F481668

General Info

Members Datasets Scaffolds Average Seq Length
806 469 746 237

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_201199_c1|nmdc:mga08x19_201199_c1_328_1146
Length 272
Sequence MRRHAARGHGLCMHAGQQSGNLKEGESPMGSNWDWQVFLQDPGGKYPTYWQWMLSAWGWTVSVALLALIVALVLGSLIGIIRTLPNSPWLVRLGNAWVELFRNIPLLVQIFLWYHVIPALVPVMKGVPSFVLVVLALGFFTSARIAEQVRSGIQALPKGQRYAGMAVGFTTAQYYRYVILPMAYRIIIPPLTSETMNIFKNSSVAFAVSVAELTMFAMQAQEETSRGIEVYLAVTACYVVSALVINRLMAFIEKKTRVPGFIVSASSGGGGH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2816332133 Acidovorax radicis 2721A Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
27 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
28 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
31 2842733646 Variovorax sp. R-72446 Isolate Unclassified
32 2842747753 Variovorax sp. R-72060 Isolate Unclassified
33 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
34 2885198086 Variovorax sp. 679 Isolate Unclassified
35 2885211737 Variovorax sp. 553 Isolate Unclassified
36 2899924645 Variovorax sp. 369 Isolate Unclassified
37 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
38 2904456579 Variovorax sp. 2002 Isolate Unclassified
39 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
40 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
41 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
42 2928037797 Variovorax sp. 1126 Isolate Unclassified
43 2928044640 Variovorax sp. 1128 Isolate Unclassified
44 2928051484 Variovorax sp. 1133 Isolate Unclassified
45 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
46 2928070936 Variovorax gossypii 1167 Isolate Unclassified
47 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
48 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
49 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
50 2929520902 Variovorax beijingensis 502 Isolate Unclassified
51 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
52 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
53 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
54 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
55 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
56 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
57 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
58 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
59 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
60 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
61 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
62 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
66 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
67 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
68 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
69 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
72 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
73 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
74 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
79 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
80 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
81 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
84 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
85 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
86 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
87 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
88 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
89 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
90 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
93 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
94 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
100 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
103 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
104 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
105 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
108 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
109 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
110 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
111 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
115 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
120 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
121 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
133 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
147 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
159 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
160 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
163 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
164 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
172 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
173 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
178 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
179 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
197 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
252 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
254 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
260 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
261 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
262 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
263 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
264 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
265 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
266 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
267 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
268 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
269 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
270 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
275 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
278 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
279 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
286 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
296 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
297 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
298 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
299 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
300 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
301 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
302 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
305 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
306 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
307 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
308 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
309 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
310 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
311 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
312 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
313 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
314 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
315 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
316 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
317 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
318 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
319 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
320 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
321 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
322 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
323 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
324 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
325 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
326 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
327 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
328 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
329 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
330 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
331 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
332 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
333 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
334 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
335 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
336 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
337 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
338 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
339 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
340 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
341 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
342 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
343 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
344 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
345 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
348 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
349 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
350 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
351 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
361 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
364 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
365 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
366 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
373 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
374 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
377 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
378 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
379 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
380 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
381 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
382 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
383 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
384 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
385 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
386 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
387 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
388 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
389 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
390 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
391 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
392 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
393 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
412 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
413 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
414 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
415 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
417 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
418 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
419 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
420 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
421 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
422 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
423 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
424 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
425 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
426 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
427 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
428 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
429 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
430 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
431 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
432 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
433 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
434 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
435 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
436 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
437 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
438 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
439 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
443 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
444 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
445 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
446 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
449 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
450 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
451 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
452 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
453 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
454 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
455 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
456 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
457 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
458 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
459 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
460 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
461 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
462 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
463 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
464 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
465 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
466 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
467 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
468 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.18
Metatranscriptomes 0.37
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.96
Nodule 0.62
Rhizoplane 4.22
Rhizosphere 64.02
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3746793 2162886007 Bacteria 2597
2 SwRhRL2b_contig_610863 2162886007 Bacteria 1357
3 JGI24740J21852_10018062 3300001979 Bacteria 2511
4 JGI24739J22299_10055276 3300001989 Bacteria 1269
5 JGI24739J22299_10056873 3300001989 Bacteria 1246
6 JGI25158J39367_1010187 3300002739 Bacteria 1273
7 JGI25152J39213_1003336 3300002773 Bacteria 5526
8 JGI25152J39213_1003566 3300002773 Bacteria 5267
9 JGI25150J39212_1000738 3300002774 Bacteria 11596
10 JGI25150J39212_1002908 3300002774 Bacteria 4142
11 JGI25159J45721_1005944 3300002987 Bacteria 3743
12 JGI25159J45721_1009574 3300002987 Bacteria 2545
13 JGI25151J46595_10005919 3300003187 Bacteria 6238
14 JGI25151J46595_10009155 3300003187 Bacteria 4712
15 JGI25151J46595_10010213 3300003187 Bacteria 4378
16 JGI25153J46596_10008968 3300003215 Bacteria 4712
17 JGI25153J46596_10010079 3300003215 Bacteria 4310
18 rootH1_10006334 3300003316 Bacteria 1734
19 rootH2_10097452 3300003320 Bacteria 1460
20 rootH1_10003106 3300003323 Bacteria 1609
21 JGI25160J50197_1010406 3300003354 Bacteria 3368
22 JGI25160J50197_1017894 3300003354 Bacteria 2227
23 JGI25161J50226_1003339 3300003374 Bacteria 3712
24 JGI25161J50226_1005841 3300003374 Bacteria 2313
25 Ga0006562J51391_1031713 3300003578 Bacteria 2367
26 Ga0055525_1000031 3300003759 Bacteria 314909
27 Ga0055535_1000790 3300003761 Bacteria 23053
28 Ga0055542_1000091 3300003762 Bacteria 121973
29 Ga0055526_1012334 3300003771 Bacteria 3743
30 Ga0055526_1012373 3300003771 Bacteria 3732
31 Ga0055537_1000842 3300003773 Bacteria 14933
32 Ga0055537_1004834 3300003773 Bacteria 3743
33 Ga0055537_1004874 3300003773 Bacteria 3720
34 Ga0055524_1010252 3300003775 Bacteria 3743
35 Ga0055524_1010305 3300003775 Bacteria 3732
36 Ga0055536_1001211 3300003781 Bacteria 16007
37 Ga0055536_1011717 3300003781 Bacteria 3326
38 Ga0055536_1021502 3300003781 Bacteria 1955
39 Ga0055534_1000290 3300003784 Bacteria 33979
40 Ga0055534_1000787 3300003784 Bacteria 14768
41 Ga0055534_1002934 3300003784 Bacteria 5651
42 Ga0055534_1003711 3300003784 Bacteria 4712
43 Ga0055528_1002803 3300003790 Bacteria 9114
44 Ga0055528_1010131 3300003790 Bacteria 3868
45 Ga0055528_1010575 3300003790 Bacteria 3743
46 Ga0055530_10001775 3300003791 Bacteria 14996
47 Ga0055530_10017768 3300003791 Bacteria 2215
48 Ga0055540_1004087 3300003792 Bacteria 6760
49 Ga0055540_1005591 3300003792 Bacteria 5235
50 Ga0055540_1007080 3300003792 Bacteria 4309
51 Ga0055540_1007100 3300003792 Bacteria 4299
52 Ga0055531_10000436 3300003794 Bacteria 39378
53 Ga0055531_10008922 3300003794 Bacteria 5200
54 Ga0055531_10015212 3300003794 Bacteria 3409
55 Ga0055543_1004532 3300004625 Bacteria 3754
56 Ga0055543_1005437 3300004625 Bacteria 3253
57 Ga0065165_1007653 3300005262 Bacteria 5248
58 Ga0065165_1021367 3300005262 Bacteria 2250
59 Ga0065714_10121128 3300005288 Bacteria 1347
60 Ga0065704_10013284 3300005289 Bacteria 1990
61 Ga0065704_10073773 3300005289 Bacteria 6797
62 Ga0065704_10110781 3300005289 Bacteria 1973
63 Ga0065704_10129756 3300005289 Bacteria 1644
64 Ga0065707_10324931 3300005295 Bacteria 960
65 Ga0070658_10099021 3300005327 Bacteria 2409
66 Ga0070690_100114330 3300005330 Bacteria 1804
67 Ga0070670_100010572 3300005331 Bacteria 7881
68 Ga0070677_10022066 3300005333 Bacteria 2340
69 Ga0070677_10178852 3300005333 Bacteria 1009
70 Ga0070666_10023485 3300005335 Bacteria 4014
71 Ga0070666_10274243 3300005335 Bacteria 1198
72 Ga0070680_100483326 3300005336 Bacteria 1059
73 Ga0068868_100012774 3300005338 Bacteria 6143
74 Ga0068868_100033067 3300005338 Bacteria 3984
75 Ga0070660_100537085 3300005339 Bacteria 975
76 Ga0070689_100231303 3300005340 Bacteria 1520
77 Ga0070689_100601634 3300005340 Bacteria 952
78 Ga0070687_100058106 3300005343 Bacteria 2031
79 Ga0070668_100093382 3300005347 Bacteria 2374
80 Ga0070669_100112834 3300005353 Bacteria 2065
81 Ga0070671_100165080 3300005355 Bacteria 1872
82 Ga0070674_100401617 3300005356 Bacteria 1120
83 Ga0070673_100295128 3300005364 Bacteria 1425
84 Ga0070659_100526462 3300005366 Bacteria 1010
85 Ga0070667_100016131 3300005367 Bacteria 6179
86 Ga0070667_100019825 3300005367 Bacteria 5580
87 Ga0070667_100204319 3300005367 Bacteria 1754
88 Ga0070667_100682264 3300005367 Bacteria 950
89 Ga0070714_100213040 3300005435 Bacteria 1771
90 Ga0070714_100878161 3300005435 Bacteria 870
91 Ga0070700_100070816 3300005441 Bacteria 2224
92 Ga0070678_100031016 3300005456 Bacteria 3681
93 Ga0070678_100289129 3300005456 Bacteria 1389
94 Ga0070678_100527317 3300005456 Bacteria 1046
95 Ga0070662_100112243 3300005457 Bacteria 2078
96 Ga0070706_100846712 3300005467 Bacteria 846
97 Ga0070679_100059819 3300005530 Bacteria 3797
98 Ga0070679_100141961 3300005530 Bacteria 2380
99 Ga0068853_100385371 3300005539 Bacteria 1310
100 Ga0070672_100084825 3300005543 Bacteria 2544
101 Ga0070672_100104073 3300005543 Bacteria 2306
102 Ga0070665_100003525 3300005548 Bacteria 16634
103 Ga0070665_100341767 3300005548 Bacteria 1502
104 Ga0070704_100841094 3300005549 Bacteria 822
105 Ga0068855_100012468 3300005563 Bacteria 10259
106 Ga0068855_100117910 3300005563 Bacteria 3040
107 Ga0068855_100228474 3300005563 Bacteria 2085
108 Ga0068857_100047019 3300005577 Bacteria 3831
109 Ga0068854_100265249 3300005578 Bacteria 1377
110 Ga0068854_100405047 3300005578 Bacteria 1130
111 Ga0068854_100559888 3300005578 Bacteria 971
112 Ga0068856_100228852 3300005614 Bacteria 1874
113 Ga0068856_100231784 3300005614 Bacteria 1862
114 Ga0068852_100097787 3300005616 Bacteria 2641
115 Ga0068852_100133527 3300005616 Bacteria 2288
116 Ga0068852_100221862 3300005616 Bacteria 1798
117 Ga0068859_100028193 3300005617 Bacteria 5629
118 Ga0068864_100005504 3300005618 Bacteria 10376
119 Ga0068864_100356085 3300005618 Bacteria 1382
120 Ga0068864_100585979 3300005618 Bacteria 1081
121 Ga0068866_10128268 3300005718 Bacteria 1439
122 Ga0068866_10295862 3300005718 Bacteria 1009
123 Ga0068861_100112000 3300005719 Bacteria 2188
124 Ga0068851_10002216 3300005834 Bacteria 8552
125 Ga0068863_100000753 3300005841 Bacteria 32410
126 Ga0068863_100072260 3300005841 Bacteria 3264
127 Ga0068863_100089926 3300005841 Bacteria 2911
128 Ga0068858_100013579 3300005842 Bacteria 7686
129 Ga0068858_100099839 3300005842 Bacteria 2707
130 Ga0068860_100026302 3300005843 Bacteria 5610
131 Ga0068860_100261850 3300005843 Bacteria 1686
132 Ga0068862_100054762 3300005844 Bacteria 3415
133 Ga0075365_10078888 3300006038 Bacteria 2227
134 Ga0075363_100048474 3300006048 Bacteria 2259
135 Ga0075363_100081585 3300006048 Bacteria 1769
136 Ga0075363_100368801 3300006048 Bacteria 840
137 Ga0075363_100428558 3300006048 Bacteria 779
138 Ga0075364_10189850 3300006051 Bacteria 1391
139 Ga0075362_10038402 3300006177 Bacteria 2103
140 Ga0075362_10141458 3300006177 Bacteria 1150
141 Ga0075362_10148843 3300006177 Bacteria 1122
142 Ga0075362_10263046 3300006177 Bacteria 850
143 Ga0075367_10013717 3300006178 Bacteria 4367
144 Ga0075367_10068132 3300006178 Bacteria 2134
145 Ga0075367_10239565 3300006178 Bacteria 1137
146 Ga0075369_10028686 3300006186 Bacteria 2334
147 Ga0075366_10004573 3300006195 Bacteria 7431
148 Ga0075366_10013946 3300006195 Bacteria 4583
149 Ga0075366_10017902 3300006195 Bacteria 4087
150 Ga0075366_10125106 3300006195 Bacteria 1550
151 Ga0075366_10248901 3300006195 Bacteria 1084
152 Ga0097621_100126716 3300006237 Bacteria 2169
153 Ga0075370_10022477 3300006353 Bacteria 3463
154 Ga0075370_10025727 3300006353 Bacteria 3256
155 Ga0075370_10075798 3300006353 Bacteria 1928
156 Ga0075370_10307291 3300006353 Bacteria 944
157 Ga0068871_100032026 3300006358 Bacteria 4149
158 Ga0068871_100372681 3300006358 Bacteria 1266
159 Ga0075430_100164643 3300006846 Bacteria 1845
160 Ga0075429_100004929 3300006880 Bacteria 11503
161 Ga0075429_100124963 3300006880 Bacteria 2250
162 Ga0068865_100118368 3300006881 Bacteria 1965
163 Ga0068865_100865820 3300006881 Bacteria 784
164 Ga0097620_100028193 3300006931 Bacteria 5629
165 Ga0097620_100650691 3300006931 Bacteria 1146
166 Ga0079104_1000020 3300006946 Bacteria 256848
167 Ga0099826_10018180 3300006948 Bacteria 5311
168 Ga0105244_10011632 3300009036 Bacteria 5259
169 Ga0105244_10100727 3300009036 Bacteria 1413
170 Ga0105250_10003253 3300009092 Bacteria 7735
171 Ga0105240_10052818 3300009093 Bacteria 5106
172 Ga0105240_10066437 3300009093 Bacteria 4473
173 Ga0105240_10146894 3300009093 Bacteria 2813
174 Ga0105240_10833215 3300009093 Bacteria 997
175 Ga0105245_10493419 3300009098 Bacteria 1240
176 Ga0105243_10006987 3300009148 Bacteria 8691
177 Ga0105243_10014258 3300009148 Bacteria 6014
178 Ga0105243_10090880 3300009148 Bacteria 2513
179 Ga0105243_10863537 3300009148 Bacteria 897
180 Ga0105242_10000311 3300009176 Bacteria 39040
181 Ga0105242_10069104 3300009176 Bacteria 2925
182 Ga0105242_10416201 3300009176 Bacteria 1258
183 Ga0105248_10123630 3300009177 Bacteria 2919
184 Ga0105248_10270789 3300009177 Bacteria 1912
185 Ga0105248_10315742 3300009177 Bacteria 1760
186 Ga0105237_10106184 3300009545 Bacteria 2800
187 Ga0105237_10120434 3300009545 Bacteria 2618
188 Ga0105238_10029865 3300009551 Bacteria 5550
189 Ga0105238_10038608 3300009551 Bacteria 4848
190 Ga0105238_10094741 3300009551 Bacteria 2973
191 Ga0105238_10430233 3300009551 Bacteria 1315
192 Ga0105249_10034394 3300009553 Bacteria 4593
193 Ga0105239_10080161 3300010375 Bacteria 3592
194 Ga0105239_10082268 3300010375 Bacteria 3545
195 Ga0105246_10037040 3300011119 Bacteria 3272
196 Ga0105246_10082206 3300011119 Bacteria 2298
197 Ga0157347_1000750 3300012502 Bacteria 2267
198 Ga0157373_10017464 3300013100 Bacteria 5225
199 Ga0157373_10025058 3300013100 Bacteria 4318
200 Ga0157373_10452197 3300013100 Bacteria 924
201 Ga0157370_10083781 3300013104 Bacteria 2998
202 Ga0157369_10013025 3300013105 Bacteria 9420
203 Ga0157374_10013029 3300013296 Bacteria 7250
204 Ga0157374_10097576 3300013296 Bacteria 2812
205 Ga0157374_10351474 3300013296 Bacteria 1465
206 Ga0157378_10139086 3300013297 Bacteria 2253
207 Ga0157378_10174981 3300013297 Bacteria 2015
208 Ga0157378_10312446 3300013297 Bacteria 1524
209 Ga0157378_10961794 3300013297 Bacteria 887
210 Ga0163162_10338200 3300013306 Bacteria 1638
211 Ga0157372_10499990 3300013307 Bacteria 1418
212 Ga0157375_10471792 3300013308 Bacteria 1420
213 Ga0157375_10479986 3300013308 Bacteria 1408
214 Ga0157375_10772804 3300013308 Bacteria 1111
215 Ga0163163_10003909 3300014325 Bacteria 12708
216 Ga0163163_10009499 3300014325 Bacteria 8687
217 Ga0163163_10474348 3300014325 Bacteria 1312
218 Ga0157380_10272280 3300014326 Bacteria 1544
219 Ga0157380_10307497 3300014326 Bacteria 1463
220 Ga0157380_10385008 3300014326 Bacteria 1325
221 Ga0182008_10006629 3300014497 Bacteria 6449
222 Ga0182008_10006787 3300014497 Bacteria 6367
223 Ga0182008_10008035 3300014497 Bacteria 5781
224 Ga0182008_10129289 3300014497 Bacteria 1259
225 Ga0157379_10071903 3300014968 Bacteria 3094
226 Ga0157379_10115785 3300014968 Bacteria 2410
227 Ga0157379_10171747 3300014968 Bacteria 1957
228 Ga0157376_10226220 3300014969 Bacteria 1735
229 Ga0157376_10361935 3300014969 Bacteria 1391
230 Ga0157376_10933403 3300014969 Bacteria 887
231 Ga0182007_10005457 3300015262 Bacteria 5581
232 Ga0183362_10005 3300015683 Bacteria 437616
233 Ga0163161_10005030 3300017792 Bacteria 9199
234 Ga0163161_10019973 3300017792 Bacteria 4698
235 Ga0163161_10028919 3300017792 Bacteria 3938
236 Ga0163161_10037961 3300017792 Bacteria 3453
237 Ga0163161_10111266 3300017792 Bacteria 2047
238 Ga0163161_10112679 3300017792 Bacteria 2035
239 Ga0163161_10210246 3300017792 Bacteria 1503
240 Ga0213872_10000006 3300021361 Bacteria 249845
241 Ga0213872_10000085 3300021361 Bacteria 85496
242 Ga0213872_10001073 3300021361 Bacteria 18880
243 Ga0213872_10024158 3300021361 Bacteria 2795
244 Ga0213876_10065823 3300021384 Bacteria 1913
245 Ga0209436_102690 3300025208 Bacteria 5143
246 Ga0209436_104505 3300025208 Bacteria 3433
247 Ga0209147_100347 3300025229 Bacteria 33903
248 Ga0209563_100044 3300025230 Bacteria 396812
249 Ga0209258_100143 3300025242 Bacteria 165551
250 Ga0207425_1000414 3300025245 Bacteria 28762
251 Ga0207425_1005204 3300025245 Bacteria 3743
252 Ga0209148_1000007 3300025254 Bacteria 1592273
253 Ga0209129_1000084 3300025258 Bacteria 182554
254 Ga0209129_1000414 3300025258 Bacteria 33160
255 Ga0209129_1000731 3300025258 Bacteria 21113
256 Ga0209565_1000150 3300025263 Bacteria 94073
257 Ga0209565_1000772 3300025263 Bacteria 18678
258 Ga0209673_1000114 3300025273 Bacteria 178557
259 Ga0209673_1001701 3300025273 Bacteria 18678
260 Ga0209673_1027689 3300025273 Bacteria 1839
261 Ga0209673_1029198 3300025273 Bacteria 1759
262 Ga0209130_1000323 3300025284 Bacteria 56069
263 Ga0209130_1001159 3300025284 Bacteria 19065
264 Ga0209130_1002174 3300025284 Bacteria 10332
265 Ga0209675_1000062 3300025291 Bacteria 178557
266 Ga0209675_1000394 3300025291 Bacteria 36250
267 Ga0209675_1001017 3300025291 Bacteria 17561
268 Ga0209675_1005156 3300025291 Bacteria 5557
269 Ga0209676_1000112 3300025292 Bacteria 208328
270 Ga0209676_1000325 3300025292 Bacteria 91840
271 Ga0209676_1001513 3300025292 Bacteria 21169
272 Ga0209676_1017162 3300025292 Bacteria 2575
273 Ga0209025_1000521 3300025294 Bacteria 73251
274 Ga0209025_1000709 3300025294 Bacteria 56684
275 Ga0209025_1002529 3300025294 Bacteria 19121
276 Ga0209025_1013573 3300025294 Bacteria 5104
277 Ga0209025_1017133 3300025294 Bacteria 4209
278 Ga0209025_1021785 3300025294 Bacteria 3432
279 Ga0209564_1000108 3300025295 Bacteria 213699
280 Ga0209564_1000357 3300025295 Bacteria 85402
281 Ga0209564_1038005 3300025295 Bacteria 1347
282 Ga0209758_1000184 3300025297 Bacteria 140021
283 Ga0209758_1013856 3300025297 Bacteria 4349
284 Ga0209758_1019568 3300025297 Bacteria 3258
285 Ga0209050_1000052 3300025298 Bacteria 351785
286 Ga0209050_1000445 3300025298 Bacteria 74894
287 Ga0209050_1001113 3300025298 Bacteria 32509
288 Ga0209050_1018323 3300025298 Bacteria 2727
289 Ga0209050_1019662 3300025298 Bacteria 2552
290 Ga0209050_1021447 3300025298 Bacteria 2355
291 Ga0209256_1000101 3300025299 Bacteria 200246
292 Ga0209256_1000156 3300025299 Bacteria 144277
293 Ga0209256_1025250 3300025299 Bacteria 1735
294 Ga0207426_1000049 3300025302 Bacteria 401954
295 Ga0207426_1000086 3300025302 Bacteria 292089
296 Ga0207426_1001811 3300025302 Bacteria 15849
297 Ga0209051_1000025 3300025303 Bacteria 415397
298 Ga0209051_1000220 3300025303 Bacteria 96404
299 Ga0209051_1000365 3300025303 Bacteria 66149
300 Ga0209051_1000760 3300025303 Bacteria 34370
301 Ga0209051_1001379 3300025303 Bacteria 20965
302 Ga0209051_1011447 3300025303 Bacteria 4378
303 Ga0209257_1000037 3300025304 Bacteria 612915
304 Ga0209257_1000039 3300025304 Bacteria 591694
305 Ga0209257_1000411 3300025304 Bacteria 83024
306 Ga0209257_1007391 3300025304 Bacteria 6645
307 Ga0209257_1009384 3300025304 Bacteria 5261
308 Ga0209257_1013350 3300025304 Bacteria 3664
309 Ga0207656_10014449 3300025321 Bacteria 3042
310 Ga0207696_1003921 3300025711 Bacteria 6560
311 Ga0207655_1007807 3300025728 Bacteria 6889
312 Ga0207682_10096137 3300025893 Bacteria 1290
313 Ga0207682_10119229 3300025893 Bacteria 1169
314 Ga0207642_10146219 3300025899 Bacteria 1252
315 Ga0207680_10004392 3300025903 Bacteria 6683
316 Ga0207643_10034786 3300025908 Bacteria 2823
317 Ga0207705_10237901 3300025909 Bacteria 1386
318 Ga0207705_10336261 3300025909 Bacteria 1162
319 Ga0207695_10215440 3300025913 Bacteria 1829
320 Ga0207660_10492481 3300025917 Bacteria 994
321 Ga0207662_10069806 3300025918 Bacteria 2124
322 Ga0207649_10253715 3300025920 Bacteria 1268
323 Ga0207652_10189841 3300025921 Bacteria 1848
324 Ga0207681_10071478 3300025923 Bacteria 2420
325 Ga0207694_10021260 3300025924 Bacteria 4916
326 Ga0207650_10004982 3300025925 Bacteria 9074
327 Ga0207650_10017064 3300025925 Bacteria 5082
328 Ga0207650_10174929 3300025925 Bacteria 1708
329 Ga0207659_10006704 3300025926 Bacteria 7074
330 Ga0207659_10206308 3300025926 Bacteria 1573
331 Ga0207687_10341088 3300025927 Bacteria 1218
332 Ga0207664_10283549 3300025929 Bacteria 1454
333 Ga0207664_10560283 3300025929 Bacteria 1026
334 Ga0207644_10045846 3300025931 Bacteria 3111
335 Ga0207690_10029296 3300025932 Bacteria 3498
336 Ga0207690_10334476 3300025932 Bacteria 1194
337 Ga0207686_10005767 3300025934 Bacteria 6643
338 Ga0207686_10082758 3300025934 Bacteria 2099
339 Ga0207709_10000198 3300025935 Bacteria 80022
340 Ga0207709_10001280 3300025935 Bacteria 17963
341 Ga0207709_10007586 3300025935 Bacteria 6026
342 Ga0207709_10069249 3300025935 Bacteria 2233
343 Ga0207709_10243485 3300025935 Bacteria 1309
344 Ga0207669_10019944 3300025937 Bacteria 3503
345 Ga0207669_10051123 3300025937 Bacteria 2474
346 Ga0207669_10100468 3300025937 Bacteria 1911
347 Ga0207669_10150218 3300025937 Bacteria 1631
348 Ga0207704_10252543 3300025938 Bacteria 1325
349 Ga0207704_10521394 3300025938 Bacteria 961
350 Ga0207691_10112267 3300025940 Bacteria 2422
351 Ga0207691_10395335 3300025940 Bacteria 1179
352 Ga0207711_10239418 3300025941 Bacteria 1664
353 Ga0207711_10407480 3300025941 Bacteria 1264
354 Ga0207689_10230584 3300025942 Bacteria 1530
355 Ga0207667_10098918 3300025949 Bacteria 3009
356 Ga0207667_10115027 3300025949 Bacteria 2773
357 Ga0207651_10036708 3300025960 Bacteria 3203
358 Ga0207651_10037017 3300025960 Bacteria 3192
359 Ga0207712_10206973 3300025961 Bacteria 1560
360 Ga0207712_10219013 3300025961 Bacteria 1521
361 Ga0207668_10079657 3300025972 Bacteria 2370
362 Ga0207668_10149540 3300025972 Bacteria 1806
363 Ga0207640_10218077 3300025981 Bacteria 1459
364 Ga0207640_10489972 3300025981 Bacteria 1021
365 Ga0207658_10028581 3300025986 Bacteria 3927
366 Ga0207658_10058427 3300025986 Bacteria 2870
367 Ga0207677_10004562 3300026023 Bacteria 7449
368 Ga0207677_10129922 3300026023 Bacteria 1911
369 Ga0207703_10008117 3300026035 Bacteria 8297
370 Ga0207703_10128189 3300026035 Bacteria 2188
371 Ga0207639_10056313 3300026041 Bacteria 3013
372 Ga0207639_10371195 3300026041 Bacteria 1283
373 Ga0207678_10178117 3300026067 Bacteria 1815
374 Ga0207702_10144267 3300026078 Bacteria 2158
375 Ga0207702_10195115 3300026078 Bacteria 1874
376 Ga0207641_10010643 3300026088 Bacteria 7548
377 Ga0207641_10025054 3300026088 Bacteria 4919
378 Ga0207641_10052314 3300026088 Bacteria 3458
379 Ga0207641_10538695 3300026088 Bacteria 1137
380 Ga0207648_10062180 3300026089 Bacteria 3256
381 Ga0207648_10167674 3300026089 Bacteria 1941
382 Ga0207648_10269515 3300026089 Bacteria 1521
383 Ga0207648_10351978 3300026089 Bacteria 1328
384 Ga0207676_10010144 3300026095 Bacteria 6705
385 Ga0207676_10026017 3300026095 Bacteria 4346
386 Ga0207676_10233647 3300026095 Bacteria 1645
387 Ga0207674_10036676 3300026116 Bacteria 5105
388 Ga0207674_10124358 3300026116 Bacteria 2545
389 Ga0207675_100001372 3300026118 Bacteria 24404
390 Ga0207675_100043575 3300026118 Bacteria 4191
391 Ga0207675_100292843 3300026118 Bacteria 1584
392 Ga0207683_10066534 3300026121 Bacteria 3178
393 Ga0207683_10290818 3300026121 Bacteria 1494
394 Ga0207683_10320467 3300026121 Bacteria 1420
395 Ga0207683_10918615 3300026121 Bacteria 813
396 Ga0207698_10057074 3300026142 Bacteria 3018
397 Ga0207698_10359468 3300026142 Bacteria 1378
398 Ga0207698_10555959 3300026142 Bacteria 1126
399 Ga0209281_1000002 3300027111 Bacteria 1924012
400 Ga0209969_1016236 3300027360 Bacteria 1091
401 Ga0209967_1000518 3300027364 Bacteria 5062
402 Ga0209981_1003935 3300027378 Bacteria 1934
403 Ga0210000_1001677 3300027462 Bacteria 3123
404 Ga0209999_1001547 3300027543 Bacteria 3951
405 Ga0209282_1006428 3300027666 Bacteria 7301
406 Ga0209971_1000610 3300027682 Bacteria 9288
407 Ga0209813_10010910 3300027866 Bacteria 2362
408 Ga0209974_10004290 3300027876 Bacteria 5084
409 Ga0207428_10037132 3300027907 Bacteria 3966
410 Ga0268266_10012292 3300028379 Bacteria 7407
411 Ga0268266_10182192 3300028379 Bacteria 1913
412 Ga0268265_10018378 3300028380 Bacteria 4844
413 Ga0268265_10027331 3300028380 Bacteria 4071
414 Ga0268264_10048817 3300028381 Bacteria 3520
415 Ga0307515_10000064 3300028794 Bacteria 245452
416 Ga0307515_10011665 3300028794 Bacteria 16648
417 Ga0307515_10290427 3300028794 Bacteria 1331
418 Ga0316177_1009786 3300030731 Bacteria 4540
419 Ga0316176_1139166 3300030732 Bacteria 4103
420 Ga0316178_1180759 3300030735 Bacteria 5272
421 Ga0316181_1233761 3300030744 Bacteria 2949
422 Ga0316182_1024353 3300030745 Bacteria 3283
423 Ga0265330_10000116 3300031235 Bacteria 64622
424 Ga0265332_10000012 3300031238 Bacteria 272641
425 Ga0265332_10000035 3300031238 Bacteria 139554
426 Ga0265332_10013777 3300031238 Bacteria 3580
427 Ga0265325_10007223 3300031241 Bacteria 6679
428 Ga0265340_10067866 3300031247 Bacteria 1694
429 Ga0265327_10000399 3300031251 Bacteria 81304
430 Ga0265327_10000589 3300031251 Bacteria 60929
431 Ga0265327_10004244 3300031251 Bacteria 12849
432 Ga0307513_10424904 3300031456 Bacteria 1058
433 Ga0307408_100007096 3300031548 Bacteria 7414
434 Ga0307408_100580042 3300031548 Bacteria 993
435 Ga0307514_10002069 3300031649 Bacteria 21669
436 Ga0307514_10019719 3300031649 Bacteria 5515
437 Ga0265314_10000029 3300031711 Bacteria 272506
438 Ga0265314_10001279 3300031711 Bacteria 28615
439 Ga0307516_10001122 3300031730 Bacteria 37338
440 Ga0307405_10004316 3300031731 Bacteria 6697
441 Ga0307405_10008322 3300031731 Bacteria 5247
442 Ga0307405_10187787 3300031731 Bacteria 1489
443 Ga0307405_10389561 3300031731 Bacteria 1087
444 Ga0307413_10001754 3300031824 Bacteria 8486
445 Ga0307413_10026366 3300031824 Bacteria 3201
446 Ga0307410_10007332 3300031852 Bacteria 6030
447 Ga0307410_10038312 3300031852 Bacteria 3139
448 Ga0307406_10008442 3300031901 Bacteria 5745
449 Ga0307406_10011520 3300031901 Bacteria 5024
450 Ga0307406_10032430 3300031901 Bacteria 3189
451 Ga0307407_10035258 3300031903 Bacteria 2747
452 Ga0307407_10041597 3300031903 Bacteria 2571
453 Ga0307407_10079402 3300031903 Bacteria 1979
454 Ga0307412_10023541 3300031911 Bacteria 3791
455 Ga0307412_10156523 3300031911 Bacteria 1687
456 Ga0307412_10187695 3300031911 Bacteria 1560
457 Ga0307412_10199731 3300031911 Bacteria 1517
458 Ga0307409_100002223 3300031995 Bacteria 10034
459 Ga0307416_100066106 3300032002 Bacteria 2975
460 Ga0307416_100093775 3300032002 Bacteria 2587
461 Ga0307416_100101547 3300032002 Bacteria 2505
462 Ga0307416_100130855 3300032002 Bacteria 2258
463 Ga0307414_10006464 3300032004 Bacteria 6537
464 Ga0307414_10270264 3300032004 Bacteria 1423
465 Ga0307414_10415809 3300032004 Bacteria 1171
466 Ga0307414_10594575 3300032004 Bacteria 991
467 Ga0307411_10003956 3300032005 Bacteria 6996
468 Ga0307411_10006283 3300032005 Bacteria 5929
469 Ga0307411_10091909 3300032005 Bacteria 2121
470 Ga0307411_10211797 3300032005 Bacteria 1497
471 Ga0307415_100005516 3300032126 Bacteria 6726
472 Ga0307415_100824468 3300032126 Bacteria 849
473 Ga0395899_0003639 3300037312 Bacteria 12203
474 Ga0395899_0190370 3300037312 Bacteria 1436
475 Ga0395900_0020054 3300037418 Bacteria 6818
476 Ga0395898_0016994 3300037466 Bacteria 7429
477 Ga0395905_0012925 3300037471 Bacteria 8025
478 Ga0395905_0145326 3300037471 Bacteria 2231
479 Ga0395905_0523215 3300037471 Bacteria 1086
480 Ga0395901_0016216 3300038443 Bacteria 7589
481 Ga0395901_0136131 3300038443 Bacteria 2582
482 Ga0395901_0158647 3300038443 Bacteria 2376
483 Ga0436365_0041930 3300039437 Bacteria 2813
484 Ga0436361_0019641 3300039447 Bacteria 127735
485 Ga0436361_0021397 3300039447 Bacteria 46447
486 Ga0436361_0085209 3300039447 Bacteria 38016
487 Ga0436361_0422921 3300039447 Bacteria 7721
488 Ga0436361_0562232 3300039447 Bacteria 1151
489 Ga0436361_0741203 3300039447 Bacteria 1759
490 Ga0439447_059648 3300041407 Bacteria 899
491 Ga0439466_0053527 3300041411 Bacteria 1316
492 Ga0439465_0047674 3300041413 Bacteria 1397
493 Ga0451789_0549618 3300041443 Bacteria 3665
494 Ga0451797_0689461 3300041453 Bacteria 1263
495 Ga0451798_0554549 3300041458 Bacteria 2766
496 Ga0451802_1397458 3300041460 Bacteria 1683
497 Ga0451804_0901955 3300041463 Bacteria 2701
498 Ga0451807_0616347 3300041486 Bacteria 2078
499 Ga0451843_0146574 3300041509 Bacteria 1019
500 Ga0451853_1034031 3300041512 Bacteria 1051
501 Ga0439442_021752 3300042002 Bacteria 1330
502 Ga0439445_0054944 3300042004 Bacteria 1080
503 Ga0439432_005284 3300042006 Bacteria 4662
504 Ga0439449_0006231 3300042007 Bacteria 4558
505 Ga0439449_0014203 3300042007 Bacteria 2993
506 Ga0439449_0085243 3300042007 Bacteria 1165
507 Ga0439452_013065 3300042010 Bacteria 2341
508 Ga0439462_0002682 3300042015 Bacteria 4180
509 Ga0439462_0013376 3300042015 Bacteria 2102
510 Ga0450911_000210 3300042115 Bacteria 22859
511 Ga0450913_010424 3300042117 Bacteria 744
512 Ga0450917_000212 3300042120 Bacteria 4188
513 Ga0450921_006602 3300042123 Bacteria 905
514 Ga0450923_000797 3300042125 Bacteria 3784
515 Ga0450888_000201 3300042126 Bacteria 5304
516 Ga0450890_001025 3300042127 Bacteria 4048
517 Ga0450890_022791 3300042127 Bacteria 858
518 Ga0450891_000553 3300042129 Bacteria 3872
519 Ga0450892_000410 3300042130 Bacteria 5079
520 Ga0450899_009764 3300042135 Bacteria 1060
521 Ga0450889_001619 3300042144 Bacteria 2295
522 Ga0450908_008504 3300042184 Bacteria 1922
523 Ga0439434_0011873 3300042435 Bacteria 2575
524 Ga0439434_0021337 3300042435 Bacteria 1946
525 Ga0450918_001524 3300042531 Bacteria 4575
526 Ga0450893_0001695 3300042532 Bacteria 3389
527 Ga0450893_0002038 3300042532 Bacteria 3146
528 Ga0450893_0009774 3300042532 Bacteria 1569
529 Ga0451577_0000190 3300042876 Bacteria 130692
530 Ga0451577_0001771 3300042876 Bacteria 27782
531 Ga0451577_0206865 3300042876 Bacteria 1772
532 Ga0466969_0022418 3300044656 Bacteria 3259
533 Ga0453683_0003388 3300044673 Bacteria 11764
534 Ga0466965_0017859 3300044683 Bacteria 3393
535 Ga0466966_0004500 3300044684 Bacteria 9195
536 Ga0466961_0039903 3300044693 Bacteria 3009
537 Ga0453684_0000618 3300044712 Bacteria 129995
538 Ga0453684_0033421 3300044712 Bacteria 7172
539 Ga0453684_0148014 3300044712 Bacteria 2794
540 Ga0453684_0359999 3300044712 Bacteria 1638
541 Ga0466970_0117078 3300044765 Bacteria 1457
542 Ga0466957_0170668 3300044842 Bacteria 1417
543 Ga0451576_0000237 3300045051 Bacteria 134538
544 Ga0451576_0001041 3300045051 Bacteria 51115
545 Ga0451576_0006976 3300045051 Bacteria 13670
546 Ga0451576_0027762 3300045051 Bacteria 6076
547 Ga0451576_0094967 3300045051 Bacteria 3101
548 Ga0451576_0125168 3300045051 Bacteria 2678
549 Ga0451576_0125830 3300045051 Bacteria 2670
550 Ga0451576_0202553 3300045051 Bacteria 2073
551 Ga0451576_0226750 3300045051 Bacteria 1951
552 Ga0451576_0635901 3300045051 Bacteria 1121
553 Ga0466958_0013122 3300045836 Bacteria 4711
554 Ga0495627_024947 3300046453 Bacteria 1943
555 Ga0495629_0001059 3300046459 Bacteria 21997
556 Ga0495629_0004313 3300046459 Bacteria 10664
557 Ga0495638_0114427 3300046460 Bacteria 1600
558 Ga0495651_0195927 3300046462 Bacteria 1418
559 Ga0495653_0046947 3300046463 Bacteria 3342
560 Ga0495650_0002291 3300046471 Bacteria 15884
561 Ga0495650_0083338 3300046471 Bacteria 1229
562 Ga0495580_0002292 3300046472 Bacteria 16704
563 Ga0495580_0004245 3300046472 Bacteria 12062
564 Ga0495580_0113577 3300046472 Bacteria 1881
565 Ga0495605_0011048 3300046474 Bacteria 5045
566 Ga0495639_0004416 3300046475 Bacteria 6029
567 Ga0495583_0018628 3300046506 Bacteria 3650
568 Ga0495616_0021554 3300046513 Bacteria 3487
569 Ga0495628_0251410 3300046516 Bacteria 1320
570 Ga0495630_0148967 3300046517 Bacteria 1780
571 Ga0495643_0073974 3300046522 Bacteria 1785
572 Ga0495644_0071239 3300046523 Bacteria 1306
573 Ga0495648_0003240 3300046524 Bacteria 14433
574 Ga0495648_0061033 3300046524 Bacteria 2240
575 Ga0495666_0049474 3300046526 Bacteria 2022
576 Ga0495642_0001045 3300046528 Bacteria 12865
577 Ga0495642_0011634 3300046528 Bacteria 3386
578 Ga0495642_0090504 3300046528 Bacteria 1295
579 Ga0495654_0003219 3300046530 Bacteria 10093
580 Ga0495654_0005770 3300046530 Bacteria 7135
581 Ga0495654_0132460 3300046530 Bacteria 1118
582 Ga0495665_0007530 3300046531 Bacteria 5894
583 Ga0495586_0070809 3300046535 Bacteria 1905
584 Ga0495621_0021300 3300046539 Bacteria 2136
585 Ga0495597_0000054 3300046542 Bacteria 95390
586 Ga0495645_0000759 3300046543 Bacteria 22016
587 Ga0495622_0003408 3300046557 Bacteria 7497
588 Ga0495622_0025571 3300046557 Bacteria 2757
589 Ga0495622_0097168 3300046557 Bacteria 1351
590 Ga0495656_0002907 3300046615 Bacteria 5739
591 Ga0495668_0104950 3300046616 Bacteria 1546
592 Ga0495625_0000297 3300046660 Bacteria 76945
593 Ga0495625_0021330 3300046660 Bacteria 4990
594 Ga0495625_0134708 3300046660 Bacteria 1671
595 Ga0495661_0213011 3300046665 Bacteria 1005
596 Ga0495588_0038383 3300046674 Bacteria 2436
597 Ga0495646_0103222 3300046680 Bacteria 1632
598 Ga0495658_0046411 3300046683 Bacteria 2442
599 Ga0495669_0004779 3300046684 Bacteria 5620
600 Ga0495613_0084640 3300046689 Bacteria 2302
601 Ga0495613_0491702 3300046689 Bacteria 827
602 Ga0495624_0004099 3300046690 Bacteria 10720
603 Ga0495670_0109860 3300046691 Bacteria 1426
604 Ga0495671_0093054 3300046692 Bacteria 1475
605 Ga0495589_0045746 3300046794 Bacteria 2174
606 Ga0495600_0019733 3300046809 Bacteria 4308
607 Ga0495674_0056400 3300047319 Bacteria 3440
608 Ga0495674_0096697 3300047319 Bacteria 2517
609 Ga0495674_0268630 3300047319 Bacteria 1400
610 Ga0495672_0177217 3300047320 Bacteria 1082
611 Ga0495683_0016632 3300047323 Bacteria 3817
612 Ga0495687_007763 3300047443 Bacteria 6248
613 Ga0495677_0006051 3300047445 Bacteria 4576
614 Ga0495673_0060968 3300047469 Bacteria 1616
615 Ga0495681_0048740 3300047470 Bacteria 2006
616 Ga0495593_0003200 3300047673 Bacteria 9827
617 Ga0495593_0003990 3300047673 Bacteria 8805
618 Ga0495602_0142218 3300048088 Bacteria 1898
619 Ga0495602_0407687 3300048088 Bacteria 968
620 Ga0495614_0007125 3300048089 Bacteria 4986
621 Ga0495614_0025363 3300048089 Bacteria 2557
622 Ga0495626_0014106 3300048091 Bacteria 4133
623 Ga0496100_0464637 3300048903 Bacteria 971
624 Ga0496101_0060686 3300048904 Bacteria 2745
625 Ga0496101_0101859 3300048904 Bacteria 2150
626 Ga0496102_0030214 3300048905 Bacteria 4849
627 Ga0496102_0091654 3300048905 Bacteria 2813
628 Ga0496103_0035133 3300048906 Bacteria 3068
629 Ga0496104_0035331 3300048907 Bacteria 4666
630 Ga0496104_0092812 3300048907 Bacteria 2887
631 Ga0496104_0103472 3300048907 Bacteria 2728
632 Ga0496105_0002858 3300048908 Bacteria 12642
633 Ga0496105_0014374 3300048908 Bacteria 6299
634 Ga0496105_0304561 3300048908 Bacteria 1280
635 Ga0496106_0023495 3300048909 Bacteria 4580
636 Ga0496106_0259750 3300048909 Bacteria 1390
637 Ga0496107_0170266 3300048910 Bacteria 1616
638 Ga0496109_0298302 3300048912 Bacteria 1519
639 Ga0496110_0231027 3300048913 Bacteria 1682
640 Ga0496110_0569002 3300048913 Bacteria 1029
641 Ga0496111_0399609 3300048914 Bacteria 1015
642 Ga0496112_0054636 3300048915 Bacteria 3924
643 Ga0496112_0234483 3300048915 Bacteria 1789
644 Ga0496113_0097320 3300048916 Bacteria 2276
645 Ga0496114_0005372 3300048917 Bacteria 10018
646 Ga0496114_0341262 3300048917 Bacteria 1324
647 Ga0496115_0112179 3300048918 Bacteria 2240
648 Ga0496116_0001057 3300048919 Bacteria 33374
649 Ga0496116_0026490 3300048919 Bacteria 4239
650 Ga0496117_0052364 3300048920 Bacteria 2875
651 Ga0496117_0092997 3300048920 Bacteria 1935
652 Ga0496118_0039861 3300048921 Bacteria 3742
653 Ga0496118_0074883 3300048921 Bacteria 2417
654 Ga0496121_0001139 3300048924 Bacteria 46685
655 Ga0496121_0007622 3300048924 Bacteria 13019
656 Ga0496121_0049547 3300048924 Bacteria 3561
657 Ga0496121_0107994 3300048924 Bacteria 2129
658 Ga0496122_0000184 3300048925 Bacteria 144437
659 Ga0496122_0188859 3300048925 Bacteria 1218
660 Ga0496122_0231262 3300048925 Bacteria 1051
661 Ga0496123_0000738 3300048926 Bacteria 52962
662 Ga0496124_0036030 3300048927 Bacteria 4321
663 Ga0496124_0154228 3300048927 Bacteria 1798
664 Ga0496125_0001094 3300048928 Bacteria 41763
665 Ga0496125_0008051 3300048928 Bacteria 11124
666 Ga0496125_0012419 3300048928 Bacteria 8456
667 Ga0496125_0029131 3300048928 Bacteria 4968
668 Ga0496125_0044333 3300048928 Bacteria 3764
669 Ga0496126_0024068 3300048929 Bacteria 5884
670 Ga0496126_0119709 3300048929 Bacteria 2285
671 Ga0496126_0162838 3300048929 Bacteria 1905
672 Ga0496126_0211197 3300048929 Bacteria 1634
673 Ga0501310_001074 3300049130 Bacteria 2464
674 Ga0495682_0006901 3300049460 Bacteria 4561
675 Ga0501294_003989 3300049517 Bacteria 1391
676 Ga0501299_013057 3300049522 Bacteria 1428
677 Ga0501300_002598 3300049523 Bacteria 2709
678 Ga0501031_0008612 3300049568 Bacteria 6635
679 Ga0501207_014977 3300049654 Bacteria 1190
680 Ga0501211_000514 3300049658 Bacteria 3764
681 Ga0501222_000866 3300049662 Bacteria 4369
682 Ga0501235_000554 3300049669 Bacteria 7483
683 Ga0501236_000725 3300049670 Bacteria 3686
684 Ga0501238_001434 3300049671 Bacteria 2764
685 Ga0501249_001742 3300049679 Bacteria 4437
686 Ga0501249_004420 3300049679 Bacteria 2856
687 Ga0501252_003132 3300049682 Bacteria 1690
688 Ga0501255_000139 3300049684 Bacteria 4407
689 Ga0501257_075360 3300049686 Bacteria 866
690 Ga0501258_000854 3300049687 Bacteria 2277
691 Ga0501221_000277 3300049704 Bacteria 7624
692 Ga0501225_0008269 3300049705 Bacteria 2992
693 Ga0501229_003518 3300049706 Bacteria 1881
694 Ga0501232_009185 3300049757 Bacteria 1086
695 Ga0501241_014271 3300049758 Bacteria 1443
696 Ga0501262_000236 3300049759 Bacteria 6812
697 Ga0501262_014190 3300049759 Bacteria 1035
698 Ga0501264_008771 3300049761 Bacteria 956
699 Ga0501265_003342 3300049762 Bacteria 1823
700 Ga0501267_001500 3300049764 Bacteria 2014
701 Ga0501269_012120 3300049766 Bacteria 1052
702 Ga0501282_002803 3300049778 Bacteria 1888
703 nmdc:mga03683_226860_c1 3300050489 Bacteria 863
704 nmdc:mga03683_34264_c1 3300050489 Bacteria 2054
705 nmdc:mga03683_7713_c1 3300050489 Bacteria 3751
706 nmdc:mga03683_8085_c1 3300050489 Bacteria 3683
707 nmdc:mga03n38_16900_c1 3300050490 Bacteria 2847
708 nmdc:mga00v17_28715_c1 3300050491 Bacteria 3260
709 nmdc:mga0yw44_117262_c1 3300050492 Bacteria 1712
710 nmdc:mga0yw44_43095_c1 3300050492 Bacteria 2693
711 nmdc:mga0yw44_9938_c1 3300050492 Bacteria 4837
712 nmdc:mga0k408_21708_c1 3300050493 Bacteria 2138
713 nmdc:mga0k408_21783_c1 3300050493 Bacteria 3604
714 nmdc:mga04h51_19339_c1 3300050495 Bacteria 2018
715 nmdc:mga07m45_15957_c1 3300050496 Bacteria 4017
716 nmdc:mga07m45_22495_c1 3300050496 Bacteria 3442
717 nmdc:mga07m45_2644_c1 3300050496 Bacteria 8435
718 nmdc:mga07m45_278697_c1 3300050496 Bacteria 973
719 nmdc:mga09592_358245_c1 3300050508 Bacteria 1262
720 nmdc:mga09592_4778_c1 3300050508 Bacteria 10976
721 nmdc:mga0qj67_174427_c1 3300050509 Bacteria 1746
722 nmdc:mga08x19_201199_c1 3300050514 Bacteria 1365
723 nmdc:mga0sz30_40780_c2 3300050516 Bacteria 1188
724 Ga0500610_0044805 3300053079 Bacteria 2295
725 Ga0500643_005649 3300053087 Bacteria 5349
726 Ga0500644_0033965 3300053088 Bacteria 1642
727 Ga0500646_0040289 3300053090 Bacteria 1313
728 Ga0500651_0000030 3300053093 Bacteria 112247
729 Ga0500651_0011330 3300053093 Bacteria 5373
730 Ga0500593_009764 3300053117 Bacteria 3999
731 Ga0500594_0001539 3300053118 Bacteria 5023
732 Ga0500607_005898 3300053121 Bacteria 7885
733 Ga0500608_031487 3300053122 Bacteria 2517
734 Ga0500642_0039768 3300053130 Bacteria 2024
735 Ga0500652_000123 3300053131 Bacteria 29418
736 Ga0500658_0242059 3300053134 Bacteria 828
737 Ga0500658_0242065 3300053134 Bacteria 828
738 Ga0500559_0011698 3300053136 Bacteria 3742
739 Ga0500559_0134785 3300053136 Bacteria 1154
740 Ga0500568_0001927 3300053139 Bacteria 12717
741 Ga0500574_029614 3300053141 Bacteria 1461
742 Ga0500604_0007146 3300053151 Bacteria 2955
743 Ga0500622_0000799 3300053156 Bacteria 27135
744 Ga0500627_0006957 3300053158 Bacteria 3899
745 Ga0500634_0061396 3300053161 Bacteria 1993
746 Ga0587072_029890 3300059643 Bacteria 1013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049687 Ga0501258_000854 Ga0501258_000854_1202_1786 175
2 3300049686 Ga0501257_075360 Ga0501257_075360_76_684 185
3 3300027364 Ga0209967_1000518 Ga0209967_10005184 187
4 3300027378 Ga0209981_1003935 Ga0209981_10039352 187
5 3300027462 Ga0210000_1001677 Ga0210000_10016772 187
6 3300027543 Ga0209999_1001547 Ga0209999_10015473 187
7 3300027876 Ga0209974_10004290 Ga0209974_100042904 187
8 3300005335 Ga0070666_10023485 Ga0070666_100234855 188
9 3300025941 Ga0207711_10407480 Ga0207711_104074801 189
10 3300026121 Ga0207683_10918615 Ga0207683_109186152 193
11 3300005333 Ga0070677_10022066 Ga0070677_100220662 194
12 3300005364 Ga0070673_100295128 Ga0070673_1002951282 194
13 3300005366 Ga0070659_100526462 Ga0070659_1005264621 194
14 3300009176 Ga0105242_10416201 Ga0105242_104162011 194
15 3300025925 Ga0207650_10174929 Ga0207650_101749292 194
16 3300025932 Ga0207690_10334476 Ga0207690_103344762 194
17 3300005340 Ga0070689_100231303 Ga0070689_1002313032 195
18 3300048913 Ga0496110_0569002 Ga0496110_0569002_35_673 199
19 3300025908 Ga0207643_10034786 Ga0207643_100347862 201
20 3300017792 Ga0163161_10210246 Ga0163161_102102461 202
21 3300046557 Ga0495622_0097168 Ga0495622_0097168_36_743 202
22 3300021384 Ga0213876_10065823 Ga0213876_100658231 204
23 3300041443 Ga0451789_0549618 Ga0451789_0549618_1476_2255 204
24 3300041453 Ga0451797_0689461 Ga0451797_0689461_193_972 204
25 3300041458 Ga0451798_0554549 Ga0451798_0554549_1828_2607 204
26 3300041460 Ga0451802_1397458 Ga0451802_1397458_225_1004 204
27 3300041463 Ga0451804_0901955 Ga0451804_0901955_445_1224 204
28 3300041486 Ga0451807_0616347 Ga0451807_0616347_432_1211 204
29 3300046460 Ga0495638_0114427 Ga0495638_0114427_47_826 204
30 3300053088 Ga0500644_0033965 Ga0500644_0033965_500_1279 204
31 3300053090 Ga0500646_0040289 Ga0500646_0040289_465_1244 204
32 3300053093 Ga0500651_0011330 Ga0500651_0011330_2042_2821 204
33 3300053130 Ga0500642_0039768 Ga0500642_0039768_1138_1917 204
34 3300053131 Ga0500652_000123 Ga0500652_000123_21686_22465 204
35 3300053151 Ga0500604_0007146 Ga0500604_0007146_534_1313 204
36 3300053156 Ga0500622_0000799 Ga0500622_0000799_22674_23453 204
37 3300006178 Ga0075367_10239565 Ga0075367_102395652 205
38 3300009148 Ga0105243_10863537 Ga0105243_108635371 205
39 3300050489 nmdc:mga03683_8085_c1 nmdc:mga03683_8085_c1_2621_3331 205
40 3300005618 Ga0068864_100005504 Ga0068864_1000055044 206
41 3300005841 Ga0068863_100000753 Ga0068863_1000007532 206
42 3300006177 Ga0075362_10148843 Ga0075362_101488432 206
43 3300013296 Ga0157374_10351474 Ga0157374_103514742 206
44 3300014325 Ga0163163_10003909 Ga0163163_100039094 206
45 3300025925 Ga0207650_10004982 Ga0207650_100049829 206
46 3300026088 Ga0207641_10010643 Ga0207641_100106433 206
47 3300026095 Ga0207676_10026017 Ga0207676_100260174 206
48 3300048915 Ga0496112_0234483 Ga0496112_0234483_794_1549 206
49 3300005367 Ga0070667_100204319 Ga0070667_1002043192 207
50 3300005456 Ga0070678_100031016 Ga0070678_1000310163 207
51 3300005578 Ga0068854_100559888 Ga0068854_1005598881 207
52 3300025960 Ga0207651_10036708 Ga0207651_100367083 207
53 3300025961 Ga0207712_10206973 Ga0207712_102069732 207
54 3300025972 Ga0207668_10149540 Ga0207668_101495402 207
55 3300026118 Ga0207675_100043575 Ga0207675_1000435752 207
56 3300026118 Ga0207675_100292843 Ga0207675_1002928432 207
57 3300027360 Ga0209969_1016236 Ga0209969_10162361 207
58 3300031852 Ga0307410_10038312 Ga0307410_100383123 207
59 3300031901 Ga0307406_10011520 Ga0307406_100115207 207
60 3300031903 Ga0307407_10041597 Ga0307407_100415972 207
61 3300032002 Ga0307416_100101547 Ga0307416_1001015472 207
62 3300032004 Ga0307414_10270264 Ga0307414_102702642 207
63 3300031824 Ga0307413_10026366 Ga0307413_100263662 208
64 3300045051 Ga0451576_0094967 Ga0451576_0094967_105_839 211
65 3300045051 Ga0451576_0125830 Ga0451576_0125830_105_839 211
66 3300045836 Ga0466958_0013122 Ga0466958_0013122_968_1720 213
67 3300049568 Ga0501031_0008612 Ga0501031_0008612_4075_4839 214
68 3300039437 Ga0436365_0041930 Ga0436365_0041930_1006_1767 215
69 3300046471 Ga0495650_0083338 Ga0495650_0083338_411_1136 216
70 3300046472 Ga0495580_0002292 Ga0495580_0002292_12044_12769 217
71 3300046524 Ga0495648_0003240 Ga0495648_0003240_8891_9616 217
72 3300048925 Ga0496122_0231262 Ga0496122_0231262_349_1011 217
73 3300050489 nmdc:mga03683_226860_c1 nmdc:mga03683_226860_c1_161_817 217
74 3300050492 nmdc:mga0yw44_117262_c1 nmdc:mga0yw44_117262_c1_1010_1666 217
75 3300050496 nmdc:mga07m45_278697_c1 nmdc:mga07m45_278697_c1_274_930 217
76 3300009148 Ga0105243_10090880 Ga0105243_100908802 218
77 3300005330 Ga0070690_100114330 Ga0070690_1001143302 219
78 3300005338 Ga0068868_100033067 Ga0068868_1000330673 219
79 3300005343 Ga0070687_100058106 Ga0070687_1000581062 219
80 3300005355 Ga0070671_100165080 Ga0070671_1001650802 219
81 3300005367 Ga0070667_100016131 Ga0070667_1000161313 219
82 3300005441 Ga0070700_100070816 Ga0070700_1000708163 219
83 3300005457 Ga0070662_100112243 Ga0070662_1001122432 219
84 3300005578 Ga0068854_100265249 Ga0068854_1002652492 219
85 3300005616 Ga0068852_100133527 Ga0068852_1001335273 219
86 3300005617 Ga0068859_100028193 Ga0068859_1000281935 219
87 3300005719 Ga0068861_100112000 Ga0068861_1001120003 219
88 3300005841 Ga0068863_100089926 Ga0068863_1000899261 219
89 3300005842 Ga0068858_100013579 Ga0068858_1000135799 219
90 3300005843 Ga0068860_100261850 Ga0068860_1002618502 219
91 3300005844 Ga0068862_100054762 Ga0068862_1000547622 219
92 3300006237 Ga0097621_100126716 Ga0097621_1001267162 219
93 3300006358 Ga0068871_100032026 Ga0068871_1000320265 219
94 3300006846 Ga0075430_100164643 Ga0075430_1001646433 219
95 3300006880 Ga0075429_100004929 Ga0075429_1000049295 219
96 3300006881 Ga0068865_100118368 Ga0068865_1001183681 219
97 3300006931 Ga0097620_100028193 Ga0097620_1000281933 219
98 3300009553 Ga0105249_10034394 Ga0105249_100343943 219
99 3300013296 Ga0157374_10097576 Ga0157374_100975763 219
100 3300013297 Ga0157378_10312446 Ga0157378_103124462 219
101 3300013308 Ga0157375_10772804 Ga0157375_107728042 219
102 3300014325 Ga0163163_10009499 Ga0163163_100094991 219
103 3300014326 Ga0157380_10272280 Ga0157380_102722802 219
104 3300014968 Ga0157379_10171747 Ga0157379_101717472 219
105 3300017792 Ga0163161_10111266 Ga0163161_101112662 219
106 3300025321 Ga0207656_10014449 Ga0207656_100144492 219
107 3300025893 Ga0207682_10096137 Ga0207682_100961372 219
108 3300025903 Ga0207680_10004392 Ga0207680_100043925 219
109 3300025918 Ga0207662_10069806 Ga0207662_100698062 219
110 3300025923 Ga0207681_10071478 Ga0207681_100714782 219
111 3300025926 Ga0207659_10006704 Ga0207659_100067043 219
112 3300025931 Ga0207644_10045846 Ga0207644_100458463 219
113 3300025935 Ga0207709_10069249 Ga0207709_100692493 219
114 3300025937 Ga0207669_10019944 Ga0207669_100199443 219
115 3300025960 Ga0207651_10037017 Ga0207651_100370172 219
116 3300025961 Ga0207712_10219013 Ga0207712_102190131 219
117 3300025972 Ga0207668_10079657 Ga0207668_100796573 219
118 3300025981 Ga0207640_10218077 Ga0207640_102180772 219
119 3300025986 Ga0207658_10028581 Ga0207658_100285813 219
120 3300026023 Ga0207677_10004562 Ga0207677_100045623 219
121 3300026035 Ga0207703_10008117 Ga0207703_100081173 219
122 3300026041 Ga0207639_10371195 Ga0207639_103711952 219
123 3300026088 Ga0207641_10052314 Ga0207641_100523143 219
124 3300026089 Ga0207648_10351978 Ga0207648_103519782 219
125 3300026095 Ga0207676_10010144 Ga0207676_100101445 219
126 3300026118 Ga0207675_100001372 Ga0207675_1000013722 219
127 3300026142 Ga0207698_10359468 Ga0207698_103594682 219
128 3300028380 Ga0268265_10027331 Ga0268265_100273314 219
129 3300045051 Ga0451576_0006976 Ga0451576_0006976_12701_13438 219
130 3300049679 Ga0501249_001742 Ga0501249_001742_1225_2025 219
131 3300050508 nmdc:mga09592_4778_c1 nmdc:mga09592_4778_c1_7161_7871 219
132 3300050509 nmdc:mga0qj67_174427_c1 nmdc:mga0qj67_174427_c1_879_1589 219
133 3300005616 Ga0068852_100221862 Ga0068852_1002218622 220
134 3300026142 Ga0207698_10555959 Ga0207698_105559592 220
135 3300048929 Ga0496126_0119709 Ga0496126_0119709_487_1209 220
136 3300005467 Ga0070706_100846712 Ga0070706_1008467121 221
137 3300031548 Ga0307408_100007096 Ga0307408_10000709610 221
138 3300031730 Ga0307516_10001122 Ga0307516_1000112230 221
139 3300031731 Ga0307405_10004316 Ga0307405_100043162 221
140 3300031824 Ga0307413_10001754 Ga0307413_100017542 221
141 3300031852 Ga0307410_10007332 Ga0307410_100073324 221
142 3300031901 Ga0307406_10008442 Ga0307406_100084421 221
143 3300031903 Ga0307407_10035258 Ga0307407_100352584 221
144 3300031911 Ga0307412_10023541 Ga0307412_100235415 221
145 3300031995 Ga0307409_100002223 Ga0307409_10000222312 221
146 3300032002 Ga0307416_100130855 Ga0307416_1001308551 221
147 3300032004 Ga0307414_10006464 Ga0307414_100064644 221
148 3300032005 Ga0307411_10006283 Ga0307411_100062831 221
149 3300032126 Ga0307415_100005516 Ga0307415_1000055163 221
150 3300005353 Ga0070669_100112834 Ga0070669_1001128341 222
151 3300005543 Ga0070672_100084825 Ga0070672_1000848252 222
152 3300005718 Ga0068866_10128268 Ga0068866_101282682 222
153 3300006358 Ga0068871_100372681 Ga0068871_1003726812 222
154 3300009176 Ga0105242_10069104 Ga0105242_100691043 222
155 3300009177 Ga0105248_10315742 Ga0105248_103157422 222
156 3300013297 Ga0157378_10961794 Ga0157378_109617941 222
157 3300014326 Ga0157380_10385008 Ga0157380_103850082 222
158 3300014497 Ga0182008_10129289 Ga0182008_101292892 222
159 3300014968 Ga0157379_10115785 Ga0157379_101157853 222
160 3300014969 Ga0157376_10361935 Ga0157376_103619352 222
161 3300017792 Ga0163161_10112679 Ga0163161_101126792 222
162 3300025893 Ga0207682_10119229 Ga0207682_101192292 222
163 3300025899 Ga0207642_10146219 Ga0207642_101462192 222
164 3300025934 Ga0207686_10082758 Ga0207686_100827583 222
165 3300025937 Ga0207669_10051123 Ga0207669_100511232 222
166 3300025940 Ga0207691_10112267 Ga0207691_101122673 222
167 3300026089 Ga0207648_10062180 Ga0207648_100621803 222
168 3300026121 Ga0207683_10066534 Ga0207683_100665342 222
169 3300039447 Ga0436361_0021397 Ga0436361_0021397_25726_26457 222
170 3300041509 Ga0451843_0146574 Ga0451843_0146574_258_983 222
171 3300048925 Ga0496122_0000184 Ga0496122_0000184_44303_45034 222
172 3300048926 Ga0496123_0000738 Ga0496123_0000738_34085_34816 222
173 3300048927 Ga0496124_0036030 Ga0496124_0036030_1056_1787 222
174 3300048929 Ga0496126_0211197 Ga0496126_0211197_555_1286 222
175 3300049671 Ga0501238_001434 Ga0501238_001434_725_1456 222
176 3300049758 Ga0501241_014271 Ga0501241_014271_496_1227 222
177 3300053136 Ga0500559_0134785 Ga0500559_0134785_184_915 222
178 3300042117 Ga0450913_010424 Ga0450913_010424_14_733 223
179 3300042876 Ga0451577_0000190 Ga0451577_0000190_41903_42661 223
180 3300044712 Ga0453684_0000618 Ga0453684_0000618_87653_88411 223
181 3300045051 Ga0451576_0001041 Ga0451576_0001041_50291_51052 223
182 3300045051 Ga0451576_0226750 Ga0451576_0226750_571_1308 223
183 3300005289 Ga0065704_10013284 Ga0065704_100132842 224
184 3300014326 Ga0157380_10307497 Ga0157380_103074972 224
185 3300014968 Ga0157379_10071903 Ga0157379_100719033 224
186 3300042004 Ga0439445_0054944 Ga0439445_0054944_72_797 224
187 3300042115 Ga0450911_000210 Ga0450911_000210_4226_4951 224
188 3300042127 Ga0450890_022791 Ga0450890_022791_116_841 224
189 3300048927 Ga0496124_0154228 Ga0496124_0154228_482_1207 224
190 3300048928 Ga0496125_0008051 Ga0496125_0008051_10028_10753 224
191 3300048928 Ga0496125_0029131 Ga0496125_0029131_3946_4671 224
192 3300005356 Ga0070674_100401617 Ga0070674_1004016172 225
193 3300005548 Ga0070665_100003525 Ga0070665_1000035254 225
194 3300014969 Ga0157376_10933403 Ga0157376_109334032 225
195 3300025937 Ga0207669_10100468 Ga0207669_101004682 225
196 3300028379 Ga0268266_10012292 Ga0268266_100122926 225
197 3300031251 Ga0265327_10004244 Ga0265327_1000424413 225
198 3300046516 Ga0495628_0251410 Ga0495628_0251410_528_1253 225
199 3300046522 Ga0495643_0073974 Ga0495643_0073974_402_1127 225
200 3300005367 Ga0070667_100019825 Ga0070667_1000198253 226
201 3300005548 Ga0070665_100341767 Ga0070665_1003417672 226
202 3300009551 Ga0105238_10430233 Ga0105238_104302332 226
203 3300013308 Ga0157375_10471792 Ga0157375_104717922 226
204 3300014497 Ga0182008_10006787 Ga0182008_100067873 226
205 3300015262 Ga0182007_10005457 Ga0182007_100054574 226
206 3300017792 Ga0163161_10037961 Ga0163161_100379613 226
207 3300025926 Ga0207659_10206308 Ga0207659_102063082 226
208 3300025986 Ga0207658_10058427 Ga0207658_100584273 226
209 3300028379 Ga0268266_10182192 Ga0268266_101821922 226
210 3300046475 Ga0495639_0004416 Ga0495639_0004416_1315_2043 226
211 3300046528 Ga0495642_0090504 Ga0495642_0090504_227_955 226
212 3300046665 Ga0495661_0213011 Ga0495661_0213011_145_873 226
213 3300046674 Ga0495588_0038383 Ga0495588_0038383_792_1520 226
214 3300048904 Ga0496101_0101859 Ga0496101_0101859_460_1188 226
215 3300048905 Ga0496102_0091654 Ga0496102_0091654_556_1284 226
216 3300048906 Ga0496103_0035133 Ga0496103_0035133_829_1557 226
217 3300048907 Ga0496104_0092812 Ga0496104_0092812_1087_1815 226
218 3300048908 Ga0496105_0014374 Ga0496105_0014374_857_1585 226
219 3300048909 Ga0496106_0023495 Ga0496106_0023495_2981_3709 226
220 3300048910 Ga0496107_0170266 Ga0496107_0170266_508_1236 226
221 3300048912 Ga0496109_0298302 Ga0496109_0298302_305_1033 226
222 3300048913 Ga0496110_0231027 Ga0496110_0231027_526_1254 226
223 3300048914 Ga0496111_0399609 Ga0496111_0399609_89_817 226
224 3300048917 Ga0496114_0341262 Ga0496114_0341262_143_871 226
225 3300032005 Ga0307411_10003956 Ga0307411_100039565 228
226 3300042120 Ga0450917_000212 Ga0450917_000212_393_1130 228
227 3300042126 Ga0450888_000201 Ga0450888_000201_2471_3208 228
228 3300042127 Ga0450890_001025 Ga0450890_001025_1907_2644 228
229 3300042129 Ga0450891_000553 Ga0450891_000553_1493_2230 228
230 3300042130 Ga0450892_000410 Ga0450892_000410_3564_4301 228
231 3300042144 Ga0450889_001619 Ga0450889_001619_184_921 228
232 3300042532 Ga0450893_0001695 Ga0450893_0001695_274_1011 228
233 3300045051 Ga0451576_0635901 Ga0451576_0635901_182_919 228
234 3300049130 Ga0501310_001074 Ga0501310_001074_423_1160 228
235 3300049517 Ga0501294_003989 Ga0501294_003989_138_875 228
236 3300049522 Ga0501299_013057 Ga0501299_013057_317_1054 228
237 3300049523 Ga0501300_002598 Ga0501300_002598_294_1031 228
238 3300049654 Ga0501207_014977 Ga0501207_014977_180_917 228
239 3300049658 Ga0501211_000514 Ga0501211_000514_2001_2738 228
240 3300049662 Ga0501222_000866 Ga0501222_000866_1696_2433 228
241 3300049669 Ga0501235_000554 Ga0501235_000554_2416_3153 228
242 3300049670 Ga0501236_000725 Ga0501236_000725_2279_3016 228
243 3300049679 Ga0501249_004420 Ga0501249_004420_1269_2006 228
244 3300049682 Ga0501252_003132 Ga0501252_003132_715_1452 228
245 3300049684 Ga0501255_000139 Ga0501255_000139_1940_2677 228
246 3300049704 Ga0501221_000277 Ga0501221_000277_1475_2212 228
247 3300049705 Ga0501225_0008269 Ga0501225_0008269_1878_2615 228
248 3300049706 Ga0501229_003518 Ga0501229_003518_1085_1822 228
249 3300049757 Ga0501232_009185 Ga0501232_009185_50_787 228
250 3300049759 Ga0501262_014190 Ga0501262_014190_65_802 228
251 3300049761 Ga0501264_008771 Ga0501264_008771_131_868 228
252 3300049762 Ga0501265_003342 Ga0501265_003342_900_1637 228
253 3300049764 Ga0501267_001500 Ga0501267_001500_305_1042 228
254 3300049766 Ga0501269_012120 Ga0501269_012120_300_1037 228
255 3300049778 Ga0501282_002803 Ga0501282_002803_1064_1801 228
256 3300005718 Ga0068866_10295862 Ga0068866_102958622 230
257 3300001989 JGI24739J22299_10056873 JGI24739J22299_100568732 231
258 3300003578 Ga0006562J51391_1031713 Ga0006562J51391_10317133 231
259 3300003773 Ga0055537_1000842 Ga0055537_10008428 231
260 3300003784 Ga0055534_1000290 Ga0055534_100029026 231
261 3300003790 Ga0055528_1002803 Ga0055528_10028033 231
262 3300003792 Ga0055540_1005591 Ga0055540_10055913 231
263 3300005288 Ga0065714_10121128 Ga0065714_101211282 231
264 3300006038 Ga0075365_10078888 Ga0075365_100788882 231
265 3300006048 Ga0075363_100368801 Ga0075363_1003688012 231
266 3300006048 Ga0075363_100428558 Ga0075363_1004285581 231
267 3300006051 Ga0075364_10189850 Ga0075364_101898502 231
268 3300006177 Ga0075362_10263046 Ga0075362_102630462 231
269 3300006186 Ga0075369_10028686 Ga0075369_100286862 231
270 3300006195 Ga0075366_10004573 Ga0075366_100045736 231
271 3300006353 Ga0075370_10025727 Ga0075370_100257273 231
272 3300006353 Ga0075370_10075798 Ga0075370_100757982 231
273 3300006948 Ga0099826_10018180 Ga0099826_100181805 231
274 3300009148 Ga0105243_10006987 Ga0105243_100069877 231
275 3300011119 Ga0105246_10037040 Ga0105246_100370403 231
276 3300013100 Ga0157373_10017464 Ga0157373_100174643 231
277 3300025263 Ga0209565_1000150 Ga0209565_100015011 231
278 3300025273 Ga0209673_1000114 Ga0209673_100011493 231
279 3300025291 Ga0209675_1000062 Ga0209675_100006293 231
280 3300025294 Ga0209025_1017133 Ga0209025_10171333 231
281 3300025299 Ga0209256_1025250 Ga0209256_10252502 231
282 3300025303 Ga0209051_1000365 Ga0209051_100036519 231
283 3300025935 Ga0207709_10001280 Ga0207709_100012803 231
284 3300026142 Ga0207698_10057074 Ga0207698_100570742 231
285 3300027666 Ga0209282_1006428 Ga0209282_10064283 231
286 3300027907 Ga0207428_10037132 Ga0207428_100371323 231
287 3300028794 Ga0307515_10000064 Ga0307515_1000006450 231
288 3300030731 Ga0316177_1009786 Ga0316177_10097863 231
289 3300030732 Ga0316176_1139166 Ga0316176_11391664 231
290 3300030735 Ga0316178_1180759 Ga0316178_11807593 231
291 3300030744 Ga0316181_1233761 Ga0316181_12337613 231
292 3300030745 Ga0316182_1024353 Ga0316182_10243532 231
293 3300031548 Ga0307408_100580042 Ga0307408_1005800422 231
294 3300031649 Ga0307514_10019719 Ga0307514_100197196 231
295 3300031731 Ga0307405_10187787 Ga0307405_101877871 231
296 3300031731 Ga0307405_10389561 Ga0307405_103895612 231
297 3300031901 Ga0307406_10032430 Ga0307406_100324303 231
298 3300031903 Ga0307407_10079402 Ga0307407_100794022 231
299 3300032004 Ga0307414_10415809 Ga0307414_104158091 231
300 3300032004 Ga0307414_10594575 Ga0307414_105945751 231
301 3300032126 Ga0307415_100824468 Ga0307415_1008244681 231
302 3300037312 Ga0395899_0003639 Ga0395899_0003639_5927_6628 231
303 3300037418 Ga0395900_0020054 Ga0395900_0020054_3990_4691 231
304 3300037466 Ga0395898_0016994 Ga0395898_0016994_2712_3413 231
305 3300037471 Ga0395905_0012925 Ga0395905_0012925_5069_5770 231
306 3300038443 Ga0395901_0016216 Ga0395901_0016216_5069_5770 231
307 3300041411 Ga0439466_0053527 Ga0439466_0053527_363_1094 231
308 3300041413 Ga0439465_0047674 Ga0439465_0047674_230_961 231
309 3300041512 Ga0451853_1034031 Ga0451853_1034031_197_928 231
310 3300042002 Ga0439442_021752 Ga0439442_021752_109_840 231
311 3300042007 Ga0439449_0085243 Ga0439449_0085243_164_895 231
312 3300042123 Ga0450921_006602 Ga0450921_006602_118_849 231
313 3300042125 Ga0450923_000797 Ga0450923_000797_2724_3455 231
314 3300042184 Ga0450908_008504 Ga0450908_008504_816_1547 231
315 3300042531 Ga0450918_001524 Ga0450918_001524_1681_2412 231
316 3300042532 Ga0450893_0009774 Ga0450893_0009774_543_1274 231
317 3300042876 Ga0451577_0206865 Ga0451577_0206865_689_1426 231
318 3300046660 Ga0495625_0000297 Ga0495625_0000297_59890_60621 231
319 3300048909 Ga0496106_0259750 Ga0496106_0259750_405_1118 231
320 3300050489 nmdc:mga03683_7713_c1 nmdc:mga03683_7713_c1_1275_2006 231
321 3300050490 nmdc:mga03n38_16900_c1 nmdc:mga03n38_16900_c1_1255_1986 231
322 3300050491 nmdc:mga00v17_28715_c1 nmdc:mga00v17_28715_c1_1946_2677 231
323 3300050492 nmdc:mga0yw44_9938_c1 nmdc:mga0yw44_9938_c1_886_1617 231
324 3300050493 nmdc:mga0k408_21708_c1 nmdc:mga0k408_21708_c1_512_1243 231
325 3300050496 nmdc:mga07m45_15957_c1 nmdc:mga07m45_15957_c1_2738_3472 231
326 3300050496 nmdc:mga07m45_2644_c1 nmdc:mga07m45_2644_c1_2538_3269 231
327 3300050516 nmdc:mga0sz30_40780_c2 nmdc:mga0sz30_40780_c2_412_1143 231
328 iso_pu_bacteria 639633007 639785552 231
329 3300014497 Ga0182008_10008035 Ga0182008_100080355 232
330 3300053117 Ga0500593_009764 Ga0500593_009764_1761_2462 232
331 3300005333 Ga0070677_10178852 Ga0070677_101788522 233
332 3300005340 Ga0070689_100601634 Ga0070689_1006016342 233
333 3300005347 Ga0070668_100093382 Ga0070668_1000933822 233
334 3300005367 Ga0070667_100682264 Ga0070667_1006822641 233
335 3300005456 Ga0070678_100527317 Ga0070678_1005273172 233
336 3300005543 Ga0070672_100104073 Ga0070672_1001040732 233
337 3300005549 Ga0070704_100841094 Ga0070704_1008410941 233
338 3300005618 Ga0068864_100585979 Ga0068864_1005859792 233
339 3300005842 Ga0068858_100099839 Ga0068858_1000998393 233
340 3300005843 Ga0068860_100026302 Ga0068860_1000263025 233
341 3300006881 Ga0068865_100865820 Ga0068865_1008658201 233
342 3300009177 Ga0105248_10270789 Ga0105248_102707892 233
343 3300013296 Ga0157374_10013029 Ga0157374_100130292 233
344 3300013297 Ga0157378_10139086 Ga0157378_101390862 233
345 3300013308 Ga0157375_10479986 Ga0157375_104799862 233
346 3300014325 Ga0163163_10474348 Ga0163163_104743482 233
347 3300017792 Ga0163161_10019973 Ga0163161_100199734 233
348 3300025935 Ga0207709_10243485 Ga0207709_102434852 233
349 3300025937 Ga0207669_10150218 Ga0207669_101502182 233
350 3300025938 Ga0207704_10252543 Ga0207704_102525432 233
351 3300025938 Ga0207704_10521394 Ga0207704_105213941 233
352 3300025940 Ga0207691_10395335 Ga0207691_103953352 233
353 3300026035 Ga0207703_10128189 Ga0207703_101281891 233
354 3300026088 Ga0207641_10538695 Ga0207641_105386951 233
355 3300026089 Ga0207648_10167674 Ga0207648_101676742 233
356 3300026089 Ga0207648_10269515 Ga0207648_102695152 233
357 3300026121 Ga0207683_10290818 Ga0207683_102908182 233
358 3300028381 Ga0268264_10048817 Ga0268264_100488174 233
359 3300046615 Ga0495656_0002907 Ga0495656_0002907_3516_4241 233
360 3300005456 Ga0070678_100289129 Ga0070678_1002891291 234
361 3300026121 Ga0207683_10320467 Ga0207683_103204671 234
362 3300027682 Ga0209971_1000610 Ga0209971_10006105 234
363 3300031238 Ga0265332_10000035 Ga0265332_1000003579 234
364 3300042876 Ga0451577_0001771 Ga0451577_0001771_11387_12127 234
365 3300044712 Ga0453684_0148014 Ga0453684_0148014_1041_1820 234
366 3300045051 Ga0451576_0125168 Ga0451576_0125168_677_1411 234
367 3300045051 Ga0451576_0202553 Ga0451576_0202553_512_1246 234
368 3300048919 Ga0496116_0001057 Ga0496116_0001057_14060_14791 234
369 iso_pu_bacteria 2511231002 2511243536 234
370 3300031251 Ga0265327_10000589 Ga0265327_1000058933 235
371 3300037312 Ga0395899_0190370 Ga0395899_0190370_424_1185 235
372 3300037471 Ga0395905_0523215 Ga0395905_0523215_297_1058 235
373 3300038443 Ga0395901_0158647 Ga0395901_0158647_345_1106 235
374 3300044673 Ga0453683_0003388 Ga0453683_0003388_4658_5419 235
375 3300044712 Ga0453684_0033421 Ga0453684_0033421_5276_6013 235
376 3300044712 Ga0453684_0359999 Ga0453684_0359999_19_756 235
377 3300045051 Ga0451576_0000237 Ga0451576_0000237_118539_119276 235
378 3300045051 Ga0451576_0027762 Ga0451576_0027762_857_1618 235
379 3300003759 Ga0055525_1000031 Ga0055525_1000031117 236
380 3300005338 Ga0068868_100012774 Ga0068868_1000127743 236
381 3300005563 Ga0068855_100228474 Ga0068855_1002284741 236
382 3300005614 Ga0068856_100231784 Ga0068856_1002317843 236
383 3300006177 Ga0075362_10141458 Ga0075362_101414582 236
384 3300006195 Ga0075366_10248901 Ga0075366_102489012 236
385 3300009093 Ga0105240_10833215 Ga0105240_108332152 236
386 3300009098 Ga0105245_10493419 Ga0105245_104934191 236
387 3300010375 Ga0105239_10080161 Ga0105239_100801613 236
388 3300012502 Ga0157347_1000750 Ga0157347_10007502 236
389 3300014969 Ga0157376_10226220 Ga0157376_102262202 236
390 3300025230 Ga0209563_100044 Ga0209563_100044186 236
391 3300025273 Ga0209673_1027689 Ga0209673_10276892 236
392 3300025297 Ga0209758_1019568 Ga0209758_10195683 236
393 3300025927 Ga0207687_10341088 Ga0207687_103410881 236
394 3300025949 Ga0207667_10115027 Ga0207667_101150274 236
395 3300026023 Ga0207677_10129922 Ga0207677_101299222 236
396 3300026078 Ga0207702_10195115 Ga0207702_101951151 236
397 3300028794 Ga0307515_10011665 Ga0307515_1001166514 236
398 3300031649 Ga0307514_10002069 Ga0307514_1000206914 236
399 3300044842 Ga0466957_0170668 Ga0466957_0170668_289_1050 236
400 iso_pu_bacteria 2513020051 2513231578 236
401 iso_pu_bacteria 2599185214 2599621003 236
402 iso_pu_bacteria 2599185226 2599674191 236
403 iso_pu_bacteria 2599185227 2599678381 236
404 iso_pu_bacteria 2599185229 2599690514 236
405 iso_pu_bacteria 2643221658 2644325757 236
406 iso_pu_bacteria 2643221672 2644400857 236
407 iso_pu_bacteria 2711768613 2713472349 236
408 iso_pu_bacteria 2738541277 2738723012 236
409 iso_pu_bacteria 2738541307 2738882436 236
410 iso_pu_bacteria 2738543019 2739283743 236
411 iso_pu_bacteria 2885198086 2885201982 236
412 iso_pu_bacteria 2885211737 2885215308 236
413 iso_pu_bacteria 2904479285 2904479483 236
414 iso_pu_bacteria 2904541872 2904545989 236
415 iso_pu_bacteria 2928070936 2928073739 236
416 iso_pu_bacteria 2928084124 2928085997 236
417 iso_pu_bacteria 2929160207 2929161184 236
418 iso_pu_bacteria 2945909444 2945914335 236
419 iso_pu_bacteria 2945984333 2945990271 236
420 3300003794 Ga0055531_10000436 Ga0055531_1000043619 237
421 3300005563 Ga0068855_100117910 Ga0068855_1001179102 237
422 3300009093 Ga0105240_10066437 Ga0105240_100664374 237
423 3300009545 Ga0105237_10120434 Ga0105237_101204343 237
424 3300009551 Ga0105238_10094741 Ga0105238_100947412 237
425 3300010375 Ga0105239_10082268 Ga0105239_100822683 237
426 3300013100 Ga0157373_10025058 Ga0157373_100250583 237
427 3300013105 Ga0157369_10013025 Ga0157369_100130255 237
428 3300013297 Ga0157378_10174981 Ga0157378_101749812 237
429 3300025273 Ga0209673_1029198 Ga0209673_10291982 237
430 3300025303 Ga0209051_1000025 Ga0209051_1000025247 237
431 3300025304 Ga0209257_1000039 Ga0209257_1000039361 237
432 3300025913 Ga0207695_10215440 Ga0207695_102154402 237
433 3300025924 Ga0207694_10021260 Ga0207694_100212602 237
434 3300025949 Ga0207667_10098918 Ga0207667_100989182 237
435 3300039447 Ga0436361_0562232 Ga0436361_0562232_47_838 237
436 iso_pu_bacteria 2643221628 2644161262 237
437 iso_pu_bacteria 2842677519 2842681127 237
438 iso_pu_bacteria 2842718218 2842721770 237
439 iso_pu_bacteria 2842733646 2842737446 237
440 iso_pu_bacteria 2842747753 2842749806 237
441 iso_pu_bacteria 2885192300 2885196622 237
442 iso_pu_bacteria 2904449895 2904454084 237
443 iso_pu_bacteria 2904456579 2904462059 237
444 iso_pu_bacteria 2919462493 2919465312 237
445 iso_pu_bacteria 2929520902 2929521815 237
446 iso_pu_bacteria 2945945610 2945949881 237
447 iso_pu_bacteria 2945972063 2945973884 237
448 iso_pu_bacteria 2954767861 2954770511 237
449 iso_pu_bacteria 2974320154 2974322160 237
450 3300006177 Ga0075362_10038402 Ga0075362_100384022 238
451 3300006178 Ga0075367_10013717 Ga0075367_100137173 238
452 3300006195 Ga0075366_10017902 Ga0075366_100179024 238
453 3300013306 Ga0163162_10338200 Ga0163162_103382002 238
454 3300025909 Ga0207705_10336261 Ga0207705_103362612 238
455 3300027866 Ga0209813_10010910 Ga0209813_100109103 238
456 3300042007 Ga0439449_0014203 Ga0439449_0014203_893_1651 238
457 3300042015 Ga0439462_0002682 Ga0439462_0002682_428_1186 238
458 3300048907 Ga0496104_0103472 Ga0496104_0103472_1766_2491 238
459 3300050493 nmdc:mga0k408_21783_c1 nmdc:mga0k408_21783_c1_222_965 238
460 3300050495 nmdc:mga04h51_19339_c1 nmdc:mga04h51_19339_c1_857_1579 238
461 3300059643 Ga0587072_029890 Ga0587072_029890_152_883 238
462 3300001979 JGI24740J21852_10018062 JGI24740J21852_100180622 239
463 3300001989 JGI24739J22299_10055276 JGI24739J22299_100552762 239
464 3300002739 JGI25158J39367_1010187 JGI25158J39367_10101872 239
465 3300002773 JGI25152J39213_1003566 JGI25152J39213_10035664 239
466 3300002774 JGI25150J39212_1002908 JGI25150J39212_10029083 239
467 3300002987 JGI25159J45721_1005944 JGI25159J45721_10059443 239
468 3300003187 JGI25151J46595_10005919 JGI25151J46595_100059191 239
469 3300003187 JGI25151J46595_10009155 JGI25151J46595_100091554 239
470 3300003187 JGI25151J46595_10010213 JGI25151J46595_100102131 239
471 3300003215 JGI25153J46596_10008968 JGI25153J46596_100089684 239
472 3300003354 JGI25160J50197_1010406 JGI25160J50197_10104063 239
473 3300003374 JGI25161J50226_1003339 JGI25161J50226_10033393 239
474 3300003771 Ga0055526_1012334 Ga0055526_10123343 239
475 3300003773 Ga0055537_1004834 Ga0055537_10048343 239
476 3300003775 Ga0055524_1010252 Ga0055524_10102523 239
477 3300003781 Ga0055536_1001211 Ga0055536_100121116 239
478 3300003781 Ga0055536_1021502 Ga0055536_10215022 239
479 3300003784 Ga0055534_1003711 Ga0055534_10037114 239
480 3300003790 Ga0055528_1010575 Ga0055528_10105753 239
481 3300003791 Ga0055530_10017768 Ga0055530_100177682 239
482 3300003792 Ga0055540_1004087 Ga0055540_10040876 239
483 3300003792 Ga0055540_1007080 Ga0055540_10070802 239
484 3300003794 Ga0055531_10015212 Ga0055531_100152123 239
485 3300004625 Ga0055543_1004532 Ga0055543_10045323 239
486 3300005262 Ga0065165_1007653 Ga0065165_10076533 239
487 3300005289 Ga0065704_10110781 Ga0065704_101107812 239
488 3300005289 Ga0065704_10129756 Ga0065704_101297562 239
489 3300005327 Ga0070658_10099021 Ga0070658_100990213 239
490 3300005335 Ga0070666_10274243 Ga0070666_102742432 239
491 3300005336 Ga0070680_100483326 Ga0070680_1004833262 239
492 3300005339 Ga0070660_100537085 Ga0070660_1005370851 239
493 3300005435 Ga0070714_100213040 Ga0070714_1002130402 239
494 3300005530 Ga0070679_100059819 Ga0070679_1000598193 239
495 3300005530 Ga0070679_100141961 Ga0070679_1001419613 239
496 3300005539 Ga0068853_100385371 Ga0068853_1003853712 239
497 3300005563 Ga0068855_100012468 Ga0068855_1000124687 239
498 3300005577 Ga0068857_100047019 Ga0068857_1000470193 239
499 3300005578 Ga0068854_100405047 Ga0068854_1004050472 239
500 3300005616 Ga0068852_100097787 Ga0068852_1000977872 239
501 3300006048 Ga0075363_100048474 Ga0075363_1000484742 239
502 3300006048 Ga0075363_100081585 Ga0075363_1000815853 239
503 3300006178 Ga0075367_10068132 Ga0075367_100681322 239
504 3300006195 Ga0075366_10013946 Ga0075366_100139463 239
505 3300006195 Ga0075366_10125106 Ga0075366_101251062 239
506 3300006353 Ga0075370_10307291 Ga0075370_103072912 239
507 3300009036 Ga0105244_10011632 Ga0105244_100116324 239
508 3300009036 Ga0105244_10100727 Ga0105244_101007272 239
509 3300009093 Ga0105240_10052818 Ga0105240_100528184 239
510 3300009093 Ga0105240_10146894 Ga0105240_101468943 239
511 3300009176 Ga0105242_10000311 Ga0105242_100003115 239
512 3300009545 Ga0105237_10106184 Ga0105237_101061843 239
513 3300009551 Ga0105238_10029865 Ga0105238_100298655 239
514 3300009551 Ga0105238_10038608 Ga0105238_100386082 239
515 3300011119 Ga0105246_10082206 Ga0105246_100822063 239
516 3300013100 Ga0157373_10452197 Ga0157373_104521972 239
517 3300013104 Ga0157370_10083781 Ga0157370_100837812 239
518 3300014497 Ga0182008_10006629 Ga0182008_100066292 239
519 3300017792 Ga0163161_10005030 Ga0163161_100050307 239
520 3300017792 Ga0163161_10028919 Ga0163161_100289192 239
521 3300025208 Ga0209436_104505 Ga0209436_1045053 239
522 3300025245 Ga0207425_1000414 Ga0207425_100041416 239
523 3300025258 Ga0209129_1000084 Ga0209129_1000084148 239
524 3300025258 Ga0209129_1000414 Ga0209129_100041418 239
525 3300025258 Ga0209129_1000731 Ga0209129_100073119 239
526 3300025284 Ga0209130_1001159 Ga0209130_100115915 239
527 3300025291 Ga0209675_1005156 Ga0209675_10051563 239
528 3300025292 Ga0209676_1000325 Ga0209676_100032582 239
529 3300025292 Ga0209676_1001513 Ga0209676_10015133 239
530 3300025294 Ga0209025_1000521 Ga0209025_100052120 239
531 3300025294 Ga0209025_1000709 Ga0209025_100070938 239
532 3300025294 Ga0209025_1002529 Ga0209025_100252914 239
533 3300025294 Ga0209025_1021785 Ga0209025_10217853 239
534 3300025295 Ga0209564_1000357 Ga0209564_100035747 239
535 3300025297 Ga0209758_1000184 Ga0209758_1000184110 239
536 3300025298 Ga0209050_1001113 Ga0209050_100111320 239
537 3300025298 Ga0209050_1018323 Ga0209050_10183232 239
538 3300025298 Ga0209050_1021447 Ga0209050_10214472 239
539 3300025299 Ga0209256_1000156 Ga0209256_1000156102 239
540 3300025302 Ga0207426_1000049 Ga0207426_100004936 239
541 3300025303 Ga0209051_1000760 Ga0209051_10007603 239
542 3300025303 Ga0209051_1001379 Ga0209051_10013793 239
543 3300025303 Ga0209051_1011447 Ga0209051_10114473 239
544 3300025304 Ga0209257_1000411 Ga0209257_100041163 239
545 3300025304 Ga0209257_1009384 Ga0209257_10093844 239
546 3300025304 Ga0209257_1013350 Ga0209257_10133504 239
547 3300025728 Ga0207655_1007807 Ga0207655_10078076 239
548 3300025909 Ga0207705_10237901 Ga0207705_102379012 239
549 3300025917 Ga0207660_10492481 Ga0207660_104924812 239
550 3300025920 Ga0207649_10253715 Ga0207649_102537152 239
551 3300025921 Ga0207652_10189841 Ga0207652_101898411 239
552 3300025929 Ga0207664_10283549 Ga0207664_102835491 239
553 3300025932 Ga0207690_10029296 Ga0207690_100292963 239
554 3300025934 Ga0207686_10005767 Ga0207686_100057676 239
555 3300025935 Ga0207709_10007586 Ga0207709_100075862 239
556 3300025942 Ga0207689_10230584 Ga0207689_102305842 239
557 3300025981 Ga0207640_10489972 Ga0207640_104899722 239
558 3300026041 Ga0207639_10056313 Ga0207639_100563132 239
559 3300026067 Ga0207678_10178117 Ga0207678_101781172 239
560 3300026116 Ga0207674_10036676 Ga0207674_100366763 239
561 3300026116 Ga0207674_10124358 Ga0207674_101243583 239
562 3300028380 Ga0268265_10018378 Ga0268265_100183785 239
563 3300028794 Ga0307515_10290427 Ga0307515_102904272 239
564 3300031251 Ga0265327_10000399 Ga0265327_1000039961 239
565 3300031456 Ga0307513_10424904 Ga0307513_104249042 239
566 3300031731 Ga0307405_10008322 Ga0307405_100083224 239
567 3300031911 Ga0307412_10187695 Ga0307412_101876952 239
568 3300031911 Ga0307412_10199731 Ga0307412_101997312 239
569 3300032002 Ga0307416_100066106 Ga0307416_1000661063 239
570 3300032002 Ga0307416_100093775 Ga0307416_1000937752 239
571 3300038443 Ga0395901_0136131 Ga0395901_0136131_886_1623 239
572 3300041407 Ga0439447_059648 Ga0439447_059648_82_807 239
573 3300042006 Ga0439432_005284 Ga0439432_005284_3677_4402 239
574 3300042007 Ga0439449_0006231 Ga0439449_0006231_3429_4154 239
575 3300042010 Ga0439452_013065 Ga0439452_013065_1451_2176 239
576 3300042015 Ga0439462_0013376 Ga0439462_0013376_283_1008 239
577 3300042135 Ga0450899_009764 Ga0450899_009764_314_1039 239
578 3300042435 Ga0439434_0011873 Ga0439434_0011873_1500_2225 239
579 3300044683 Ga0466965_0017859 Ga0466965_0017859_1887_2612 239
580 3300046453 Ga0495627_024947 Ga0495627_024947_401_1132 239
581 3300046530 Ga0495654_0003219 Ga0495654_0003219_1217_1948 239
582 3300046530 Ga0495654_0132460 Ga0495654_0132460_245_973 239
583 3300046539 Ga0495621_0021300 Ga0495621_0021300_480_1211 239
584 3300046557 Ga0495622_0025571 Ga0495622_0025571_1444_2175 239
585 3300046616 Ga0495668_0104950 Ga0495668_0104950_521_1252 239
586 3300046660 Ga0495625_0021330 Ga0495625_0021330_222_953 239
587 3300046683 Ga0495658_0046411 Ga0495658_0046411_488_1219 239
588 3300046691 Ga0495670_0109860 Ga0495670_0109860_218_949 239
589 3300047673 Ga0495593_0003990 Ga0495593_0003990_888_1619 239
590 3300048088 Ga0495602_0142218 Ga0495602_0142218_733_1464 239
591 3300048089 Ga0495614_0007125 Ga0495614_0007125_3754_4485 239
592 3300048905 Ga0496102_0030214 Ga0496102_0030214_39_770 239
593 3300048919 Ga0496116_0026490 Ga0496116_0026490_1812_2540 239
594 3300048920 Ga0496117_0052364 Ga0496117_0052364_940_1668 239
595 3300048920 Ga0496117_0092997 Ga0496117_0092997_874_1602 239
596 3300048921 Ga0496118_0039861 Ga0496118_0039861_1026_1757 239
597 3300048921 Ga0496118_0074883 Ga0496118_0074883_519_1247 239
598 3300048924 Ga0496121_0007622 Ga0496121_0007622_11884_12609 239
599 3300048924 Ga0496121_0049547 Ga0496121_0049547_1021_1749 239
600 3300048924 Ga0496121_0107994 Ga0496121_0107994_1227_1958 239
601 3300048928 Ga0496125_0012419 Ga0496125_0012419_2511_3236 239
602 3300048928 Ga0496125_0044333 Ga0496125_0044333_1988_2716 239
603 3300048929 Ga0496126_0162838 Ga0496126_0162838_435_1166 239
604 3300049759 Ga0501262_000236 Ga0501262_000236_1557_2354 239
605 3300050489 nmdc:mga03683_34264_c1 nmdc:mga03683_34264_c1_761_1486 239
606 3300050496 nmdc:mga07m45_22495_c1 nmdc:mga07m45_22495_c1_2689_3420 239
607 3300050514 nmdc:mga08x19_201199_c1 nmdc:mga08x19_201199_c1_328_1146 239
608 3300053079 Ga0500610_0044805 Ga0500610_0044805_512_1243 239
609 3300053087 Ga0500643_005649 Ga0500643_005649_930_1661 239
610 3300053093 Ga0500651_0000030 Ga0500651_0000030_95326_96057 239
611 3300053118 Ga0500594_0001539 Ga0500594_0001539_4042_4773 239
612 3300053121 Ga0500607_005898 Ga0500607_005898_6626_7357 239
613 3300053122 Ga0500608_031487 Ga0500608_031487_16_747 239
614 3300053134 Ga0500658_0242059 Ga0500658_0242059_81_812 239
615 3300053134 Ga0500658_0242065 Ga0500658_0242065_17_748 239
616 3300053136 Ga0500559_0011698 Ga0500559_0011698_2482_3213 239
617 3300053139 Ga0500568_0001927 Ga0500568_0001927_3561_4292 239
618 3300053141 Ga0500574_029614 Ga0500574_029614_482_1213 239
619 3300053158 Ga0500627_0006957 Ga0500627_0006957_823_1554 239
620 3300053161 Ga0500634_0061396 Ga0500634_0061396_49_780 239
621 3300005295 Ga0065707_10324931 Ga0065707_103249312 240
622 3300005331 Ga0070670_100010572 Ga0070670_1000105727 241
623 3300005618 Ga0068864_100356085 Ga0068864_1003560852 241
624 3300005841 Ga0068863_100072260 Ga0068863_1000722603 241
625 3300006880 Ga0075429_100124963 Ga0075429_1001249633 241
626 3300009177 Ga0105248_10123630 Ga0105248_101236302 241
627 3300025925 Ga0207650_10017064 Ga0207650_100170646 241
628 3300025941 Ga0207711_10239418 Ga0207711_102394181 241
629 3300026088 Ga0207641_10025054 Ga0207641_100250543 241
630 3300026095 Ga0207676_10233647 Ga0207676_102336472 241
631 3300050508 nmdc:mga09592_358245_c1 nmdc:mga09592_358245_c1_96_860 241
632 3300031235 Ga0265330_10000116 Ga0265330_1000011647 243
633 3300031238 Ga0265332_10000012 Ga0265332_10000012213 243
634 3300031241 Ga0265325_10007223 Ga0265325_100072232 243
635 3300031247 Ga0265340_10067866 Ga0265340_100678662 243
636 3300031711 Ga0265314_10000029 Ga0265314_1000002944 243
637 3300032005 Ga0307411_10091909 Ga0307411_100919092 243
638 iso_pu_bacteria 2711768613 2713476010 245
639 iso_pu_bacteria 2643221570 2643866105 246
640 iso_pu_bacteria 2643221596 2643994091 246
641 iso_pu_bacteria 2643221609 2644057673 246
642 iso_pu_bacteria 2643221611 2644072240 246
643 iso_pu_bacteria 2643221652 2644292919 246
644 iso_pu_bacteria 2643221683 2644466084 246
645 iso_pu_bacteria 2643221717 2644647934 246
646 iso_pu_bacteria 2721755523 2722885780 246
647 iso_pu_bacteria 2738543012 2739241947 246
648 iso_pu_bacteria 2816332133 2816470751 246
649 iso_pu_bacteria 2839138175 2839144100 246
650 iso_pu_bacteria 2932422444 2932424435 246
651 iso_pu_bacteria 2990710928 2990714160 246
652 iso_pu_bacteria 2818991446 2819602651 247
653 iso_pu_bacteria 2831265667 2831269963 247
654 iso_pu_bacteria 2838054893 2838055026 247
655 iso_pu_bacteria 2899924645 2899927119 247
656 iso_pu_bacteria 2928037797 2928043967 247
657 iso_pu_bacteria 2928044640 2928048615 247
658 iso_pu_bacteria 2928051484 2928054938 247
659 iso_pu_bacteria 2928064002 2928068377 247
660 iso_pu_bacteria 2928115317 2928118341 247
661 iso_pu_bacteria 2939631187 2939636279 247
662 3300005435 Ga0070714_100878161 Ga0070714_1008781611 248
663 3300025929 Ga0207664_10560283 Ga0207664_105602832 248
664 3300031238 Ga0265332_10013777 Ga0265332_100137772 249
665 3300031711 Ga0265314_10001279 Ga0265314_100012793 249
666 3300037471 Ga0395905_0145326 Ga0395905_0145326_138_893 249
667 3300042435 Ga0439434_0021337 Ga0439434_0021337_356_1111 249
668 3300044656 Ga0466969_0022418 Ga0466969_0022418_2012_2767 249
669 3300044684 Ga0466966_0004500 Ga0466966_0004500_4422_5177 249
670 3300044693 Ga0466961_0039903 Ga0466961_0039903_1207_1962 249
671 3300044765 Ga0466970_0117078 Ga0466970_0117078_501_1256 249
672 3300046459 Ga0495629_0001059 Ga0495629_0001059_14893_15648 249
673 3300046459 Ga0495629_0004313 Ga0495629_0004313_6615_7370 249
674 3300046462 Ga0495651_0195927 Ga0495651_0195927_483_1238 249
675 3300046463 Ga0495653_0046947 Ga0495653_0046947_604_1359 249
676 3300046471 Ga0495650_0002291 Ga0495650_0002291_14886_15641 249
677 3300046472 Ga0495580_0004245 Ga0495580_0004245_2398_3153 249
678 3300046472 Ga0495580_0113577 Ga0495580_0113577_172_927 249
679 3300046474 Ga0495605_0011048 Ga0495605_0011048_854_1609 249
680 3300046506 Ga0495583_0018628 Ga0495583_0018628_1900_2655 249
681 3300046513 Ga0495616_0021554 Ga0495616_0021554_1229_1984 249
682 3300046517 Ga0495630_0148967 Ga0495630_0148967_336_1091 249
683 3300046523 Ga0495644_0071239 Ga0495644_0071239_59_814 249
684 3300046524 Ga0495648_0061033 Ga0495648_0061033_737_1492 249
685 3300046526 Ga0495666_0049474 Ga0495666_0049474_648_1403 249
686 3300046528 Ga0495642_0001045 Ga0495642_0001045_6321_7076 249
687 3300046528 Ga0495642_0011634 Ga0495642_0011634_562_1317 249
688 3300046530 Ga0495654_0005770 Ga0495654_0005770_5409_6164 249
689 3300046531 Ga0495665_0007530 Ga0495665_0007530_576_1331 249
690 3300046535 Ga0495586_0070809 Ga0495586_0070809_926_1681 249
691 3300046543 Ga0495645_0000759 Ga0495645_0000759_6350_7105 249
692 3300046557 Ga0495622_0003408 Ga0495622_0003408_6687_7442 249
693 3300046660 Ga0495625_0134708 Ga0495625_0134708_727_1482 249
694 3300046680 Ga0495646_0103222 Ga0495646_0103222_382_1137 249
695 3300046684 Ga0495669_0004779 Ga0495669_0004779_2224_2979 249
696 3300046689 Ga0495613_0084640 Ga0495613_0084640_733_1488 249
697 3300046689 Ga0495613_0491702 Ga0495613_0491702_26_781 249
698 3300046690 Ga0495624_0004099 Ga0495624_0004099_6671_7426 249
699 3300046692 Ga0495671_0093054 Ga0495671_0093054_511_1266 249
700 3300046794 Ga0495589_0045746 Ga0495589_0045746_1239_1994 249
701 3300046809 Ga0495600_0019733 Ga0495600_0019733_166_921 249
702 3300047319 Ga0495674_0056400 Ga0495674_0056400_685_1440 249
703 3300047319 Ga0495674_0096697 Ga0495674_0096697_1686_2441 249
704 3300047319 Ga0495674_0268630 Ga0495674_0268630_547_1302 249
705 3300047320 Ga0495672_0177217 Ga0495672_0177217_156_911 249
706 3300047323 Ga0495683_0016632 Ga0495683_0016632_1228_1983 249
707 3300047443 Ga0495687_007763 Ga0495687_007763_1386_2141 249
708 3300047445 Ga0495677_0006051 Ga0495677_0006051_510_1265 249
709 3300047469 Ga0495673_0060968 Ga0495673_0060968_685_1440 249
710 3300047470 Ga0495681_0048740 Ga0495681_0048740_782_1537 249
711 3300047673 Ga0495593_0003200 Ga0495593_0003200_3253_4008 249
712 3300048088 Ga0495602_0407687 Ga0495602_0407687_159_914 249
713 3300048089 Ga0495614_0025363 Ga0495614_0025363_1213_1968 249
714 3300048091 Ga0495626_0014106 Ga0495626_0014106_828_1583 249
715 3300048903 Ga0496100_0464637 Ga0496100_0464637_117_872 249
716 3300048904 Ga0496101_0060686 Ga0496101_0060686_795_1550 249
717 3300048907 Ga0496104_0035331 Ga0496104_0035331_1475_2230 249
718 3300048908 Ga0496105_0002858 Ga0496105_0002858_2006_2761 249
719 3300048908 Ga0496105_0304561 Ga0496105_0304561_499_1254 249
720 3300048915 Ga0496112_0054636 Ga0496112_0054636_24_779 249
721 3300048916 Ga0496113_0097320 Ga0496113_0097320_698_1453 249
722 3300048917 Ga0496114_0005372 Ga0496114_0005372_1522_2277 249
723 3300048918 Ga0496115_0112179 Ga0496115_0112179_960_1715 249
724 3300048924 Ga0496121_0001139 Ga0496121_0001139_36684_37439 249
725 3300049460 Ga0495682_0006901 Ga0495682_0006901_1801_2556 249
726 3300050492 nmdc:mga0yw44_43095_c1 nmdc:mga0yw44_43095_c1_438_1202 249
727 2162886007 SwRhRL2b_contig_3746793 SwRhRL2b_0934.00002360 250
728 2162886007 SwRhRL2b_contig_610863 SwRhRL2b_0621.00007160 250
729 3300002773 JGI25152J39213_1003336 JGI25152J39213_10033363 250
730 3300002774 JGI25150J39212_1000738 JGI25150J39212_10007382 250
731 3300002987 JGI25159J45721_1009574 JGI25159J45721_10095742 250
732 3300003215 JGI25153J46596_10010079 JGI25153J46596_100100793 250
733 3300003316 rootH1_10006334 rootH1_100063342 250
734 3300003320 rootH2_10097452 rootH2_100974522 250
735 3300003323 rootH1_10003106 rootH1_100031062 250
736 3300003354 JGI25160J50197_1017894 JGI25160J50197_10178942 250
737 3300003374 JGI25161J50226_1005841 JGI25161J50226_10058412 250
738 3300003761 Ga0055535_1000790 Ga0055535_10007904 250
739 3300003762 Ga0055542_1000091 Ga0055542_100009189 250
740 3300003771 Ga0055526_1012373 Ga0055526_10123733 250
741 3300003773 Ga0055537_1004874 Ga0055537_10048743 250
742 3300003775 Ga0055524_1010305 Ga0055524_10103053 250
743 3300003781 Ga0055536_1011717 Ga0055536_10117173 250
744 3300003784 Ga0055534_1000787 Ga0055534_10007875 250
745 3300003784 Ga0055534_1002934 Ga0055534_10029342 250
746 3300003790 Ga0055528_1010131 Ga0055528_10101313 250
747 3300003791 Ga0055530_10001775 Ga0055530_1000177512 250
748 3300003792 Ga0055540_1007100 Ga0055540_10071003 250
749 3300003794 Ga0055531_10008922 Ga0055531_100089223 250
750 3300004625 Ga0055543_1005437 Ga0055543_10054373 250
751 3300005262 Ga0065165_1021367 Ga0065165_10213672 250
752 3300005289 Ga0065704_10073773 Ga0065704_100737733 250
753 3300005614 Ga0068856_100228852 Ga0068856_1002288522 250
754 3300005834 Ga0068851_10002216 Ga0068851_100022165 250
755 3300006353 Ga0075370_10022477 Ga0075370_100224773 250
756 3300006931 Ga0097620_100650691 Ga0097620_1006506912 250
757 3300006946 Ga0079104_1000020 Ga0079104_100002010 250
758 3300009092 Ga0105250_10003253 Ga0105250_100032536 250
759 3300009148 Ga0105243_10014258 Ga0105243_100142585 250
760 3300013307 Ga0157372_10499990 Ga0157372_104999902 250
761 3300015683 Ga0183362_10005 Ga0183362_10005116 250
762 3300021361 Ga0213872_10000006 Ga0213872_1000000639 250
763 3300021361 Ga0213872_10000085 Ga0213872_1000008556 250
764 3300021361 Ga0213872_10001073 Ga0213872_100010733 250
765 3300021361 Ga0213872_10024158 Ga0213872_100241581 250
766 3300025208 Ga0209436_102690 Ga0209436_1026905 250
767 3300025229 Ga0209147_100347 Ga0209147_10034721 250
768 3300025242 Ga0209258_100143 Ga0209258_10014321 250
769 3300025245 Ga0207425_1005204 Ga0207425_10052043 250
770 3300025254 Ga0209148_1000007 Ga0209148_10000071366 250
771 3300025263 Ga0209565_1000772 Ga0209565_10007723 250
772 3300025273 Ga0209673_1001701 Ga0209673_10017013 250
773 3300025284 Ga0209130_1000323 Ga0209130_100032326 250
774 3300025284 Ga0209130_1002174 Ga0209130_10021744 250
775 3300025291 Ga0209675_1000394 Ga0209675_100039415 250
776 3300025291 Ga0209675_1001017 Ga0209675_100101716 250
777 3300025292 Ga0209676_1000112 Ga0209676_100011250 250
778 3300025292 Ga0209676_1017162 Ga0209676_10171623 250
779 3300025294 Ga0209025_1013573 Ga0209025_10135733 250
780 3300025295 Ga0209564_1000108 Ga0209564_1000108130 250
781 3300025295 Ga0209564_1038005 Ga0209564_10380052 250
782 3300025297 Ga0209758_1013856 Ga0209758_10138563 250
783 3300025298 Ga0209050_1000052 Ga0209050_1000052166 250
784 3300025298 Ga0209050_1000445 Ga0209050_100044550 250
785 3300025298 Ga0209050_1019662 Ga0209050_10196622 250
786 3300025299 Ga0209256_1000101 Ga0209256_100010128 250
787 3300025302 Ga0207426_1000086 Ga0207426_1000086158 250
788 3300025302 Ga0207426_1001811 Ga0207426_100181110 250
789 3300025303 Ga0209051_1000220 Ga0209051_100022080 250
790 3300025304 Ga0209257_1000037 Ga0209257_1000037133 250
791 3300025304 Ga0209257_1007391 Ga0209257_10073911 250
792 3300025711 Ga0207696_1003921 Ga0207696_10039214 250
793 3300025935 Ga0207709_10000198 Ga0207709_1000019825 250
794 3300026078 Ga0207702_10144267 Ga0207702_101442673 250
795 3300027111 Ga0209281_1000002 Ga0209281_1000002734 250
796 3300031911 Ga0307412_10156523 Ga0307412_101565231 250
797 3300032005 Ga0307411_10211797 Ga0307411_102117972 250
798 3300039447 Ga0436361_0019641 Ga0436361_0019641_49123_49881 250
799 3300039447 Ga0436361_0085209 Ga0436361_0085209_16609_17367 250
800 3300039447 Ga0436361_0422921 Ga0436361_0422921_1413_2174 250
801 3300039447 Ga0436361_0741203 Ga0436361_0741203_564_1325 250
802 3300042532 Ga0450893_0002038 Ga0450893_0002038_647_1402 250
803 3300046542 Ga0495597_0000054 Ga0495597_0000054_59419_60174 250
804 3300048925 Ga0496122_0188859 Ga0496122_0188859_350_1105 250
805 3300048928 Ga0496125_0001094 Ga0496125_0001094_20024_20779 250
806 3300048929 Ga0496126_0024068 Ga0496126_0024068_1156_1911 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

71

258

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.84 30 236
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8008 35 191
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7992 33 239
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7977 30 236
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7942 31 239
ID Description Score Start End Superfamily
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9009 29 239 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8946 31 237 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8934 40 237 1.10.3720.10
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8799 40 240 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8714 31 239 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3D3D1Z7-F1-model_v4 deleted 0.9422 1 250
AF-A0A2U1CBF3-F1-model_v4 Amino acid ABC transporter membrane protein 1 (PAAT family) 0.9413 1 250 GO:0006865
GO:0022857
GO:0043190
AF-A0A2S9K9A9-F1-model_v4 Glutamate ABC transporter permease 0.9394 1 250 GO:0006865
GO:0022857
GO:0043190
AF-A0A4Q3FYS5-F1-model_v4 deleted 0.9374 2 191
AF-A0A7H0GNR8-F1-model_v4 Amino acid ABC transporter permease 0.9366 1 250 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
80.74 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map