0496101_0341634_401_730 98
342 3300048905 Ga0496102_0321878 Ga0496102_0321878_1085_1414 98
343 3300048907 Ga0496104_1186332 Ga0496104_1186332_208_537 98
344 3300048909 Ga0496106_0197483 Ga0496106_0197483_356_685 98
345 3300048910 Ga0496107_0425422 Ga0496107_0425422_486_815 98
346 3300048911 Ga0496108_1301059 Ga0496108_1301059_70_399 98
347 3300048912 Ga0496109_0020224 Ga0496109_0020224_4461_4790 98
348 3300048915 Ga0496112_0156335 Ga0496112_0156335_1145_1474 98
349 3300048915 Ga0496112_0849698 Ga0496112_0849698_85_414 98
350 3300048916 Ga0496113_0156872 Ga0496113_0156872_13_342 98
351 3300048918 Ga0496115_0199085 Ga0496115_0199085_940_1269 98
352 3300048919 Ga0496116_0005222 Ga0496116_0005222_11526_11855 98
353 3300048920 Ga0496117_0102014 Ga0496117_0102014_1329_1658 98
354 3300048921 Ga0496118_0079870 Ga0496118_0079870_994_1323 98
355 3300048924 Ga0496121_0199386 Ga0496121_0199386_739_1068 98
356 3300048924 Ga0496121_0340794 Ga0496121_0340794_20_349 98
357 3300048925 Ga0496122_0036120 Ga0496122_0036120_99_428 98
358 3300048925 Ga0496122_0274083 Ga0496122_0274083_588_917 98
359 3300048926 Ga0496123_0040182 Ga0496123_0040182_2630_2959 98
360 3300048927 Ga0496124_0000072 Ga0496124_0000072_47759_48088 98
361 3300048928 Ga0496125_0185179 Ga0496125_0185179_900_1229 98
362 3300048928 Ga0496125_0264126 Ga0496125_0264126_355_684 98
363 3300049686 Ga0501257_233758 Ga0501257_233758_181_510 98
364 3300050491 nmdc:mga00v17_908014_c1 nmdc:mga00v17_908014_c1_60_389 98
365 3300050492 nmdc:mga0yw44_106066_c1 nmdc:mga0yw44_106066_c1_115_444 98
366 3300050492 nmdc:mga0yw44_585087_c1 nmdc:mga0yw44_585087_c1_34_363 98
367 3300050492 nmdc:mga0yw44_64951_c1 nmdc:mga0yw44_64951_c1_1771_2100 98
368 3300050493 nmdc:mga0k408_232439_c1 nmdc:mga0k408_232439_c1_601_930 98
369 3300050494 nmdc:mga06z11_73991_c1 nmdc:mga06z11_73991_c1_142_471 98
370 3300050516 nmdc:mga0sz30_169577_c1 nmdc:mga0sz30_169577_c1_412_741 98
371 3300053077 Ga0495601_0118402 Ga0495601_0118402_1272_1601 98
372 3300053080 Ga0500635_0151170 Ga0500635_0151170_489_818 98
373 3300053085 Ga0495619_0553196 Ga0495619_0553196_192_521 98
374 3300053090 Ga0500646_0011329 Ga0500646_0011329_1505_1834 98
375 3300053091 Ga0500647_0004379 Ga0500647_0004379_415_744 98
376 3300053092 Ga0500583_0010304 Ga0500583_0010304_845_1174 98
377 3300053093 Ga0500651_0271807 Ga0500651_0271807_265_594 98
378 3300053103 Ga0500555_043595 Ga0500555_043595_332_661 98
379 3300053133 Ga0500655_002911 Ga0500655_002911_1177_1506 98
380 3300053133 Ga0500655_020508 Ga0500655_020508_399_743 98
381 3300053133 Ga0500655_022495 Ga0500655_022495_521_850 98
382 3300053136 Ga0500559_0247820 Ga0500559_0247820_222_551 98
383 3300053139 Ga0500568_0341257 Ga0500568_0341257_140_469 98
384 3300053142 Ga0500577_0496991 Ga0500577_0496991_34_363 98
385 3300053146 Ga0500588_0255444 Ga0500588_0255444_194_523 98
386 3300053151 Ga0500604_0008860 Ga0500604_0008860_644_973 98
387 3300053153 Ga0500616_0109210 Ga0500616_0109210_314_643 98
388 3300053156 Ga0500622_0284660 Ga0500622_0284660_79_411 98
389 3300053177 Ga0500636_0146857 Ga0500636_0146857_146_475 98
390 3300053730 Ga0500645_006515 Ga0500645_006515_396_725 98
391 3300053730 Ga0500645_012980 Ga0500645_012980_1769_2098 98
392 3300053730 Ga0500645_094686 Ga0500645_094686_338_667 98
393 iso_pu_bacteria 2513237104 2513720536 98
394 iso_pu_bacteria 2932794094 2932797327 98
395 iso_pu_bacteria 2932801729 2932804788 98
396 iso_pu_bacteria 2935675223 2935677071 98
397 3300003320 rootH2_10037340 rootH2_100373406 99
398 3300003323 rootH1_10023157 rootH1_100231577 99
399 3300025939 Ga0207665_10285229 Ga0207665_102852291 99
400 iso_pu_bacteria 2841957949 2841959496 99
401 iso_pu_bacteria 2847939898 2847945138 99
402 iso_pu_bacteria 2903727486 2903735421 99
403 iso_pu_bacteria 2906602504 2906608660 99
404 iso_pu_bacteria 3005710791 3005713506 99
405 3300001989 JGI24739J22299_10080875 JGI24739J22299_100808752 100
406 3300002067 JGI24735J21928_10182759 JGI24735J21928_101827591 100
407 3300003215 JGI25153J46596_10000920 JGI25153J46596_1000092019 100
408 3300003215 JGI25153J46596_10001125 JGI25153J46596_100011254 100
409 3300003215 JGI25153J46596_10002262 JGI25153J46596_1000226212 100
410 3300003215 JGI25153J46596_10056866 JGI25153J46596_100568662 100
411 3300003323 rootH1_10082836 rootH1_100828363 100
412 3300003354 JGI25160J50197_1000504 JGI25160J50197_100050416 100
413 3300003354 JGI25160J50197_1034350 JGI25160J50197_10343502 100
414 3300003762 Ga0055542_1021755 Ga0055542_10217551 100
415 3300003771 Ga0055526_1054742 Ga0055526_10547422 100
416 3300003794 Ga0055531_10004813 Ga0055531_100048132 100
417 3300003794 Ga0055531_10047828 Ga0055531_100478281 100
418 3300004625 Ga0055543_1029488 Ga0055543_10294881 100
419 3300005262 Ga0065165_1000278 Ga0065165_100027844 100
420 3300005262 Ga0065165_1002349 Ga0065165_100234919 100
421 3300005262 Ga0065165_1064628 Ga0065165_10646281 100
422 3300005327 Ga0070658_10426009 Ga0070658_104260093 100
423 3300005331 Ga0070670_101958049 Ga0070670_1019580491 100
424 3300005335 Ga0070666_10301582 Ga0070666_103015823 100
425 3300005337 Ga0070682_100834730 Ga0070682_1008347301 100
426 3300005338 Ga0068868_100260338 Ga0068868_1002603382 100
427 3300005339 Ga0070660_100090206 Ga0070660_1000902062 100
428 3300005343 Ga0070687_101467247 Ga0070687_1014672471 100
429 3300005344 Ga0070661_100223681 Ga0070661_1002236813 100
430 3300005347 Ga0070668_100026997 Ga0070668_1000269976 100
431 3300005347 Ga0070668_100164454 Ga0070668_1001644543 100
432 3300005347 Ga0070668_102051535 Ga0070668_1020515352 100
433 3300005355 Ga0070671_100034351 Ga0070671_1000343514 100
434 3300005364 Ga0070673_100549704 Ga0070673_1005497042 100
435 3300005366 Ga0070659_100125344 Ga0070659_1001253443 100
436 3300005455 Ga0070663_100167747 Ga0070663_1001677472 100
437 3300005455 Ga0070663_100279293 Ga0070663_1002792933 100
438 3300005455 Ga0070663_101287135 Ga0070663_1012871351 100
439 3300005457 Ga0070662_100131977 Ga0070662_1001319774 100
440 3300005530 Ga0070679_101237795 Ga0070679_1012377951 100
441 3300005535 Ga0070684_101256490 Ga0070684_1012564902 100
442 3300005539 Ga0068853_100670497 Ga0068853_1006704972 100
443 3300005546 Ga0070696_101527513 Ga0070696_1015275131 100
444 3300005548 Ga0070665_100834317 Ga0070665_1008343172 100
445 3300005563 Ga0068855_100150995 Ga0068855_1001509955 100
446 3300005564 Ga0070664_101418207 Ga0070664_1014182072 100
447 3300005577 Ga0068857_100285909 Ga0068857_1002859094 100
448 3300005578 Ga0068854_100322525 Ga0068854_1003225253 100
449 3300005578 Ga0068854_101792683 Ga0068854_1017926832 100
450 3300005614 Ga0068856_100429825 Ga0068856_1004298252 100
451 3300005614 Ga0068856_101187176 Ga0068856_1011871762 100
452 3300005616 Ga0068852_100030886 Ga0068852_1000308863 100
453 3300005616 Ga0068852_100304950 Ga0068852_1003049503 100
454 3300005616 Ga0068852_102094699 Ga0068852_1020946992 100
455 3300005617 Ga0068859_100500733 Ga0068859_1005007332 100
456 3300005719 Ga0068861_102300670 Ga0068861_1023006702 100
457 3300005834 Ga0068851_10190163 Ga0068851_101901632 100
458 3300005841 Ga0068863_101416724 Ga0068863_1014167242 100
459 3300005842 Ga0068858_100808582 Ga0068858_1008085822 100
460 3300005843 Ga0068860_100466678 Ga0068860_1004666782 100
461 3300005843 Ga0068860_100971742 Ga0068860_1009717421 100
462 3300005844 Ga0068862_100722053 Ga0068862_1007220532 100
463 3300005981 Ga0081538_10189026 Ga0081538_101890262 100
464 3300005983 Ga0081540_1109605 Ga0081540_11096052 100
465 3300006028 Ga0070717_11632077 Ga0070717_116320771 100
466 3300006038 Ga0075365_10039463 Ga0075365_100394632 100
467 3300006038 Ga0075365_10052571 Ga0075365_100525713 100
468 3300006038 Ga0075365_10632402 Ga0075365_106324021 100
469 3300006038 Ga0075365_10650661 Ga0075365_106506612 100
470 3300006042 Ga0075368_10007174 Ga0075368_100071744 100
471 3300006048 Ga0075363_100001650 Ga0075363_1000016508 100
472 3300006048 Ga0075363_100265970 Ga0075363_1002659703 100
473 3300006051 Ga0075364_10160045 Ga0075364_101600452 100
474 3300006177 Ga0075362_10056719 Ga0075362_100567194 100
475 3300006178 Ga0075367_10111355 Ga0075367_101113552 100
476 3300006178 Ga0075367_10116181 Ga0075367_101161811 100
477 3300006178 Ga0075367_10485205 Ga0075367_104852051 100
478 3300006186 Ga0075369_10019487 Ga0075369_100194873 100
479 3300006186 Ga0075369_10099972 Ga0075369_100999722 100
480 3300006195 Ga0075366_10249464 Ga0075366_102494642 100
481 3300006195 Ga0075366_10892764 Ga0075366_108927642 100
482 3300006353 Ga0075370_10051002 Ga0075370_100510022 100
483 3300006358 Ga0068871_102109783 Ga0068871_1021097831 100
484 3300006931 Ga0097620_100500698 Ga0097620_1005006982 100
485 3300006942 Ga0099824_1016622 Ga0099824_101662210 100
486 3300006944 Ga0099823_1027325 Ga0099823_10273256 100
487 3300009093 Ga0105240_12251048 Ga0105240_122510481 100
488 3300009098 Ga0105245_13090658 Ga0105245_130906581 100
489 3300009101 Ga0105247_10123462 Ga0105247_101234624 100
490 3300009148 Ga0105243_10048108 Ga0105243_100481083 100
491 3300009174 Ga0105241_10089422 Ga0105241_100894224 100
492 3300009174 Ga0105241_10128044 Ga0105241_101280444 100
493 3300009174 Ga0105241_10424439 Ga0105241_104244392 100
494 3300009176 Ga0105242_10440098 Ga0105242_104400983 100
495 3300009177 Ga0105248_10099852 Ga0105248_100998524 100
496 3300009177 Ga0105248_10943174 Ga0105248_109431741 100
497 3300009177 Ga0105248_13231138 Ga0105248_132311381 100
498 3300009545 Ga0105237_10035674 Ga0105237_100356746 100
499 3300009545 Ga0105237_10274451 Ga0105237_102744512 100
500 3300009551 Ga0105238_10820238 Ga0105238_108202382 100
501 3300009551 Ga0105238_11863117 Ga0105238_118631171 100
502 3300009551 Ga0105238_12227338 Ga0105238_122273381 100
503 3300009551 Ga0105238_12995031 Ga0105238_129950311 100
504 3300009553 Ga0105249_10310925 Ga0105249_103109252 100
505 3300010375 Ga0105239_10022884 Ga0105239_100228846 100
506 3300010375 Ga0105239_10238225 Ga0105239_102382253 100
507 3300010375 Ga0105239_10439169 Ga0105239_104391692 100
508 3300010375 Ga0105239_10626918 Ga0105239_106269181 100
509 3300010375 Ga0105239_11797712 Ga0105239_117977122 100
510 3300011119 Ga0105246_10041441 Ga0105246_100414414 100
511 3300013104 Ga0157370_11182077 Ga0157370_111820771 100
512 3300013105 Ga0157369_10707693 Ga0157369_107076931 100
513 3300013105 Ga0157369_10876278 Ga0157369_108762782 100
514 3300013296 Ga0157374_10368990 Ga0157374_103689903 100
515 3300013297 Ga0157378_11897925 Ga0157378_118979252 100
516 3300013307 Ga0157372_12503103 Ga0157372_125031031 100
517 3300013308 Ga0157375_10744496 Ga0157375_107444961 100
518 3300014325 Ga0163163_10138673 Ga0163163_101386731 100
519 3300014325 Ga0163163_10153121 Ga0163163_101531214 100
520 3300014497 Ga0182008_10290928 Ga0182008_102909282 100
521 3300014968 Ga0157379_11232481 Ga0157379_112324812 100
522 3300017792 Ga0163161_10656866 Ga0163161_106568662 100
523 3300021320 Ga0214544_1000020 Ga0214544_1000020168 100
524 3300021320 Ga0214544_1033003 Ga0214544_10330032 100
525 3300021320 Ga0214544_1037219 Ga0214544_10372192 100
526 3300021321 Ga0214542_1000024 Ga0214542_1000024179 100
527 3300021321 Ga0214542_1040209 Ga0214542_10402092 100
528 3300021324 Ga0214545_1000011 Ga0214545_1000011179 100
529 3300021327 Ga0214543_1000033 Ga0214543_100003325 100
530 3300021327 Ga0214543_1047985 Ga0214543_10479852 100
531 3300021384 Ga0213876_10717198 Ga0213876_107171981 100
532 3300025245 Ga0207425_1027894 Ga0207425_10278943 100
533 3300025253 Ga0209677_105274 Ga0209677_1052744 100
534 3300025254 Ga0209148_1000574 Ga0209148_100057418 100
535 3300025261 Ga0209233_1004212 Ga0209233_10042124 100
536 3300025261 Ga0209233_1010224 Ga0209233_10102242 100
537 3300025272 Ga0209455_1000834 Ga0209455_100083415 100
538 3300025272 Ga0209455_1050977 Ga0209455_10509771 100
539 3300025295 Ga0209564_1029379 Ga0209564_10293792 100
540 3300025297 Ga0209758_1000065 Ga0209758_100006525 100
541 3300025297 Ga0209758_1000498 Ga0209758_100049826 100
542 3300025297 Ga0209758_1000560 Ga0209758_100056015 100
543 3300025297 Ga0209758_1014068 Ga0209758_10140682 100
544 3300025297 Ga0209758_1164100 Ga0209758_11641001 100
545 3300025299 Ga0209256_1011226 Ga0209256_10112261 100
546 3300025299 Ga0209256_1116341 Ga0209256_11163412 100
547 3300025302 Ga0207426_1000721 Ga0207426_100072115 100
548 3300025302 Ga0207426_1000728 Ga0207426_100072823 100
549 3300025302 Ga0207426_1100856 Ga0207426_11008561 100
550 3300025303 Ga0209051_1092645 Ga0209051_10926452 100
551 3300025304 Ga0209257_1001031 Ga0209257_100103132 100
552 3300025304 Ga0209257_1021240 Ga0209257_10212404 100
553 3300025315 Ga0207697_10021892 Ga0207697_100218923 100
554 3300025321 Ga0207656_10729292 Ga0207656_107292922 100
555 3300025900 Ga0207710_10121717 Ga0207710_101217171 100
556 3300025900 Ga0207710_10304419 Ga0207710_103044191 100
557 3300025901 Ga0207688_11036869 Ga0207688_110368691 100
558 3300025903 Ga0207680_10324419 Ga0207680_103244191 100
559 3300025904 Ga0207647_10011713 Ga0207647_100117134 100
560 3300025904 Ga0207647_10334274 Ga0207647_103342741 100
561 3300025909 Ga0207705_10027327 Ga0207705_100273271 100
562 3300025911 Ga0207654_10020949 Ga0207654_100209495 100
563 3300025911 Ga0207654_10050199 Ga0207654_100501992 100
564 3300025911 Ga0207654_10067495 Ga0207654_100674952 100
565 3300025911 Ga0207654_10361558 Ga0207654_103615582 100
566 3300025913 Ga0207695_10000029 Ga0207695_1000002993 100
567 3300025914 Ga0207671_10003068 Ga0207671_100030684 100
568 3300025918 Ga0207662_11022588 Ga0207662_110225881 100
569 3300025919 Ga0207657_10135966 Ga0207657_101359661 100
570 3300025919 Ga0207657_11433002 Ga0207657_114330021 100
571 3300025920 Ga0207649_10054356 Ga0207649_100543564 100
572 3300025920 Ga0207649_11134007 Ga0207649_111340072 100
573 3300025924 Ga0207694_10532211 Ga0207694_105322113 100
574 3300025924 Ga0207694_10690806 Ga0207694_106908062 100
575 3300025926 Ga0207659_10693112 Ga0207659_106931121 100
576 3300025927 Ga0207687_10204343 Ga0207687_102043432 100
577 3300025927 Ga0207687_10514698 Ga0207687_105146982 100
578 3300025931 Ga0207644_10009377 Ga0207644_100093774 100
579 3300025933 Ga0207706_11548871 Ga0207706_115488712 100
580 3300025935 Ga0207709_10792011 Ga0207709_107920112 100
581 3300025941 Ga0207711_10123427 Ga0207711_101234274 100
582 3300025941 Ga0207711_10378230 Ga0207711_103782303 100
583 3300025949 Ga0207667_10825017 Ga0207667_108250172 100
584 3300025972 Ga0207668_10257924 Ga0207668_102579243 100
585 3300025972 Ga0207668_10351653 Ga0207668_103516532 100
586 3300025981 Ga0207640_10784450 Ga0207640_107844502 100
587 3300025981 Ga0207640_11341075 Ga0207640_113410751 100
588 3300025981 Ga0207640_11513376 Ga0207640_115133761 100
589 3300025986 Ga0207658_10068331 Ga0207658_100683312 100
590 3300025986 Ga0207658_11737019 Ga0207658_117370192 100
591 3300026035 Ga0207703_10181815 Ga0207703_101818152 100
592 3300026041 Ga0207639_10304814 Ga0207639_103048143 100
593 3300026041 Ga0207639_11061557 Ga0207639_110615572 100
594 3300026041 Ga0207639_11507003 Ga0207639_115070031 100
595 3300026041 Ga0207639_11520168 Ga0207639_115201681 100
596 3300026067 Ga0207678_10066105 Ga0207678_100661053 100
597 3300026067 Ga0207678_10707327 Ga0207678_107073271 100
598 3300026078 Ga0207702_10207401 Ga0207702_102074011 100
599 3300026078 Ga0207702_10276208 Ga0207702_102762081 100
600 3300026088 Ga0207641_10254720 Ga0207641_102547201 100
601 3300026116 Ga0207674_10117439 Ga0207674_101174394 100
602 3300026118 Ga0207675_100544898 Ga0207675_1005448981 100
603 3300026142 Ga0207698_10086772 Ga0207698_100867724 100
604 3300026142 Ga0207698_11996904 Ga0207698_119969041 100
605 3300026142 Ga0207698_12213536 Ga0207698_122135362 100
606 3300027296 Ga0209389_1000011 Ga0209389_100001138 100
607 3300027296 Ga0209389_1000025 Ga0209389_1000025100 100
608 3300027357 Ga0209589_1000066 Ga0209589_100006649 100
609 3300027361 Ga0209489_100017 Ga0209489_100017196 100
610 3300027361 Ga0209489_100030 Ga0209489_10003064 100
611 3300027363 Ga0209700_100027 Ga0209700_10002738 100
612 3300027866 Ga0209813_10018694 Ga0209813_100186944 100
613 3300028379 Ga0268266_11181599 Ga0268266_111815992 100
614 3300028380 Ga0268265_10648204 Ga0268265_106482043 100
615 3300028381 Ga0268264_10221943 Ga0268264_102219433 100
616 3300032002 Ga0307416_100222438 Ga0307416_1002224383 100
617 3300032002 Ga0307416_102016514 Ga0307416_1020165142 100
618 3300032002 Ga0307416_102298020 Ga0307416_1022980202 100
619 3300032126 Ga0307415_100308769 Ga0307415_1003087692 100
620 3300032126 Ga0307415_100515087 Ga0307415_1005150872 100
621 3300033180 Ga0307510_10018544 Ga0307510_100185446 100
622 3300033180 Ga0307510_10049877 Ga0307510_100498775 100
623 3300037471 Ga0395905_0019296 Ga0395905_0019296_4137_4472 100
624 3300037853 Ga0436364_0628597 Ga0436364_0628597_121_456 100
625 3300037853 Ga0436364_0758834 Ga0436364_0758834_148_483 100
626 3300038443 Ga0395901_0112041 Ga0395901_0112041_1565_1900 100
627 3300039437 Ga0436365_0903985 Ga0436365_0903985_81_416 100
628 3300039437 Ga0436365_1551576 Ga0436365_1551576_27_362 100
629 3300041413 Ga0439465_0022870 Ga0439465_0022870_186_539 100
630 3300041451 Ga0451791_0384925 Ga0451791_0384925_427_762 100
631 3300041452 Ga0451793_0966425 Ga0451793_0966425_31_366 100
632 3300041460 Ga0451802_2124237 Ga0451802_2124237_396_731 100
633 3300041498 Ga0451841_0728594 Ga0451841_0728594_205_540 100
634 3300044656 Ga0466969_0014853 Ga0466969_0014853_2658_2993 100
635 3300044658 Ga0466972_0051607 Ga0466972_0051607_129_464 100
636 3300044683 Ga0466965_0047899 Ga0466965_0047899_913_1248 100
637 3300044684 Ga0466966_0001348 Ga0466966_0001348_11035_11370 100
638 3300044693 Ga0466961_0000120 Ga0466961_0000120_39742_40077 100
639 3300044693 Ga0466961_0516478 Ga0466961_0516478_274_609 100
640 3300044694 Ga0466963_0011705 Ga0466963_0011705_3414_3749 100
641 3300044706 Ga0466964_0122591 Ga0466964_0122591_631_966 100
642 3300044706 Ga0466964_0268634 Ga0466964_0268634_56_391 100
643 3300044706 Ga0466964_0313606 Ga0466964_0313606_331_666 100
644 3300044735 Ga0466968_0003277 Ga0466968_0003277_525_860 100
645 3300044901 Ga0466960_0018574 Ga0466960_0018574_375_710 100
646 3300044901 Ga0466960_0235957 Ga0466960_0235957_102_437 100
647 3300045049 Ga0466959_0108014 Ga0466959_0108014_960_1295 100
648 3300045976 Ga0466967_0041384 Ga0466967_0041384_3552_3887 100
649 3300046459 Ga0495629_0004834 Ga0495629_0004834_9363_9698 100
650 3300046460 Ga0495638_0004073 Ga0495638_0004073_9510_9845 100
651 3300046462 Ga0495651_0358019 Ga0495651_0358019_56_391 100
652 3300046471 Ga0495650_0248396 Ga0495650_0248396_70_405 100
653 3300046472 Ga0495580_0411540 Ga0495580_0411540_108_443 100
654 3300046474 Ga0495605_0096450 Ga0495605_0096450_55_390 100
655 3300046474 Ga0495605_0167246 Ga0495605_0167246_112_447 100
656 3300046476 Ga0495662_0177843 Ga0495662_0177843_287_622 100
657 3300046492 Ga0495585_0204208 Ga0495585_0204208_625_960 100
658 3300046500 Ga0495596_0150544 Ga0495596_0150544_508_843 100
659 3300046501 Ga0495607_0214652 Ga0495607_0214652_253_588 100
660 3300046507 Ga0495606_0014314 Ga0495606_0014314_5432_5767 100
661 3300046507 Ga0495606_0054446 Ga0495606_0054446_1823_2158 100
662 3300046507 Ga0495606_0113453 Ga0495606_0113453_471_806 100
663 3300046512 Ga0495610_0074032 Ga0495610_0074032_621_956 100
664 3300046513 Ga0495616_0071766 Ga0495616_0071766_675_1010 100
665 3300046513 Ga0495616_0148793 Ga0495616_0148793_232_567 100
666 3300046514 Ga0495618_0089914 Ga0495618_0089914_1352_1687 100
667 3300046516 Ga0495628_0230964 Ga0495628_0230964_339_674 100
668 3300046517 Ga0495630_0732728 Ga0495630_0732728_58_393 100
669 3300046522 Ga0495643_0076606 Ga0495643_0076606_1052_1387 100
670 3300046524 Ga0495648_0030954 Ga0495648_0030954_498_833 100
671 3300046524 Ga0495648_0069995 Ga0495648_0069995_1402_1737 100
672 3300046524 Ga0495648_0135996 Ga0495648_0135996_894_1229 100
673 3300046529 Ga0495652_0017641 Ga0495652_0017641_5196_5531 100
674 3300046531 Ga0495665_0499674 Ga0495665_0499674_54_389 100
675 3300046533 Ga0495640_0280720 Ga0495640_0280720_492_827 100
676 3300046542 Ga0495597_0259918 Ga0495597_0259918_52_387 100
677 3300046557 Ga0495622_0031173 Ga0495622_0031173_1400_1735 100
678 3300046616 Ga0495668_0083471 Ga0495668_0083471_986_1321 100
679 3300046616 Ga0495668_0110449 Ga0495668_0110449_211_546 100
680 3300046642 Ga0495634_0513388 Ga0495634_0513388_286_621 100
681 3300046660 Ga0495625_0554945 Ga0495625_0554945_91_426 100
682 3300046663 Ga0495635_0046740 Ga0495635_0046740_191_526 100
683 3300046665 Ga0495661_0234390 Ga0495661_0234390_594_929 100
684 3300046674 Ga0495588_0202712 Ga0495588_0202712_273_608 100
685 3300046674 Ga0495588_0371934 Ga0495588_0371934_376_711 100
686 3300046680 Ga0495646_0212150 Ga0495646_0212150_489_824 100
687 3300046690 Ga0495624_0061882 Ga0495624_0061882_725_1060 100
688 3300046692 Ga0495671_0220428 Ga0495671_0220428_413_748 100
689 3300046694 Ga0495649_0182836 Ga0495649_0182836_86_421 100
690 3300046694 Ga0495649_0260970 Ga0495649_0260970_200_535 100
691 3300046694 Ga0495649_0367849 Ga0495649_0367849_338_673 100
692 3300046694 Ga0495649_0460802 Ga0495649_0460802_242_577 100
693 3300046794 Ga0495589_0124374 Ga0495589_0124374_896_1231 100
694 3300047317 Ga0495604_0070415 Ga0495604_0070415_78_413 100
695 3300047320 Ga0495672_0405426 Ga0495672_0405426_116_451 100
696 3300047323 Ga0495683_0021360 Ga0495683_0021360_1007_1342 100
697 3300047323 Ga0495683_0281248 Ga0495683_0281248_287_622 100
698 3300047443 Ga0495687_011038 Ga0495687_011038_2397_2732 100
699 3300047443 Ga0495687_144991 Ga0495687_144991_469_804 100
700 3300047469 Ga0495673_0078367 Ga0495673_0078367_455_790 100
701 3300047472 Ga0495686_0157905 Ga0495686_0157905_447_782 100
702 3300047472 Ga0495686_0269320 Ga0495686_0269320_50_385 100
703 3300047673 Ga0495593_0114662 Ga0495593_0114662_275_610 100
704 3300048088 Ga0495602_0239731 Ga0495602_0239731_994_1329 100
705 3300048089 Ga0495614_0545223 Ga0495614_0545223_65_400 100
706 3300048091 Ga0495626_0129938 Ga0495626_0129938_664_999 100
707 3300048903 Ga0496100_0225421 Ga0496100_0225421_472_807 100
708 3300048904 Ga0496101_0121402 Ga0496101_0121402_785_1120 100
709 3300048904 Ga0496101_0465456 Ga0496101_0465456_653_988 100
710 3300048905 Ga0496102_0034116 Ga0496102_0034116_2774_3109 100
711 3300048905 Ga0496102_0209752 Ga0496102_0209752_1452_1787 100
712 3300048906 Ga0496103_0002701 Ga0496103_0002701_1545_1880 100
713 3300048907 Ga0496104_0075514 Ga0496104_0075514_2344_2679 100
714 3300048907 Ga0496104_0453246 Ga0496104_0453246_68_403 100
715 3300048907 Ga0496104_0617030 Ga0496104_0617030_620_955 100
716 3300048908 Ga0496105_0145330 Ga0496105_0145330_1589_1924 100
717 3300048908 Ga0496105_0544021 Ga0496105_0544021_394_729 100
718 3300048908 Ga0496105_0743588 Ga0496105_0743588_123_458 100
719 3300048910 Ga0496107_0391746 Ga0496107_0391746_276_611 100
720 3300048911 Ga0496108_0083771 Ga0496108_0083771_1708_2043 100
721 3300048911 Ga0496108_0144795 Ga0496108_0144795_91_426 100
722 3300048911 Ga0496108_1644775 Ga0496108_1644775_14_349 100
723 3300048912 Ga0496109_0732158 Ga0496109_0732158_513_848 100
724 3300048913 Ga0496110_0092863 Ga0496110_0092863_1023_1358 100
725 3300048913 Ga0496110_1293961 Ga0496110_1293961_83_418 100
726 3300048914 Ga0496111_0215895 Ga0496111_0215895_972_1307 100
727 3300048915 Ga0496112_0134434 Ga0496112_0134434_713_1048 100
728 3300048915 Ga0496112_1080722 Ga0496112_1080722_300_635 100
729 3300048916 Ga0496113_0111091 Ga0496113_0111091_253_588 100
730 3300048916 Ga0496113_0178795 Ga0496113_0178795_533_868 100
731 3300048917 Ga0496114_0422794 Ga0496114_0422794_291_626 100
732 3300048917 Ga0496114_0650782 Ga0496114_0650782_527_862 100
733 3300048917 Ga0496114_0962835 Ga0496114_0962835_288_623 100
734 3300048918 Ga0496115_0226271 Ga0496115_0226271_338_673 100
735 3300048919 Ga0496116_0112814 Ga0496116_0112814_799_1134 100
736 3300048920 Ga0496117_0320548 Ga0496117_0320548_409_744 100
737 3300048920 Ga0496117_0345597 Ga0496117_0345597_254_589 100
738 3300048921 Ga0496118_0018021 Ga0496118_0018021_3837_4172 100
739 3300048921 Ga0496118_0068786 Ga0496118_0068786_916_1251 100
740 3300048921 Ga0496118_0128153 Ga0496118_0128153_77_412 100
741 3300048921 Ga0496118_0297806 Ga0496118_0297806_507_842 100
742 3300048922 Ga0496119_0011409 Ga0496119_0011409_404_739 100
743 3300048922 Ga0496119_0141423 Ga0496119_0141423_342_677 100
744 3300048923 Ga0496120_0194813 Ga0496120_0194813_382_717 100
745 3300048924 Ga0496121_0029418 Ga0496121_0029418_4585_4920 100
746 3300048924 Ga0496121_0034794 Ga0496121_0034794_557_892 100
747 3300048924 Ga0496121_0074310 Ga0496121_0074310_396_731 100
748 3300048924 Ga0496121_0267977 Ga0496121_0267977_112_447 100
749 3300048925 Ga0496122_0318389 Ga0496122_0318389_310_645 100
750 3300048927 Ga0496124_0537839 Ga0496124_0537839_366_701 100
751 3300048928 Ga0496125_0016125 Ga0496125_0016125_6388_6723 100
752 3300048928 Ga0496125_0069446 Ga0496125_0069446_1856_2191 100
753 3300048928 Ga0496125_0094222 Ga0496125_0094222_727_1062 100
754 3300048929 Ga0496126_0048730 Ga0496126_0048730_1667_2002 100
755 3300048929 Ga0496126_0063564 Ga0496126_0063564_1824_2159 100
756 3300048929 Ga0496126_1015894 Ga0496126_1015894_168_503 100
757 3300049460 Ga0495682_0051280 Ga0495682_0051280_1130_1465 100
758 3300049460 Ga0495682_0064472 Ga0495682_0064472_15_350 100
759 3300050489 nmdc:mga03683_57034_c1 nmdc:mga03683_57034_c1_346_681 100
760 3300050491 nmdc:mga00v17_114811_c1 nmdc:mga00v17_114811_c1_374_709 100
761 3300050491 nmdc:mga00v17_228874_c1 nmdc:mga00v17_228874_c1_843_1178 100
762 3300050492 nmdc:mga0yw44_360835_c1 nmdc:mga0yw44_360835_c1_352_687 100
763 3300050493 nmdc:mga0k408_33345_c1 nmdc:mga0k408_33345_c1_450_785 100
764 3300050494 nmdc:mga06z11_472901_c1 nmdc:mga06z11_472901_c1_408_743 100
765 3300050494 nmdc:mga06z11_572403_c1 nmdc:mga06z11_572403_c1_279_614 100
766 3300050495 nmdc:mga04h51_22238_c1 nmdc:mga04h51_22238_c1_1384_1719 100
767 3300050496 nmdc:mga07m45_149174_c1 nmdc:mga07m45_149174_c1_911_1246 100
768 3300050516 nmdc:mga0sz30_116467_c1 nmdc:mga0sz30_116467_c1_688_1023 100
769 3300050516 nmdc:mga0sz30_89222_c1 nmdc:mga0sz30_89222_c1_787_1122 100
770 3300053077 Ga0495601_0659881 Ga0495601_0659881_105_440 100
771 3300053079 Ga0500610_0270227 Ga0500610_0270227_202_537 100
772 3300053085 Ga0495619_0088055 Ga0495619_0088055_397_732 100
773 3300053086 Ga0500578_0044563 Ga0500578_0044563_1502_1837 100
774 3300053086 Ga0500578_0172036 Ga0500578_0172036_611_946 100
775 3300053087 Ga0500643_010912 Ga0500643_010912_2166_2525 100
776 3300053091 Ga0500647_0268564 Ga0500647_0268564_155_490 100
777 3300053093 Ga0500651_0245269 Ga0500651_0245269_312_647 100
778 3300053093 Ga0500651_0626987 Ga0500651_0626987_145_480 100
779 3300053094 Ga0500566_0000537 Ga0500566_0000537_9226_9561 100
780 3300053094 Ga0500566_0469572 Ga0500566_0469572_153_488 100
781 3300053108 Ga0500562_012893 Ga0500562_012893_1322_1657 100
782 3300053109 Ga0500569_003017 Ga0500569_003017_1369_1704 100
783 3300053109 Ga0500569_122683 Ga0500569_122683_313_648 100
784 3300053118 Ga0500594_0226498 Ga0500594_0226498_175_510 100
785 3300053119 Ga0500595_020891 Ga0500595_020891_161_496 100
786 3300053120 Ga0500597_290518 Ga0500597_290518_228_563 100
787 3300053121 Ga0500607_011476 Ga0500607_011476_1794_2129 100
788 3300053131 Ga0500652_288713 Ga0500652_288713_225_560 100
789 3300053136 Ga0500559_0013563 Ga0500559_0013563_862_1197 100
790 3300053136 Ga0500559_0172098 Ga0500559_0172098_581_916 100
791 3300053142 Ga0500577_0025487 Ga0500577_0025487_1247_1582 100
792 3300053142 Ga0500577_0066795 Ga0500577_0066795_798_1133 100
793 3300053146 Ga0500588_0087037 Ga0500588_0087037_98_433 100
794 3300053153 Ga0500616_0021935 Ga0500616_0021935_182_517 100
795 3300053154 Ga0500619_023059 Ga0500619_023059_1390_1725 100
796 3300053156 Ga0500622_0009099 Ga0500622_0009099_44_379 100
797 3300053160 Ga0500633_0013201 Ga0500633_0013201_1625_1960 100
798 3300053177 Ga0500636_0000076 Ga0500636_0000076_35404_35739 100
799 3300053177 Ga0500636_0050783 Ga0500636_0050783_202_537 100
800 3300053722 Ga0500649_049044 Ga0500649_049044_186_521 100
801 3300053729 Ga0500625_007870 Ga0500625_007870_993_1328 100
802 3300053730 Ga0500645_143227 Ga0500645_143227_211_546 100
803 3300053736 Ga0500599_000490 Ga0500599_000490_1651_1986 100
804 3300053737 Ga0500601_000249 Ga0500601_000249_9850_10185 100
805 3300055283 Ga0500661_013992 Ga0500661_013992_992_1327 100
806 3300009553 Ga0105249_12087974 Ga0105249_120879741 101
807 3300025961 Ga0207712_11450369 Ga0207712_114503692 101
808 2010549000 RicEn_C9286 RicEn_162720 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

17

67

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

19

66

0.93

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

19

65

0.92

PF12802

MarR_2

MarR family

19

72

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9323 21 76
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.9236 18 76
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.913 19 77
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9073 21 77
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9032 7 76
ID Description Score Start End Superfamily
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9402 16 78 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9323 21 76 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9266 18 77 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9228 18 75 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 35 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9PWD2-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.966 7 78 GO:0003700
GO:0016020
AF-A0A530QKL1-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9603 7 76 GO:0003700
AF-A0A1G2IGX9-F1-model_v4 HTH arsR-type domain-containing protein 0.96 6 77 GO:0003700
AF-A0A0G2AN63-F1-model_v4 Transcriptional regulator, ArsR family 0.9464 7 77 GO:0003700
AF-E4KMI1-F1-model_v4 Transcriptional regulator, ArsR family 0.9384 8 77 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
78.99 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map