F481716
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 808 | 541 | 614 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_12087974|Ga0105249_120879741 |
| Length | 125 |
| Sequence | MMQTIEAAVVSTVLRTLADPTRRAVFERIATSDEITVAELTRGSGVTQGAISQHLKSLKQAGLVTERPAGRNVYYRAQPEGLAPLRDWLSFYERFWTSRLDVLEQLLRKEDERHSSAPPKKGDDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 15 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 16 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 17 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 18 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 19 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 20 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 21 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 22 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 23 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 24 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 25 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 26 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 27 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 28 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 29 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 38 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 41 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 42 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 43 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 44 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 45 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 46 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 47 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 48 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 49 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 50 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 51 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 52 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 53 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 54 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 55 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 56 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 57 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 58 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 59 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 60 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 61 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 62 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 63 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 64 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 65 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 66 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 71 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 72 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 76 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 77 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 78 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 79 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 80 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 81 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 82 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 83 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 84 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 85 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 86 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 87 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 90 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 91 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 92 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 93 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 94 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 95 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 96 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 97 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 98 | 2922368715 | |||
| 99 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 100 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 101 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 102 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 103 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 104 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 105 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 106 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 107 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 108 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 109 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 110 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 111 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 112 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 113 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 114 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 115 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 116 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 117 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 118 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 119 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 120 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 121 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 122 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 123 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 124 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 125 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 126 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 127 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 128 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 129 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 130 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 131 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 132 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 133 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 134 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 135 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 136 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 137 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 138 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 139 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 140 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 141 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 142 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 143 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 144 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 145 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 146 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 147 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 148 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 149 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 150 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 151 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 152 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 153 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 154 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 155 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 156 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 157 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 158 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 159 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 160 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 161 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 162 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 163 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 164 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 165 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 166 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 167 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 168 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 169 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 170 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 171 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 172 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 173 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 174 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 175 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 176 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 177 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 178 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 179 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 180 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 184 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 185 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 187 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 197 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 199 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 201 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 204 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 206 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 207 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 208 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 209 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 210 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 211 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 212 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 213 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 214 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 215 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 216 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 217 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 218 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 219 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 220 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 222 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 223 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 224 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 225 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 226 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 227 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 228 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 229 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 231 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 232 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 234 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 235 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 236 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 247 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 249 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 258 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 261 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 263 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 264 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 265 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 266 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 267 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 268 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 271 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 322 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 323 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 324 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 325 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 330 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 331 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 332 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 333 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 334 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 335 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 336 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 337 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 338 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 339 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 340 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 341 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 342 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 343 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 344 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 345 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 346 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 347 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 348 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 349 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 350 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 351 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 352 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 353 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 357 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 358 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 359 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 360 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 361 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 362 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 363 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 364 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 365 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 366 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 367 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 368 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 369 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 370 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 371 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 372 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 373 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 374 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 375 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 376 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 377 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 378 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 379 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 380 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 381 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 382 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 441 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 442 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 443 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 444 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 445 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 446 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 449 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 450 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 451 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 452 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 453 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 454 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 455 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 456 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 457 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 458 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 463 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 464 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 465 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 467 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 471 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 472 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 473 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 474 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 477 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 478 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 481 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 482 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 483 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 484 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 485 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 486 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 487 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 488 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 489 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 490 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 492 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 493 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 494 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 495 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 503 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 504 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 507 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 508 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 509 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 510 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 511 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 512 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 513 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 514 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 515 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 516 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 517 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 518 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 519 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 520 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 521 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 522 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 523 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 524 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 525 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 526 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 527 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 528 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 529 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 530 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 531 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 532 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 533 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 534 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 535 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 536 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 537 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 538 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 539 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 540 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 541 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.08 |
| Metatranscriptomes | 0 |
| Isolates | 23.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.57 |
| Nodule | 18.81 |
| Rhizoplane | 5.45 |
| Rhizosphere | 44.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C9286 | 2010549000 | Bacteria | 1292 |
| 2 | JGI24739J22299_10080875 | 3300001989 | Bacteria | 998 |
| 3 | JGI24735J21928_10182759 | 3300002067 | Bacteria | 607 |
| 4 | JGI25151J46595_10034751 | 3300003187 | Bacteria | 1923 |
| 5 | JGI25153J46596_10000920 | 3300003215 | Bacteria | 17882 |
| 6 | JGI25153J46596_10001125 | 3300003215 | Bacteria | 16201 |
| 7 | JGI25153J46596_10002262 | 3300003215 | Bacteria | 11217 |
| 8 | JGI25153J46596_10056866 | 3300003215 | Bacteria | 1085 |
| 9 | rootH2_10037340 | 3300003320 | Bacteria | 4917 |
| 10 | rootH1_10023157 | 3300003323 | Bacteria | 11483 |
| 11 | rootH1_10082836 | 3300003323 | Bacteria | 1335 |
| 12 | JGI25160J50197_1000504 | 3300003354 | Bacteria | 23228 |
| 13 | JGI25160J50197_1034350 | 3300003354 | Bacteria | 1260 |
| 14 | Ga0055542_1021755 | 3300003762 | Bacteria | 920 |
| 15 | Ga0055526_1054742 | 3300003771 | Bacteria | 884 |
| 16 | Ga0055534_1027789 | 3300003784 | Bacteria | 891 |
| 17 | Ga0055530_10007145 | 3300003791 | Bacteria | 4781 |
| 18 | Ga0055531_10004813 | 3300003794 | Bacteria | 8062 |
| 19 | Ga0055531_10010973 | 3300003794 | Bacteria | 4432 |
| 20 | Ga0055531_10047828 | 3300003794 | Bacteria | 1160 |
| 21 | Ga0055543_1029488 | 3300004625 | Bacteria | 963 |
| 22 | Ga0065165_1000278 | 3300005262 | Bacteria | 87353 |
| 23 | Ga0065165_1002349 | 3300005262 | Bacteria | 16429 |
| 24 | Ga0065165_1064628 | 3300005262 | Bacteria | 990 |
| 25 | Ga0070658_10230315 | 3300005327 | Bacteria | 1569 |
| 26 | Ga0070658_10426009 | 3300005327 | Bacteria | 1142 |
| 27 | Ga0070670_100449246 | 3300005331 | Bacteria | 1142 |
| 28 | Ga0070670_101958049 | 3300005331 | Bacteria | 540 |
| 29 | Ga0070666_10301582 | 3300005335 | Bacteria | 1141 |
| 30 | Ga0070682_100834730 | 3300005337 | Bacteria | 752 |
| 31 | Ga0068868_100260338 | 3300005338 | Bacteria | 1462 |
| 32 | Ga0070660_100090206 | 3300005339 | Bacteria | 2416 |
| 33 | Ga0070660_100535887 | 3300005339 | Bacteria | 976 |
| 34 | Ga0070687_101467247 | 3300005343 | Bacteria | 512 |
| 35 | Ga0070661_100223681 | 3300005344 | Bacteria | 1444 |
| 36 | Ga0070668_100026997 | 3300005347 | Bacteria | 4359 |
| 37 | Ga0070668_100164454 | 3300005347 | Bacteria | 1802 |
| 38 | Ga0070668_102051535 | 3300005347 | Bacteria | 528 |
| 39 | Ga0070671_100034351 | 3300005355 | Bacteria | 4197 |
| 40 | Ga0070671_100095040 | 3300005355 | Bacteria | 2498 |
| 41 | Ga0070671_100212039 | 3300005355 | Bacteria | 1643 |
| 42 | Ga0070673_100549704 | 3300005364 | Bacteria | 1049 |
| 43 | Ga0070659_100125344 | 3300005366 | Bacteria | 2083 |
| 44 | Ga0070667_100300318 | 3300005367 | Bacteria | 1446 |
| 45 | Ga0070663_100167747 | 3300005455 | Bacteria | 1695 |
| 46 | Ga0070663_100279293 | 3300005455 | Bacteria | 1330 |
| 47 | Ga0070663_101287135 | 3300005455 | Bacteria | 645 |
| 48 | Ga0070678_100102649 | 3300005456 | Bacteria | 2220 |
| 49 | Ga0070662_100048293 | 3300005457 | Bacteria | 3066 |
| 50 | Ga0070662_100131977 | 3300005457 | Bacteria | 1927 |
| 51 | Ga0070681_10082606 | 3300005458 | Bacteria | 3167 |
| 52 | Ga0070679_101237795 | 3300005530 | Bacteria | 692 |
| 53 | Ga0070684_101002342 | 3300005535 | Bacteria | 784 |
| 54 | Ga0070684_101256490 | 3300005535 | Bacteria | 697 |
| 55 | Ga0070697_100055346 | 3300005536 | Bacteria | 3225 |
| 56 | Ga0068853_100670497 | 3300005539 | Bacteria | 988 |
| 57 | Ga0068853_100693682 | 3300005539 | Bacteria | 971 |
| 58 | Ga0070696_101527513 | 3300005546 | Bacteria | 572 |
| 59 | Ga0070665_100768901 | 3300005548 | Bacteria | 976 |
| 60 | Ga0070665_100834317 | 3300005548 | Bacteria | 935 |
| 61 | Ga0068855_100025743 | 3300005563 | Bacteria | 7035 |
| 62 | Ga0068855_100150995 | 3300005563 | Bacteria | 2642 |
| 63 | Ga0068855_101000110 | 3300005563 | Bacteria | 879 |
| 64 | Ga0070664_100620956 | 3300005564 | Bacteria | 1003 |
| 65 | Ga0070664_101418207 | 3300005564 | Bacteria | 657 |
| 66 | Ga0068857_100285909 | 3300005577 | Bacteria | 1518 |
| 67 | Ga0068854_100322525 | 3300005578 | Bacteria | 1256 |
| 68 | Ga0068854_100487372 | 3300005578 | Bacteria | 1036 |
| 69 | Ga0068854_101792683 | 3300005578 | Bacteria | 563 |
| 70 | Ga0068856_100189953 | 3300005614 | Bacteria | 2068 |
| 71 | Ga0068856_100429825 | 3300005614 | Bacteria | 1341 |
| 72 | Ga0068856_101187176 | 3300005614 | Bacteria | 780 |
| 73 | Ga0068852_100030886 | 3300005616 | Bacteria | 4414 |
| 74 | Ga0068852_100304950 | 3300005616 | Bacteria | 1542 |
| 75 | Ga0068852_102094699 | 3300005616 | Bacteria | 587 |
| 76 | Ga0068859_100500733 | 3300005617 | Bacteria | 1310 |
| 77 | Ga0068864_100176401 | 3300005618 | Bacteria | 1951 |
| 78 | Ga0068861_102300670 | 3300005719 | Bacteria | 541 |
| 79 | Ga0068851_10190163 | 3300005834 | Bacteria | 1141 |
| 80 | Ga0068863_100361821 | 3300005841 | Bacteria | 1414 |
| 81 | Ga0068863_101416724 | 3300005841 | Bacteria | 703 |
| 82 | Ga0068858_100808582 | 3300005842 | Bacteria | 915 |
| 83 | Ga0068858_100955076 | 3300005842 | Bacteria | 839 |
| 84 | Ga0068858_101301050 | 3300005842 | Bacteria | 715 |
| 85 | Ga0068860_100154260 | 3300005843 | Bacteria | 2213 |
| 86 | Ga0068860_100466678 | 3300005843 | Bacteria | 1257 |
| 87 | Ga0068860_100971742 | 3300005843 | Bacteria | 867 |
| 88 | Ga0068862_100722053 | 3300005844 | Bacteria | 967 |
| 89 | Ga0081538_10189026 | 3300005981 | Bacteria | 868 |
| 90 | Ga0081540_1109605 | 3300005983 | Bacteria | 1170 |
| 91 | Ga0081539_10007629 | 3300005985 | Bacteria | 9762 |
| 92 | Ga0081539_10012883 | 3300005985 | Bacteria | 6370 |
| 93 | Ga0070717_11632077 | 3300006028 | Bacteria | 584 |
| 94 | Ga0075365_10039463 | 3300006038 | Bacteria | 3074 |
| 95 | Ga0075365_10052571 | 3300006038 | Bacteria | 2695 |
| 96 | Ga0075365_10075845 | 3300006038 | Bacteria | 2270 |
| 97 | Ga0075365_10632402 | 3300006038 | Bacteria | 757 |
| 98 | Ga0075365_10650661 | 3300006038 | Bacteria | 745 |
| 99 | Ga0075368_10007174 | 3300006042 | Bacteria | 3927 |
| 100 | Ga0075363_100001650 | 3300006048 | Bacteria | 8628 |
| 101 | Ga0075363_100265970 | 3300006048 | Bacteria | 990 |
| 102 | Ga0075364_10160045 | 3300006051 | Bacteria | 1520 |
| 103 | Ga0075362_10056719 | 3300006177 | Bacteria | 1764 |
| 104 | Ga0075367_10111355 | 3300006178 | Bacteria | 1680 |
| 105 | Ga0075367_10116181 | 3300006178 | Bacteria | 1646 |
| 106 | Ga0075367_10159833 | 3300006178 | Bacteria | 1401 |
| 107 | Ga0075367_10485205 | 3300006178 | Bacteria | 784 |
| 108 | Ga0075369_10019487 | 3300006186 | Bacteria | 2770 |
| 109 | Ga0075369_10038153 | 3300006186 | Bacteria | 2049 |
| 110 | Ga0075369_10049252 | 3300006186 | Bacteria | 1819 |
| 111 | Ga0075369_10099972 | 3300006186 | Bacteria | 1301 |
| 112 | Ga0075366_10249464 | 3300006195 | Bacteria | 1082 |
| 113 | Ga0075366_10892764 | 3300006195 | Bacteria | 554 |
| 114 | Ga0075366_10906387 | 3300006195 | Bacteria | 549 |
| 115 | Ga0097621_100215853 | 3300006237 | Bacteria | 1670 |
| 116 | Ga0075370_10051002 | 3300006353 | Bacteria | 2347 |
| 117 | Ga0068871_102109783 | 3300006358 | Bacteria | 537 |
| 118 | Ga0097620_100500698 | 3300006931 | Bacteria | 1310 |
| 119 | Ga0099824_1016622 | 3300006942 | Bacteria | 6617 |
| 120 | Ga0099823_1027325 | 3300006944 | Bacteria | 4980 |
| 121 | Ga0099795_10191363 | 3300007788 | Bacteria | 859 |
| 122 | Ga0105240_10002229 | 3300009093 | Bacteria | 31523 |
| 123 | Ga0105240_10082573 | 3300009093 | Bacteria | 3946 |
| 124 | Ga0105240_12251048 | 3300009093 | Bacteria | 565 |
| 125 | Ga0105245_11967275 | 3300009098 | Bacteria | 638 |
| 126 | Ga0105245_13090658 | 3300009098 | Bacteria | 516 |
| 127 | Ga0105247_10123462 | 3300009101 | Bacteria | 1680 |
| 128 | Ga0105243_10048108 | 3300009148 | Bacteria | 3360 |
| 129 | Ga0105241_10089422 | 3300009174 | Bacteria | 2426 |
| 130 | Ga0105241_10128044 | 3300009174 | Bacteria | 2052 |
| 131 | Ga0105241_10424439 | 3300009174 | Bacteria | 1171 |
| 132 | Ga0105242_10440098 | 3300009176 | Bacteria | 1226 |
| 133 | Ga0105248_10033433 | 3300009177 | Bacteria | 5745 |
| 134 | Ga0105248_10099852 | 3300009177 | Bacteria | 3270 |
| 135 | Ga0105248_10943174 | 3300009177 | Bacteria | 975 |
| 136 | Ga0105248_11799650 | 3300009177 | Bacteria | 695 |
| 137 | Ga0105248_13231138 | 3300009177 | Bacteria | 518 |
| 138 | Ga0105237_10035674 | 3300009545 | Bacteria | 5031 |
| 139 | Ga0105237_10274451 | 3300009545 | Bacteria | 1689 |
| 140 | Ga0105237_11240748 | 3300009545 | Bacteria | 752 |
| 141 | Ga0105238_10755742 | 3300009551 | Bacteria | 986 |
| 142 | Ga0105238_10820238 | 3300009551 | Bacteria | 946 |
| 143 | Ga0105238_11863117 | 3300009551 | Bacteria | 634 |
| 144 | Ga0105238_12227338 | 3300009551 | Bacteria | 583 |
| 145 | Ga0105238_12995031 | 3300009551 | Bacteria | 507 |
| 146 | Ga0105249_10310925 | 3300009553 | Bacteria | 1584 |
| 147 | Ga0105249_12087974 | 3300009553 | Bacteria | 639 |
| 148 | Ga0099796_10466465 | 3300010159 | Bacteria | 563 |
| 149 | Ga0105239_10022884 | 3300010375 | Bacteria | 6889 |
| 150 | Ga0105239_10238225 | 3300010375 | Bacteria | 2042 |
| 151 | Ga0105239_10439169 | 3300010375 | Bacteria | 1480 |
| 152 | Ga0105239_10626918 | 3300010375 | Bacteria | 1227 |
| 153 | Ga0105239_10667163 | 3300010375 | Bacteria | 1188 |
| 154 | Ga0105239_11797712 | 3300010375 | Bacteria | 710 |
| 155 | Ga0105246_10041441 | 3300011119 | Bacteria | 3112 |
| 156 | Ga0157370_10115884 | 3300013104 | Bacteria | 2503 |
| 157 | Ga0157370_11182077 | 3300013104 | Bacteria | 690 |
| 158 | Ga0157369_10707693 | 3300013105 | Bacteria | 1037 |
| 159 | Ga0157369_10757107 | 3300013105 | Bacteria | 999 |
| 160 | Ga0157369_10876278 | 3300013105 | Bacteria | 921 |
| 161 | Ga0157374_10368990 | 3300013296 | Bacteria | 1428 |
| 162 | Ga0157378_11211786 | 3300013297 | Bacteria | 794 |
| 163 | Ga0157378_11897925 | 3300013297 | Bacteria | 645 |
| 164 | Ga0163162_11785283 | 3300013306 | Bacteria | 703 |
| 165 | Ga0157372_12503103 | 3300013307 | Bacteria | 592 |
| 166 | Ga0157375_10278080 | 3300013308 | Bacteria | 1837 |
| 167 | Ga0157375_10744496 | 3300013308 | Bacteria | 1132 |
| 168 | Ga0163163_10138673 | 3300014325 | Bacteria | 2474 |
| 169 | Ga0163163_10153121 | 3300014325 | Bacteria | 2349 |
| 170 | Ga0163163_10232514 | 3300014325 | Bacteria | 1892 |
| 171 | Ga0182008_10290928 | 3300014497 | Bacteria | 852 |
| 172 | Ga0157379_10386935 | 3300014968 | Bacteria | 1284 |
| 173 | Ga0157379_11232481 | 3300014968 | Bacteria | 720 |
| 174 | Ga0157376_10408002 | 3300014969 | Bacteria | 1315 |
| 175 | Ga0182005_1211335 | 3300015265 | Bacteria | 587 |
| 176 | Ga0163161_10584685 | 3300017792 | Bacteria | 919 |
| 177 | Ga0163161_10656866 | 3300017792 | Bacteria | 869 |
| 178 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 179 | Ga0214544_1033003 | 3300021320 | Bacteria | 1565 |
| 180 | Ga0214544_1037219 | 3300021320 | Bacteria | 1210 |
| 181 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 182 | Ga0214542_1040209 | 3300021321 | Bacteria | 1210 |
| 183 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 184 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 185 | Ga0214543_1047985 | 3300021327 | Bacteria | 903 |
| 186 | Ga0213876_10717198 | 3300021384 | Bacteria | 532 |
| 187 | Ga0207425_1027894 | 3300025245 | Bacteria | 1149 |
| 188 | Ga0209677_105274 | 3300025253 | Bacteria | 3422 |
| 189 | Ga0209148_1000574 | 3300025254 | Bacteria | 34124 |
| 190 | Ga0209233_1004212 | 3300025261 | Bacteria | 4931 |
| 191 | Ga0209233_1010224 | 3300025261 | Bacteria | 2822 |
| 192 | Ga0209455_1000834 | 3300025272 | Bacteria | 16636 |
| 193 | Ga0209455_1050977 | 3300025272 | Bacteria | 579 |
| 194 | Ga0209025_1001616 | 3300025294 | Bacteria | 28163 |
| 195 | Ga0209025_1041117 | 3300025294 | Bacteria | 1986 |
| 196 | Ga0209564_1029379 | 3300025295 | Bacteria | 1731 |
| 197 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 198 | Ga0209758_1000498 | 3300025297 | Bacteria | 64011 |
| 199 | Ga0209758_1000560 | 3300025297 | Bacteria | 58586 |
| 200 | Ga0209758_1014068 | 3300025297 | Bacteria | 4296 |
| 201 | Ga0209758_1164100 | 3300025297 | Bacteria | 549 |
| 202 | Ga0209050_1000173 | 3300025298 | Bacteria | 149800 |
| 203 | Ga0209256_1011226 | 3300025299 | Bacteria | 3613 |
| 204 | Ga0209256_1116341 | 3300025299 | Bacteria | 530 |
| 205 | Ga0207426_1000721 | 3300025302 | Bacteria | 38161 |
| 206 | Ga0207426_1000728 | 3300025302 | Bacteria | 37754 |
| 207 | Ga0207426_1100856 | 3300025302 | Bacteria | 746 |
| 208 | Ga0209051_1092645 | 3300025303 | Bacteria | 835 |
| 209 | Ga0209257_1000196 | 3300025304 | Bacteria | 149656 |
| 210 | Ga0209257_1001031 | 3300025304 | Bacteria | 37368 |
| 211 | Ga0209257_1021240 | 3300025304 | Bacteria | 2367 |
| 212 | Ga0209257_1035331 | 3300025304 | Bacteria | 1548 |
| 213 | Ga0207697_10021892 | 3300025315 | Bacteria | 2619 |
| 214 | Ga0207656_10729292 | 3300025321 | Bacteria | 508 |
| 215 | Ga0207710_10121717 | 3300025900 | Bacteria | 1247 |
| 216 | Ga0207710_10304419 | 3300025900 | Bacteria | 806 |
| 217 | Ga0207688_11036869 | 3300025901 | Bacteria | 518 |
| 218 | Ga0207680_10086878 | 3300025903 | Bacteria | 1979 |
| 219 | Ga0207680_10324419 | 3300025903 | Bacteria | 1077 |
| 220 | Ga0207647_10011713 | 3300025904 | Bacteria | 6138 |
| 221 | Ga0207647_10334274 | 3300025904 | Bacteria | 859 |
| 222 | Ga0207705_10027327 | 3300025909 | Bacteria | 4070 |
| 223 | Ga0207705_10095723 | 3300025909 | Bacteria | 2179 |
| 224 | Ga0207684_10340970 | 3300025910 | Bacteria | 1291 |
| 225 | Ga0207654_10020949 | 3300025911 | Bacteria | 3472 |
| 226 | Ga0207654_10050199 | 3300025911 | Bacteria | 2396 |
| 227 | Ga0207654_10067495 | 3300025911 | Bacteria | 2113 |
| 228 | Ga0207654_10361558 | 3300025911 | Bacteria | 1001 |
| 229 | Ga0207707_10094516 | 3300025912 | Bacteria | 2612 |
| 230 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 231 | Ga0207695_10023959 | 3300025913 | Bacteria | 6884 |
| 232 | Ga0207695_10393373 | 3300025913 | Bacteria | 1271 |
| 233 | Ga0207671_10003068 | 3300025914 | Bacteria | 17080 |
| 234 | Ga0207662_11022588 | 3300025918 | Bacteria | 587 |
| 235 | Ga0207657_10135966 | 3300025919 | Bacteria | 2011 |
| 236 | Ga0207657_11433002 | 3300025919 | Bacteria | 518 |
| 237 | Ga0207649_10054356 | 3300025920 | Bacteria | 2492 |
| 238 | Ga0207649_11134007 | 3300025920 | Bacteria | 617 |
| 239 | Ga0207694_10308585 | 3300025924 | Bacteria | 1304 |
| 240 | Ga0207694_10532211 | 3300025924 | Bacteria | 985 |
| 241 | Ga0207694_10690806 | 3300025924 | Bacteria | 860 |
| 242 | Ga0207650_10885012 | 3300025925 | Bacteria | 758 |
| 243 | Ga0207659_10693112 | 3300025926 | Bacteria | 872 |
| 244 | Ga0207687_10204343 | 3300025927 | Bacteria | 1546 |
| 245 | Ga0207687_10514698 | 3300025927 | Bacteria | 1000 |
| 246 | Ga0207644_10009377 | 3300025931 | Bacteria | 6429 |
| 247 | Ga0207644_10303418 | 3300025931 | Bacteria | 1287 |
| 248 | Ga0207644_10339800 | 3300025931 | Bacteria | 1217 |
| 249 | Ga0207706_10180298 | 3300025933 | Bacteria | 1855 |
| 250 | Ga0207706_11548871 | 3300025933 | Bacteria | 539 |
| 251 | Ga0207709_10792011 | 3300025935 | Bacteria | 765 |
| 252 | Ga0207665_10285229 | 3300025939 | Bacteria | 1230 |
| 253 | Ga0207691_10316872 | 3300025940 | Bacteria | 1338 |
| 254 | Ga0207711_10123427 | 3300025941 | Bacteria | 2314 |
| 255 | Ga0207711_10176615 | 3300025941 | Bacteria | 1940 |
| 256 | Ga0207711_10378230 | 3300025941 | Bacteria | 1314 |
| 257 | Ga0207679_10265107 | 3300025945 | Bacteria | 1467 |
| 258 | Ga0207679_12135175 | 3300025945 | Bacteria | 509 |
| 259 | Ga0207667_10103609 | 3300025949 | Bacteria | 2935 |
| 260 | Ga0207667_10825017 | 3300025949 | Bacteria | 923 |
| 261 | Ga0207712_11450369 | 3300025961 | Bacteria | 614 |
| 262 | Ga0207668_10257924 | 3300025972 | Bacteria | 1419 |
| 263 | Ga0207668_10351653 | 3300025972 | Bacteria | 1232 |
| 264 | Ga0207640_10530660 | 3300025981 | Bacteria | 985 |
| 265 | Ga0207640_10784450 | 3300025981 | Bacteria | 824 |
| 266 | Ga0207640_11341075 | 3300025981 | Bacteria | 640 |
| 267 | Ga0207640_11513376 | 3300025981 | Bacteria | 603 |
| 268 | Ga0207658_10068331 | 3300025986 | Bacteria | 2681 |
| 269 | Ga0207658_10370661 | 3300025986 | Bacteria | 1252 |
| 270 | Ga0207658_10520135 | 3300025986 | Bacteria | 1062 |
| 271 | Ga0207658_10810689 | 3300025986 | Bacteria | 850 |
| 272 | Ga0207658_11737019 | 3300025986 | Bacteria | 570 |
| 273 | Ga0207703_10181815 | 3300026035 | Bacteria | 1856 |
| 274 | Ga0207703_10729068 | 3300026035 | Bacteria | 944 |
| 275 | Ga0207639_10304814 | 3300026041 | Bacteria | 1409 |
| 276 | Ga0207639_11061557 | 3300026041 | Bacteria | 759 |
| 277 | Ga0207639_11507003 | 3300026041 | Bacteria | 631 |
| 278 | Ga0207639_11520168 | 3300026041 | Bacteria | 628 |
| 279 | Ga0207678_10066105 | 3300026067 | Bacteria | 3105 |
| 280 | Ga0207678_10707327 | 3300026067 | Bacteria | 887 |
| 281 | Ga0207702_10207401 | 3300026078 | Bacteria | 1820 |
| 282 | Ga0207702_10216281 | 3300026078 | Bacteria | 1784 |
| 283 | Ga0207702_10276208 | 3300026078 | Bacteria | 1586 |
| 284 | Ga0207641_10254720 | 3300026088 | Bacteria | 1641 |
| 285 | Ga0207676_10053941 | 3300026095 | Bacteria | 3148 |
| 286 | Ga0207674_10117439 | 3300026116 | Bacteria | 2631 |
| 287 | Ga0207675_100544898 | 3300026118 | Bacteria | 1159 |
| 288 | Ga0207683_10051407 | 3300026121 | Bacteria | 3610 |
| 289 | Ga0207698_10086772 | 3300026142 | Bacteria | 2546 |
| 290 | Ga0207698_11996904 | 3300026142 | Bacteria | 594 |
| 291 | Ga0207698_12213536 | 3300026142 | Bacteria | 562 |
| 292 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 293 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 294 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 295 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 296 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 297 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 298 | Ga0209813_10018694 | 3300027866 | Bacteria | 1917 |
| 299 | Ga0268266_10216436 | 3300028379 | Bacteria | 1759 |
| 300 | Ga0268266_11181599 | 3300028379 | Bacteria | 740 |
| 301 | Ga0268265_10648204 | 3300028380 | Bacteria | 1015 |
| 302 | Ga0268264_10221943 | 3300028381 | Bacteria | 1740 |
| 303 | Ga0268264_11730696 | 3300028381 | Bacteria | 635 |
| 304 | Ga0307517_10031603 | 3300028786 | Bacteria | 6155 |
| 305 | Ga0316177_1161710 | 3300030731 | Bacteria | 651 |
| 306 | Ga0316177_1194283 | 3300030731 | Bacteria | 1655 |
| 307 | Ga0316180_1185350 | 3300030736 | Bacteria | 2733 |
| 308 | Ga0316181_1269212 | 3300030744 | Bacteria | 728 |
| 309 | Ga0316182_1089562 | 3300030745 | Bacteria | 1211 |
| 310 | Ga0307513_10003074 | 3300031456 | Bacteria | 22759 |
| 311 | Ga0307508_10755496 | 3300031616 | Bacteria | 586 |
| 312 | Ga0307516_10082010 | 3300031730 | Bacteria | 3067 |
| 313 | Ga0307405_10782352 | 3300031731 | Bacteria | 798 |
| 314 | Ga0307412_10286706 | 3300031911 | Bacteria | 1295 |
| 315 | Ga0307412_10741324 | 3300031911 | Bacteria | 847 |
| 316 | Ga0307412_11312568 | 3300031911 | Bacteria | 652 |
| 317 | Ga0307416_100222438 | 3300032002 | Bacteria | 1812 |
| 318 | Ga0307416_100718263 | 3300032002 | Bacteria | 1090 |
| 319 | Ga0307416_102016514 | 3300032002 | Bacteria | 680 |
| 320 | Ga0307416_102149545 | 3300032002 | Bacteria | 660 |
| 321 | Ga0307416_102298020 | 3300032002 | Bacteria | 640 |
| 322 | Ga0307414_10058278 | 3300032004 | Bacteria | 2720 |
| 323 | Ga0307414_10356818 | 3300032004 | Bacteria | 1257 |
| 324 | Ga0307414_11356899 | 3300032004 | Bacteria | 660 |
| 325 | Ga0307411_10060445 | 3300032005 | Bacteria | 2517 |
| 326 | Ga0307415_100308769 | 3300032126 | Bacteria | 1314 |
| 327 | Ga0307415_100515087 | 3300032126 | Bacteria | 1049 |
| 328 | Ga0307510_10018544 | 3300033180 | Bacteria | 8187 |
| 329 | Ga0307510_10049877 | 3300033180 | Bacteria | 4448 |
| 330 | Ga0307510_10156576 | 3300033180 | Bacteria | 1884 |
| 331 | Ga0395905_0019296 | 3300037471 | Bacteria | 6464 |
| 332 | Ga0395905_0583896 | 3300037471 | Bacteria | 1019 |
| 333 | Ga0436364_0628597 | 3300037853 | Bacteria | 1050 |
| 334 | Ga0436364_0758834 | 3300037853 | Bacteria | 595 |
| 335 | Ga0395901_0112041 | 3300038443 | Bacteria | 2866 |
| 336 | Ga0436365_0903985 | 3300039437 | Bacteria | 558 |
| 337 | Ga0436365_1551576 | 3300039437 | Bacteria | 651 |
| 338 | Ga0436361_0888239 | 3300039447 | Bacteria | 6345 |
| 339 | Ga0439436_0000605 | 3300041404 | Bacteria | 9500 |
| 340 | Ga0439438_124292 | 3300041405 | Bacteria | 620 |
| 341 | Ga0439439_0006362 | 3300041406 | Bacteria | 2730 |
| 342 | Ga0439465_0001602 | 3300041413 | Bacteria | 7363 |
| 343 | Ga0439465_0022870 | 3300041413 | Bacteria | 1965 |
| 344 | Ga0451791_0384925 | 3300041451 | Bacteria | 1350 |
| 345 | Ga0451793_0966425 | 3300041452 | Bacteria | 638 |
| 346 | Ga0451802_2124237 | 3300041460 | Bacteria | 910 |
| 347 | Ga0451841_0728594 | 3300041498 | Bacteria | 575 |
| 348 | Ga0451849_0710854 | 3300041505 | Bacteria | 631 |
| 349 | Ga0451851_1128638 | 3300041507 | Bacteria | 514 |
| 350 | Ga0451853_1629056 | 3300041512 | Bacteria | 690 |
| 351 | Ga0439448_0027589 | 3300042005 | Bacteria | 1790 |
| 352 | Ga0439449_0018394 | 3300042007 | Bacteria | 2623 |
| 353 | Ga0439452_085394 | 3300042010 | Bacteria | 685 |
| 354 | Ga0439455_0007379 | 3300042012 | Bacteria | 2322 |
| 355 | Ga0439457_009322 | 3300042014 | Bacteria | 2289 |
| 356 | Ga0450906_000256 | 3300042145 | Bacteria | 10256 |
| 357 | Ga0450907_048480 | 3300042146 | Bacteria | 729 |
| 358 | Ga0450910_010689 | 3300042147 | Bacteria | 1311 |
| 359 | Ga0450909_032558 | 3300042185 | Bacteria | 792 |
| 360 | Ga0439434_0140271 | 3300042435 | Bacteria | 796 |
| 361 | Ga0450918_003752 | 3300042531 | Bacteria | 2804 |
| 362 | Ga0466969_0014853 | 3300044656 | Bacteria | 4088 |
| 363 | Ga0466972_0051607 | 3300044658 | Bacteria | 1983 |
| 364 | Ga0466972_0421416 | 3300044658 | Bacteria | 626 |
| 365 | Ga0466965_0047899 | 3300044683 | Bacteria | 2116 |
| 366 | Ga0466966_0001348 | 3300044684 | Bacteria | 15776 |
| 367 | Ga0466961_0000120 | 3300044693 | Bacteria | 52569 |
| 368 | Ga0466961_0516478 | 3300044693 | Bacteria | 721 |
| 369 | Ga0466963_0011705 | 3300044694 | Bacteria | 5348 |
| 370 | Ga0466964_0122591 | 3300044706 | Bacteria | 1174 |
| 371 | Ga0466964_0268634 | 3300044706 | Bacteria | 848 |
| 372 | Ga0466964_0313606 | 3300044706 | Bacteria | 795 |
| 373 | Ga0466968_0003277 | 3300044735 | Bacteria | 5966 |
| 374 | Ga0466960_0018574 | 3300044901 | Bacteria | 3050 |
| 375 | Ga0466960_0235957 | 3300044901 | Bacteria | 1011 |
| 376 | Ga0466959_0108014 | 3300045049 | Bacteria | 1988 |
| 377 | Ga0466959_0117008 | 3300045049 | Bacteria | 1898 |
| 378 | Ga0466967_0041384 | 3300045976 | Bacteria | 3972 |
| 379 | Ga0495629_0004834 | 3300046459 | Bacteria | 10101 |
| 380 | Ga0495638_0004073 | 3300046460 | Bacteria | 11197 |
| 381 | Ga0495651_0358019 | 3300046462 | Bacteria | 962 |
| 382 | Ga0495650_0248396 | 3300046471 | Bacteria | 606 |
| 383 | Ga0495580_0411540 | 3300046472 | Bacteria | 911 |
| 384 | Ga0495605_0096450 | 3300046474 | Bacteria | 1364 |
| 385 | Ga0495605_0167246 | 3300046474 | Bacteria | 973 |
| 386 | Ga0495662_0177843 | 3300046476 | Bacteria | 1049 |
| 387 | Ga0495664_0155960 | 3300046477 | Bacteria | 1385 |
| 388 | Ga0495585_0204208 | 3300046492 | Bacteria | 1005 |
| 389 | Ga0495596_0150544 | 3300046500 | Bacteria | 904 |
| 390 | Ga0495607_0214652 | 3300046501 | Bacteria | 945 |
| 391 | Ga0495583_0140772 | 3300046506 | Bacteria | 1004 |
| 392 | Ga0495606_0014314 | 3300046507 | Bacteria | 6204 |
| 393 | Ga0495606_0054446 | 3300046507 | Bacteria | 2591 |
| 394 | Ga0495606_0113453 | 3300046507 | Bacteria | 1631 |
| 395 | Ga0495606_0339592 | 3300046507 | Bacteria | 801 |
| 396 | Ga0495610_0074032 | 3300046512 | Bacteria | 1581 |
| 397 | Ga0495616_0071766 | 3300046513 | Bacteria | 1673 |
| 398 | Ga0495616_0148793 | 3300046513 | Bacteria | 1061 |
| 399 | Ga0495618_0089914 | 3300046514 | Bacteria | 1964 |
| 400 | Ga0495628_0230964 | 3300046516 | Bacteria | 1387 |
| 401 | Ga0495630_0732728 | 3300046517 | Bacteria | 756 |
| 402 | Ga0495643_0076606 | 3300046522 | Bacteria | 1748 |
| 403 | Ga0495648_0030954 | 3300046524 | Bacteria | 3531 |
| 404 | Ga0495648_0040932 | 3300046524 | Bacteria | 2932 |
| 405 | Ga0495648_0069995 | 3300046524 | Bacteria | 2040 |
| 406 | Ga0495648_0135996 | 3300046524 | Bacteria | 1300 |
| 407 | Ga0495666_0145146 | 3300046526 | Bacteria | 1105 |
| 408 | Ga0495642_0016284 | 3300046528 | Bacteria | 2896 |
| 409 | Ga0495652_0017641 | 3300046529 | Bacteria | 6370 |
| 410 | Ga0495665_0499674 | 3300046531 | Bacteria | 613 |
| 411 | Ga0495640_0280720 | 3300046533 | Bacteria | 1037 |
| 412 | Ga0495597_0259918 | 3300046542 | Bacteria | 680 |
| 413 | Ga0495622_0031173 | 3300046557 | Bacteria | 2492 |
| 414 | Ga0495668_0014834 | 3300046616 | Bacteria | 4561 |
| 415 | Ga0495668_0083471 | 3300046616 | Bacteria | 1752 |
| 416 | Ga0495668_0110449 | 3300046616 | Bacteria | 1504 |
| 417 | Ga0495634_0513388 | 3300046642 | Bacteria | 702 |
| 418 | Ga0495611_0026685 | 3300046648 | Bacteria | 2521 |
| 419 | Ga0495625_0005726 | 3300046660 | Bacteria | 11236 |
| 420 | Ga0495625_0008262 | 3300046660 | Bacteria | 8898 |
| 421 | Ga0495625_0282428 | 3300046660 | Bacteria | 1068 |
| 422 | Ga0495625_0554945 | 3300046660 | Bacteria | 695 |
| 423 | Ga0495625_0805503 | 3300046660 | Bacteria | 546 |
| 424 | Ga0495635_0046740 | 3300046663 | Bacteria | 2985 |
| 425 | Ga0495661_0234390 | 3300046665 | Bacteria | 945 |
| 426 | Ga0495588_0202712 | 3300046674 | Bacteria | 1048 |
| 427 | Ga0495588_0371934 | 3300046674 | Bacteria | 751 |
| 428 | Ga0495657_0328671 | 3300046675 | Bacteria | 907 |
| 429 | Ga0495646_0212150 | 3300046680 | Bacteria | 1050 |
| 430 | Ga0495658_0123202 | 3300046683 | Bacteria | 1570 |
| 431 | Ga0495669_0007293 | 3300046684 | Bacteria | 4632 |
| 432 | Ga0495669_0376333 | 3300046684 | Bacteria | 687 |
| 433 | Ga0495624_0061882 | 3300046690 | Bacteria | 2343 |
| 434 | Ga0495670_0530829 | 3300046691 | Bacteria | 640 |
| 435 | Ga0495671_0220428 | 3300046692 | Bacteria | 918 |
| 436 | Ga0495649_0182836 | 3300046694 | Bacteria | 1093 |
| 437 | Ga0495649_0260970 | 3300046694 | Bacteria | 888 |
| 438 | Ga0495649_0367849 | 3300046694 | Bacteria | 725 |
| 439 | Ga0495649_0460802 | 3300046694 | Bacteria | 634 |
| 440 | Ga0495589_0124374 | 3300046794 | Bacteria | 1241 |
| 441 | Ga0495600_0933889 | 3300046809 | Bacteria | 510 |
| 442 | Ga0495604_0070415 | 3300047317 | Bacteria | 2648 |
| 443 | Ga0495604_0172143 | 3300047317 | Bacteria | 1521 |
| 444 | Ga0495672_0405426 | 3300047320 | Bacteria | 623 |
| 445 | Ga0495683_0021360 | 3300047323 | Bacteria | 3336 |
| 446 | Ga0495683_0281248 | 3300047323 | Bacteria | 720 |
| 447 | Ga0495687_011038 | 3300047443 | Bacteria | 4891 |
| 448 | Ga0495687_144991 | 3300047443 | Bacteria | 820 |
| 449 | Ga0495677_0218506 | 3300047445 | Bacteria | 742 |
| 450 | Ga0495673_0078367 | 3300047469 | Bacteria | 1374 |
| 451 | Ga0495681_0122985 | 3300047470 | Bacteria | 1112 |
| 452 | Ga0495686_0011106 | 3300047472 | Bacteria | 6362 |
| 453 | Ga0495686_0017861 | 3300047472 | Bacteria | 4770 |
| 454 | Ga0495686_0157905 | 3300047472 | Bacteria | 1327 |
| 455 | Ga0495686_0269320 | 3300047472 | Bacteria | 951 |
| 456 | Ga0495593_0114662 | 3300047673 | Bacteria | 1374 |
| 457 | Ga0495602_0116479 | 3300048088 | Bacteria | 2159 |
| 458 | Ga0495602_0239731 | 3300048088 | Bacteria | 1357 |
| 459 | Ga0495614_0545223 | 3300048089 | Bacteria | 554 |
| 460 | Ga0495626_0129938 | 3300048091 | Bacteria | 1076 |
| 461 | Ga0496100_0225421 | 3300048903 | Bacteria | 1377 |
| 462 | Ga0496100_1057565 | 3300048903 | Bacteria | 639 |
| 463 | Ga0496101_0121402 | 3300048904 | Bacteria | 1976 |
| 464 | Ga0496101_0341634 | 3300048904 | Unclassified | 1176 |
| 465 | Ga0496101_0465456 | 3300048904 | Bacteria | 998 |
| 466 | Ga0496102_0034116 | 3300048905 | Bacteria | 4576 |
| 467 | Ga0496102_0209752 | 3300048905 | Bacteria | 1837 |
| 468 | Ga0496102_0321878 | 3300048905 | Bacteria | 1457 |
| 469 | Ga0496103_0002701 | 3300048906 | Bacteria | 11067 |
| 470 | Ga0496104_0075514 | 3300048907 | Bacteria | 3209 |
| 471 | Ga0496104_0453246 | 3300048907 | Bacteria | 1194 |
| 472 | Ga0496104_0617030 | 3300048907 | Bacteria | 994 |
| 473 | Ga0496104_1186332 | 3300048907 | Bacteria | 667 |
| 474 | Ga0496105_0145330 | 3300048908 | Bacteria | 1950 |
| 475 | Ga0496105_0544021 | 3300048908 | Bacteria | 907 |
| 476 | Ga0496105_0743588 | 3300048908 | Bacteria | 750 |
| 477 | Ga0496106_0197483 | 3300048909 | Bacteria | 1600 |
| 478 | Ga0496107_0391746 | 3300048910 | Bacteria | 1033 |
| 479 | Ga0496107_0425422 | 3300048910 | Bacteria | 987 |
| 480 | Ga0496108_0083771 | 3300048911 | Bacteria | 2705 |
| 481 | Ga0496108_0144795 | 3300048911 | Bacteria | 2048 |
| 482 | Ga0496108_1301059 | 3300048911 | Bacteria | 611 |
| 483 | Ga0496108_1644775 | 3300048911 | Bacteria | 530 |
| 484 | Ga0496109_0020224 | 3300048912 | Bacteria | 5880 |
| 485 | Ga0496109_0732158 | 3300048912 | Bacteria | 927 |
| 486 | Ga0496110_0092863 | 3300048913 | Bacteria | 2701 |
| 487 | Ga0496110_1293961 | 3300048913 | Bacteria | 638 |
| 488 | Ga0496111_0215895 | 3300048914 | Bacteria | 1425 |
| 489 | Ga0496112_0134434 | 3300048915 | Bacteria | 2443 |
| 490 | Ga0496112_0156335 | 3300048915 | Bacteria | 2247 |
| 491 | Ga0496112_0849698 | 3300048915 | Bacteria | 836 |
| 492 | Ga0496112_1080722 | 3300048915 | Bacteria | 721 |
| 493 | Ga0496113_0111091 | 3300048916 | Bacteria | 2134 |
| 494 | Ga0496113_0156872 | 3300048916 | Bacteria | 1798 |
| 495 | Ga0496113_0178795 | 3300048916 | Bacteria | 1682 |
| 496 | Ga0496114_0422794 | 3300048917 | Bacteria | 1180 |
| 497 | Ga0496114_0650782 | 3300048917 | Bacteria | 927 |
| 498 | Ga0496114_0962835 | 3300048917 | Bacteria | 736 |
| 499 | Ga0496115_0199085 | 3300048918 | Bacteria | 1655 |
| 500 | Ga0496115_0226271 | 3300048918 | Bacteria | 1543 |
| 501 | Ga0496116_0005222 | 3300048919 | Bacteria | 12153 |
| 502 | Ga0496116_0112814 | 3300048919 | Bacteria | 1592 |
| 503 | Ga0496117_0102014 | 3300048920 | Unclassified | 1812 |
| 504 | Ga0496117_0320548 | 3300048920 | Bacteria | 812 |
| 505 | Ga0496117_0345597 | 3300048920 | Bacteria | 770 |
| 506 | Ga0496118_0018021 | 3300048921 | Bacteria | 6394 |
| 507 | Ga0496118_0068786 | 3300048921 | Bacteria | 2569 |
| 508 | Ga0496118_0079870 | 3300048921 | Bacteria | 2305 |
| 509 | Ga0496118_0128153 | 3300048921 | Bacteria | 1636 |
| 510 | Ga0496118_0297806 | 3300048921 | Bacteria | 887 |
| 511 | Ga0496119_0011409 | 3300048922 | Bacteria | 7362 |
| 512 | Ga0496119_0141423 | 3300048922 | Bacteria | 1299 |
| 513 | Ga0496120_0194813 | 3300048923 | Bacteria | 985 |
| 514 | Ga0496121_0029418 | 3300048924 | Bacteria | 5079 |
| 515 | Ga0496121_0034794 | 3300048924 | Bacteria | 4527 |
| 516 | Ga0496121_0074310 | 3300048924 | Bacteria | 2720 |
| 517 | Ga0496121_0199386 | 3300048924 | Bacteria | 1428 |
| 518 | Ga0496121_0267977 | 3300048924 | Bacteria | 1175 |
| 519 | Ga0496121_0340794 | 3300048924 | Bacteria | 1002 |
| 520 | Ga0496122_0036120 | 3300048925 | Bacteria | 4004 |
| 521 | Ga0496122_0274083 | 3300048925 | Bacteria | 927 |
| 522 | Ga0496122_0318389 | 3300048925 | Bacteria | 829 |
| 523 | Ga0496123_0040182 | 3300048926 | Bacteria | 3262 |
| 524 | Ga0496124_0000072 | 3300048927 | Bacteria | 219914 |
| 525 | Ga0496124_0537839 | 3300048927 | Bacteria | 774 |
| 526 | Ga0496125_0016125 | 3300048928 | Bacteria | 7189 |
| 527 | Ga0496125_0069446 | 3300048928 | Bacteria | 2765 |
| 528 | Ga0496125_0094222 | 3300048928 | Bacteria | 2232 |
| 529 | Ga0496125_0185179 | 3300048928 | Bacteria | 1382 |
| 530 | Ga0496125_0264126 | 3300048928 | Bacteria | 1077 |
| 531 | Ga0496126_0048730 | 3300048929 | Bacteria | 3870 |
| 532 | Ga0496126_0063564 | 3300048929 | Bacteria | 3309 |
| 533 | Ga0496126_1015894 | 3300048929 | Bacteria | 621 |
| 534 | Ga0495682_0051280 | 3300049460 | Bacteria | 1501 |
| 535 | Ga0495682_0064472 | 3300049460 | Bacteria | 1321 |
| 536 | Ga0501257_233758 | 3300049686 | Bacteria | 540 |
| 537 | nmdc:mga03683_57034_c1 | 3300050489 | Bacteria | 1643 |
| 538 | nmdc:mga00v17_114811_c1 | 3300050491 | Bacteria | 1711 |
| 539 | nmdc:mga00v17_228874_c1 | 3300050491 | Bacteria | 1204 |
| 540 | nmdc:mga00v17_908014_c1 | 3300050491 | Bacteria | 557 |
| 541 | nmdc:mga0yw44_106066_c1 | 3300050492 | Bacteria | 1795 |
| 542 | nmdc:mga0yw44_360835_c1 | 3300050492 | Bacteria | 979 |
| 543 | nmdc:mga0yw44_585087_c1 | 3300050492 | Bacteria | 758 |
| 544 | nmdc:mga0yw44_64951_c1 | 3300050492 | Bacteria | 2247 |
| 545 | nmdc:mga0k408_232439_c1 | 3300050493 | Bacteria | 1100 |
| 546 | nmdc:mga0k408_33345_c1 | 3300050493 | Bacteria | 2945 |
| 547 | nmdc:mga06z11_472901_c1 | 3300050494 | Bacteria | 758 |
| 548 | nmdc:mga06z11_572403_c1 | 3300050494 | Bacteria | 686 |
| 549 | nmdc:mga06z11_73991_c1 | 3300050494 | Bacteria | 1810 |
| 550 | nmdc:mga04h51_22238_c1 | 3300050495 | Bacteria | 1917 |
| 551 | nmdc:mga07m45_149174_c1 | 3300050496 | Bacteria | 1356 |
| 552 | nmdc:mga0sz30_116467_c1 | 3300050516 | Bacteria | 1173 |
| 553 | nmdc:mga0sz30_169577_c1 | 3300050516 | Bacteria | 968 |
| 554 | nmdc:mga0sz30_89222_c1 | 3300050516 | Bacteria | 1340 |
| 555 | Ga0495601_0118402 | 3300053077 | Bacteria | 1719 |
| 556 | Ga0495601_0659881 | 3300053077 | Bacteria | 669 |
| 557 | Ga0500610_0270227 | 3300053079 | Bacteria | 770 |
| 558 | Ga0500635_0151170 | 3300053080 | Bacteria | 886 |
| 559 | Ga0495619_0088055 | 3300053085 | Bacteria | 2100 |
| 560 | Ga0495619_0553196 | 3300053085 | Bacteria | 789 |
| 561 | Ga0500578_0044563 | 3300053086 | Bacteria | 2847 |
| 562 | Ga0500578_0172036 | 3300053086 | Bacteria | 1339 |
| 563 | Ga0500643_010912 | 3300053087 | Bacteria | 3351 |
| 564 | Ga0500646_0011329 | 3300053090 | Bacteria | 2293 |
| 565 | Ga0500647_0004379 | 3300053091 | Bacteria | 5676 |
| 566 | Ga0500647_0268564 | 3300053091 | Bacteria | 742 |
| 567 | Ga0500583_0010304 | 3300053092 | Bacteria | 3462 |
| 568 | Ga0500651_0245269 | 3300053093 | Bacteria | 1043 |
| 569 | Ga0500651_0271807 | 3300053093 | Bacteria | 980 |
| 570 | Ga0500651_0626987 | 3300053093 | Bacteria | 581 |
| 571 | Ga0500566_0000537 | 3300053094 | Bacteria | 21255 |
| 572 | Ga0500566_0469572 | 3300053094 | Bacteria | 547 |
| 573 | Ga0500555_043595 | 3300053103 | Bacteria | 1243 |
| 574 | Ga0500562_010786 | 3300053108 | Bacteria | 2318 |
| 575 | Ga0500562_012893 | 3300053108 | Bacteria | 2128 |
| 576 | Ga0500569_003017 | 3300053109 | Bacteria | 3384 |
| 577 | Ga0500569_122683 | 3300053109 | Bacteria | 866 |
| 578 | Ga0500594_0226498 | 3300053118 | Bacteria | 619 |
| 579 | Ga0500595_020891 | 3300053119 | Bacteria | 2346 |
| 580 | Ga0500597_290518 | 3300053120 | Bacteria | 656 |
| 581 | Ga0500607_011476 | 3300053121 | Bacteria | 5240 |
| 582 | Ga0500652_288713 | 3300053131 | Bacteria | 638 |
| 583 | Ga0500655_002911 | 3300053133 | Bacteria | 3110 |
| 584 | Ga0500655_020508 | 3300053133 | Bacteria | 1235 |
| 585 | Ga0500655_022495 | 3300053133 | Bacteria | 1187 |
| 586 | Ga0500559_0013563 | 3300053136 | Bacteria | 3449 |
| 587 | Ga0500559_0172098 | 3300053136 | Bacteria | 1018 |
| 588 | Ga0500559_0247820 | 3300053136 | Bacteria | 839 |
| 589 | Ga0500568_0341257 | 3300053139 | Bacteria | 543 |
| 590 | Ga0500577_0025487 | 3300053142 | Bacteria | 2002 |
| 591 | Ga0500577_0066795 | 3300053142 | Bacteria | 1400 |
| 592 | Ga0500577_0496991 | 3300053142 | Bacteria | 533 |
| 593 | Ga0500588_0087037 | 3300053146 | Bacteria | 1056 |
| 594 | Ga0500588_0255444 | 3300053146 | Bacteria | 659 |
| 595 | Ga0500604_0008860 | 3300053151 | Bacteria | 2673 |
| 596 | Ga0500616_0021935 | 3300053153 | Bacteria | 3571 |
| 597 | Ga0500616_0109210 | 3300053153 | Bacteria | 1339 |
| 598 | Ga0500619_023059 | 3300053154 | Bacteria | 1814 |
| 599 | Ga0500622_0009099 | 3300053156 | Bacteria | 5515 |
| 600 | Ga0500622_0284660 | 3300053156 | Bacteria | 711 |
| 601 | Ga0500633_0013201 | 3300053160 | Bacteria | 2307 |
| 602 | Ga0500636_0000076 | 3300053177 | Bacteria | 48321 |
| 603 | Ga0500636_0050783 | 3300053177 | Bacteria | 2439 |
| 604 | Ga0500636_0146857 | 3300053177 | Bacteria | 1299 |
| 605 | Ga0500649_049044 | 3300053722 | Bacteria | 1776 |
| 606 | Ga0500625_007870 | 3300053729 | Bacteria | 4661 |
| 607 | Ga0500645_006515 | 3300053730 | Bacteria | 4153 |
| 608 | Ga0500645_012980 | 3300053730 | Bacteria | 2683 |
| 609 | Ga0500645_094686 | 3300053730 | Bacteria | 845 |
| 610 | Ga0500645_143227 | 3300053730 | Bacteria | 661 |
| 611 | Ga0500596_083865 | 3300053735 | Bacteria | 558 |
| 612 | Ga0500599_000490 | 3300053736 | Bacteria | 4119 |
| 613 | Ga0500601_000249 | 3300053737 | Bacteria | 10384 |
| 614 | Ga0500661_013992 | 3300055283 | Bacteria | 1445 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300015265 | Ga0182005_1211335 | Ga0182005_12113351 | 91 |
| 2 | iso_pu_bacteria | 8016613128 | 8016621579 | 91 |
| 3 | 3300025940 | Ga0207691_10316872 | Ga0207691_103168723 | 92 |
| 4 | 3300053735 | Ga0500596_083865 | Ga0500596_083865_230_541 | 92 |
| 5 | 3300005563 | Ga0068855_101000110 | Ga0068855_1010001102 | 94 |
| 6 | iso_pu_bacteria | 2513237159 | 2513998010 | 94 |
| 7 | iso_pu_bacteria | 2617270735 | 2617353083 | 94 |
| 8 | iso_pu_bacteria | 2643221618 | 2644103706 | 94 |
| 9 | iso_pu_bacteria | 2643221626 | 2644144585 | 94 |
| 10 | iso_pu_bacteria | 2643221655 | 2644306636 | 94 |
| 11 | iso_pu_bacteria | 2643221659 | 2644330826 | 94 |
| 12 | iso_pu_bacteria | 2643221698 | 2644542368 | 94 |
| 13 | iso_pu_bacteria | 2643221712 | 2644612247 | 94 |
| 14 | iso_pu_bacteria | 2643221736 | 2644747112 | 94 |
| 15 | iso_pu_bacteria | 2718218365 | 2721157539 | 94 |
| 16 | iso_pu_bacteria | 2728369397 | 2730297171 | 94 |
| 17 | iso_pu_bacteria | 2765235802 | 2765464044 | 94 |
| 18 | iso_pu_bacteria | 2838022645 | 2838027774 | 94 |
| 19 | iso_pu_bacteria | 2841760612 | 2841762242 | 94 |
| 20 | iso_pu_bacteria | 2842198810 | 2842203670 | 94 |
| 21 | iso_pu_bacteria | 2842521101 | 2842523115 | 94 |
| 22 | iso_pu_bacteria | 2844104063 | 2844109780 | 94 |
| 23 | iso_pu_bacteria | 2844163670 | 2844170018 | 94 |
| 24 | iso_pu_bacteria | 2851246043 | 2851248255 | 94 |
| 25 | iso_pu_bacteria | 2904578770 | 2904579310 | 94 |
| 26 | iso_pu_bacteria | 2919119836 | 2919121864 | 94 |
| 27 | iso_pu_bacteria | 2996310559 | 2996312992 | 94 |
| 28 | iso_pu_bacteria | 3002141150 | 3002142859 | 94 |
| 29 | iso_pu_bacteria | 8005301065 | 8005304196 | 94 |
| 30 | iso_pu_bacteria | 8005688590 | 8005690620 | 94 |
| 31 | iso_pu_bacteria | 8019648815 | 8019656473 | 94 |
| 32 | iso_pu_bacteria | 8024486573 | 8024490075 | 94 |
| 33 | iso_pu_bacteria | 8057529695 | 8057535647 | 94 |
| 34 | 3300053108 | Ga0500562_010786 | Ga0500562_010786_551_874 | 96 |
| 35 | iso_pu_bacteria | 2507262055 | 2507510023 | 96 |
| 36 | iso_pu_bacteria | 2508501009 | 2508544025 | 96 |
| 37 | iso_pu_bacteria | 2508501042 | 2508698041 | 96 |
| 38 | iso_pu_bacteria | 2511231028 | 2511397573 | 96 |
| 39 | iso_pu_bacteria | 2513237092 | 2513628184 | 96 |
| 40 | iso_pu_bacteria | 2513237094 | 2513643553 | 96 |
| 41 | iso_pu_bacteria | 2513237095 | 2513649011 | 96 |
| 42 | iso_pu_bacteria | 2513237102 | 2513702557 | 96 |
| 43 | iso_pu_bacteria | 2513237139 | 2513878127 | 96 |
| 44 | iso_pu_bacteria | 2513237161 | 2514012577 | 96 |
| 45 | iso_pu_bacteria | 2524023205 | 2524439049 | 96 |
| 46 | iso_pu_bacteria | 2528768022 | 2528849596 | 96 |
| 47 | iso_pu_bacteria | 2617270741 | 2617378946 | 96 |
| 48 | iso_pu_bacteria | 2744054633 | 2745078838 | 96 |
| 49 | iso_pu_bacteria | 2791355196 | 2793059998 | 96 |
| 50 | iso_pu_bacteria | 2802429603 | 2805920088 | 96 |
| 51 | iso_pu_bacteria | 2816332527 | 2818241585 | 96 |
| 52 | iso_pu_bacteria | 2824600985 | 2824605611 | 96 |
| 53 | iso_pu_bacteria | 2824609381 | 2824609861 | 96 |
| 54 | iso_pu_bacteria | 2824617872 | 2824625353 | 96 |
| 55 | iso_pu_bacteria | 2824626560 | 2824633840 | 96 |
| 56 | iso_pu_bacteria | 2824635225 | 2824641556 | 96 |
| 57 | iso_pu_bacteria | 2824644064 | 2824649785 | 96 |
| 58 | iso_pu_bacteria | 2824653114 | 2824655740 | 96 |
| 59 | iso_pu_bacteria | 2824661429 | 2824669449 | 96 |
| 60 | iso_pu_bacteria | 2824671348 | 2824674197 | 96 |
| 61 | iso_pu_bacteria | 2824679649 | 2824686181 | 96 |
| 62 | iso_pu_bacteria | 2824687955 | 2824693023 | 96 |
| 63 | iso_pu_bacteria | 2824696289 | 2824698906 | 96 |
| 64 | iso_pu_bacteria | 2824704595 | 2824711485 | 96 |
| 65 | iso_pu_bacteria | 2824714736 | 2824720962 | 96 |
| 66 | iso_pu_bacteria | 2824723954 | 2824729001 | 96 |
| 67 | iso_pu_bacteria | 2824732956 | 2824739207 | 96 |
| 68 | iso_pu_bacteria | 2824746037 | 2824752363 | 96 |
| 69 | iso_pu_bacteria | 2824753945 | 2824758036 | 96 |
| 70 | iso_pu_bacteria | 2824763712 | 2824766174 | 96 |
| 71 | iso_pu_bacteria | 2824773399 | 2824781057 | 96 |
| 72 | iso_pu_bacteria | 2838122688 | 2838127536 | 96 |
| 73 | iso_pu_bacteria | 2841941048 | 2841941511 | 96 |
| 74 | iso_pu_bacteria | 2841949485 | 2841952475 | 96 |
| 75 | iso_pu_bacteria | 2841966195 | 2841967654 | 96 |
| 76 | iso_pu_bacteria | 2841974524 | 2841982179 | 96 |
| 77 | iso_pu_bacteria | 2841983080 | 2841986497 | 96 |
| 78 | iso_pu_bacteria | 2842038055 | 2842038262 | 96 |
| 79 | iso_pu_bacteria | 2842045827 | 2842048793 | 96 |
| 80 | iso_pu_bacteria | 2847930680 | 2847934531 | 96 |
| 81 | iso_pu_bacteria | 2849076700 | 2849080681 | 96 |
| 82 | iso_pu_bacteria | 2857509624 | 2857509957 | 96 |
| 83 | iso_pu_bacteria | 2874590934 | 2874596769 | 96 |
| 84 | iso_pu_bacteria | 2874612657 | 2874618229 | 96 |
| 85 | iso_pu_bacteria | 2874620515 | 2874623218 | 96 |
| 86 | iso_pu_bacteria | 2874645413 | 2874653001 | 96 |
| 87 | iso_pu_bacteria | 2876761206 | 2876766686 | 96 |
| 88 | iso_pu_bacteria | 2876771140 | 2876776935 | 96 |
| 89 | iso_pu_bacteria | 2876818435 | 2876825315 | 96 |
| 90 | iso_pu_bacteria | 2879074833 | 2879081072 | 96 |
| 91 | iso_pu_bacteria | 2879083081 | 2879089722 | 96 |
| 92 | iso_pu_bacteria | 2879099564 | 2879107736 | 96 |
| 93 | iso_pu_bacteria | 2879127579 | 2879130810 | 96 |
| 94 | iso_pu_bacteria | 2879142872 | 2879147600 | 96 |
| 95 | iso_pu_bacteria | 2881364244 | 2881365669 | 96 |
| 96 | iso_pu_bacteria | 2881665667 | 2881671728 | 96 |
| 97 | iso_pu_bacteria | 2885366525 | 2885368940 | 96 |
| 98 | iso_pu_bacteria | 2885409591 | 2885414471 | 96 |
| 99 | iso_pu_bacteria | 2888378607 | 2888382468 | 96 |
| 100 | iso_pu_bacteria | 2888419890 | 2888423048 | 96 |
| 101 | iso_pu_bacteria | 2904666416 | 2904670038 | 96 |
| 102 | iso_pu_bacteria | 2904711408 | 2904718474 | 96 |
| 103 | iso_pu_bacteria | 2906643746 | 2906649925 | 96 |
| 104 | iso_pu_bacteria | 2908775508 | 2908778716 | 96 |
| 105 | iso_pu_bacteria | 2922368715 | 2922375498 | 96 |
| 106 | iso_pu_bacteria | 2922393267 | 2922394989 | 96 |
| 107 | iso_pu_bacteria | 2929615660 | 2929616233 | 96 |
| 108 | iso_pu_bacteria | 2929624759 | 2929624977 | 96 |
| 109 | iso_pu_bacteria | 2932784394 | 2932787100 | 96 |
| 110 | iso_pu_bacteria | 2932809354 | 2932811295 | 96 |
| 111 | iso_pu_bacteria | 2932818245 | 2932819832 | 96 |
| 112 | iso_pu_bacteria | 2932828146 | 2932832310 | 96 |
| 113 | iso_pu_bacteria | 2933577622 | 2933578483 | 96 |
| 114 | iso_pu_bacteria | 2935608549 | 2935611072 | 96 |
| 115 | iso_pu_bacteria | 2935616580 | 2935619020 | 96 |
| 116 | iso_pu_bacteria | 2935638405 | 2935643163 | 96 |
| 117 | iso_pu_bacteria | 2935648319 | 2935648509 | 96 |
| 118 | iso_pu_bacteria | 2935656913 | 2935657503 | 96 |
| 119 | iso_pu_bacteria | 2935665750 | 2935669789 | 96 |
| 120 | iso_pu_bacteria | 2935684952 | 2935693110 | 96 |
| 121 | iso_pu_bacteria | 2935694250 | 2935695399 | 96 |
| 122 | iso_pu_bacteria | 2935703347 | 2935709492 | 96 |
| 123 | iso_pu_bacteria | 2935713505 | 2935719718 | 96 |
| 124 | iso_pu_bacteria | 2935722832 | 2935729515 | 96 |
| 125 | iso_pu_bacteria | 2935732158 | 2935739601 | 96 |
| 126 | iso_pu_bacteria | 2935741537 | 2935748639 | 96 |
| 127 | iso_pu_bacteria | 2935750917 | 2935756774 | 96 |
| 128 | iso_pu_bacteria | 2935760218 | 2935761238 | 96 |
| 129 | iso_pu_bacteria | 2935769743 | 2935771487 | 96 |
| 130 | iso_pu_bacteria | 2935777560 | 2935779176 | 96 |
| 131 | iso_pu_bacteria | 2935785616 | 2935790855 | 96 |
| 132 | iso_pu_bacteria | 2935793552 | 2935799204 | 96 |
| 133 | iso_pu_bacteria | 2935801545 | 2935807307 | 96 |
| 134 | iso_pu_bacteria | 2935810662 | 2935812446 | 96 |
| 135 | iso_pu_bacteria | 2935819856 | 2935820557 | 96 |
| 136 | iso_pu_bacteria | 2935827899 | 2935832693 | 96 |
| 137 | iso_pu_bacteria | 2935837841 | 2935839228 | 96 |
| 138 | iso_pu_bacteria | 2935847175 | 2935849434 | 96 |
| 139 | iso_pu_bacteria | 2935855204 | 2935857385 | 96 |
| 140 | iso_pu_bacteria | 2935864058 | 2935864914 | 96 |
| 141 | iso_pu_bacteria | 2935873716 | 2935876692 | 96 |
| 142 | iso_pu_bacteria | 2935908558 | 2935911792 | 96 |
| 143 | iso_pu_bacteria | 2935916978 | 2935919447 | 96 |
| 144 | iso_pu_bacteria | 2935926038 | 2935928821 | 96 |
| 145 | iso_pu_bacteria | 2935934488 | 2935938466 | 96 |
| 146 | iso_pu_bacteria | 2935942939 | 2935945642 | 96 |
| 147 | iso_pu_bacteria | 2935951376 | 2935954751 | 96 |
| 148 | iso_pu_bacteria | 2935959822 | 2935963350 | 96 |
| 149 | iso_pu_bacteria | 2935967501 | 2935970638 | 96 |
| 150 | iso_pu_bacteria | 2935984226 | 2935987865 | 96 |
| 151 | iso_pu_bacteria | 2935992306 | 2935998957 | 96 |
| 152 | iso_pu_bacteria | 2936002035 | 2936008285 | 96 |
| 153 | iso_pu_bacteria | 2936011229 | 2936011419 | 96 |
| 154 | iso_pu_bacteria | 2936019824 | 2936020014 | 96 |
| 155 | iso_pu_bacteria | 2936028420 | 2936028610 | 96 |
| 156 | iso_pu_bacteria | 2936037263 | 2936039039 | 96 |
| 157 | iso_pu_bacteria | 2936046547 | 2936046737 | 96 |
| 158 | iso_pu_bacteria | 2936055302 | 2936058388 | 96 |
| 159 | iso_pu_bacteria | 2940556831 | 2940562688 | 96 |
| 160 | iso_pu_bacteria | 2941531003 | 2941536380 | 96 |
| 161 | iso_pu_bacteria | 2941538514 | 2941539918 | 96 |
| 162 | iso_pu_bacteria | 3005483717 | 3005487940 | 96 |
| 163 | iso_pu_bacteria | 3005506211 | 3005508738 | 96 |
| 164 | iso_pu_bacteria | 3005587118 | 3005589448 | 96 |
| 165 | iso_pu_bacteria | 3005594810 | 3005597476 | 96 |
| 166 | iso_pu_bacteria | 3005718088 | 3005720912 | 96 |
| 167 | iso_pu_bacteria | 8006926726 | 8006930237 | 96 |
| 168 | iso_pu_bacteria | 8016511872 | 8016515106 | 96 |
| 169 | iso_pu_bacteria | 8016522445 | 8016522895 | 96 |
| 170 | iso_pu_bacteria | 8016530956 | 8016536356 | 96 |
| 171 | iso_pu_bacteria | 8016539877 | 8016540632 | 96 |
| 172 | iso_pu_bacteria | 8016548790 | 8016552611 | 96 |
| 173 | iso_pu_bacteria | 8016557553 | 8016560990 | 96 |
| 174 | iso_pu_bacteria | 8016566248 | 8016574717 | 96 |
| 175 | iso_pu_bacteria | 8016575299 | 8016578792 | 96 |
| 176 | iso_pu_bacteria | 8016595262 | 8016598853 | 96 |
| 177 | iso_pu_bacteria | 8016603502 | 8016612224 | 96 |
| 178 | iso_pu_bacteria | 8016622563 | 8016628379 | 96 |
| 179 | iso_pu_bacteria | 8016630954 | 8016632577 | 96 |
| 180 | iso_pu_bacteria | 8017057580 | 8017061347 | 96 |
| 181 | iso_pu_bacteria | 8019530166 | 8019536076 | 96 |
| 182 | iso_pu_bacteria | 8019538911 | 8019543394 | 96 |
| 183 | iso_pu_bacteria | 8019547302 | 8019555460 | 96 |
| 184 | iso_pu_bacteria | 8019576017 | 8019580818 | 96 |
| 185 | iso_pu_bacteria | 8019586578 | 8019588555 | 96 |
| 186 | iso_pu_bacteria | 8019608314 | 8019615770 | 96 |
| 187 | iso_pu_bacteria | 8019678201 | 8019682756 | 96 |
| 188 | iso_pu_bacteria | 8019687851 | 8019688444 | 96 |
| 189 | iso_pu_bacteria | 8055742211 | 8055747880 | 96 |
| 190 | iso_pu_bacteria | 8056967851 | 8056969541 | 96 |
| 191 | 3300039447 | Ga0436361_0888239 | Ga0436361_0888239_2356_2682 | 97 |
| 192 | 3300003187 | JGI25151J46595_10034751 | JGI25151J46595_100347512 | 98 |
| 193 | 3300003784 | Ga0055534_1027789 | Ga0055534_10277892 | 98 |
| 194 | 3300003791 | Ga0055530_10007145 | Ga0055530_100071457 | 98 |
| 195 | 3300003794 | Ga0055531_10010973 | Ga0055531_100109733 | 98 |
| 196 | 3300005327 | Ga0070658_10230315 | Ga0070658_102303153 | 98 |
| 197 | 3300005331 | Ga0070670_100449246 | Ga0070670_1004492462 | 98 |
| 198 | 3300005339 | Ga0070660_100535887 | Ga0070660_1005358872 | 98 |
| 199 | 3300005355 | Ga0070671_100095040 | Ga0070671_1000950402 | 98 |
| 200 | 3300005355 | Ga0070671_100212039 | Ga0070671_1002120392 | 98 |
| 201 | 3300005367 | Ga0070667_100300318 | Ga0070667_1003003182 | 98 |
| 202 | 3300005456 | Ga0070678_100102649 | Ga0070678_1001026494 | 98 |
| 203 | 3300005457 | Ga0070662_100048293 | Ga0070662_1000482932 | 98 |
| 204 | 3300005458 | Ga0070681_10082606 | Ga0070681_100826063 | 98 |
| 205 | 3300005535 | Ga0070684_101002342 | Ga0070684_1010023422 | 98 |
| 206 | 3300005536 | Ga0070697_100055346 | Ga0070697_1000553464 | 98 |
| 207 | 3300005539 | Ga0068853_100693682 | Ga0068853_1006936822 | 98 |
| 208 | 3300005548 | Ga0070665_100768901 | Ga0070665_1007689012 | 98 |
| 209 | 3300005563 | Ga0068855_100025743 | Ga0068855_1000257435 | 98 |
| 210 | 3300005564 | Ga0070664_100620956 | Ga0070664_1006209562 | 98 |
| 211 | 3300005578 | Ga0068854_100487372 | Ga0068854_1004873723 | 98 |
| 212 | 3300005614 | Ga0068856_100189953 | Ga0068856_1001899533 | 98 |
| 213 | 3300005618 | Ga0068864_100176401 | Ga0068864_1001764012 | 98 |
| 214 | 3300005841 | Ga0068863_100361821 | Ga0068863_1003618213 | 98 |
| 215 | 3300005842 | Ga0068858_100955076 | Ga0068858_1009550762 | 98 |
| 216 | 3300005842 | Ga0068858_101301050 | Ga0068858_1013010502 | 98 |
| 217 | 3300005843 | Ga0068860_100154260 | Ga0068860_1001542602 | 98 |
| 218 | 3300005985 | Ga0081539_10007629 | Ga0081539_1000762916 | 98 |
| 219 | 3300005985 | Ga0081539_10012883 | Ga0081539_100128835 | 98 |
| 220 | 3300006038 | Ga0075365_10075845 | Ga0075365_100758454 | 98 |
| 221 | 3300006178 | Ga0075367_10159833 | Ga0075367_101598332 | 98 |
| 222 | 3300006186 | Ga0075369_10038153 | Ga0075369_100381531 | 98 |
| 223 | 3300006186 | Ga0075369_10049252 | Ga0075369_100492522 | 98 |
| 224 | 3300006195 | Ga0075366_10906387 | Ga0075366_109063871 | 98 |
| 225 | 3300006237 | Ga0097621_100215853 | Ga0097621_1002158533 | 98 |
| 226 | 3300007788 | Ga0099795_10191363 | Ga0099795_101913632 | 98 |
| 227 | 3300009093 | Ga0105240_10002229 | Ga0105240_1000222916 | 98 |
| 228 | 3300009093 | Ga0105240_10082573 | Ga0105240_100825733 | 98 |
| 229 | 3300009098 | Ga0105245_11967275 | Ga0105245_119672751 | 98 |
| 230 | 3300009177 | Ga0105248_10033433 | Ga0105248_100334332 | 98 |
| 231 | 3300009177 | Ga0105248_11799650 | Ga0105248_117996501 | 98 |
| 232 | 3300009545 | Ga0105237_11240748 | Ga0105237_112407482 | 98 |
| 233 | 3300009551 | Ga0105238_10755742 | Ga0105238_107557422 | 98 |
| 234 | 3300010159 | Ga0099796_10466465 | Ga0099796_104664651 | 98 |
| 235 | 3300010375 | Ga0105239_10667163 | Ga0105239_106671632 | 98 |
| 236 | 3300013104 | Ga0157370_10115884 | Ga0157370_101158843 | 98 |
| 237 | 3300013105 | Ga0157369_10757107 | Ga0157369_107571072 | 98 |
| 238 | 3300013297 | Ga0157378_11211786 | Ga0157378_112117862 | 98 |
| 239 | 3300013306 | Ga0163162_11785283 | Ga0163162_117852831 | 98 |
| 240 | 3300013308 | Ga0157375_10278080 | Ga0157375_102780802 | 98 |
| 241 | 3300014325 | Ga0163163_10232514 | Ga0163163_102325142 | 98 |
| 242 | 3300014968 | Ga0157379_10386935 | Ga0157379_103869351 | 98 |
| 243 | 3300014969 | Ga0157376_10408002 | Ga0157376_104080022 | 98 |
| 244 | 3300017792 | Ga0163161_10584685 | Ga0163161_105846852 | 98 |
| 245 | 3300025294 | Ga0209025_1001616 | Ga0209025_100161612 | 98 |
| 246 | 3300025294 | Ga0209025_1041117 | Ga0209025_10411173 | 98 |
| 247 | 3300025298 | Ga0209050_1000173 | Ga0209050_1000173132 | 98 |
| 248 | 3300025304 | Ga0209257_1000196 | Ga0209257_1000196132 | 98 |
| 249 | 3300025304 | Ga0209257_1035331 | Ga0209257_10353312 | 98 |
| 250 | 3300025903 | Ga0207680_10086878 | Ga0207680_100868781 | 98 |
| 251 | 3300025909 | Ga0207705_10095723 | Ga0207705_100957232 | 98 |
| 252 | 3300025910 | Ga0207684_10340970 | Ga0207684_103409701 | 98 |
| 253 | 3300025912 | Ga0207707_10094516 | Ga0207707_100945162 | 98 |
| 254 | 3300025913 | Ga0207695_10023959 | Ga0207695_100239596 | 98 |
| 255 | 3300025913 | Ga0207695_10393373 | Ga0207695_103933733 | 98 |
| 256 | 3300025924 | Ga0207694_10308585 | Ga0207694_103085851 | 98 |
| 257 | 3300025925 | Ga0207650_10885012 | Ga0207650_108850122 | 98 |
| 258 | 3300025931 | Ga0207644_10303418 | Ga0207644_103034182 | 98 |
| 259 | 3300025931 | Ga0207644_10339800 | Ga0207644_103398002 | 98 |
| 260 | 3300025933 | Ga0207706_10180298 | Ga0207706_101802982 | 98 |
| 261 | 3300025941 | Ga0207711_10176615 | Ga0207711_101766152 | 98 |
| 262 | 3300025945 | Ga0207679_10265107 | Ga0207679_102651072 | 98 |
| 263 | 3300025945 | Ga0207679_12135175 | Ga0207679_121351751 | 98 |
| 264 | 3300025949 | Ga0207667_10103609 | Ga0207667_101036095 | 98 |
| 265 | 3300025981 | Ga0207640_10530660 | Ga0207640_105306602 | 98 |
| 266 | 3300025986 | Ga0207658_10370661 | Ga0207658_103706612 | 98 |
| 267 | 3300025986 | Ga0207658_10520135 | Ga0207658_105201352 | 98 |
| 268 | 3300025986 | Ga0207658_10810689 | Ga0207658_108106892 | 98 |
| 269 | 3300026035 | Ga0207703_10729068 | Ga0207703_107290681 | 98 |
| 270 | 3300026078 | Ga0207702_10216281 | Ga0207702_102162813 | 98 |
| 271 | 3300026095 | Ga0207676_10053941 | Ga0207676_100539413 | 98 |
| 272 | 3300026121 | Ga0207683_10051407 | Ga0207683_100514073 | 98 |
| 273 | 3300028379 | Ga0268266_10216436 | Ga0268266_102164362 | 98 |
| 274 | 3300028381 | Ga0268264_11730696 | Ga0268264_117306961 | 98 |
| 275 | 3300028786 | Ga0307517_10031603 | Ga0307517_100316035 | 98 |
| 276 | 3300030731 | Ga0316177_1161710 | Ga0316177_11617102 | 98 |
| 277 | 3300030731 | Ga0316177_1194283 | Ga0316177_11942833 | 98 |
| 278 | 3300030736 | Ga0316180_1185350 | Ga0316180_11853506 | 98 |
| 279 | 3300030744 | Ga0316181_1269212 | Ga0316181_12692122 | 98 |
| 280 | 3300030745 | Ga0316182_1089562 | Ga0316182_10895622 | 98 |
| 281 | 3300031456 | Ga0307513_10003074 | Ga0307513_1000307421 | 98 |
| 282 | 3300031616 | Ga0307508_10755496 | Ga0307508_107554961 | 98 |
| 283 | 3300031730 | Ga0307516_10082010 | Ga0307516_100820103 | 98 |
| 284 | 3300031731 | Ga0307405_10782352 | Ga0307405_107823522 | 98 |
| 285 | 3300031911 | Ga0307412_10286706 | Ga0307412_102867062 | 98 |
| 286 | 3300031911 | Ga0307412_10741324 | Ga0307412_107413241 | 98 |
| 287 | 3300031911 | Ga0307412_11312568 | Ga0307412_113125681 | 98 |
| 288 | 3300032002 | Ga0307416_100718263 | Ga0307416_1007182631 | 98 |
| 289 | 3300032002 | Ga0307416_102149545 | Ga0307416_1021495452 | 98 |
| 290 | 3300032004 | Ga0307414_10058278 | Ga0307414_100582784 | 98 |
| 291 | 3300032004 | Ga0307414_10356818 | Ga0307414_103568182 | 98 |
| 292 | 3300032004 | Ga0307414_11356899 | Ga0307414_113568992 | 98 |
| 293 | 3300032005 | Ga0307411_10060445 | Ga0307411_100604453 | 98 |
| 294 | 3300033180 | Ga0307510_10156576 | Ga0307510_101565763 | 98 |
| 295 | 3300037471 | Ga0395905_0583896 | Ga0395905_0583896_186_515 | 98 |
| 296 | 3300041404 | Ga0439436_0000605 | Ga0439436_0000605_8902_9231 | 98 |
| 297 | 3300041405 | Ga0439438_124292 | Ga0439438_124292_243_572 | 98 |
| 298 | 3300041406 | Ga0439439_0006362 | Ga0439439_0006362_2247_2576 | 98 |
| 299 | 3300041413 | Ga0439465_0001602 | Ga0439465_0001602_401_730 | 98 |
| 300 | 3300041505 | Ga0451849_0710854 | Ga0451849_0710854_174_503 | 98 |
| 301 | 3300041507 | Ga0451851_1128638 | Ga0451851_1128638_42_371 | 98 |
| 302 | 3300041512 | Ga0451853_1629056 | Ga0451853_1629056_242_571 | 98 |
| 303 | 3300042005 | Ga0439448_0027589 | Ga0439448_0027589_1289_1618 | 98 |
| 304 | 3300042007 | Ga0439449_0018394 | Ga0439449_0018394_1301_1630 | 98 |
| 305 | 3300042010 | Ga0439452_085394 | Ga0439452_085394_58_387 | 98 |
| 306 | 3300042012 | Ga0439455_0007379 | Ga0439455_0007379_684_1013 | 98 |
| 307 | 3300042014 | Ga0439457_009322 | Ga0439457_009322_25_354 | 98 |
| 308 | 3300042145 | Ga0450906_000256 | Ga0450906_000256_6549_6878 | 98 |
| 309 | 3300042146 | Ga0450907_048480 | Ga0450907_048480_173_502 | 98 |
| 310 | 3300042147 | Ga0450910_010689 | Ga0450910_010689_76_405 | 98 |
| 311 | 3300042185 | Ga0450909_032558 | Ga0450909_032558_118_447 | 98 |
| 312 | 3300042435 | Ga0439434_0140271 | Ga0439434_0140271_130_459 | 98 |
| 313 | 3300042531 | Ga0450918_003752 | Ga0450918_003752_1112_1441 | 98 |
| 314 | 3300044658 | Ga0466972_0421416 | Ga0466972_0421416_229_558 | 98 |
| 315 | 3300045049 | Ga0466959_0117008 | Ga0466959_0117008_711_1040 | 98 |
| 316 | 3300046477 | Ga0495664_0155960 | Ga0495664_0155960_315_644 | 98 |
| 317 | 3300046506 | Ga0495583_0140772 | Ga0495583_0140772_130_459 | 98 |
| 318 | 3300046507 | Ga0495606_0339592 | Ga0495606_0339592_177_506 | 98 |
| 319 | 3300046524 | Ga0495648_0040932 | Ga0495648_0040932_415_744 | 98 |
| 320 | 3300046526 | Ga0495666_0145146 | Ga0495666_0145146_50_379 | 98 |
| 321 | 3300046528 | Ga0495642_0016284 | Ga0495642_0016284_258_587 | 98 |
| 322 | 3300046616 | Ga0495668_0014834 | Ga0495668_0014834_3300_3629 | 98 |
| 323 | 3300046648 | Ga0495611_0026685 | Ga0495611_0026685_1746_2075 | 98 |
| 324 | 3300046660 | Ga0495625_0005726 | Ga0495625_0005726_3276_3605 | 98 |
| 325 | 3300046660 | Ga0495625_0008262 | Ga0495625_0008262_3721_4050 | 98 |
| 326 | 3300046660 | Ga0495625_0282428 | Ga0495625_0282428_40_369 | 98 |
| 327 | 3300046660 | Ga0495625_0805503 | Ga0495625_0805503_103_432 | 98 |
| 328 | 3300046675 | Ga0495657_0328671 | Ga0495657_0328671_357_686 | 98 |
| 329 | 3300046683 | Ga0495658_0123202 | Ga0495658_0123202_404_733 | 98 |
| 330 | 3300046684 | Ga0495669_0007293 | Ga0495669_0007293_2488_2817 | 98 |
| 331 | 3300046684 | Ga0495669_0376333 | Ga0495669_0376333_122_451 | 98 |
| 332 | 3300046691 | Ga0495670_0530829 | Ga0495670_0530829_198_527 | 98 |
| 333 | 3300046809 | Ga0495600_0933889 | Ga0495600_0933889_151_480 | 98 |
| 334 | 3300047317 | Ga0495604_0172143 | Ga0495604_0172143_477_806 | 98 |
| 335 | 3300047445 | Ga0495677_0218506 | Ga0495677_0218506_327_656 | 98 |
| 336 | 3300047470 | Ga0495681_0122985 | Ga0495681_0122985_381_710 | 98 |
| 337 | 3300047472 | Ga0495686_0011106 | Ga0495686_0011106_2909_3247 | 98 |
| 338 | 3300047472 | Ga0495686_0017861 | Ga0495686_0017861_658_987 | 98 |
| 339 | 3300048088 | Ga0495602_0116479 | Ga0495602_0116479_294_623 | 98 |
| 340 | 3300048903 | Ga0496100_1057565 | Ga0496100_1057565_53_382 | 98 |
| 341 | 3300048904 | Ga0496101_0341634 | Ga0496101_0341634_401_730 | 98 |
| 342 | 3300048905 | Ga0496102_0321878 | Ga0496102_0321878_1085_1414 | 98 |
| 343 | 3300048907 | Ga0496104_1186332 | Ga0496104_1186332_208_537 | 98 |
| 344 | 3300048909 | Ga0496106_0197483 | Ga0496106_0197483_356_685 | 98 |
| 345 | 3300048910 | Ga0496107_0425422 | Ga0496107_0425422_486_815 | 98 |
| 346 | 3300048911 | Ga0496108_1301059 | Ga0496108_1301059_70_399 | 98 |
| 347 | 3300048912 | Ga0496109_0020224 | Ga0496109_0020224_4461_4790 | 98 |
| 348 | 3300048915 | Ga0496112_0156335 | Ga0496112_0156335_1145_1474 | 98 |
| 349 | 3300048915 | Ga0496112_0849698 | Ga0496112_0849698_85_414 | 98 |
| 350 | 3300048916 | Ga0496113_0156872 | Ga0496113_0156872_13_342 | 98 |
| 351 | 3300048918 | Ga0496115_0199085 | Ga0496115_0199085_940_1269 | 98 |
| 352 | 3300048919 | Ga0496116_0005222 | Ga0496116_0005222_11526_11855 | 98 |
| 353 | 3300048920 | Ga0496117_0102014 | Ga0496117_0102014_1329_1658 | 98 |
| 354 | 3300048921 | Ga0496118_0079870 | Ga0496118_0079870_994_1323 | 98 |
| 355 | 3300048924 | Ga0496121_0199386 | Ga0496121_0199386_739_1068 | 98 |
| 356 | 3300048924 | Ga0496121_0340794 | Ga0496121_0340794_20_349 | 98 |
| 357 | 3300048925 | Ga0496122_0036120 | Ga0496122_0036120_99_428 | 98 |
| 358 | 3300048925 | Ga0496122_0274083 | Ga0496122_0274083_588_917 | 98 |
| 359 | 3300048926 | Ga0496123_0040182 | Ga0496123_0040182_2630_2959 | 98 |
| 360 | 3300048927 | Ga0496124_0000072 | Ga0496124_0000072_47759_48088 | 98 |
| 361 | 3300048928 | Ga0496125_0185179 | Ga0496125_0185179_900_1229 | 98 |
| 362 | 3300048928 | Ga0496125_0264126 | Ga0496125_0264126_355_684 | 98 |
| 363 | 3300049686 | Ga0501257_233758 | Ga0501257_233758_181_510 | 98 |
| 364 | 3300050491 | nmdc:mga00v17_908014_c1 | nmdc:mga00v17_908014_c1_60_389 | 98 |
| 365 | 3300050492 | nmdc:mga0yw44_106066_c1 | nmdc:mga0yw44_106066_c1_115_444 | 98 |
| 366 | 3300050492 | nmdc:mga0yw44_585087_c1 | nmdc:mga0yw44_585087_c1_34_363 | 98 |
| 367 | 3300050492 | nmdc:mga0yw44_64951_c1 | nmdc:mga0yw44_64951_c1_1771_2100 | 98 |
| 368 | 3300050493 | nmdc:mga0k408_232439_c1 | nmdc:mga0k408_232439_c1_601_930 | 98 |
| 369 | 3300050494 | nmdc:mga06z11_73991_c1 | nmdc:mga06z11_73991_c1_142_471 | 98 |
| 370 | 3300050516 | nmdc:mga0sz30_169577_c1 | nmdc:mga0sz30_169577_c1_412_741 | 98 |
| 371 | 3300053077 | Ga0495601_0118402 | Ga0495601_0118402_1272_1601 | 98 |
| 372 | 3300053080 | Ga0500635_0151170 | Ga0500635_0151170_489_818 | 98 |
| 373 | 3300053085 | Ga0495619_0553196 | Ga0495619_0553196_192_521 | 98 |
| 374 | 3300053090 | Ga0500646_0011329 | Ga0500646_0011329_1505_1834 | 98 |
| 375 | 3300053091 | Ga0500647_0004379 | Ga0500647_0004379_415_744 | 98 |
| 376 | 3300053092 | Ga0500583_0010304 | Ga0500583_0010304_845_1174 | 98 |
| 377 | 3300053093 | Ga0500651_0271807 | Ga0500651_0271807_265_594 | 98 |
| 378 | 3300053103 | Ga0500555_043595 | Ga0500555_043595_332_661 | 98 |
| 379 | 3300053133 | Ga0500655_002911 | Ga0500655_002911_1177_1506 | 98 |
| 380 | 3300053133 | Ga0500655_020508 | Ga0500655_020508_399_743 | 98 |
| 381 | 3300053133 | Ga0500655_022495 | Ga0500655_022495_521_850 | 98 |
| 382 | 3300053136 | Ga0500559_0247820 | Ga0500559_0247820_222_551 | 98 |
| 383 | 3300053139 | Ga0500568_0341257 | Ga0500568_0341257_140_469 | 98 |
| 384 | 3300053142 | Ga0500577_0496991 | Ga0500577_0496991_34_363 | 98 |
| 385 | 3300053146 | Ga0500588_0255444 | Ga0500588_0255444_194_523 | 98 |
| 386 | 3300053151 | Ga0500604_0008860 | Ga0500604_0008860_644_973 | 98 |
| 387 | 3300053153 | Ga0500616_0109210 | Ga0500616_0109210_314_643 | 98 |
| 388 | 3300053156 | Ga0500622_0284660 | Ga0500622_0284660_79_411 | 98 |
| 389 | 3300053177 | Ga0500636_0146857 | Ga0500636_0146857_146_475 | 98 |
| 390 | 3300053730 | Ga0500645_006515 | Ga0500645_006515_396_725 | 98 |
| 391 | 3300053730 | Ga0500645_012980 | Ga0500645_012980_1769_2098 | 98 |
| 392 | 3300053730 | Ga0500645_094686 | Ga0500645_094686_338_667 | 98 |
| 393 | iso_pu_bacteria | 2513237104 | 2513720536 | 98 |
| 394 | iso_pu_bacteria | 2932794094 | 2932797327 | 98 |
| 395 | iso_pu_bacteria | 2932801729 | 2932804788 | 98 |
| 396 | iso_pu_bacteria | 2935675223 | 2935677071 | 98 |
| 397 | 3300003320 | rootH2_10037340 | rootH2_100373406 | 99 |
| 398 | 3300003323 | rootH1_10023157 | rootH1_100231577 | 99 |
| 399 | 3300025939 | Ga0207665_10285229 | Ga0207665_102852291 | 99 |
| 400 | iso_pu_bacteria | 2841957949 | 2841959496 | 99 |
| 401 | iso_pu_bacteria | 2847939898 | 2847945138 | 99 |
| 402 | iso_pu_bacteria | 2903727486 | 2903735421 | 99 |
| 403 | iso_pu_bacteria | 2906602504 | 2906608660 | 99 |
| 404 | iso_pu_bacteria | 3005710791 | 3005713506 | 99 |
| 405 | 3300001989 | JGI24739J22299_10080875 | JGI24739J22299_100808752 | 100 |
| 406 | 3300002067 | JGI24735J21928_10182759 | JGI24735J21928_101827591 | 100 |
| 407 | 3300003215 | JGI25153J46596_10000920 | JGI25153J46596_1000092019 | 100 |
| 408 | 3300003215 | JGI25153J46596_10001125 | JGI25153J46596_100011254 | 100 |
| 409 | 3300003215 | JGI25153J46596_10002262 | JGI25153J46596_1000226212 | 100 |
| 410 | 3300003215 | JGI25153J46596_10056866 | JGI25153J46596_100568662 | 100 |
| 411 | 3300003323 | rootH1_10082836 | rootH1_100828363 | 100 |
| 412 | 3300003354 | JGI25160J50197_1000504 | JGI25160J50197_100050416 | 100 |
| 413 | 3300003354 | JGI25160J50197_1034350 | JGI25160J50197_10343502 | 100 |
| 414 | 3300003762 | Ga0055542_1021755 | Ga0055542_10217551 | 100 |
| 415 | 3300003771 | Ga0055526_1054742 | Ga0055526_10547422 | 100 |
| 416 | 3300003794 | Ga0055531_10004813 | Ga0055531_100048132 | 100 |
| 417 | 3300003794 | Ga0055531_10047828 | Ga0055531_100478281 | 100 |
| 418 | 3300004625 | Ga0055543_1029488 | Ga0055543_10294881 | 100 |
| 419 | 3300005262 | Ga0065165_1000278 | Ga0065165_100027844 | 100 |
| 420 | 3300005262 | Ga0065165_1002349 | Ga0065165_100234919 | 100 |
| 421 | 3300005262 | Ga0065165_1064628 | Ga0065165_10646281 | 100 |
| 422 | 3300005327 | Ga0070658_10426009 | Ga0070658_104260093 | 100 |
| 423 | 3300005331 | Ga0070670_101958049 | Ga0070670_1019580491 | 100 |
| 424 | 3300005335 | Ga0070666_10301582 | Ga0070666_103015823 | 100 |
| 425 | 3300005337 | Ga0070682_100834730 | Ga0070682_1008347301 | 100 |
| 426 | 3300005338 | Ga0068868_100260338 | Ga0068868_1002603382 | 100 |
| 427 | 3300005339 | Ga0070660_100090206 | Ga0070660_1000902062 | 100 |
| 428 | 3300005343 | Ga0070687_101467247 | Ga0070687_1014672471 | 100 |
| 429 | 3300005344 | Ga0070661_100223681 | Ga0070661_1002236813 | 100 |
| 430 | 3300005347 | Ga0070668_100026997 | Ga0070668_1000269976 | 100 |
| 431 | 3300005347 | Ga0070668_100164454 | Ga0070668_1001644543 | 100 |
| 432 | 3300005347 | Ga0070668_102051535 | Ga0070668_1020515352 | 100 |
| 433 | 3300005355 | Ga0070671_100034351 | Ga0070671_1000343514 | 100 |
| 434 | 3300005364 | Ga0070673_100549704 | Ga0070673_1005497042 | 100 |
| 435 | 3300005366 | Ga0070659_100125344 | Ga0070659_1001253443 | 100 |
| 436 | 3300005455 | Ga0070663_100167747 | Ga0070663_1001677472 | 100 |
| 437 | 3300005455 | Ga0070663_100279293 | Ga0070663_1002792933 | 100 |
| 438 | 3300005455 | Ga0070663_101287135 | Ga0070663_1012871351 | 100 |
| 439 | 3300005457 | Ga0070662_100131977 | Ga0070662_1001319774 | 100 |
| 440 | 3300005530 | Ga0070679_101237795 | Ga0070679_1012377951 | 100 |
| 441 | 3300005535 | Ga0070684_101256490 | Ga0070684_1012564902 | 100 |
| 442 | 3300005539 | Ga0068853_100670497 | Ga0068853_1006704972 | 100 |
| 443 | 3300005546 | Ga0070696_101527513 | Ga0070696_1015275131 | 100 |
| 444 | 3300005548 | Ga0070665_100834317 | Ga0070665_1008343172 | 100 |
| 445 | 3300005563 | Ga0068855_100150995 | Ga0068855_1001509955 | 100 |
| 446 | 3300005564 | Ga0070664_101418207 | Ga0070664_1014182072 | 100 |
| 447 | 3300005577 | Ga0068857_100285909 | Ga0068857_1002859094 | 100 |
| 448 | 3300005578 | Ga0068854_100322525 | Ga0068854_1003225253 | 100 |
| 449 | 3300005578 | Ga0068854_101792683 | Ga0068854_1017926832 | 100 |
| 450 | 3300005614 | Ga0068856_100429825 | Ga0068856_1004298252 | 100 |
| 451 | 3300005614 | Ga0068856_101187176 | Ga0068856_1011871762 | 100 |
| 452 | 3300005616 | Ga0068852_100030886 | Ga0068852_1000308863 | 100 |
| 453 | 3300005616 | Ga0068852_100304950 | Ga0068852_1003049503 | 100 |
| 454 | 3300005616 | Ga0068852_102094699 | Ga0068852_1020946992 | 100 |
| 455 | 3300005617 | Ga0068859_100500733 | Ga0068859_1005007332 | 100 |
| 456 | 3300005719 | Ga0068861_102300670 | Ga0068861_1023006702 | 100 |
| 457 | 3300005834 | Ga0068851_10190163 | Ga0068851_101901632 | 100 |
| 458 | 3300005841 | Ga0068863_101416724 | Ga0068863_1014167242 | 100 |
| 459 | 3300005842 | Ga0068858_100808582 | Ga0068858_1008085822 | 100 |
| 460 | 3300005843 | Ga0068860_100466678 | Ga0068860_1004666782 | 100 |
| 461 | 3300005843 | Ga0068860_100971742 | Ga0068860_1009717421 | 100 |
| 462 | 3300005844 | Ga0068862_100722053 | Ga0068862_1007220532 | 100 |
| 463 | 3300005981 | Ga0081538_10189026 | Ga0081538_101890262 | 100 |
| 464 | 3300005983 | Ga0081540_1109605 | Ga0081540_11096052 | 100 |
| 465 | 3300006028 | Ga0070717_11632077 | Ga0070717_116320771 | 100 |
| 466 | 3300006038 | Ga0075365_10039463 | Ga0075365_100394632 | 100 |
| 467 | 3300006038 | Ga0075365_10052571 | Ga0075365_100525713 | 100 |
| 468 | 3300006038 | Ga0075365_10632402 | Ga0075365_106324021 | 100 |
| 469 | 3300006038 | Ga0075365_10650661 | Ga0075365_106506612 | 100 |
| 470 | 3300006042 | Ga0075368_10007174 | Ga0075368_100071744 | 100 |
| 471 | 3300006048 | Ga0075363_100001650 | Ga0075363_1000016508 | 100 |
| 472 | 3300006048 | Ga0075363_100265970 | Ga0075363_1002659703 | 100 |
| 473 | 3300006051 | Ga0075364_10160045 | Ga0075364_101600452 | 100 |
| 474 | 3300006177 | Ga0075362_10056719 | Ga0075362_100567194 | 100 |
| 475 | 3300006178 | Ga0075367_10111355 | Ga0075367_101113552 | 100 |
| 476 | 3300006178 | Ga0075367_10116181 | Ga0075367_101161811 | 100 |
| 477 | 3300006178 | Ga0075367_10485205 | Ga0075367_104852051 | 100 |
| 478 | 3300006186 | Ga0075369_10019487 | Ga0075369_100194873 | 100 |
| 479 | 3300006186 | Ga0075369_10099972 | Ga0075369_100999722 | 100 |
| 480 | 3300006195 | Ga0075366_10249464 | Ga0075366_102494642 | 100 |
| 481 | 3300006195 | Ga0075366_10892764 | Ga0075366_108927642 | 100 |
| 482 | 3300006353 | Ga0075370_10051002 | Ga0075370_100510022 | 100 |
| 483 | 3300006358 | Ga0068871_102109783 | Ga0068871_1021097831 | 100 |
| 484 | 3300006931 | Ga0097620_100500698 | Ga0097620_1005006982 | 100 |
| 485 | 3300006942 | Ga0099824_1016622 | Ga0099824_101662210 | 100 |
| 486 | 3300006944 | Ga0099823_1027325 | Ga0099823_10273256 | 100 |
| 487 | 3300009093 | Ga0105240_12251048 | Ga0105240_122510481 | 100 |
| 488 | 3300009098 | Ga0105245_13090658 | Ga0105245_130906581 | 100 |
| 489 | 3300009101 | Ga0105247_10123462 | Ga0105247_101234624 | 100 |
| 490 | 3300009148 | Ga0105243_10048108 | Ga0105243_100481083 | 100 |
| 491 | 3300009174 | Ga0105241_10089422 | Ga0105241_100894224 | 100 |
| 492 | 3300009174 | Ga0105241_10128044 | Ga0105241_101280444 | 100 |
| 493 | 3300009174 | Ga0105241_10424439 | Ga0105241_104244392 | 100 |
| 494 | 3300009176 | Ga0105242_10440098 | Ga0105242_104400983 | 100 |
| 495 | 3300009177 | Ga0105248_10099852 | Ga0105248_100998524 | 100 |
| 496 | 3300009177 | Ga0105248_10943174 | Ga0105248_109431741 | 100 |
| 497 | 3300009177 | Ga0105248_13231138 | Ga0105248_132311381 | 100 |
| 498 | 3300009545 | Ga0105237_10035674 | Ga0105237_100356746 | 100 |
| 499 | 3300009545 | Ga0105237_10274451 | Ga0105237_102744512 | 100 |
| 500 | 3300009551 | Ga0105238_10820238 | Ga0105238_108202382 | 100 |
| 501 | 3300009551 | Ga0105238_11863117 | Ga0105238_118631171 | 100 |
| 502 | 3300009551 | Ga0105238_12227338 | Ga0105238_122273381 | 100 |
| 503 | 3300009551 | Ga0105238_12995031 | Ga0105238_129950311 | 100 |
| 504 | 3300009553 | Ga0105249_10310925 | Ga0105249_103109252 | 100 |
| 505 | 3300010375 | Ga0105239_10022884 | Ga0105239_100228846 | 100 |
| 506 | 3300010375 | Ga0105239_10238225 | Ga0105239_102382253 | 100 |
| 507 | 3300010375 | Ga0105239_10439169 | Ga0105239_104391692 | 100 |
| 508 | 3300010375 | Ga0105239_10626918 | Ga0105239_106269181 | 100 |
| 509 | 3300010375 | Ga0105239_11797712 | Ga0105239_117977122 | 100 |
| 510 | 3300011119 | Ga0105246_10041441 | Ga0105246_100414414 | 100 |
| 511 | 3300013104 | Ga0157370_11182077 | Ga0157370_111820771 | 100 |
| 512 | 3300013105 | Ga0157369_10707693 | Ga0157369_107076931 | 100 |
| 513 | 3300013105 | Ga0157369_10876278 | Ga0157369_108762782 | 100 |
| 514 | 3300013296 | Ga0157374_10368990 | Ga0157374_103689903 | 100 |
| 515 | 3300013297 | Ga0157378_11897925 | Ga0157378_118979252 | 100 |
| 516 | 3300013307 | Ga0157372_12503103 | Ga0157372_125031031 | 100 |
| 517 | 3300013308 | Ga0157375_10744496 | Ga0157375_107444961 | 100 |
| 518 | 3300014325 | Ga0163163_10138673 | Ga0163163_101386731 | 100 |
| 519 | 3300014325 | Ga0163163_10153121 | Ga0163163_101531214 | 100 |
| 520 | 3300014497 | Ga0182008_10290928 | Ga0182008_102909282 | 100 |
| 521 | 3300014968 | Ga0157379_11232481 | Ga0157379_112324812 | 100 |
| 522 | 3300017792 | Ga0163161_10656866 | Ga0163161_106568662 | 100 |
| 523 | 3300021320 | Ga0214544_1000020 | Ga0214544_1000020168 | 100 |
| 524 | 3300021320 | Ga0214544_1033003 | Ga0214544_10330032 | 100 |
| 525 | 3300021320 | Ga0214544_1037219 | Ga0214544_10372192 | 100 |
| 526 | 3300021321 | Ga0214542_1000024 | Ga0214542_1000024179 | 100 |
| 527 | 3300021321 | Ga0214542_1040209 | Ga0214542_10402092 | 100 |
| 528 | 3300021324 | Ga0214545_1000011 | Ga0214545_1000011179 | 100 |
| 529 | 3300021327 | Ga0214543_1000033 | Ga0214543_100003325 | 100 |
| 530 | 3300021327 | Ga0214543_1047985 | Ga0214543_10479852 | 100 |
| 531 | 3300021384 | Ga0213876_10717198 | Ga0213876_107171981 | 100 |
| 532 | 3300025245 | Ga0207425_1027894 | Ga0207425_10278943 | 100 |
| 533 | 3300025253 | Ga0209677_105274 | Ga0209677_1052744 | 100 |
| 534 | 3300025254 | Ga0209148_1000574 | Ga0209148_100057418 | 100 |
| 535 | 3300025261 | Ga0209233_1004212 | Ga0209233_10042124 | 100 |
| 536 | 3300025261 | Ga0209233_1010224 | Ga0209233_10102242 | 100 |
| 537 | 3300025272 | Ga0209455_1000834 | Ga0209455_100083415 | 100 |
| 538 | 3300025272 | Ga0209455_1050977 | Ga0209455_10509771 | 100 |
| 539 | 3300025295 | Ga0209564_1029379 | Ga0209564_10293792 | 100 |
| 540 | 3300025297 | Ga0209758_1000065 | Ga0209758_100006525 | 100 |
| 541 | 3300025297 | Ga0209758_1000498 | Ga0209758_100049826 | 100 |
| 542 | 3300025297 | Ga0209758_1000560 | Ga0209758_100056015 | 100 |
| 543 | 3300025297 | Ga0209758_1014068 | Ga0209758_10140682 | 100 |
| 544 | 3300025297 | Ga0209758_1164100 | Ga0209758_11641001 | 100 |
| 545 | 3300025299 | Ga0209256_1011226 | Ga0209256_10112261 | 100 |
| 546 | 3300025299 | Ga0209256_1116341 | Ga0209256_11163412 | 100 |
| 547 | 3300025302 | Ga0207426_1000721 | Ga0207426_100072115 | 100 |
| 548 | 3300025302 | Ga0207426_1000728 | Ga0207426_100072823 | 100 |
| 549 | 3300025302 | Ga0207426_1100856 | Ga0207426_11008561 | 100 |
| 550 | 3300025303 | Ga0209051_1092645 | Ga0209051_10926452 | 100 |
| 551 | 3300025304 | Ga0209257_1001031 | Ga0209257_100103132 | 100 |
| 552 | 3300025304 | Ga0209257_1021240 | Ga0209257_10212404 | 100 |
| 553 | 3300025315 | Ga0207697_10021892 | Ga0207697_100218923 | 100 |
| 554 | 3300025321 | Ga0207656_10729292 | Ga0207656_107292922 | 100 |
| 555 | 3300025900 | Ga0207710_10121717 | Ga0207710_101217171 | 100 |
| 556 | 3300025900 | Ga0207710_10304419 | Ga0207710_103044191 | 100 |
| 557 | 3300025901 | Ga0207688_11036869 | Ga0207688_110368691 | 100 |
| 558 | 3300025903 | Ga0207680_10324419 | Ga0207680_103244191 | 100 |
| 559 | 3300025904 | Ga0207647_10011713 | Ga0207647_100117134 | 100 |
| 560 | 3300025904 | Ga0207647_10334274 | Ga0207647_103342741 | 100 |
| 561 | 3300025909 | Ga0207705_10027327 | Ga0207705_100273271 | 100 |
| 562 | 3300025911 | Ga0207654_10020949 | Ga0207654_100209495 | 100 |
| 563 | 3300025911 | Ga0207654_10050199 | Ga0207654_100501992 | 100 |
| 564 | 3300025911 | Ga0207654_10067495 | Ga0207654_100674952 | 100 |
| 565 | 3300025911 | Ga0207654_10361558 | Ga0207654_103615582 | 100 |
| 566 | 3300025913 | Ga0207695_10000029 | Ga0207695_1000002993 | 100 |
| 567 | 3300025914 | Ga0207671_10003068 | Ga0207671_100030684 | 100 |
| 568 | 3300025918 | Ga0207662_11022588 | Ga0207662_110225881 | 100 |
| 569 | 3300025919 | Ga0207657_10135966 | Ga0207657_101359661 | 100 |
| 570 | 3300025919 | Ga0207657_11433002 | Ga0207657_114330021 | 100 |
| 571 | 3300025920 | Ga0207649_10054356 | Ga0207649_100543564 | 100 |
| 572 | 3300025920 | Ga0207649_11134007 | Ga0207649_111340072 | 100 |
| 573 | 3300025924 | Ga0207694_10532211 | Ga0207694_105322113 | 100 |
| 574 | 3300025924 | Ga0207694_10690806 | Ga0207694_106908062 | 100 |
| 575 | 3300025926 | Ga0207659_10693112 | Ga0207659_106931121 | 100 |
| 576 | 3300025927 | Ga0207687_10204343 | Ga0207687_102043432 | 100 |
| 577 | 3300025927 | Ga0207687_10514698 | Ga0207687_105146982 | 100 |
| 578 | 3300025931 | Ga0207644_10009377 | Ga0207644_100093774 | 100 |
| 579 | 3300025933 | Ga0207706_11548871 | Ga0207706_115488712 | 100 |
| 580 | 3300025935 | Ga0207709_10792011 | Ga0207709_107920112 | 100 |
| 581 | 3300025941 | Ga0207711_10123427 | Ga0207711_101234274 | 100 |
| 582 | 3300025941 | Ga0207711_10378230 | Ga0207711_103782303 | 100 |
| 583 | 3300025949 | Ga0207667_10825017 | Ga0207667_108250172 | 100 |
| 584 | 3300025972 | Ga0207668_10257924 | Ga0207668_102579243 | 100 |
| 585 | 3300025972 | Ga0207668_10351653 | Ga0207668_103516532 | 100 |
| 586 | 3300025981 | Ga0207640_10784450 | Ga0207640_107844502 | 100 |
| 587 | 3300025981 | Ga0207640_11341075 | Ga0207640_113410751 | 100 |
| 588 | 3300025981 | Ga0207640_11513376 | Ga0207640_115133761 | 100 |
| 589 | 3300025986 | Ga0207658_10068331 | Ga0207658_100683312 | 100 |
| 590 | 3300025986 | Ga0207658_11737019 | Ga0207658_117370192 | 100 |
| 591 | 3300026035 | Ga0207703_10181815 | Ga0207703_101818152 | 100 |
| 592 | 3300026041 | Ga0207639_10304814 | Ga0207639_103048143 | 100 |
| 593 | 3300026041 | Ga0207639_11061557 | Ga0207639_110615572 | 100 |
| 594 | 3300026041 | Ga0207639_11507003 | Ga0207639_115070031 | 100 |
| 595 | 3300026041 | Ga0207639_11520168 | Ga0207639_115201681 | 100 |
| 596 | 3300026067 | Ga0207678_10066105 | Ga0207678_100661053 | 100 |
| 597 | 3300026067 | Ga0207678_10707327 | Ga0207678_107073271 | 100 |
| 598 | 3300026078 | Ga0207702_10207401 | Ga0207702_102074011 | 100 |
| 599 | 3300026078 | Ga0207702_10276208 | Ga0207702_102762081 | 100 |
| 600 | 3300026088 | Ga0207641_10254720 | Ga0207641_102547201 | 100 |
| 601 | 3300026116 | Ga0207674_10117439 | Ga0207674_101174394 | 100 |
| 602 | 3300026118 | Ga0207675_100544898 | Ga0207675_1005448981 | 100 |
| 603 | 3300026142 | Ga0207698_10086772 | Ga0207698_100867724 | 100 |
| 604 | 3300026142 | Ga0207698_11996904 | Ga0207698_119969041 | 100 |
| 605 | 3300026142 | Ga0207698_12213536 | Ga0207698_122135362 | 100 |
| 606 | 3300027296 | Ga0209389_1000011 | Ga0209389_100001138 | 100 |
| 607 | 3300027296 | Ga0209389_1000025 | Ga0209389_1000025100 | 100 |
| 608 | 3300027357 | Ga0209589_1000066 | Ga0209589_100006649 | 100 |
| 609 | 3300027361 | Ga0209489_100017 | Ga0209489_100017196 | 100 |
| 610 | 3300027361 | Ga0209489_100030 | Ga0209489_10003064 | 100 |
| 611 | 3300027363 | Ga0209700_100027 | Ga0209700_10002738 | 100 |
| 612 | 3300027866 | Ga0209813_10018694 | Ga0209813_100186944 | 100 |
| 613 | 3300028379 | Ga0268266_11181599 | Ga0268266_111815992 | 100 |
| 614 | 3300028380 | Ga0268265_10648204 | Ga0268265_106482043 | 100 |
| 615 | 3300028381 | Ga0268264_10221943 | Ga0268264_102219433 | 100 |
| 616 | 3300032002 | Ga0307416_100222438 | Ga0307416_1002224383 | 100 |
| 617 | 3300032002 | Ga0307416_102016514 | Ga0307416_1020165142 | 100 |
| 618 | 3300032002 | Ga0307416_102298020 | Ga0307416_1022980202 | 100 |
| 619 | 3300032126 | Ga0307415_100308769 | Ga0307415_1003087692 | 100 |
| 620 | 3300032126 | Ga0307415_100515087 | Ga0307415_1005150872 | 100 |
| 621 | 3300033180 | Ga0307510_10018544 | Ga0307510_100185446 | 100 |
| 622 | 3300033180 | Ga0307510_10049877 | Ga0307510_100498775 | 100 |
| 623 | 3300037471 | Ga0395905_0019296 | Ga0395905_0019296_4137_4472 | 100 |
| 624 | 3300037853 | Ga0436364_0628597 | Ga0436364_0628597_121_456 | 100 |
| 625 | 3300037853 | Ga0436364_0758834 | Ga0436364_0758834_148_483 | 100 |
| 626 | 3300038443 | Ga0395901_0112041 | Ga0395901_0112041_1565_1900 | 100 |
| 627 | 3300039437 | Ga0436365_0903985 | Ga0436365_0903985_81_416 | 100 |
| 628 | 3300039437 | Ga0436365_1551576 | Ga0436365_1551576_27_362 | 100 |
| 629 | 3300041413 | Ga0439465_0022870 | Ga0439465_0022870_186_539 | 100 |
| 630 | 3300041451 | Ga0451791_0384925 | Ga0451791_0384925_427_762 | 100 |
| 631 | 3300041452 | Ga0451793_0966425 | Ga0451793_0966425_31_366 | 100 |
| 632 | 3300041460 | Ga0451802_2124237 | Ga0451802_2124237_396_731 | 100 |
| 633 | 3300041498 | Ga0451841_0728594 | Ga0451841_0728594_205_540 | 100 |
| 634 | 3300044656 | Ga0466969_0014853 | Ga0466969_0014853_2658_2993 | 100 |
| 635 | 3300044658 | Ga0466972_0051607 | Ga0466972_0051607_129_464 | 100 |
| 636 | 3300044683 | Ga0466965_0047899 | Ga0466965_0047899_913_1248 | 100 |
| 637 | 3300044684 | Ga0466966_0001348 | Ga0466966_0001348_11035_11370 | 100 |
| 638 | 3300044693 | Ga0466961_0000120 | Ga0466961_0000120_39742_40077 | 100 |
| 639 | 3300044693 | Ga0466961_0516478 | Ga0466961_0516478_274_609 | 100 |
| 640 | 3300044694 | Ga0466963_0011705 | Ga0466963_0011705_3414_3749 | 100 |
| 641 | 3300044706 | Ga0466964_0122591 | Ga0466964_0122591_631_966 | 100 |
| 642 | 3300044706 | Ga0466964_0268634 | Ga0466964_0268634_56_391 | 100 |
| 643 | 3300044706 | Ga0466964_0313606 | Ga0466964_0313606_331_666 | 100 |
| 644 | 3300044735 | Ga0466968_0003277 | Ga0466968_0003277_525_860 | 100 |
| 645 | 3300044901 | Ga0466960_0018574 | Ga0466960_0018574_375_710 | 100 |
| 646 | 3300044901 | Ga0466960_0235957 | Ga0466960_0235957_102_437 | 100 |
| 647 | 3300045049 | Ga0466959_0108014 | Ga0466959_0108014_960_1295 | 100 |
| 648 | 3300045976 | Ga0466967_0041384 | Ga0466967_0041384_3552_3887 | 100 |
| 649 | 3300046459 | Ga0495629_0004834 | Ga0495629_0004834_9363_9698 | 100 |
| 650 | 3300046460 | Ga0495638_0004073 | Ga0495638_0004073_9510_9845 | 100 |
| 651 | 3300046462 | Ga0495651_0358019 | Ga0495651_0358019_56_391 | 100 |
| 652 | 3300046471 | Ga0495650_0248396 | Ga0495650_0248396_70_405 | 100 |
| 653 | 3300046472 | Ga0495580_0411540 | Ga0495580_0411540_108_443 | 100 |
| 654 | 3300046474 | Ga0495605_0096450 | Ga0495605_0096450_55_390 | 100 |
| 655 | 3300046474 | Ga0495605_0167246 | Ga0495605_0167246_112_447 | 100 |
| 656 | 3300046476 | Ga0495662_0177843 | Ga0495662_0177843_287_622 | 100 |
| 657 | 3300046492 | Ga0495585_0204208 | Ga0495585_0204208_625_960 | 100 |
| 658 | 3300046500 | Ga0495596_0150544 | Ga0495596_0150544_508_843 | 100 |
| 659 | 3300046501 | Ga0495607_0214652 | Ga0495607_0214652_253_588 | 100 |
| 660 | 3300046507 | Ga0495606_0014314 | Ga0495606_0014314_5432_5767 | 100 |
| 661 | 3300046507 | Ga0495606_0054446 | Ga0495606_0054446_1823_2158 | 100 |
| 662 | 3300046507 | Ga0495606_0113453 | Ga0495606_0113453_471_806 | 100 |
| 663 | 3300046512 | Ga0495610_0074032 | Ga0495610_0074032_621_956 | 100 |
| 664 | 3300046513 | Ga0495616_0071766 | Ga0495616_0071766_675_1010 | 100 |
| 665 | 3300046513 | Ga0495616_0148793 | Ga0495616_0148793_232_567 | 100 |
| 666 | 3300046514 | Ga0495618_0089914 | Ga0495618_0089914_1352_1687 | 100 |
| 667 | 3300046516 | Ga0495628_0230964 | Ga0495628_0230964_339_674 | 100 |
| 668 | 3300046517 | Ga0495630_0732728 | Ga0495630_0732728_58_393 | 100 |
| 669 | 3300046522 | Ga0495643_0076606 | Ga0495643_0076606_1052_1387 | 100 |
| 670 | 3300046524 | Ga0495648_0030954 | Ga0495648_0030954_498_833 | 100 |
| 671 | 3300046524 | Ga0495648_0069995 | Ga0495648_0069995_1402_1737 | 100 |
| 672 | 3300046524 | Ga0495648_0135996 | Ga0495648_0135996_894_1229 | 100 |
| 673 | 3300046529 | Ga0495652_0017641 | Ga0495652_0017641_5196_5531 | 100 |
| 674 | 3300046531 | Ga0495665_0499674 | Ga0495665_0499674_54_389 | 100 |
| 675 | 3300046533 | Ga0495640_0280720 | Ga0495640_0280720_492_827 | 100 |
| 676 | 3300046542 | Ga0495597_0259918 | Ga0495597_0259918_52_387 | 100 |
| 677 | 3300046557 | Ga0495622_0031173 | Ga0495622_0031173_1400_1735 | 100 |
| 678 | 3300046616 | Ga0495668_0083471 | Ga0495668_0083471_986_1321 | 100 |
| 679 | 3300046616 | Ga0495668_0110449 | Ga0495668_0110449_211_546 | 100 |
| 680 | 3300046642 | Ga0495634_0513388 | Ga0495634_0513388_286_621 | 100 |
| 681 | 3300046660 | Ga0495625_0554945 | Ga0495625_0554945_91_426 | 100 |
| 682 | 3300046663 | Ga0495635_0046740 | Ga0495635_0046740_191_526 | 100 |
| 683 | 3300046665 | Ga0495661_0234390 | Ga0495661_0234390_594_929 | 100 |
| 684 | 3300046674 | Ga0495588_0202712 | Ga0495588_0202712_273_608 | 100 |
| 685 | 3300046674 | Ga0495588_0371934 | Ga0495588_0371934_376_711 | 100 |
| 686 | 3300046680 | Ga0495646_0212150 | Ga0495646_0212150_489_824 | 100 |
| 687 | 3300046690 | Ga0495624_0061882 | Ga0495624_0061882_725_1060 | 100 |
| 688 | 3300046692 | Ga0495671_0220428 | Ga0495671_0220428_413_748 | 100 |
| 689 | 3300046694 | Ga0495649_0182836 | Ga0495649_0182836_86_421 | 100 |
| 690 | 3300046694 | Ga0495649_0260970 | Ga0495649_0260970_200_535 | 100 |
| 691 | 3300046694 | Ga0495649_0367849 | Ga0495649_0367849_338_673 | 100 |
| 692 | 3300046694 | Ga0495649_0460802 | Ga0495649_0460802_242_577 | 100 |
| 693 | 3300046794 | Ga0495589_0124374 | Ga0495589_0124374_896_1231 | 100 |
| 694 | 3300047317 | Ga0495604_0070415 | Ga0495604_0070415_78_413 | 100 |
| 695 | 3300047320 | Ga0495672_0405426 | Ga0495672_0405426_116_451 | 100 |
| 696 | 3300047323 | Ga0495683_0021360 | Ga0495683_0021360_1007_1342 | 100 |
| 697 | 3300047323 | Ga0495683_0281248 | Ga0495683_0281248_287_622 | 100 |
| 698 | 3300047443 | Ga0495687_011038 | Ga0495687_011038_2397_2732 | 100 |
| 699 | 3300047443 | Ga0495687_144991 | Ga0495687_144991_469_804 | 100 |
| 700 | 3300047469 | Ga0495673_0078367 | Ga0495673_0078367_455_790 | 100 |
| 701 | 3300047472 | Ga0495686_0157905 | Ga0495686_0157905_447_782 | 100 |
| 702 | 3300047472 | Ga0495686_0269320 | Ga0495686_0269320_50_385 | 100 |
| 703 | 3300047673 | Ga0495593_0114662 | Ga0495593_0114662_275_610 | 100 |
| 704 | 3300048088 | Ga0495602_0239731 | Ga0495602_0239731_994_1329 | 100 |
| 705 | 3300048089 | Ga0495614_0545223 | Ga0495614_0545223_65_400 | 100 |
| 706 | 3300048091 | Ga0495626_0129938 | Ga0495626_0129938_664_999 | 100 |
| 707 | 3300048903 | Ga0496100_0225421 | Ga0496100_0225421_472_807 | 100 |
| 708 | 3300048904 | Ga0496101_0121402 | Ga0496101_0121402_785_1120 | 100 |
| 709 | 3300048904 | Ga0496101_0465456 | Ga0496101_0465456_653_988 | 100 |
| 710 | 3300048905 | Ga0496102_0034116 | Ga0496102_0034116_2774_3109 | 100 |
| 711 | 3300048905 | Ga0496102_0209752 | Ga0496102_0209752_1452_1787 | 100 |
| 712 | 3300048906 | Ga0496103_0002701 | Ga0496103_0002701_1545_1880 | 100 |
| 713 | 3300048907 | Ga0496104_0075514 | Ga0496104_0075514_2344_2679 | 100 |
| 714 | 3300048907 | Ga0496104_0453246 | Ga0496104_0453246_68_403 | 100 |
| 715 | 3300048907 | Ga0496104_0617030 | Ga0496104_0617030_620_955 | 100 |
| 716 | 3300048908 | Ga0496105_0145330 | Ga0496105_0145330_1589_1924 | 100 |
| 717 | 3300048908 | Ga0496105_0544021 | Ga0496105_0544021_394_729 | 100 |
| 718 | 3300048908 | Ga0496105_0743588 | Ga0496105_0743588_123_458 | 100 |
| 719 | 3300048910 | Ga0496107_0391746 | Ga0496107_0391746_276_611 | 100 |
| 720 | 3300048911 | Ga0496108_0083771 | Ga0496108_0083771_1708_2043 | 100 |
| 721 | 3300048911 | Ga0496108_0144795 | Ga0496108_0144795_91_426 | 100 |
| 722 | 3300048911 | Ga0496108_1644775 | Ga0496108_1644775_14_349 | 100 |
| 723 | 3300048912 | Ga0496109_0732158 | Ga0496109_0732158_513_848 | 100 |
| 724 | 3300048913 | Ga0496110_0092863 | Ga0496110_0092863_1023_1358 | 100 |
| 725 | 3300048913 | Ga0496110_1293961 | Ga0496110_1293961_83_418 | 100 |
| 726 | 3300048914 | Ga0496111_0215895 | Ga0496111_0215895_972_1307 | 100 |
| 727 | 3300048915 | Ga0496112_0134434 | Ga0496112_0134434_713_1048 | 100 |
| 728 | 3300048915 | Ga0496112_1080722 | Ga0496112_1080722_300_635 | 100 |
| 729 | 3300048916 | Ga0496113_0111091 | Ga0496113_0111091_253_588 | 100 |
| 730 | 3300048916 | Ga0496113_0178795 | Ga0496113_0178795_533_868 | 100 |
| 731 | 3300048917 | Ga0496114_0422794 | Ga0496114_0422794_291_626 | 100 |
| 732 | 3300048917 | Ga0496114_0650782 | Ga0496114_0650782_527_862 | 100 |
| 733 | 3300048917 | Ga0496114_0962835 | Ga0496114_0962835_288_623 | 100 |
| 734 | 3300048918 | Ga0496115_0226271 | Ga0496115_0226271_338_673 | 100 |
| 735 | 3300048919 | Ga0496116_0112814 | Ga0496116_0112814_799_1134 | 100 |
| 736 | 3300048920 | Ga0496117_0320548 | Ga0496117_0320548_409_744 | 100 |
| 737 | 3300048920 | Ga0496117_0345597 | Ga0496117_0345597_254_589 | 100 |
| 738 | 3300048921 | Ga0496118_0018021 | Ga0496118_0018021_3837_4172 | 100 |
| 739 | 3300048921 | Ga0496118_0068786 | Ga0496118_0068786_916_1251 | 100 |
| 740 | 3300048921 | Ga0496118_0128153 | Ga0496118_0128153_77_412 | 100 |
| 741 | 3300048921 | Ga0496118_0297806 | Ga0496118_0297806_507_842 | 100 |
| 742 | 3300048922 | Ga0496119_0011409 | Ga0496119_0011409_404_739 | 100 |
| 743 | 3300048922 | Ga0496119_0141423 | Ga0496119_0141423_342_677 | 100 |
| 744 | 3300048923 | Ga0496120_0194813 | Ga0496120_0194813_382_717 | 100 |
| 745 | 3300048924 | Ga0496121_0029418 | Ga0496121_0029418_4585_4920 | 100 |
| 746 | 3300048924 | Ga0496121_0034794 | Ga0496121_0034794_557_892 | 100 |
| 747 | 3300048924 | Ga0496121_0074310 | Ga0496121_0074310_396_731 | 100 |
| 748 | 3300048924 | Ga0496121_0267977 | Ga0496121_0267977_112_447 | 100 |
| 749 | 3300048925 | Ga0496122_0318389 | Ga0496122_0318389_310_645 | 100 |
| 750 | 3300048927 | Ga0496124_0537839 | Ga0496124_0537839_366_701 | 100 |
| 751 | 3300048928 | Ga0496125_0016125 | Ga0496125_0016125_6388_6723 | 100 |
| 752 | 3300048928 | Ga0496125_0069446 | Ga0496125_0069446_1856_2191 | 100 |
| 753 | 3300048928 | Ga0496125_0094222 | Ga0496125_0094222_727_1062 | 100 |
| 754 | 3300048929 | Ga0496126_0048730 | Ga0496126_0048730_1667_2002 | 100 |
| 755 | 3300048929 | Ga0496126_0063564 | Ga0496126_0063564_1824_2159 | 100 |
| 756 | 3300048929 | Ga0496126_1015894 | Ga0496126_1015894_168_503 | 100 |
| 757 | 3300049460 | Ga0495682_0051280 | Ga0495682_0051280_1130_1465 | 100 |
| 758 | 3300049460 | Ga0495682_0064472 | Ga0495682_0064472_15_350 | 100 |
| 759 | 3300050489 | nmdc:mga03683_57034_c1 | nmdc:mga03683_57034_c1_346_681 | 100 |
| 760 | 3300050491 | nmdc:mga00v17_114811_c1 | nmdc:mga00v17_114811_c1_374_709 | 100 |
| 761 | 3300050491 | nmdc:mga00v17_228874_c1 | nmdc:mga00v17_228874_c1_843_1178 | 100 |
| 762 | 3300050492 | nmdc:mga0yw44_360835_c1 | nmdc:mga0yw44_360835_c1_352_687 | 100 |
| 763 | 3300050493 | nmdc:mga0k408_33345_c1 | nmdc:mga0k408_33345_c1_450_785 | 100 |
| 764 | 3300050494 | nmdc:mga06z11_472901_c1 | nmdc:mga06z11_472901_c1_408_743 | 100 |
| 765 | 3300050494 | nmdc:mga06z11_572403_c1 | nmdc:mga06z11_572403_c1_279_614 | 100 |
| 766 | 3300050495 | nmdc:mga04h51_22238_c1 | nmdc:mga04h51_22238_c1_1384_1719 | 100 |
| 767 | 3300050496 | nmdc:mga07m45_149174_c1 | nmdc:mga07m45_149174_c1_911_1246 | 100 |
| 768 | 3300050516 | nmdc:mga0sz30_116467_c1 | nmdc:mga0sz30_116467_c1_688_1023 | 100 |
| 769 | 3300050516 | nmdc:mga0sz30_89222_c1 | nmdc:mga0sz30_89222_c1_787_1122 | 100 |
| 770 | 3300053077 | Ga0495601_0659881 | Ga0495601_0659881_105_440 | 100 |
| 771 | 3300053079 | Ga0500610_0270227 | Ga0500610_0270227_202_537 | 100 |
| 772 | 3300053085 | Ga0495619_0088055 | Ga0495619_0088055_397_732 | 100 |
| 773 | 3300053086 | Ga0500578_0044563 | Ga0500578_0044563_1502_1837 | 100 |
| 774 | 3300053086 | Ga0500578_0172036 | Ga0500578_0172036_611_946 | 100 |
| 775 | 3300053087 | Ga0500643_010912 | Ga0500643_010912_2166_2525 | 100 |
| 776 | 3300053091 | Ga0500647_0268564 | Ga0500647_0268564_155_490 | 100 |
| 777 | 3300053093 | Ga0500651_0245269 | Ga0500651_0245269_312_647 | 100 |
| 778 | 3300053093 | Ga0500651_0626987 | Ga0500651_0626987_145_480 | 100 |
| 779 | 3300053094 | Ga0500566_0000537 | Ga0500566_0000537_9226_9561 | 100 |
| 780 | 3300053094 | Ga0500566_0469572 | Ga0500566_0469572_153_488 | 100 |
| 781 | 3300053108 | Ga0500562_012893 | Ga0500562_012893_1322_1657 | 100 |
| 782 | 3300053109 | Ga0500569_003017 | Ga0500569_003017_1369_1704 | 100 |
| 783 | 3300053109 | Ga0500569_122683 | Ga0500569_122683_313_648 | 100 |
| 784 | 3300053118 | Ga0500594_0226498 | Ga0500594_0226498_175_510 | 100 |
| 785 | 3300053119 | Ga0500595_020891 | Ga0500595_020891_161_496 | 100 |
| 786 | 3300053120 | Ga0500597_290518 | Ga0500597_290518_228_563 | 100 |
| 787 | 3300053121 | Ga0500607_011476 | Ga0500607_011476_1794_2129 | 100 |
| 788 | 3300053131 | Ga0500652_288713 | Ga0500652_288713_225_560 | 100 |
| 789 | 3300053136 | Ga0500559_0013563 | Ga0500559_0013563_862_1197 | 100 |
| 790 | 3300053136 | Ga0500559_0172098 | Ga0500559_0172098_581_916 | 100 |
| 791 | 3300053142 | Ga0500577_0025487 | Ga0500577_0025487_1247_1582 | 100 |
| 792 | 3300053142 | Ga0500577_0066795 | Ga0500577_0066795_798_1133 | 100 |
| 793 | 3300053146 | Ga0500588_0087037 | Ga0500588_0087037_98_433 | 100 |
| 794 | 3300053153 | Ga0500616_0021935 | Ga0500616_0021935_182_517 | 100 |
| 795 | 3300053154 | Ga0500619_023059 | Ga0500619_023059_1390_1725 | 100 |
| 796 | 3300053156 | Ga0500622_0009099 | Ga0500622_0009099_44_379 | 100 |
| 797 | 3300053160 | Ga0500633_0013201 | Ga0500633_0013201_1625_1960 | 100 |
| 798 | 3300053177 | Ga0500636_0000076 | Ga0500636_0000076_35404_35739 | 100 |
| 799 | 3300053177 | Ga0500636_0050783 | Ga0500636_0050783_202_537 | 100 |
| 800 | 3300053722 | Ga0500649_049044 | Ga0500649_049044_186_521 | 100 |
| 801 | 3300053729 | Ga0500625_007870 | Ga0500625_007870_993_1328 | 100 |
| 802 | 3300053730 | Ga0500645_143227 | Ga0500645_143227_211_546 | 100 |
| 803 | 3300053736 | Ga0500599_000490 | Ga0500599_000490_1651_1986 | 100 |
| 804 | 3300053737 | Ga0500601_000249 | Ga0500601_000249_9850_10185 | 100 |
| 805 | 3300055283 | Ga0500661_013992 | Ga0500661_013992_992_1327 | 100 |
| 806 | 3300009553 | Ga0105249_12087974 | Ga0105249_120879741 | 101 |
| 807 | 3300025961 | Ga0207712_11450369 | Ga0207712_114503692 | 101 |
| 808 | 2010549000 | RicEn_C9286 | RicEn_162720 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9323 | 21 | 76 |
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.9236 | 18 | 76 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.913 | 19 | 77 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.9073 | 21 | 77 |
| 2p4w-assembly1.cif.gz_A | crystal structure of heat shock regulator from pyrococcus furiosus | 0.9032 | 7 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9402 | 16 | 78 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9323 | 21 | 76 | 1.10.10.10 |
| af_O94553_84_149_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9266 | 18 | 77 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9228 | 18 | 75 | 1.10.10.10 |
| 5zuoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9215 | 35 | 77 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9PWD2-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.966 | 7 | 78 |
GO:0003700
GO:0016020 |
| AF-A0A530QKL1-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9603 | 7 | 76 |
GO:0003700
|
| AF-A0A1G2IGX9-F1-model_v4 | HTH arsR-type domain-containing protein | 0.96 | 6 | 77 |
GO:0003700
|
| AF-A0A0G2AN63-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9464 | 7 | 77 |
GO:0003700
|
| AF-E4KMI1-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9384 | 8 | 77 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar