F481409

General Info

Members Datasets Scaffolds Average Seq Length
801 399 1602 44

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_102366382|Ga0068864_1023663822
Length 54
Sequence LVVETLGGHVMKTEFNHAANDSPRSGSSKRITPVVWAIIVVAVVAVVIWFRIYA

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
212 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
213 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
248 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
249 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
250 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
251 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
254 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
255 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
256 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
374 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
378 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
383 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
386 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
387 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
388 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 4.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.61
Nodule 0
Rhizoplane 6.62
Rhizosphere 80.15
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_102366382 3300005618 Unclassified 537
2 Ga0006778J45830_1054280 3300003162 Bacteria 629
3 Ga0006759J45824_1022058 3300003163 Bacteria 508
4 Ga0006759J45824_1028585 3300003163 Bacteria 756
5 Ga0006770J48903_1062456 3300003305 Bacteria 780
6 Ga0007417J51691_1043315 3300003544 Bacteria 756
7 Ga0007410J51695_1026477 3300003574 Bacteria 758
8 Ga0007409J51694_1045030 3300003575 Bacteria 703
9 Ga0007416J51690_1024662 3300003577 Bacteria 758
10 Ga0007416J51690_1039875 3300003577 Bacteria 505
11 JGI25404J52841_10083075 3300003659 Bacteria 669
12 Ga0032354_1059508 3300003693 Bacteria 568
13 Ga0032354_1089967 3300003693 Bacteria 721
14 Ga0058860_11826109 3300004801 Bacteria 587
15 Ga0065712_10261660 3300005290 Bacteria 935
16 Ga0070658_10259827 3300005327 Bacteria 1474
17 Ga0070676_10144643 3300005328 Bacteria 1517
18 Ga0070683_100863534 3300005329 Bacteria 868
19 Ga0070683_100959909 3300005329 Bacteria 820
20 Ga0070690_100279802 3300005330 Bacteria 1190
21 Ga0070670_100148484 3300005331 Bacteria 2028
22 Ga0070670_100458941 3300005331 Bacteria 1130
23 Ga0068869_100007639 3300005334 Bacteria 6923
24 Ga0068869_100720828 3300005334 Bacteria 852
25 Ga0070666_11085239 3300005335 Bacteria 595
26 Ga0070680_100138196 3300005336 Bacteria 2042
27 Ga0070682_100387355 3300005337 Bacteria 1053
28 Ga0070682_100486911 3300005337 Bacteria 953
29 Ga0070682_102089237 3300005337 Bacteria 500
30 Ga0068868_100181046 3300005338 Bacteria 1748
31 Ga0068868_100330039 3300005338 Bacteria 1302
32 Ga0068868_100879672 3300005338 Bacteria 813
33 Ga0068868_101254347 3300005338 Bacteria 687
34 Ga0070660_100016507 3300005339 Bacteria 5360
35 Ga0070660_100316282 3300005339 Bacteria 1282
36 Ga0070689_100573131 3300005340 Bacteria 975
37 Ga0070661_100073934 3300005344 Bacteria 2510
38 Ga0070661_100374887 3300005344 Bacteria 1121
39 Ga0070661_100450778 3300005344 Bacteria 1024
40 Ga0070692_10641296 3300005345 Bacteria 708
41 Ga0070668_100027016 3300005347 Bacteria 4357
42 Ga0070668_100084750 3300005347 Bacteria 2489
43 Ga0070668_100648172 3300005347 Bacteria 928
44 Ga0070669_101188330 3300005353 Bacteria 659
45 Ga0070675_100960870 3300005354 Bacteria 784
46 Ga0070675_101462699 3300005354 Bacteria 630
47 Ga0070671_100231808 3300005355 Bacteria 1567
48 Ga0070671_100300908 3300005355 Bacteria 1366
49 Ga0070673_101255769 3300005364 Bacteria 695
50 Ga0070688_100777899 3300005365 Bacteria 747
51 Ga0070659_100507502 3300005366 Bacteria 1028
52 Ga0070659_101249438 3300005366 Bacteria 658
53 Ga0070667_100186177 3300005367 Bacteria 1837
54 Ga0070667_100199581 3300005367 Bacteria 1775
55 Ga0070667_100301632 3300005367 Bacteria 1442
56 Ga0070709_10043432 3300005434 Bacteria 2779
57 Ga0070709_10826067 3300005434 Bacteria 729
58 Ga0070714_100264156 3300005435 Bacteria 1594
59 Ga0070714_100303130 3300005435 Bacteria 1490
60 Ga0070713_100025794 3300005436 Bacteria 4602
61 Ga0070713_100349314 3300005436 Bacteria 1372
62 Ga0070710_10058974 3300005437 Bacteria 2178
63 Ga0070710_10434069 3300005437 Bacteria 887
64 Ga0070701_11186191 3300005438 Bacteria 541
65 Ga0070711_100045515 3300005439 Bacteria 2985
66 Ga0070711_100565748 3300005439 Bacteria 945
67 Ga0070711_100637048 3300005439 Bacteria 892
68 Ga0070711_100895193 3300005439 Bacteria 757
69 Ga0070705_101744415 3300005440 Bacteria 527
70 Ga0070700_100571005 3300005441 Bacteria 882
71 Ga0070663_100079773 3300005455 Bacteria 2403
72 Ga0070663_100117116 3300005455 Bacteria 2009
73 Ga0070663_100160563 3300005455 Bacteria 1730
74 Ga0070663_100458792 3300005455 Bacteria 1052
75 Ga0070678_100031967 3300005456 Bacteria 3636
76 Ga0070678_100033334 3300005456 Bacteria 3575
77 Ga0070678_100557538 3300005456 Bacteria 1018
78 Ga0070662_100864169 3300005457 Bacteria 771
79 Ga0070681_10018535 3300005458 Bacteria 6958
80 Ga0070681_10056517 3300005458 Bacteria 3906
81 Ga0070681_10116912 3300005458 Bacteria 2603
82 Ga0070681_10506194 3300005458 Bacteria 1121
83 Ga0070681_10855898 3300005458 Bacteria 827
84 Ga0068867_101234473 3300005459 Bacteria 688
85 Ga0068867_101431781 3300005459 Bacteria 642
86 Ga0068867_102386573 3300005459 Bacteria 503
87 Ga0070679_100069064 3300005530 Bacteria 3525
88 Ga0070679_100585243 3300005530 Bacteria 1059
89 Ga0070679_100730223 3300005530 Bacteria 933
90 Ga0070684_101758006 3300005535 Bacteria 585
91 Ga0070684_102098223 3300005535 Bacteria 533
92 Ga0070697_100262484 3300005536 Bacteria 1479
93 Ga0068853_100031968 3300005539 Bacteria 4455
94 Ga0068853_100108160 3300005539 Bacteria 2466
95 Ga0068853_100779633 3300005539 Bacteria 915
96 Ga0068853_101236074 3300005539 Bacteria 721
97 Ga0070672_101954665 3300005543 Bacteria 528
98 Ga0070686_100089658 3300005544 Bacteria 2054
99 Ga0070693_100042988 3300005547 Bacteria 2549
100 Ga0070693_100076378 3300005547 Bacteria 1985
101 Ga0070665_100042323 3300005548 Bacteria 4578
102 Ga0070665_100147951 3300005548 Bacteria 2351
103 Ga0070665_100636701 3300005548 Unclassified 1079
104 Ga0070665_100674515 3300005548 Bacteria 1047
105 Ga0070704_100402242 3300005549 Bacteria 1169
106 Ga0068855_100029152 3300005563 Bacteria 6600
107 Ga0068855_100352695 3300005563 Bacteria 1620
108 Ga0068855_100697131 3300005563 Bacteria 1087
109 Ga0070664_100233321 3300005564 Bacteria 1650
110 Ga0070664_100317167 3300005564 Bacteria 1412
111 Ga0068857_100680242 3300005577 Bacteria 977
112 Ga0068857_101242460 3300005577 Bacteria 722
113 Ga0068854_100284369 3300005578 Bacteria 1333
114 Ga0068854_101796443 3300005578 Bacteria 562
115 Ga0068856_100219946 3300005614 Bacteria 1914
116 Ga0068856_101150185 3300005614 Bacteria 793
117 Ga0068856_101453262 3300005614 Bacteria 700
118 Ga0068856_102263406 3300005614 Bacteria 552
119 Ga0070702_100306545 3300005615 Bacteria 1101
120 Ga0070702_100508403 3300005615 Bacteria 886
121 Ga0068852_100238984 3300005616 Bacteria 1735
122 Ga0068852_100242647 3300005616 Bacteria 1723
123 Ga0068852_101385969 3300005616 Bacteria 725
124 Ga0068852_102375396 3300005616 Bacteria 551
125 Ga0068852_102727795 3300005616 Bacteria 513
126 Ga0068859_100219799 3300005617 Bacteria 1987
127 Ga0068864_100072908 3300005618 Bacteria 2993
128 Ga0068864_101357875 3300005618 Bacteria 712
129 Ga0068864_102507235 3300005618 Unclassified 522
130 Ga0068866_10079865 3300005718 Bacteria 1754
131 Ga0068861_101103779 3300005719 Bacteria 762
132 Ga0068851_10001682 3300005834 Bacteria 9679
133 Ga0068870_10316953 3300005840 Bacteria 990
134 Ga0068863_100038621 3300005841 Bacteria 4541
135 Ga0068863_101384335 3300005841 Bacteria 711
136 Ga0068863_101472329 3300005841 Bacteria 689
137 Ga0068863_102323894 3300005841 Bacteria 546
138 Ga0068858_100127043 3300005842 Bacteria 2388
139 Ga0068858_100745364 3300005842 Bacteria 954
140 Ga0068860_100978541 3300005843 Bacteria 863
141 Ga0068862_100222757 3300005844 Bacteria 1708
142 Ga0068862_101066208 3300005844 Bacteria 802
143 Ga0068862_101560195 3300005844 Bacteria 667
144 Ga0081455_10023277 3300005937 Bacteria 5767
145 Ga0081540_1001664 3300005983 Bacteria 18920
146 Ga0081540_1008692 3300005983 Bacteria 7070
147 Ga0081540_1229664 3300005983 Bacteria 656
148 Ga0070717_10020455 3300006028 Bacteria 5206
149 Ga0070717_10568982 3300006028 Bacteria 1027
150 Ga0075365_10019969 3300006038 Bacteria 4146
151 Ga0075365_10103952 3300006038 Bacteria 1947
152 Ga0075365_10125120 3300006038 Bacteria 1776
153 Ga0075365_10247706 3300006038 Bacteria 1252
154 Ga0075365_10554858 3300006038 Bacteria 812
155 Ga0075365_10867376 3300006038 Unclassified 637
156 Ga0075368_10018687 3300006042 Bacteria 2607
157 Ga0075368_10030413 3300006042 Bacteria 2091
158 Ga0075368_10053768 3300006042 Bacteria 1603
159 Ga0075363_100002426 3300006048 Bacteria 7611
160 Ga0075363_100032542 3300006048 Bacteria 2709
161 Ga0075363_100235567 3300006048 Bacteria 1052
162 Ga0075363_100328477 3300006048 Bacteria 891
163 Ga0075363_100670685 3300006048 Bacteria 625
164 Ga0075364_10060544 3300006051 Bacteria 2482
165 Ga0075364_10119372 3300006051 Bacteria 1764
166 Ga0075364_10677531 3300006051 Bacteria 704
167 Ga0075364_11131593 3300006051 Bacteria 531
168 Ga0070715_10298633 3300006163 Bacteria 861
169 Ga0070715_10979157 3300006163 Bacteria 526
170 Ga0070716_100128855 3300006173 Bacteria 1596
171 Ga0070716_100409856 3300006173 Bacteria 977
172 Ga0070716_101393177 3300006173 Bacteria 570
173 Ga0070712_100178732 3300006175 Bacteria 1652
174 Ga0070712_100281482 3300006175 Bacteria 1340
175 Ga0070712_100405461 3300006175 Bacteria 1127
176 Ga0075362_10066358 3300006177 Bacteria 1640
177 Ga0075362_10070315 3300006177 Bacteria 1597
178 Ga0075367_10023354 3300006178 Bacteria 3478
179 Ga0075367_10592399 3300006178 Bacteria 704
180 Ga0075369_10055310 3300006186 Bacteria 1724
181 Ga0075369_10134401 3300006186 Bacteria 1125
182 Ga0075369_10282152 3300006186 Bacteria 774
183 Ga0075366_10020590 3300006195 Bacteria 3829
184 Ga0075366_10090885 3300006195 Bacteria 1829
185 Ga0075366_10382188 3300006195 Bacteria 866
186 Ga0097621_100099737 3300006237 Bacteria 2442
187 Ga0097621_100562258 3300006237 Bacteria 1039
188 Ga0097621_100981053 3300006237 Bacteria 790
189 Ga0075370_10006759 3300006353 Bacteria 5792
190 Ga0075370_10058626 3300006353 Bacteria 2190
191 Ga0075370_10109875 3300006353 Bacteria 1600
192 Ga0068871_100125345 3300006358 Bacteria 2173
193 Ga0068871_100351333 3300006358 Bacteria 1304
194 Ga0068871_100444547 3300006358 Bacteria 1161
195 Ga0068871_101874867 3300006358 Bacteria 570
196 Ga0075434_100710319 3300006871 Bacteria 1023
197 Ga0097620_100219812 3300006931 Bacteria 1987
198 Ga0075435_100273289 3300007076 Bacteria 1442
199 Ga0099794_10211805 3300007265 Archaea 994
200 Ga0099795_10069732 3300007788 Bacteria 1324
201 Ga0099795_10164513 3300007788 Bacteria 918
202 Ga0105240_10123144 3300009093 Bacteria 3120
203 Ga0105240_10597841 3300009093 Bacteria 1215
204 Ga0105240_11188072 3300009093 Bacteria 808
205 Ga0105240_11417146 3300009093 Bacteria 730
206 Ga0111539_10090397 3300009094 Bacteria 3598
207 Ga0105245_10031857 3300009098 Bacteria 4668
208 Ga0105245_10752955 3300009098 Bacteria 1010
209 Ga0105245_11178495 3300009098 Bacteria 814
210 Ga0105247_10038717 3300009101 Bacteria 2912
211 Ga0105247_10056820 3300009101 Bacteria 2418
212 Ga0105247_10252554 3300009101 Bacteria 1206
213 Ga0105247_10650725 3300009101 Bacteria 787
214 Ga0114129_11098464 3300009147 Bacteria 996
215 Ga0105243_10669335 3300009148 Bacteria 1008
216 Ga0105241_10040315 3300009174 Bacteria 3525
217 Ga0105241_10539626 3300009174 Bacteria 1046
218 Ga0105241_10983638 3300009174 Bacteria 788
219 Ga0105242_10111645 3300009176 Bacteria 2331
220 Ga0105248_10021342 3300009177 Bacteria 7177
221 Ga0105248_10085221 3300009177 Bacteria 3555
222 Ga0105237_10025276 3300009545 Bacteria 6075
223 Ga0105237_10055573 3300009545 Bacteria 3964
224 Ga0105237_10189656 3300009545 Bacteria 2056
225 Ga0105237_12259402 3300009545 Bacteria 554
226 Ga0105238_10097579 3300009551 Bacteria 2924
227 Ga0105238_10350682 3300009551 Bacteria 1465
228 Ga0105238_10351588 3300009551 Bacteria 1463
229 Ga0105238_11284889 3300009551 Bacteria 757
230 Ga0105249_10794505 3300009553 Bacteria 1010
231 Ga0105249_13352973 3300009553 Bacteria 515
232 Ga0099796_10030995 3300010159 Bacteria 1740
233 Ga0099796_10087168 3300010159 Bacteria 1155
234 Ga0105239_10099936 3300010375 Bacteria 3208
235 Ga0105239_10120945 3300010375 Bacteria 2907
236 Ga0105239_10561960 3300010375 Bacteria 1300
237 Ga0105239_10646414 3300010375 Bacteria 1208
238 Ga0105239_11163450 3300010375 Bacteria 888
239 Ga0105239_12137477 3300010375 Bacteria 651
240 Ga0105246_10053212 3300011119 Bacteria 2785
241 Ga0105246_10726530 3300011119 Bacteria 873
242 Ga0105246_10814976 3300011119 Bacteria 829
243 Ga0105246_10859202 3300011119 Bacteria 810
244 Ga0157373_10655053 3300013100 Bacteria 767
245 Ga0157370_10010408 3300013104 Bacteria 9803
246 Ga0157369_10057149 3300013105 Bacteria 4210
247 Ga0157369_12071798 3300013105 Bacteria 577
248 Ga0157369_12452827 3300013105 Bacteria 528
249 Ga0157374_10075418 3300013296 Bacteria 3187
250 Ga0157374_10496747 3300013296 Bacteria 1224
251 Ga0157374_11555284 3300013296 Bacteria 685
252 Ga0157378_10203141 3300013297 Bacteria 1875
253 Ga0157378_10508606 3300013297 Bacteria 1204
254 Ga0157378_11031147 3300013297 Bacteria 858
255 Ga0157378_11761225 3300013297 Bacteria 667
256 Ga0163162_10248538 3300013306 Bacteria 1910
257 Ga0163162_10268890 3300013306 Bacteria 1836
258 Ga0163162_10442159 3300013306 Bacteria 1432
259 Ga0163162_11125883 3300013306 Bacteria 890
260 Ga0163162_11702470 3300013306 Bacteria 720
261 Ga0157372_13032356 3300013307 Bacteria 537
262 Ga0157375_10076751 3300013308 Bacteria 3369
263 Ga0157375_10350704 3300013308 Bacteria 1641
264 Ga0157375_10679633 3300013308 Bacteria 1184
265 Ga0157375_10761860 3300013308 Bacteria 1119
266 Ga0157375_11609812 3300013308 Bacteria 768
267 Ga0163163_10093284 3300014325 Bacteria 3027
268 Ga0163163_10156434 3300014325 Bacteria 2324
269 Ga0163163_10331632 3300014325 Bacteria 1576
270 Ga0163163_11007297 3300014325 Bacteria 896
271 Ga0163163_12055948 3300014325 Bacteria 631
272 Ga0163163_12833514 3300014325 Unclassified 541
273 Ga0157380_10135110 3300014326 Bacteria 2110
274 Ga0157377_10150390 3300014745 Bacteria 1439
275 Ga0157377_11173227 3300014745 Bacteria 593
276 Ga0157379_10091260 3300014968 Bacteria 2732
277 Ga0157379_10160010 3300014968 Bacteria 2033
278 Ga0157379_11058852 3300014968 Bacteria 775
279 Ga0157379_11095259 3300014968 Bacteria 763
280 Ga0157376_10145222 3300014969 Bacteria 2133
281 Ga0157376_10947924 3300014969 Bacteria 881
282 Ga0157376_11558494 3300014969 Bacteria 694
283 Ga0163161_11508646 3300017792 Bacteria 590
284 Ga0163161_11847842 3300017792 Bacteria 538
285 Ga0206356_11335742 3300020070 Bacteria 702
286 Ga0206356_11705061 3300020070 Bacteria 772
287 Ga0206349_1356360 3300020075 Bacteria 585
288 Ga0206355_1463398 3300020076 Bacteria 656
289 Ga0206355_1673326 3300020076 Bacteria 609
290 Ga0206354_11495061 3300020081 Bacteria 707
291 Ga0213876_10039235 3300021384 Bacteria 2502
292 Ga0224712_10580549 3300022467 Bacteria 546
293 Ga0224712_10616537 3300022467 Bacteria 530
294 Ga0207692_10125044 3300025898 Bacteria 1445
295 Ga0207692_10355599 3300025898 Bacteria 904
296 Ga0207642_10229446 3300025899 Bacteria 1042
297 Ga0207642_10717852 3300025899 Bacteria 631
298 Ga0207710_10087646 3300025900 Bacteria 1452
299 Ga0207710_10265414 3300025900 Bacteria 861
300 Ga0207688_10206633 3300025901 Bacteria 1179
301 Ga0207680_10389840 3300025903 Bacteria 983
302 Ga0207647_10161555 3300025904 Bacteria 1307
303 Ga0207685_10546015 3300025905 Bacteria 616
304 Ga0207685_10869739 3300025905 Unclassified 500
305 Ga0207699_10030041 3300025906 Bacteria 3037
306 Ga0207699_10471967 3300025906 Bacteria 903
307 Ga0207645_10117692 3300025907 Bacteria 1724
308 Ga0207643_10051785 3300025908 Bacteria 2331
309 Ga0207705_10338594 3300025909 Bacteria 1158
310 Ga0207705_11402251 3300025909 Bacteria 531
311 Ga0207654_10005550 3300025911 Bacteria 6380
312 Ga0207654_10533033 3300025911 Bacteria 832
313 Ga0207707_10008400 3300025912 Bacteria 8959
314 Ga0207707_10195265 3300025912 Bacteria 1765
315 Ga0207707_10579833 3300025912 Bacteria 951
316 Ga0207707_10791942 3300025912 Bacteria 790
317 Ga0207695_10463122 3300025913 Bacteria 1151
318 Ga0207671_10179347 3300025914 Bacteria 1648
319 Ga0207671_10215579 3300025914 Bacteria 1503
320 Ga0207671_10747830 3300025914 Bacteria 777
321 Ga0207693_10038490 3300025915 Bacteria 3767
322 Ga0207693_10185464 3300025915 Bacteria 1638
323 Ga0207693_10747672 3300025915 Bacteria 755
324 Ga0207663_10021964 3300025916 Bacteria 3640
325 Ga0207663_10145006 3300025916 Bacteria 1659
326 Ga0207663_10281107 3300025916 Bacteria 1236
327 Ga0207663_10803554 3300025916 Bacteria 749
328 Ga0207663_10838775 3300025916 Bacteria 733
329 Ga0207660_10605818 3300025917 Bacteria 892
330 Ga0207657_10011236 3300025919 Bacteria 8898
331 Ga0207657_10135516 3300025919 Bacteria 2015
332 Ga0207649_10407722 3300025920 Bacteria 1018
333 Ga0207649_11022551 3300025920 Bacteria 651
334 Ga0207652_10044584 3300025921 Bacteria 3778
335 Ga0207652_10311056 3300025921 Bacteria 1422
336 Ga0207652_10373172 3300025921 Bacteria 1288
337 Ga0207681_10841574 3300025923 Bacteria 767
338 Ga0207694_10260102 3300025924 Bacteria 1421
339 Ga0207694_10435763 3300025924 Bacteria 1093
340 Ga0207650_10207533 3300025925 Bacteria 1572
341 Ga0207650_10436996 3300025925 Bacteria 1087
342 Ga0207650_11092888 3300025925 Bacteria 679
343 Ga0207687_10033094 3300025927 Bacteria 3505
344 Ga0207687_10769477 3300025927 Bacteria 820
345 Ga0207700_10007907 3300025928 Bacteria 6543
346 Ga0207700_10160135 3300025928 Bacteria 1868
347 Ga0207664_11784909 3300025929 Bacteria 538
348 Ga0207644_10347772 3300025931 Bacteria 1203
349 Ga0207690_11143754 3300025932 Bacteria 649
350 Ga0207706_10544862 3300025933 Bacteria 999
351 Ga0207686_10039552 3300025934 Bacteria 2862
352 Ga0207686_10272941 3300025934 Bacteria 1245
353 Ga0207709_11104464 3300025935 Bacteria 651
354 Ga0207709_11164637 3300025935 Bacteria 634
355 Ga0207670_10194373 3300025936 Bacteria 1537
356 Ga0207665_10100572 3300025939 Bacteria 2018
357 Ga0207665_10147354 3300025939 Bacteria 1683
358 Ga0207665_10226254 3300025939 Bacteria 1373
359 Ga0207665_10502454 3300025939 Bacteria 937
360 Ga0207691_10549950 3300025940 Bacteria 979
361 Ga0207691_11138269 3300025940 Bacteria 648
362 Ga0207711_10994291 3300025941 Bacteria 778
363 Ga0207711_11097734 3300025941 Bacteria 736
364 Ga0207689_10396491 3300025942 Bacteria 1150
365 Ga0207689_10739280 3300025942 Bacteria 830
366 Ga0207679_10718848 3300025945 Bacteria 907
367 Ga0207679_11674152 3300025945 Bacteria 582
368 Ga0207667_10004391 3300025949 Bacteria 17273
369 Ga0207667_10094348 3300025949 Bacteria 3089
370 Ga0207667_10181192 3300025949 Bacteria 2163
371 Ga0207667_11230089 3300025949 Bacteria 727
372 Ga0207651_10350712 3300025960 Bacteria 1243
373 Ga0207651_11701419 3300025960 Bacteria 568
374 Ga0207712_10756981 3300025961 Bacteria 851
375 Ga0207712_11958976 3300025961 Bacteria 524
376 Ga0207668_10027476 3300025972 Bacteria 3706
377 Ga0207668_11119288 3300025972 Bacteria 706
378 Ga0207640_10108430 3300025981 Bacteria 1963
379 Ga0207658_10413226 3300025986 Bacteria 1188
380 Ga0207658_10436177 3300025986 Bacteria 1158
381 Ga0207658_10563191 3300025986 Bacteria 1021
382 Ga0207658_10677150 3300025986 Bacteria 931
383 Ga0207677_10491234 3300026023 Bacteria 1059
384 Ga0207677_12088127 3300026023 Bacteria 527
385 Ga0207677_12171359 3300026023 Bacteria 516
386 Ga0207703_10091379 3300026035 Bacteria 2560
387 Ga0207703_11039073 3300026035 Bacteria 786
388 Ga0207639_10122660 3300026041 Bacteria 2137
389 Ga0207639_10176436 3300026041 Bacteria 1814
390 Ga0207639_10309234 3300026041 Bacteria 1399
391 Ga0207639_10355251 3300026041 Bacteria 1310
392 Ga0207639_11446083 3300026041 Bacteria 645
393 Ga0207678_10128141 3300026067 Bacteria 2164
394 Ga0207678_10154141 3300026067 Bacteria 1962
395 Ga0207678_10196862 3300026067 Bacteria 1722
396 Ga0207678_11283525 3300026067 Bacteria 648
397 Ga0207708_10098158 3300026075 Bacteria 2264
398 Ga0207702_11346654 3300026078 Bacteria 708
399 Ga0207702_11737195 3300026078 Unclassified 616
400 Ga0207641_10074690 3300026088 Bacteria 2925
401 Ga0207641_11443708 3300026088 Bacteria 689
402 Ga0207648_10127183 3300026089 Bacteria 2242
403 Ga0207648_10191208 3300026089 Bacteria 1814
404 Ga0207648_12184925 3300026089 Bacteria 514
405 Ga0207676_10091158 3300026095 Bacteria 2503
406 Ga0207676_11747847 3300026095 Unclassified 620
407 Ga0207674_10022649 3300026116 Bacteria 6742
408 Ga0207674_10127003 3300026116 Bacteria 2516
409 Ga0207674_11220468 3300026116 Bacteria 722
410 Ga0207675_100900316 3300026118 Bacteria 901
411 Ga0207683_10036561 3300026121 Bacteria 4277
412 Ga0207683_10265545 3300026121 Bacteria 1567
413 Ga0207683_10681872 3300026121 Bacteria 952
414 Ga0207698_10132244 3300026142 Bacteria 2134
415 Ga0207698_10558613 3300026142 Bacteria 1123
416 Ga0207698_10736941 3300026142 Bacteria 983
417 Ga0207698_10775217 3300026142 Bacteria 959
418 Ga0207698_10896587 3300026142 Bacteria 894
419 Ga0209588_1003085 3300027671 Bacteria 4594
420 Ga0209588_1013974 3300027671 Bacteria 2455
421 Ga0209813_10005928 3300027866 Bacteria 2998
422 Ga0209813_10010325 3300027866 Bacteria 2412
423 Ga0268266_10008600 3300028379 Bacteria 9067
424 Ga0268266_10074450 3300028379 Bacteria 2948
425 Ga0268266_10274672 3300028379 Bacteria 1565
426 Ga0268266_11235987 3300028379 Bacteria 722
427 Ga0268266_11875554 3300028379 Bacteria 574
428 Ga0268265_10102603 3300028380 Bacteria 2314
429 Ga0268265_10157258 3300028380 Bacteria 1925
430 Ga0268264_10590885 3300028381 Bacteria 1093
431 Ga0268264_12589589 3300028381 Bacteria 512
432 Ga0265763_1003440 3300030763 Bacteria 1261
433 Ga0265330_10009408 3300031235 Bacteria 4642
434 Ga0265330_10234228 3300031235 Unclassified 774
435 Ga0265332_10029963 3300031238 Bacteria 2377
436 Ga0265340_10001932 3300031247 Bacteria 11846
437 Ga0265339_10051784 3300031249 Bacteria 2239
438 Ga0265331_10118475 3300031250 Bacteria 1211
439 Ga0265331_10269976 3300031250 Bacteria 762
440 Ga0307513_10526330 3300031456 Bacteria 897
441 Ga0307513_10574615 3300031456 Bacteria 838
442 Ga0265313_10058470 3300031595 Bacteria 1817
443 Ga0265313_10294804 3300031595 Unclassified 653
444 Ga0307508_10026944 3300031616 Bacteria 5207
445 Ga0307508_10235517 3300031616 Bacteria 1429
446 Ga0307508_10900673 3300031616 Bacteria 511
447 Ga0265314_10246135 3300031711 Bacteria 1029
448 Ga0265342_10112886 3300031712 Bacteria 1536
449 Ga0307516_10130664 3300031730 Bacteria 2291
450 Ga0307516_10406594 3300031730 Bacteria 1020
451 Ga0307405_10348923 3300031731 Bacteria 1141
452 Ga0307412_11837965 3300031911 Bacteria 558
453 Ga0307409_100547267 3300031995 Bacteria 1135
454 Ga0307416_100231076 3300032002 Bacteria 1783
455 Ga0307510_10062454 3300033180 Unclassified 3807
456 Ga0307510_10243082 3300033180 Bacteria 1293
457 Ga0307510_10594956 3300033180 Bacteria 557
458 Ga0316215_1001635 3300033544 Bacteria 2136
459 Ga0373930_0033740 3300034816 Bacteria 1064
460 Ga0373948_0114409 3300034817 Bacteria 647
461 Ga0373938_0149115 3300034957 Bacteria 621
462 Ga0373929_0074110 3300035085 Bacteria 819
463 Ga0373934_0200778 3300035086 Bacteria 821
464 Ga0373944_0034033 3300035089 Bacteria 1547
465 Ga0373944_0156414 3300035089 Bacteria 806
466 Ga0373949_0087898 3300035090 Bacteria 837
467 Ga0373952_0162757 3300035092 Bacteria 633
468 Ga0373923_0036001 3300035111 Bacteria 2018
469 Ga0373932_0009374 3300035112 Bacteria 2353
470 Ga0373932_0185037 3300035112 Bacteria 733
471 Ga0373936_0092159 3300035113 Bacteria 1271
472 Ga0373936_0519549 3300035113 Bacteria 555
473 Ga0373939_0139230 3300035114 Bacteria 874
474 Ga0373941_0192629 3300035115 Bacteria 771
475 Ga0373945_0157839 3300035116 Bacteria 923
476 Ga0373945_0238456 3300035116 Bacteria 765
477 Ga0373953_0000164 3300035117 Bacteria 17347
478 Ga0373954_0080582 3300035118 Bacteria 1555
479 Ga0373957_0142902 3300035120 Bacteria 979
480 Ga0373960_0266951 3300035121 Bacteria 627
481 Ga0373943_0008645 3300035170 Bacteria 4567
482 Ga0373943_0203737 3300035170 Bacteria 1096
483 Ga0373943_0662173 3300035170 Bacteria 617
484 Ga0373946_0005108 3300035171 Bacteria 4727
485 Ga0373946_0062800 3300035171 Bacteria 1585
486 Ga0373955_0024913 3300035172 Bacteria 3065
487 Ga0373942_0383704 3300035207 Bacteria 502
488 Ga0373962_0127724 3300035242 Bacteria 816
489 Ga0373931_0111018 3300035691 Bacteria 1556
490 Ga0373931_1194581 3300035691 Bacteria 520
491 Ga0373935_0002601 3300035692 Bacteria 10363
492 Ga0373935_0159263 3300035692 Bacteria 1538
493 Ga0373935_0660481 3300035692 Bacteria 767
494 Ga0373935_1447291 3300035692 Bacteria 514
495 Ga0373927_0005379 3300035695 Bacteria 8842
496 Ga0373927_0011572 3300035695 Bacteria 5877
497 Ga0373927_0063675 3300035695 Bacteria 2385
498 Ga0373927_0930314 3300035695 Bacteria 574
499 Ga0373927_1153166 3300035695 Bacteria 511
500 Ga0373933_0064163 3300035724 Bacteria 2221
501 Ga0373933_0142352 3300035724 Bacteria 1514
502 Ga0373933_0705452 3300035724 Bacteria 664
503 Ga0373947_0003674 3300035725 Bacteria 9047
504 Ga0373947_0111560 3300035725 Bacteria 1728
505 Ga0373937_0014988 3300036401 Bacteria 6849
506 Ga0265778_045890 3300036457 Bacteria 590
507 Ga0265778_047054 3300036457 Bacteria 584
508 Ga0372808_016089 3300036459 Unclassified 1071
509 Ga0373925_0002756 3300037068 Bacteria 13906
510 Ga0373925_0419899 3300037068 Bacteria 1093
511 Ga0373925_0575391 3300037068 Bacteria 927
512 Ga0373925_0578061 3300037068 Bacteria 925
513 Ga0373925_1406542 3300037068 Bacteria 571
514 Ga0395900_0338850 3300037418 Bacteria 1480
515 Ga0395898_0754371 3300037466 Bacteria 914
516 Ga0395905_1483019 3300037471 Bacteria 583
517 Ga0395901_0861682 3300038443 Bacteria 890
518 Ga0436365_0222688 3300039437 Bacteria 714
519 Ga0436365_0351215 3300039437 Bacteria 2066
520 Ga0436365_0690344 3300039437 Bacteria 812
521 Ga0451789_1066817 3300041443 Bacteria 636
522 Ga0451791_0048224 3300041451 Bacteria 652
523 Ga0451793_0971666 3300041452 Bacteria 703
524 Ga0451793_1168228 3300041452 Bacteria 553
525 Ga0451797_1466530 3300041453 Bacteria 844
526 Ga0451795_0865050 3300041456 Bacteria 936
527 Ga0451795_1094472 3300041456 Bacteria 1005
528 Ga0451798_0740388 3300041458 Bacteria 515
529 Ga0451800_1641774 3300041459 Bacteria 505
530 Ga0451802_0179968 3300041460 Bacteria 777
531 Ga0451802_0684463 3300041460 Bacteria 749
532 Ga0451837_1514253 3300041494 Bacteria 686
533 Ga0451845_0470797 3300041501 Bacteria 947
534 Ga0451843_1187566 3300041509 Bacteria 602
535 Ga0451843_1666096 3300041509 Bacteria 861
536 Ga0451853_1565746 3300041512 Bacteria 596
537 Ga0451853_4004434 3300041512 Bacteria 668
538 Ga0466967_1375437 3300045976 Bacteria 703
539 Ga0495617_137899 3300046452 Bacteria 780
540 Ga0495617_148469 3300046452 Bacteria 746
541 Ga0495617_268755 3300046452 Bacteria 523
542 Ga0495592_0033954 3300046454 Bacteria 3847
543 Ga0495592_0231957 3300046454 Unclassified 1228
544 Ga0495603_0001356 3300046455 Bacteria 14222
545 Ga0495603_0023430 3300046455 Bacteria 3735
546 Ga0495603_0112121 3300046455 Bacteria 1591
547 Ga0495603_0659961 3300046455 Bacteria 598
548 Ga0495629_0003717 3300046459 Bacteria 11499
549 Ga0495629_1004938 3300046459 Bacteria 543
550 Ga0495638_0114546 3300046460 Bacteria 1599
551 Ga0495641_0019378 3300046461 Bacteria 3483
552 Ga0495651_0077743 3300046462 Bacteria 2511
553 Ga0495651_0098595 3300046462 Bacteria 2180
554 Ga0495651_0163240 3300046462 Bacteria 1594
555 Ga0495653_0071174 3300046463 Bacteria 2601
556 Ga0495580_0001647 3300046472 Bacteria 19644
557 Ga0495580_0310380 3300046472 Bacteria 1073
558 Ga0495580_0645553 3300046472 Bacteria 696
559 Ga0495582_0001151 3300046473 Bacteria 14865
560 Ga0495582_0304732 3300046473 Bacteria 916
561 Ga0495639_0000572 3300046475 Bacteria 17170
562 Ga0495639_0030074 3300046475 Bacteria 2413
563 Ga0495639_0412907 3300046475 Bacteria 683
564 Ga0495639_0685169 3300046475 Bacteria 529
565 Ga0495639_0746755 3300046475 Bacteria 506
566 Ga0495662_0002158 3300046476 Bacteria 9880
567 Ga0495664_0028916 3300046477 Bacteria 3238
568 Ga0495584_0109054 3300046491 Bacteria 1400
569 Ga0495584_0229615 3300046491 Bacteria 943
570 Ga0495585_0020173 3300046492 Bacteria 3835
571 Ga0495585_0112916 3300046492 Bacteria 1443
572 Ga0495585_0170433 3300046492 Bacteria 1125
573 Ga0495585_0198741 3300046492 Bacteria 1022
574 Ga0495594_0002628 3300046499 Bacteria 9336
575 Ga0495594_0282721 3300046499 Bacteria 945
576 Ga0495596_0068044 3300046500 Bacteria 1384
577 Ga0495596_0285066 3300046500 Bacteria 642
578 Ga0495583_0229301 3300046506 Bacteria 749
579 Ga0495606_0267960 3300046507 Bacteria 940
580 Ga0495606_0354369 3300046507 Bacteria 778
581 Ga0495608_0003760 3300046511 Bacteria 10897
582 Ga0495608_0937118 3300046511 Bacteria 505
583 Ga0495610_0256635 3300046512 Bacteria 690
584 Ga0495616_0254806 3300046513 Bacteria 753
585 Ga0495620_0046488 3300046515 Bacteria 1874
586 Ga0495620_0264117 3300046515 Bacteria 656
587 Ga0495620_0394447 3300046515 Unclassified 524
588 Ga0495628_0011450 3300046516 Bacteria 7501
589 Ga0495628_0074706 3300046516 Bacteria 2640
590 Ga0495630_0005891 3300046517 Bacteria 8667
591 Ga0495632_0131050 3300046519 Bacteria 1167
592 Ga0495632_0416773 3300046519 Bacteria 585
593 Ga0495644_0084867 3300046523 Bacteria 1194
594 Ga0495663_0029773 3300046525 Bacteria 1614
595 Ga0495663_0126475 3300046525 Bacteria 859
596 Ga0495666_0006249 3300046526 Bacteria 6000
597 Ga0495652_0415068 3300046529 Bacteria 950
598 Ga0495652_0652028 3300046529 Bacteria 713
599 Ga0495665_0000241 3300046531 Bacteria 27409
600 Ga0495640_0002068 3300046533 Bacteria 16020
601 Ga0495640_0816242 3300046533 Bacteria 555
602 Ga0495598_0028318 3300046537 Bacteria 1553
603 Ga0495598_0038500 3300046537 Bacteria 1385
604 Ga0495621_0070177 3300046539 Bacteria 1289
605 Ga0495621_0277921 3300046539 Bacteria 689
606 Ga0495597_0318803 3300046542 Bacteria 601
607 Ga0495622_0007257 3300046557 Bacteria 5145
608 Ga0495633_0219223 3300046558 Bacteria 871
609 Ga0495633_0380334 3300046558 Bacteria 639
610 Ga0495667_0045750 3300046559 Bacteria 2896
611 Ga0495667_0274509 3300046559 Bacteria 1071
612 Ga0495656_0212584 3300046615 Bacteria 964
613 Ga0495656_0355087 3300046615 Bacteria 760
614 Ga0495668_0034350 3300046616 Bacteria 2846
615 Ga0495668_0228726 3300046616 Bacteria 1018
616 Ga0495668_0269070 3300046616 Bacteria 933
617 Ga0495668_0334511 3300046616 Bacteria 831
618 Ga0495634_0001309 3300046642 Bacteria 22746
619 Ga0495634_0018232 3300046642 Bacteria 4999
620 Ga0495611_0126929 3300046648 Bacteria 1190
621 Ga0495625_0220993 3300046660 Bacteria 1241
622 Ga0495625_0401655 3300046660 Bacteria 856
623 Ga0495625_0540878 3300046660 Bacteria 707
624 Ga0495635_0001468 3300046663 Bacteria 15766
625 Ga0495635_0099613 3300046663 Bacteria 1986
626 Ga0495635_0503601 3300046663 Bacteria 797
627 Ga0495635_0802973 3300046663 Bacteria 606
628 Ga0495659_0129615 3300046664 Bacteria 999
629 Ga0495659_0167391 3300046664 Bacteria 890
630 Ga0495659_0253519 3300046664 Bacteria 734
631 Ga0495661_0063281 3300046665 Bacteria 2188
632 Ga0495661_0474372 3300046665 Bacteria 600
633 Ga0495588_0031734 3300046674 Bacteria 2660
634 Ga0495588_0072842 3300046674 Bacteria 1788
635 Ga0495588_0094368 3300046674 Bacteria 1568
636 Ga0495657_0132470 3300046675 Bacteria 1560
637 Ga0495657_0548818 3300046675 Bacteria 671
638 Ga0495599_0443194 3300046678 Bacteria 770
639 Ga0495599_0530631 3300046678 Bacteria 691
640 Ga0495623_0352739 3300046679 Bacteria 801
641 Ga0495646_0077831 3300046680 Bacteria 1939
642 Ga0495646_0086625 3300046680 Bacteria 1816
643 Ga0495647_0001287 3300046681 Bacteria 7724
644 Ga0495647_0178685 3300046681 Bacteria 922
645 Ga0495658_0001057 3300046683 Bacteria 14542
646 Ga0495613_0003242 3300046689 Bacteria 12175
647 Ga0495613_0720124 3300046689 Bacteria 656
648 Ga0495624_0001492 3300046690 Bacteria 18164
649 Ga0495624_0629419 3300046690 Bacteria 639
650 Ga0495624_0842021 3300046690 Bacteria 541
651 Ga0495670_0258535 3300046691 Bacteria 929
652 Ga0495671_0178749 3300046692 Bacteria 1031
653 Ga0495671_0211283 3300046692 Bacteria 940
654 Ga0495671_0265049 3300046692 Bacteria 828
655 Ga0495660_0070284 3300046810 Bacteria 1859
656 Ga0495660_0146689 3300046810 Bacteria 1169
657 Ga0495581_0001029 3300047315 Bacteria 15086
658 Ga0495581_0280427 3300047315 Bacteria 974
659 Ga0495581_0287940 3300047315 Bacteria 960
660 Ga0495604_0129102 3300047317 Bacteria 1819
661 Ga0495604_0938552 3300047317 Bacteria 539
662 Ga0495636_0340804 3300047318 Bacteria 706
663 Ga0495674_0001007 3300047319 Bacteria 27011
664 Ga0495674_0620794 3300047319 Bacteria 855
665 Ga0495674_1443467 3300047319 Bacteria 511
666 Ga0495674_1478796 3300047319 Bacteria 503
667 Ga0495672_0008876 3300047320 Bacteria 7352
668 Ga0495672_0406591 3300047320 Bacteria 621
669 Ga0495676_0015432 3300047321 Bacteria 6802
670 Ga0495680_0349233 3300047322 Bacteria 1030
671 Ga0495683_0212849 3300047323 Bacteria 866
672 Ga0495675_0012986 3300047444 Bacteria 5251
673 Ga0495677_0354826 3300047445 Bacteria 579
674 Ga0495685_123261 3300047447 Bacteria 850
675 Ga0495684_0024351 3300047471 Bacteria 4660
676 Ga0495684_0027226 3300047471 Bacteria 4390
677 Ga0495686_0263138 3300047472 Bacteria 965
678 Ga0495686_0615441 3300047472 Bacteria 561
679 Ga0495593_0000612 3300047673 Bacteria 20402
680 Ga0495602_0419183 3300048088 Bacteria 951
681 Ga0495614_0105741 3300048089 Bacteria 1233
682 Ga0495615_0021995 3300048090 Bacteria 1445
683 Ga0495615_0072625 3300048090 Bacteria 930
684 Ga0495626_0149700 3300048091 Bacteria 985
685 Ga0496100_0009465 3300048903 Bacteria 5477
686 Ga0496100_0137653 3300048903 Bacteria 1727
687 Ga0496100_0172479 3300048903 Bacteria 1559
688 Ga0496100_1111831 3300048903 Bacteria 623
689 Ga0496101_0031939 3300048904 Bacteria 3704
690 Ga0496101_0129594 3300048904 Bacteria 1914
691 Ga0496101_0185333 3300048904 Bacteria 1604
692 Ga0496101_0468492 3300048904 Bacteria 994
693 Ga0496102_0071765 3300048905 Bacteria 3179
694 Ga0496102_0101742 3300048905 Bacteria 2670
695 Ga0496102_0179724 3300048905 Bacteria 1993
696 Ga0496103_0094950 3300048906 Bacteria 1884
697 Ga0496104_0063984 3300048907 Bacteria 3490
698 Ga0496104_0522138 3300048907 Bacteria 1098
699 Ga0496104_0794686 3300048907 Bacteria 852
700 Ga0496104_0924850 3300048907 Unclassified 777
701 Ga0496105_0041604 3300048908 Bacteria 3787
702 Ga0496106_0111923 3300048909 Bacteria 2126
703 Ga0496106_0147614 3300048909 Bacteria 1853
704 Ga0496106_0572081 3300048909 Bacteria 906
705 Ga0496106_0650035 3300048909 Bacteria 842
706 Ga0496107_0017473 3300048910 Bacteria 5045
707 Ga0496107_0618431 3300048910 Bacteria 800
708 Ga0496107_1219038 3300048910 Unclassified 540
709 Ga0496108_0048591 3300048911 Bacteria 3547
710 Ga0496108_0085248 3300048911 Bacteria 2681
711 Ga0496108_1542585 3300048911 Bacteria 551
712 Ga0496109_0032351 3300048912 Bacteria 4702
713 Ga0496109_0052298 3300048912 Bacteria 3722
714 Ga0496110_0029381 3300048913 Bacteria 4730
715 Ga0496110_0049637 3300048913 Bacteria 3682
716 Ga0496111_0019538 3300048914 Bacteria 4708
717 Ga0496111_0594850 3300048914 Bacteria 810
718 Ga0496112_0017495 3300048915 Bacteria 6735
719 Ga0496112_1062241 3300048915 Bacteria 728
720 Ga0496113_0013500 3300048916 Bacteria 5538
721 Ga0496113_0132334 3300048916 Bacteria 1958
722 Ga0496114_0013017 3300048917 Bacteria 6665
723 Ga0496115_0013881 3300048918 Bacteria 6098
724 Ga0496115_0029940 3300048918 Bacteria 4280
725 Ga0496115_0053634 3300048918 Bacteria 3236
726 Ga0496115_0083217 3300048918 Bacteria 2608
727 Ga0496119_0219458 3300048922 Bacteria 974
728 Ga0496121_0099082 3300048924 Bacteria 2253
729 Ga0496121_0561858 3300048924 Bacteria 712
730 Ga0496124_0320147 3300048927 Bacteria 1111
731 Ga0496125_0244140 3300048928 Bacteria 1138
732 Ga0496126_0001567 3300048929 Bacteria 35073
733 Ga0496126_0211390 3300048929 Bacteria 1633
734 Ga0496126_0231935 3300048929 Bacteria 1546
735 Ga0496126_0276174 3300048929 Bacteria 1393
736 Ga0496126_0301108 3300048929 Bacteria 1323
737 Ga0496126_0555488 3300048929 Bacteria 910
738 Ga0496126_0761188 3300048929 Bacteria 747
739 Ga0496126_0876158 3300048929 Bacteria 683
740 Ga0496126_1248249 3300048929 Bacteria 544
741 nmdc:mga03683_186554_c1 3300050489 Bacteria 948
742 nmdc:mga03n38_1483_c1 3300050490 Bacteria 6764
743 nmdc:mga00v17_135707_c1 3300050491 Bacteria 1575
744 nmdc:mga00v17_662380_c1 3300050491 Bacteria 671
745 nmdc:mga00v17_83432_c1 3300050491 Bacteria 1999
746 nmdc:mga0yw44_1031076_c1 3300050492 Unclassified 557
747 nmdc:mga0yw44_1217498_c1 3300050492 Bacteria 508
748 nmdc:mga0yw44_206291_c1 3300050492 Bacteria 1299
749 nmdc:mga0yw44_224363_c1 3300050492 Bacteria 1246
750 nmdc:mga0yw44_67822_c1 3300050492 Bacteria 2206
751 nmdc:mga0k408_157248_c1 3300050493 Bacteria 1354
752 nmdc:mga0k408_158418_c1 3300050493 Bacteria 1348
753 nmdc:mga0k408_30840_c1 3300050493 Bacteria 3059
754 nmdc:mga0k408_457614_c1 3300050493 Bacteria 757
755 nmdc:mga06z11_24890_c1 3300050494 Bacteria 2830
756 nmdc:mga06z11_378187_c1 3300050494 Bacteria 851
757 nmdc:mga04h51_13149_c1 3300050495 Bacteria 2338
758 nmdc:mga04h51_19705_c1 3300050495 Bacteria 2004
759 nmdc:mga07m45_18839_c1 3300050496 Bacteria 3733
760 nmdc:mga07m45_37623_c1 3300050496 Bacteria 2699
761 nmdc:mga05p37_279828_c1 3300050507 Bacteria 1990
762 nmdc:mga09592_275112_c1 3300050508 Bacteria 1460
763 nmdc:mga0qj67_417891_c1 3300050509 Bacteria 1081
764 nmdc:mga08y16_75023_c1 3300050511 Bacteria 3525
765 nmdc:mga08y16_816252_c1 3300050511 Bacteria 924
766 nmdc:mga0n895_72465_c1 3300050512 Bacteria 3417
767 nmdc:mga0rr50_383938_c1 3300050513 Bacteria 1185
768 nmdc:mga0sz30_151339_c1 3300050516 Bacteria 694
769 nmdc:mga0sz30_20247_c1 3300050516 Bacteria 2683
770 nmdc:mga0sz30_40264_c1 3300050516 Bacteria 1964
771 Ga0495601_0626586 3300053077 Bacteria 689
772 Ga0500610_0197568 3300053079 Bacteria 972
773 Ga0500635_0104734 3300053080 Bacteria 1045
774 Ga0495595_0008715 3300053084 Bacteria 4174
775 Ga0495595_0695415 3300053084 Bacteria 521
776 Ga0495619_0008565 3300053085 Bacteria 6473
777 Ga0495619_0898934 3300053085 Bacteria 596
778 Ga0500581_386254 3300053089 Bacteria 514
779 Ga0500647_0194269 3300053091 Bacteria 924
780 Ga0500641_0003272 3300053096 Bacteria 5729
781 Ga0500554_019174 3300053102 Bacteria 1859
782 Ga0500595_006638 3300053119 Bacteria 4881
783 Ga0500607_342179 3300053121 Bacteria 522
784 Ga0500614_058148 3300053123 Bacteria 1033
785 Ga0500658_0100305 3300053134 Bacteria 1263
786 Ga0500638_037817 3300053162 Bacteria 2342
787 Ga0500637_0314322 3300053178 Bacteria 849
788 Ga0500661_003080 3300055283 Bacteria 3135
789 Ga0587073_0278552 3300059492 Bacteria 536
790 Ga0587082_116001 3300059504 Bacteria 600
791 Ga0587088_188707 3300059508 Unclassified 520
792 Ga0587089_090344 3300059509 Bacteria 544
793 Ga0587113_041103 3300059625 Bacteria 554
794 Ga0587122_031992 3300059628 Bacteria 623
795 Ga0587128_158373 3300059630 Bacteria 520
796 Ga0587078_060138 3300059646 Bacteria 574
797 Ga0587079_235417 3300059647 Bacteria 515
798 Ga0587102_030200 3300059649 Bacteria 658
799 Ga0587107_107205 3300059652 Bacteria 560
800 Ga0587114_127646 3300059655 Bacteria 521
801 Ga0587114_137454 3300059655 Unclassified 508
802 Ga0068864_102366382
803 Ga0006778J45830_1054280
804 Ga0006759J45824_1022058
805 Ga0006759J45824_1028585
806 Ga0006770J48903_1062456
807 Ga0007417J51691_1043315
808 Ga0007410J51695_1026477
809 Ga0007409J51694_1045030
810 Ga0007416J51690_1024662
811 Ga0007416J51690_1039875
812 JGI25404J52841_10083075
813 Ga0032354_1059508
814 Ga0032354_1089967
815 Ga0058860_11826109
816 Ga0065712_10261660
817 Ga0070658_10259827
818 Ga0070676_10144643
819 Ga0070683_100863534
820 Ga0070683_100959909
821 Ga0070690_100279802
822 Ga0070670_100148484
823 Ga0070670_100458941
824 Ga0068869_100007639
825 Ga0068869_100720828
826 Ga0070666_11085239
827 Ga0070680_100138196
828 Ga0070682_100387355
829 Ga0070682_100486911
830 Ga0070682_102089237
831 Ga0068868_100181046
832 Ga0068868_100330039
833 Ga0068868_100879672
834 Ga0068868_101254347
835 Ga0070660_100016507
836 Ga0070660_100316282
837 Ga0070689_100573131
838 Ga0070661_100073934
839 Ga0070661_100374887
840 Ga0070661_100450778
841 Ga0070692_10641296
842 Ga0070668_100027016
843 Ga0070668_100084750
844 Ga0070668_100648172
845 Ga0070669_101188330
846 Ga0070675_100960870
847 Ga0070675_101462699
848 Ga0070671_100231808
849 Ga0070671_100300908
850 Ga0070673_101255769
851 Ga0070688_100777899
852 Ga0070659_100507502
853 Ga0070659_101249438
854 Ga0070667_100186177
855 Ga0070667_100199581
856 Ga0070667_100301632
857 Ga0070709_10043432
858 Ga0070709_10826067
859 Ga0070714_100264156
860 Ga0070714_100303130
861 Ga0070713_100025794
862 Ga0070713_100349314
863 Ga0070710_10058974
864 Ga0070710_10434069
865 Ga0070701_11186191
866 Ga0070711_100045515
867 Ga0070711_100565748
868 Ga0070711_100637048
869 Ga0070711_100895193
870 Ga0070705_101744415
871 Ga0070700_100571005
872 Ga0070663_100079773
873 Ga0070663_100117116
874 Ga0070663_100160563
875 Ga0070663_100458792
876 Ga0070678_100031967
877 Ga0070678_100033334
878 Ga0070678_100557538
879 Ga0070662_100864169
880 Ga0070681_10018535
881 Ga0070681_10056517
882 Ga0070681_10116912
883 Ga0070681_10506194
884 Ga0070681_10855898
885 Ga0068867_101234473
886 Ga0068867_101431781
887 Ga0068867_102386573
888 Ga0070679_100069064
889 Ga0070679_100585243
890 Ga0070679_100730223
891 Ga0070684_101758006
892 Ga0070684_102098223
893 Ga0070697_100262484
894 Ga0068853_100031968
895 Ga0068853_100108160
896 Ga0068853_100779633
897 Ga0068853_101236074
898 Ga0070672_101954665
899 Ga0070686_100089658
900 Ga0070693_100042988
901 Ga0070693_100076378
902 Ga0070665_100042323
903 Ga0070665_100147951
904 Ga0070665_100636701
905 Ga0070665_100674515
906 Ga0070704_100402242
907 Ga0068855_100029152
908 Ga0068855_100352695
909 Ga0068855_100697131
910 Ga0070664_100233321
911 Ga0070664_100317167
912 Ga0068857_100680242
913 Ga0068857_101242460
914 Ga0068854_100284369
915 Ga0068854_101796443
916 Ga0068856_100219946
917 Ga0068856_101150185
918 Ga0068856_101453262
919 Ga0068856_102263406
920 Ga0070702_100306545
921 Ga0070702_100508403
922 Ga0068852_100238984
923 Ga0068852_100242647
924 Ga0068852_101385969
925 Ga0068852_102375396
926 Ga0068852_102727795
927 Ga0068859_100219799
928 Ga0068864_100072908
929 Ga0068864_101357875
930 Ga0068864_102507235
931 Ga0068866_10079865
932 Ga0068861_101103779
933 Ga0068851_10001682
934 Ga0068870_10316953
935 Ga0068863_100038621
936 Ga0068863_101384335
937 Ga0068863_101472329
938 Ga0068863_102323894
939 Ga0068858_100127043
940 Ga0068858_100745364
941 Ga0068860_100978541
942 Ga0068862_100222757
943 Ga0068862_101066208
944 Ga0068862_101560195
945 Ga0081455_10023277
946 Ga0081540_1001664
947 Ga0081540_1008692
948 Ga0081540_1229664
949 Ga0070717_10020455
950 Ga0070717_10568982
951 Ga0075365_10019969
952 Ga0075365_10103952
953 Ga0075365_10125120
954 Ga0075365_10247706
955 Ga0075365_10554858
956 Ga0075365_10867376
957 Ga0075368_10018687
958 Ga0075368_10030413
959 Ga0075368_10053768
960 Ga0075363_100002426
961 Ga0075363_100032542
962 Ga0075363_100235567
963 Ga0075363_100328477
964 Ga0075363_100670685
965 Ga0075364_10060544
966 Ga0075364_10119372
967 Ga0075364_10677531
968 Ga0075364_11131593
969 Ga0070715_10298633
970 Ga0070715_10979157
971 Ga0070716_100128855
972 Ga0070716_100409856
973 Ga0070716_101393177
974 Ga0070712_100178732
975 Ga0070712_100281482
976 Ga0070712_100405461
977 Ga0075362_10066358
978 Ga0075362_10070315
979 Ga0075367_10023354
980 Ga0075367_10592399
981 Ga0075369_10055310
982 Ga0075369_10134401
983 Ga0075369_10282152
984 Ga0075366_10020590
985 Ga0075366_10090885
986 Ga0075366_10382188
987 Ga0097621_100099737
988 Ga0097621_100562258
989 Ga0097621_100981053
990 Ga0075370_10006759
991 Ga0075370_10058626
992 Ga0075370_10109875
993 Ga0068871_100125345
994 Ga0068871_100351333
995 Ga0068871_100444547
996 Ga0068871_101874867
997 Ga0075434_100710319
998 Ga0097620_100219812
999 Ga0075435_100273289
1000 Ga0099794_10211805
1001 Ga0099795_10069732
1002 Ga0099795_10164513
1003 Ga0105240_10123144
1004 Ga0105240_10597841
1005 Ga0105240_11188072
1006 Ga0105240_11417146
1007 Ga0111539_10090397
1008 Ga0105245_10031857
1009 Ga0105245_10752955
1010 Ga0105245_11178495
1011 Ga0105247_10038717
1012 Ga0105247_10056820
1013 Ga0105247_10252554
1014 Ga0105247_10650725
1015 Ga0114129_11098464
1016 Ga0105243_10669335
1017 Ga0105241_10040315
1018 Ga0105241_10539626
1019 Ga0105241_10983638
1020 Ga0105242_10111645
1021 Ga0105248_10021342
1022 Ga0105248_10085221
1023 Ga0105237_10025276
1024 Ga0105237_10055573
1025 Ga0105237_10189656
1026 Ga0105237_12259402
1027 Ga0105238_10097579
1028 Ga0105238_10350682
1029 Ga0105238_10351588
1030 Ga0105238_11284889
1031 Ga0105249_10794505
1032 Ga0105249_13352973
1033 Ga0099796_10030995
1034 Ga0099796_10087168
1035 Ga0105239_10099936
1036 Ga0105239_10120945
1037 Ga0105239_10561960
1038 Ga0105239_10646414
1039 Ga0105239_11163450
1040 Ga0105239_12137477
1041 Ga0105246_10053212
1042 Ga0105246_10726530
1043 Ga0105246_10814976
1044 Ga0105246_10859202
1045 Ga0157373_10655053
1046 Ga0157370_10010408
1047 Ga0157369_10057149
1048 Ga0157369_12071798
1049 Ga0157369_12452827
1050 Ga0157374_10075418
1051 Ga0157374_10496747
1052 Ga0157374_11555284
1053 Ga0157378_10203141
1054 Ga0157378_10508606
1055 Ga0157378_11031147
1056 Ga0157378_11761225
1057 Ga0163162_10248538
1058 Ga0163162_10268890
1059 Ga0163162_10442159
1060 Ga0163162_11125883
1061 Ga0163162_11702470
1062 Ga0157372_13032356
1063 Ga0157375_10076751
1064 Ga0157375_10350704
1065 Ga0157375_10679633
1066 Ga0157375_10761860
1067 Ga0157375_11609812
1068 Ga0163163_10093284
1069 Ga0163163_10156434
1070 Ga0163163_10331632
1071 Ga0163163_11007297
1072 Ga0163163_12055948
1073 Ga0163163_12833514
1074 Ga0157380_10135110
1075 Ga0157377_10150390
1076 Ga0157377_11173227
1077 Ga0157379_10091260
1078 Ga0157379_10160010
1079 Ga0157379_11058852
1080 Ga0157379_11095259
1081 Ga0157376_10145222
1082 Ga0157376_10947924
1083 Ga0157376_11558494
1084 Ga0163161_11508646
1085 Ga0163161_11847842
1086 Ga0206356_11335742
1087 Ga0206356_11705061
1088 Ga0206349_1356360
1089 Ga0206355_1463398
1090 Ga0206355_1673326
1091 Ga0206354_11495061
1092 Ga0213876_10039235
1093 Ga0224712_10580549
1094 Ga0224712_10616537
1095 Ga0207692_10125044
1096 Ga0207692_10355599
1097 Ga0207642_10229446
1098 Ga0207642_10717852
1099 Ga0207710_10087646
1100 Ga0207710_10265414
1101 Ga0207688_10206633
1102 Ga0207680_10389840
1103 Ga0207647_10161555
1104 Ga0207685_10546015
1105 Ga0207685_10869739
1106 Ga0207699_10030041
1107 Ga0207699_10471967
1108 Ga0207645_10117692
1109 Ga0207643_10051785
1110 Ga0207705_10338594
1111 Ga0207705_11402251
1112 Ga0207654_10005550
1113 Ga0207654_10533033
1114 Ga0207707_10008400
1115 Ga0207707_10195265
1116 Ga0207707_10579833
1117 Ga0207707_10791942
1118 Ga0207695_10463122
1119 Ga0207671_10179347
1120 Ga0207671_10215579
1121 Ga0207671_10747830
1122 Ga0207693_10038490
1123 Ga0207693_10185464
1124 Ga0207693_10747672
1125 Ga0207663_10021964
1126 Ga0207663_10145006
1127 Ga0207663_10281107
1128 Ga0207663_10803554
1129 Ga0207663_10838775
1130 Ga0207660_10605818
1131 Ga0207657_10011236
1132 Ga0207657_10135516
1133 Ga0207649_10407722
1134 Ga0207649_11022551
1135 Ga0207652_10044584
1136 Ga0207652_10311056
1137 Ga0207652_10373172
1138 Ga0207681_10841574
1139 Ga0207694_10260102
1140 Ga0207694_10435763
1141 Ga0207650_10207533
1142 Ga0207650_10436996
1143 Ga0207650_11092888
1144 Ga0207687_10033094
1145 Ga0207687_10769477
1146 Ga0207700_10007907
1147 Ga0207700_10160135
1148 Ga0207664_11784909
1149 Ga0207644_10347772
1150 Ga0207690_11143754
1151 Ga0207706_10544862
1152 Ga0207686_10039552
1153 Ga0207686_10272941
1154 Ga0207709_11104464
1155 Ga0207709_11164637
1156 Ga0207670_10194373
1157 Ga0207665_10100572
1158 Ga0207665_10147354
1159 Ga0207665_10226254
1160 Ga0207665_10502454
1161 Ga0207691_10549950
1162 Ga0207691_11138269
1163 Ga0207711_10994291
1164 Ga0207711_11097734
1165 Ga0207689_10396491
1166 Ga0207689_10739280
1167 Ga0207679_10718848
1168 Ga0207679_11674152
1169 Ga0207667_10004391
1170 Ga0207667_10094348
1171 Ga0207667_10181192
1172 Ga0207667_11230089
1173 Ga0207651_10350712
1174 Ga0207651_11701419
1175 Ga0207712_10756981
1176 Ga0207712_11958976
1177 Ga0207668_10027476
1178 Ga0207668_11119288
1179 Ga0207640_10108430
1180 Ga0207658_10413226
1181 Ga0207658_10436177
1182 Ga0207658_10563191
1183 Ga0207658_10677150
1184 Ga0207677_10491234
1185 Ga0207677_12088127
1186 Ga0207677_12171359
1187 Ga0207703_10091379
1188 Ga0207703_11039073
1189 Ga0207639_10122660
1190 Ga0207639_10176436
1191 Ga0207639_10309234
1192 Ga0207639_10355251
1193 Ga0207639_11446083
1194 Ga0207678_10128141
1195 Ga0207678_10154141
1196 Ga0207678_10196862
1197 Ga0207678_11283525
1198 Ga0207708_10098158
1199 Ga0207702_11346654
1200 Ga0207702_11737195
1201 Ga0207641_10074690
1202 Ga0207641_11443708
1203 Ga0207648_10127183
1204 Ga0207648_10191208
1205 Ga0207648_12184925
1206 Ga0207676_10091158
1207 Ga0207676_11747847
1208 Ga0207674_10022649
1209 Ga0207674_10127003
1210 Ga0207674_11220468
1211 Ga0207675_100900316
1212 Ga0207683_10036561
1213 Ga0207683_10265545
1214 Ga0207683_10681872
1215 Ga0207698_10132244
1216 Ga0207698_10558613
1217 Ga0207698_10736941
1218 Ga0207698_10775217
1219 Ga0207698_10896587
1220 Ga0209588_1003085
1221 Ga0209588_1013974
1222 Ga0209813_10005928
1223 Ga0209813_10010325
1224 Ga0268266_10008600
1225 Ga0268266_10074450
1226 Ga0268266_10274672
1227 Ga0268266_11235987
1228 Ga0268266_11875554
1229 Ga0268265_10102603
1230 Ga0268265_10157258
1231 Ga0268264_10590885
1232 Ga0268264_12589589
1233 Ga0265763_1003440
1234 Ga0265330_10009408
1235 Ga0265330_10234228
1236 Ga0265332_10029963
1237 Ga0265340_10001932
1238 Ga0265339_10051784
1239 Ga0265331_10118475
1240 Ga0265331_10269976
1241 Ga0307513_10526330
1242 Ga0307513_10574615
1243 Ga0265313_10058470
1244 Ga0265313_10294804
1245 Ga0307508_10026944
1246 Ga0307508_10235517
1247 Ga0307508_10900673
1248 Ga0265314_10246135
1249 Ga0265342_10112886
1250 Ga0307516_10130664
1251 Ga0307516_10406594
1252 Ga0307405_10348923
1253 Ga0307412_11837965
1254 Ga0307409_100547267
1255 Ga0307416_100231076
1256 Ga0307510_10062454
1257 Ga0307510_10243082
1258 Ga0307510_10594956
1259 Ga0316215_1001635
1260 Ga0373930_0033740
1261 Ga0373948_0114409
1262 Ga0373938_0149115
1263 Ga0373929_0074110
1264 Ga0373934_0200778
1265 Ga0373944_0034033
1266 Ga0373944_0156414
1267 Ga0373949_0087898
1268 Ga0373952_0162757
1269 Ga0373923_0036001
1270 Ga0373932_0009374
1271 Ga0373932_0185037
1272 Ga0373936_0092159
1273 Ga0373936_0519549
1274 Ga0373939_0139230
1275 Ga0373941_0192629
1276 Ga0373945_0157839
1277 Ga0373945_0238456
1278 Ga0373953_0000164
1279 Ga0373954_0080582
1280 Ga0373957_0142902
1281 Ga0373960_0266951
1282 Ga0373943_0008645
1283 Ga0373943_0203737
1284 Ga0373943_0662173
1285 Ga0373946_0005108
1286 Ga0373946_0062800
1287 Ga0373955_0024913
1288 Ga0373942_0383704
1289 Ga0373962_0127724
1290 Ga0373931_0111018
1291 Ga0373931_1194581
1292 Ga0373935_0002601
1293 Ga0373935_0159263
1294 Ga0373935_0660481
1295 Ga0373935_1447291
1296 Ga0373927_0005379
1297 Ga0373927_0011572
1298 Ga0373927_0063675
1299 Ga0373927_0930314
1300 Ga0373927_1153166
1301 Ga0373933_0064163
1302 Ga0373933_0142352
1303 Ga0373933_0705452
1304 Ga0373947_0003674
1305 Ga0373947_0111560
1306 Ga0373937_0014988
1307 Ga0265778_045890
1308 Ga0265778_047054
1309 Ga0372808_016089
1310 Ga0373925_0002756
1311 Ga0373925_0419899
1312 Ga0373925_0575391
1313 Ga0373925_0578061
1314 Ga0373925_1406542
1315 Ga0395900_0338850
1316 Ga0395898_0754371
1317 Ga0395905_1483019
1318 Ga0395901_0861682
1319 Ga0436365_0222688
1320 Ga0436365_0351215
1321 Ga0436365_0690344
1322 Ga0451789_1066817
1323 Ga0451791_0048224
1324 Ga0451793_0971666
1325 Ga0451793_1168228
1326 Ga0451797_1466530
1327 Ga0451795_0865050
1328 Ga0451795_1094472
1329 Ga0451798_0740388
1330 Ga0451800_1641774
1331 Ga0451802_0179968
1332 Ga0451802_0684463
1333 Ga0451837_1514253
1334 Ga0451845_0470797
1335 Ga0451843_1187566
1336 Ga0451843_1666096
1337 Ga0451853_1565746
1338 Ga0451853_4004434
1339 Ga0466967_1375437
1340 Ga0495617_137899
1341 Ga0495617_148469
1342 Ga0495617_268755
1343 Ga0495592_0033954
1344 Ga0495592_0231957
1345 Ga0495603_0001356
1346 Ga0495603_0023430
1347 Ga0495603_0112121
1348 Ga0495603_0659961
1349 Ga0495629_0003717
1350 Ga0495629_1004938
1351 Ga0495638_0114546
1352 Ga0495641_0019378
1353 Ga0495651_0077743
1354 Ga0495651_0098595
1355 Ga0495651_0163240
1356 Ga0495653_0071174
1357 Ga0495580_0001647
1358 Ga0495580_0310380
1359 Ga0495580_0645553
1360 Ga0495582_0001151
1361 Ga0495582_0304732
1362 Ga0495639_0000572
1363 Ga0495639_0030074
1364 Ga0495639_0412907
1365 Ga0495639_0685169
1366 Ga0495639_0746755
1367 Ga0495662_0002158
1368 Ga0495664_0028916
1369 Ga0495584_0109054
1370 Ga0495584_0229615
1371 Ga0495585_0020173
1372 Ga0495585_0112916
1373 Ga0495585_0170433
1374 Ga0495585_0198741
1375 Ga0495594_0002628
1376 Ga0495594_0282721
1377 Ga0495596_0068044
1378 Ga0495596_0285066
1379 Ga0495583_0229301
1380 Ga0495606_0267960
1381 Ga0495606_0354369
1382 Ga0495608_0003760
1383 Ga0495608_0937118
1384 Ga0495610_0256635
1385 Ga0495616_0254806
1386 Ga0495620_0046488
1387 Ga0495620_0264117
1388 Ga0495620_0394447
1389 Ga0495628_0011450
1390 Ga0495628_0074706
1391 Ga0495630_0005891
1392 Ga0495632_0131050
1393 Ga0495632_0416773
1394 Ga0495644_0084867
1395 Ga0495663_0029773
1396 Ga0495663_0126475
1397 Ga0495666_0006249
1398 Ga0495652_0415068
1399 Ga0495652_0652028
1400 Ga0495665_0000241
1401 Ga0495640_0002068
1402 Ga0495640_0816242
1403 Ga0495598_0028318
1404 Ga0495598_0038500
1405 Ga0495621_0070177
1406 Ga0495621_0277921
1407 Ga0495597_0318803
1408 Ga0495622_0007257
1409 Ga0495633_0219223
1410 Ga0495633_0380334
1411 Ga0495667_0045750
1412 Ga0495667_0274509
1413 Ga0495656_0212584
1414 Ga0495656_0355087
1415 Ga0495668_0034350
1416 Ga0495668_0228726
1417 Ga0495668_0269070
1418 Ga0495668_0334511
1419 Ga0495634_0001309
1420 Ga0495634_0018232
1421 Ga0495611_0126929
1422 Ga0495625_0220993
1423 Ga0495625_0401655
1424 Ga0495625_0540878
1425 Ga0495635_0001468
1426 Ga0495635_0099613
1427 Ga0495635_0503601
1428 Ga0495635_0802973
1429 Ga0495659_0129615
1430 Ga0495659_0167391
1431 Ga0495659_0253519
1432 Ga0495661_0063281
1433 Ga0495661_0474372
1434 Ga0495588_0031734
1435 Ga0495588_0072842
1436 Ga0495588_0094368
1437 Ga0495657_0132470
1438 Ga0495657_0548818
1439 Ga0495599_0443194
1440 Ga0495599_0530631
1441 Ga0495623_0352739
1442 Ga0495646_0077831
1443 Ga0495646_0086625
1444 Ga0495647_0001287
1445 Ga0495647_0178685
1446 Ga0495658_0001057
1447 Ga0495613_0003242
1448 Ga0495613_0720124
1449 Ga0495624_0001492
1450 Ga0495624_0629419
1451 Ga0495624_0842021
1452 Ga0495670_0258535
1453 Ga0495671_0178749
1454 Ga0495671_0211283
1455 Ga0495671_0265049
1456 Ga0495660_0070284
1457 Ga0495660_0146689
1458 Ga0495581_0001029
1459 Ga0495581_0280427
1460 Ga0495581_0287940
1461 Ga0495604_0129102
1462 Ga0495604_0938552
1463 Ga0495636_0340804
1464 Ga0495674_0001007
1465 Ga0495674_0620794
1466 Ga0495674_1443467
1467 Ga0495674_1478796
1468 Ga0495672_0008876
1469 Ga0495672_0406591
1470 Ga0495676_0015432
1471 Ga0495680_0349233
1472 Ga0495683_0212849
1473 Ga0495675_0012986
1474 Ga0495677_0354826
1475 Ga0495685_123261
1476 Ga0495684_0024351
1477 Ga0495684_0027226
1478 Ga0495686_0263138
1479 Ga0495686_0615441
1480 Ga0495593_0000612
1481 Ga0495602_0419183
1482 Ga0495614_0105741
1483 Ga0495615_0021995
1484 Ga0495615_0072625
1485 Ga0495626_0149700
1486 Ga0496100_0009465
1487 Ga0496100_0137653
1488 Ga0496100_0172479
1489 Ga0496100_1111831
1490 Ga0496101_0031939
1491 Ga0496101_0129594
1492 Ga0496101_0185333
1493 Ga0496101_0468492
1494 Ga0496102_0071765
1495 Ga0496102_0101742
1496 Ga0496102_0179724
1497 Ga0496103_0094950
1498 Ga0496104_0063984
1499 Ga0496104_0522138
1500 Ga0496104_0794686
1501 Ga0496104_0924850
1502 Ga0496105_0041604
1503 Ga0496106_0111923
1504 Ga0496106_0147614
1505 Ga0496106_0572081
1506 Ga0496106_0650035
1507 Ga0496107_0017473
1508 Ga0496107_0618431
1509 Ga0496107_1219038
1510 Ga0496108_0048591
1511 Ga0496108_0085248
1512 Ga0496108_1542585
1513 Ga0496109_0032351
1514 Ga0496109_0052298
1515 Ga0496110_0029381
1516 Ga0496110_0049637
1517 Ga0496111_0019538
1518 Ga0496111_0594850
1519 Ga0496112_0017495
1520 Ga0496112_1062241
1521 Ga0496113_0013500
1522 Ga0496113_0132334
1523 Ga0496114_0013017
1524 Ga0496115_0013881
1525 Ga0496115_0029940
1526 Ga0496115_0053634
1527 Ga0496115_0083217
1528 Ga0496119_0219458
1529 Ga0496121_0099082
1530 Ga0496121_0561858
1531 Ga0496124_0320147
1532 Ga0496125_0244140
1533 Ga0496126_0001567
1534 Ga0496126_0211390
1535 Ga0496126_0231935
1536 Ga0496126_0276174
1537 Ga0496126_0301108
1538 Ga0496126_0555488
1539 Ga0496126_0761188
1540 Ga0496126_0876158
1541 Ga0496126_1248249
1542 nmdc:mga03683_186554_c1
1543 nmdc:mga03n38_1483_c1
1544 nmdc:mga00v17_135707_c1
1545 nmdc:mga00v17_662380_c1
1546 nmdc:mga00v17_83432_c1
1547 nmdc:mga0yw44_1031076_c1
1548 nmdc:mga0yw44_1217498_c1
1549 nmdc:mga0yw44_206291_c1
1550 nmdc:mga0yw44_224363_c1
1551 nmdc:mga0yw44_67822_c1
1552 nmdc:mga0k408_157248_c1
1553 nmdc:mga0k408_158418_c1
1554 nmdc:mga0k408_30840_c1
1555 nmdc:mga0k408_457614_c1
1556 nmdc:mga06z11_24890_c1
1557 nmdc:mga06z11_378187_c1
1558 nmdc:mga04h51_13149_c1
1559 nmdc:mga04h51_19705_c1
1560 nmdc:mga07m45_18839_c1
1561 nmdc:mga07m45_37623_c1
1562 nmdc:mga05p37_279828_c1
1563 nmdc:mga09592_275112_c1
1564 nmdc:mga0qj67_417891_c1
1565 nmdc:mga08y16_75023_c1
1566 nmdc:mga08y16_816252_c1
1567 nmdc:mga0n895_72465_c1
1568 nmdc:mga0rr50_383938_c1
1569 nmdc:mga0sz30_151339_c1
1570 nmdc:mga0sz30_20247_c1
1571 nmdc:mga0sz30_40264_c1
1572 Ga0495601_0626586
1573 Ga0500610_0197568
1574 Ga0500635_0104734
1575 Ga0495595_0008715
1576 Ga0495595_0695415
1577 Ga0495619_0008565
1578 Ga0495619_0898934
1579 Ga0500581_386254
1580 Ga0500647_0194269
1581 Ga0500641_0003272
1582 Ga0500554_019174
1583 Ga0500595_006638
1584 Ga0500607_342179
1585 Ga0500614_058148
1586 Ga0500658_0100305
1587 Ga0500638_037817
1588 Ga0500637_0314322
1589 Ga0500661_003080
1590 Ga0587073_0278552
1591 Ga0587082_116001
1592 Ga0587088_188707
1593 Ga0587089_090344
1594 Ga0587113_041103
1595 Ga0587122_031992
1596 Ga0587128_158373
1597 Ga0587078_060138
1598 Ga0587079_235417
1599 Ga0587102_030200
1600 Ga0587107_107205
1601 Ga0587114_127646
1602 Ga0587114_137454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map