F481160

General Info

Members Datasets Scaffolds Average Seq Length
795 339 1590 190

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0087190|Ga0501045_0087190_223_882
Length 219
Sequence MTGPTNSMSIPAFAVRRPDKTKTRRRRLKMAARIVVTEFVSLDGVMEAPGGEPNFKYPGWTFEFERGDDGNQFKLDETMSADALLIGRRTYESFAGAWPEREGEFADKFNAMPKFVVSTTLKDPDWNNTTVLDSGDATAQVRKLKEEFDGELQVPGSHRLVQELIAADLVDQVNLMVFPVILGTGKKAFEETPERRSLKLTESKVVGDGVLVLVYERAV

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
104 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
105 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
106 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
177 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
178 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
179 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
180 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
181 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
207 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
208 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
209 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
213 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
303 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
304 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
305 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
311 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
315 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
336 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 2857472729 Cohnella sp. R-74144 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.5
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 4.15
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0087190 3300049824 Bacteria 2304
2 ARSoilOldRDRAFT_c009804 3300000044 Bacteria 799
3 JGI24738J21930_10085178 3300002075 Bacteria 664
4 JGI24034J26672_10046559 3300002239 Bacteria 738
5 JGI24751J29686_10035565 3300002459 Bacteria 1033
6 JGI25406J46586_10007830 3300003203 Bacteria 4860
7 JGI25406J46586_10013166 3300003203 Bacteria 3565
8 JGI25407J50210_10006958 3300003373 Unclassified 2829
9 JGI25407J50210_10067342 3300003373 Bacteria 895
10 Ga0058859_11098586 3300004798 Bacteria 646
11 Ga0065704_10172706 3300005289 Bacteria 1282
12 Ga0070658_10365327 3300005327 Bacteria 1237
13 Ga0070658_10611448 3300005327 Bacteria 945
14 Ga0070676_10099284 3300005328 Bacteria 1796
15 Ga0070683_100002245 3300005329 Bacteria 15321
16 Ga0070683_100006602 3300005329 Bacteria 9744
17 Ga0070683_100456794 3300005329 Bacteria 1219
18 Ga0070683_100657150 3300005329 Bacteria 1004
19 Ga0070683_101003017 3300005329 Bacteria 802
20 Ga0070670_100176236 3300005331 Bacteria 1855
21 Ga0070666_10578049 3300005335 Bacteria 819
22 Ga0070682_100090017 3300005337 Bacteria 2005
23 Ga0068868_100109240 3300005338 Bacteria 2246
24 Ga0068868_100203980 3300005338 Bacteria 1650
25 Ga0070660_100070005 3300005339 Bacteria 2737
26 Ga0070660_100419803 3300005339 Bacteria 1108
27 Ga0070689_100017734 3300005340 Bacteria 5235
28 Ga0070689_100063296 3300005340 Bacteria 2878
29 Ga0070691_10175702 3300005341 Bacteria 1112
30 Ga0070687_100467688 3300005343 Bacteria 842
31 Ga0070661_100130931 3300005344 Bacteria 1884
32 Ga0070661_100916644 3300005344 Bacteria 724
33 Ga0070692_10033492 3300005345 Bacteria 2589
34 Ga0070675_100042894 3300005354 Bacteria 3696
35 Ga0070675_100095895 3300005354 Bacteria 2491
36 Ga0070675_100180518 3300005354 Bacteria 1825
37 Ga0070671_100003760 3300005355 Bacteria 11914
38 Ga0070671_100528867 3300005355 Bacteria 1016
39 Ga0070674_100050783 3300005356 Bacteria 2855
40 Ga0070674_100517001 3300005356 Bacteria 997
41 Ga0070688_100066082 3300005365 Bacteria 2300
42 Ga0070659_100041161 3300005366 Bacteria 3611
43 Ga0070659_100042093 3300005366 Bacteria 3571
44 Ga0070659_100351504 3300005366 Unclassified 1237
45 Ga0070659_100398389 3300005366 Bacteria 1162
46 Ga0070659_101042839 3300005366 Unclassified 719
47 Ga0070714_100003434 3300005435 Bacteria 11803
48 Ga0070714_100181670 3300005435 Bacteria 1914
49 Ga0070713_100168840 3300005436 Bacteria 1958
50 Ga0070710_10046466 3300005437 Bacteria 2418
51 Ga0070710_10215290 3300005437 Bacteria 1219
52 Ga0070701_10025668 3300005438 Bacteria 2864
53 Ga0070701_10148844 3300005438 Bacteria 1346
54 Ga0070701_10274193 3300005438 Bacteria 1028
55 Ga0070701_10337891 3300005438 Unclassified 937
56 Ga0070711_100995737 3300005439 Bacteria 719
57 Ga0070705_100022393 3300005440 Bacteria 3376
58 Ga0070705_100453255 3300005440 Bacteria 963
59 Ga0070700_100503871 3300005441 Bacteria 932
60 Ga0070694_100318385 3300005444 Bacteria 1197
61 Ga0070694_100606784 3300005444 Bacteria 882
62 Ga0070708_100005640 3300005445 Archaea 9921
63 Ga0070708_100047574 3300005445 Unclassified 3789
64 Ga0070708_100125312 3300005445 Unclassified 2373
65 Ga0070708_100210268 3300005445 Bacteria 1823
66 Ga0070708_100316418 3300005445 Bacteria 1470
67 Ga0070678_100188557 3300005456 Bacteria 1694
68 Ga0070678_100593781 3300005456 Bacteria 988
69 Ga0070662_100573727 3300005457 Bacteria 947
70 Ga0068867_100480934 3300005459 Bacteria 1064
71 Ga0070685_10001384 3300005466 Bacteria 12747
72 Ga0070685_10018362 3300005466 Bacteria 3760
73 Ga0070685_10916973 3300005466 Bacteria 653
74 Ga0070706_100032291 3300005467 Bacteria 4828
75 Ga0070706_100048489 3300005467 Bacteria 3920
76 Ga0070706_100148509 3300005467 Unclassified 2188
77 Ga0070706_100243351 3300005467 Bacteria 1680
78 Ga0070707_100043137 3300005468 Bacteria 4318
79 Ga0070707_100293170 3300005468 Unclassified 1581
80 Ga0070707_100418234 3300005468 Bacteria 1301
81 Ga0070698_100003594 3300005471 Bacteria 17037
82 Ga0070698_100008016 3300005471 Bacteria 11422
83 Ga0070698_100072154 3300005471 Unclassified 3461
84 Ga0070698_100524613 3300005471 Bacteria 1123
85 Ga0070699_100069744 3300005518 Bacteria 3055
86 Ga0070699_100269366 3300005518 Bacteria 1524
87 Ga0070679_100124223 3300005530 Bacteria 2564
88 Ga0070684_100141523 3300005535 Unclassified 2175
89 Ga0070684_100168920 3300005535 Bacteria 1986
90 Ga0070684_100303159 3300005535 Bacteria 1466
91 Ga0070684_100462619 3300005535 Bacteria 1173
92 Ga0070684_100870719 3300005535 Bacteria 843
93 Ga0070697_100661068 3300005536 Bacteria 921
94 Ga0068853_100055148 3300005539 Bacteria 3426
95 Ga0068853_100299707 3300005539 Bacteria 1485
96 Ga0068853_100952505 3300005539 Bacteria 825
97 Ga0070672_100091084 3300005543 Bacteria 2460
98 Ga0070686_100009931 3300005544 Bacteria 5352
99 Ga0070686_100281092 3300005544 Bacteria 1227
100 Ga0070686_100503694 3300005544 Bacteria 940
101 Ga0070686_100690521 3300005544 Bacteria 813
102 Ga0070695_100511101 3300005545 Bacteria 931
103 Ga0070665_100073402 3300005548 Bacteria 3427
104 Ga0070665_100219034 3300005548 Bacteria 1904
105 Ga0070704_100504766 3300005549 Bacteria 1050
106 Ga0070704_100574659 3300005549 Bacteria 988
107 Ga0068855_100088586 3300005563 Bacteria 3575
108 Ga0068855_100090261 3300005563 Bacteria 3536
109 Ga0070664_100068326 3300005564 Bacteria 3038
110 Ga0070664_100489094 3300005564 Bacteria 1133
111 Ga0070664_100836088 3300005564 Bacteria 862
112 Ga0068857_100353202 3300005577 Bacteria 1362
113 Ga0068857_100973727 3300005577 Bacteria 816
114 Ga0068857_101067813 3300005577 Bacteria 779
115 Ga0068854_100380053 3300005578 Bacteria 1164
116 Ga0068854_100477276 3300005578 Bacteria 1046
117 Ga0070702_100004623 3300005615 Bacteria 6309
118 Ga0070702_100028737 3300005615 Bacteria 3016
119 Ga0070702_100066193 3300005615 Bacteria 2118
120 Ga0068852_100082983 3300005616 Bacteria 2849
121 Ga0068852_100478847 3300005616 Bacteria 1237
122 Ga0068859_100120415 3300005617 Bacteria 2691
123 Ga0068859_100394940 3300005617 Bacteria 1479
124 Ga0068864_100140197 3300005618 Bacteria 2180
125 Ga0068864_100163592 3300005618 Unclassified 2024
126 Ga0068866_10083211 3300005718 Bacteria 1724
127 Ga0068866_10102282 3300005718 Bacteria 1583
128 Ga0068866_10263873 3300005718 Bacteria 1060
129 Ga0068861_100052951 3300005719 Bacteria 3086
130 Ga0068861_100926294 3300005719 Bacteria 827
131 Ga0068851_10184151 3300005834 Bacteria 1158
132 Ga0068858_100060851 3300005842 Bacteria 3491
133 Ga0068860_100713595 3300005843 Bacteria 1013
134 Ga0068860_100917801 3300005843 Bacteria 892
135 Ga0068862_100082720 3300005844 Bacteria 2787
136 Ga0081455_10015281 3300005937 Bacteria 7464
137 Ga0081455_10053771 3300005937 Bacteria 3438
138 Ga0081455_10055023 3300005937 Bacteria 3388
139 Ga0081455_10082368 3300005937 Bacteria 2632
140 Ga0081455_10090199 3300005937 Bacteria 2486
141 Ga0081455_10226958 3300005937 Bacteria 1381
142 Ga0081538_10000114 3300005981 Bacteria 81354
143 Ga0081538_10000349 3300005981 Bacteria 52694
144 Ga0081538_10000730 3300005981 Bacteria 35887
145 Ga0081538_10003250 3300005981 Bacteria 15441
146 Ga0081538_10003531 3300005981 Bacteria 14713
147 Ga0081538_10013921 3300005981 Bacteria 6337
148 Ga0081538_10019207 3300005981 Bacteria 5091
149 Ga0081538_10027999 3300005981 Bacteria 3888
150 Ga0081538_10033259 3300005981 Bacteria 3436
151 Ga0081538_10037575 3300005981 Bacteria 3138
152 Ga0081538_10054644 3300005981 Bacteria 2359
153 Ga0081538_10060149 3300005981 Bacteria 2188
154 Ga0081538_10126395 3300005981 Bacteria 1214
155 Ga0081540_1000554 3300005983 Bacteria 36225
156 Ga0081539_10001190 3300005985 Bacteria 46973
157 Ga0081539_10068329 3300005985 Bacteria 1918
158 Ga0070717_10037118 3300006028 Bacteria 3955
159 Ga0070717_10071516 3300006028 Bacteria 2894
160 Ga0075365_10127669 3300006038 Bacteria 1758
161 Ga0075365_10250750 3300006038 Unclassified 1244
162 Ga0075365_10293718 3300006038 Bacteria 1143
163 Ga0075364_10432055 3300006051 Bacteria 899
164 Ga0075432_10019965 3300006058 Bacteria 2292
165 Ga0070716_100685898 3300006173 Bacteria 781
166 Ga0070712_100042014 3300006175 Bacteria 3142
167 Ga0070712_100146852 3300006175 Bacteria 1806
168 Ga0068871_100621358 3300006358 Bacteria 984
169 Ga0075428_100024386 3300006844 Bacteria 6693
170 Ga0075428_100032977 3300006844 Bacteria 5718
171 Ga0075428_100047490 3300006844 Bacteria 4716
172 Ga0075428_100249385 3300006844 Bacteria 1914
173 Ga0075428_100954196 3300006844 Bacteria 909
174 Ga0075430_100005703 3300006846 Bacteria 10505
175 Ga0075431_100020956 3300006847 Bacteria 6680
176 Ga0075431_100077017 3300006847 Bacteria 3442
177 Ga0075431_100095039 3300006847 Bacteria 3077
178 Ga0075431_100617613 3300006847 Bacteria 1067
179 Ga0075433_10144164 3300006852 Bacteria 2117
180 Ga0075433_10245051 3300006852 Bacteria 1591
181 Ga0075434_100093322 3300006871 Bacteria 3013
182 Ga0075434_101110647 3300006871 Bacteria 804
183 Ga0075429_100077693 3300006880 Bacteria 2892
184 Ga0075429_100418030 3300006880 Bacteria 1174
185 Ga0068865_100123799 3300006881 Bacteria 1927
186 Ga0068865_100161938 3300006881 Bacteria 1708
187 Ga0068865_100206624 3300006881 Bacteria 1528
188 Ga0068865_100952592 3300006881 Unclassified 749
189 Ga0075436_100067131 3300006914 Bacteria 2479
190 Ga0097620_100120421 3300006931 Bacteria 2691
191 Ga0097620_100394927 3300006931 Bacteria 1479
192 Ga0075435_100011297 3300007076 Bacteria 6561
193 Ga0075435_100092790 3300007076 Bacteria 2494
194 Ga0075435_100426472 3300007076 Bacteria 1142
195 Ga0099794_10013103 3300007265 Unclassified 3600
196 Ga0099794_10028823 3300007265 Bacteria 2583
197 Ga0099794_10182212 3300007265 Archaea 1072
198 Ga0105240_10001492 3300009093 Bacteria 39866
199 Ga0111539_10051520 3300009094 Bacteria 4902
200 Ga0111539_10082047 3300009094 Bacteria 3792
201 Ga0111539_10350075 3300009094 Bacteria 1719
202 Ga0111539_10592164 3300009094 Bacteria 1291
203 Ga0111539_10879408 3300009094 Bacteria 1042
204 Ga0111539_11233067 3300009094 Bacteria 868
205 Ga0105245_10009806 3300009098 Bacteria 8345
206 Ga0105245_10021897 3300009098 Bacteria 5609
207 Ga0105245_10202119 3300009098 Bacteria 1908
208 Ga0105247_10241637 3300009101 Bacteria 1231
209 Ga0105247_10440061 3300009101 Bacteria 937
210 Ga0114129_10041874 3300009147 Bacteria 6449
211 Ga0114129_10127256 3300009147 Bacteria 3502
212 Ga0114129_10354059 3300009147 Bacteria 1944
213 Ga0114129_10474719 3300009147 Bacteria 1637
214 Ga0114129_10496622 3300009147 Bacteria 1594
215 Ga0114129_11044763 3300009147 Bacteria 1026
216 Ga0105243_10012151 3300009148 Bacteria 6509
217 Ga0105243_10074378 3300009148 Bacteria 2756
218 Ga0105243_10095121 3300009148 Bacteria 2461
219 Ga0105243_10181283 3300009148 Bacteria 1832
220 Ga0105243_10912063 3300009148 Bacteria 875
221 Ga0105242_10072751 3300009176 Bacteria 2856
222 Ga0105242_10802166 3300009176 Bacteria 932
223 Ga0105248_10173945 3300009177 Bacteria 2427
224 Ga0105237_10442868 3300009545 Bacteria 1305
225 Ga0105238_10355987 3300009551 Bacteria 1453
226 Ga0105238_10852303 3300009551 Bacteria 928
227 Ga0105249_10003773 3300009553 Bacteria 13079
228 Ga0105249_10032347 3300009553 Bacteria 4731
229 Ga0105249_10044043 3300009553 Bacteria 4059
230 Ga0105249_10347795 3300009553 Unclassified 1501
231 Ga0105249_11709103 3300009553 Bacteria 702
232 Ga0105249_11729620 3300009553 Bacteria 698
233 Ga0105239_10059591 3300010375 Bacteria 4190
234 Ga0105239_10156317 3300010375 Bacteria 2546
235 Ga0105239_10343852 3300010375 Bacteria 1684
236 Ga0105239_10377418 3300010375 Bacteria 1603
237 Ga0105246_10193722 3300011119 Bacteria 1575
238 Ga0157336_1000578 3300012477 Bacteria 1685
239 Ga0157320_1001539 3300012481 Bacteria 1186
240 Ga0157313_1000598 3300012503 Bacteria 1707
241 Ga0157326_1018189 3300012513 Bacteria 846
242 Ga0157371_10400672 3300013102 Bacteria 1004
243 Ga0157370_10040347 3300013104 Bacteria 4507
244 Ga0157370_10521708 3300013104 Bacteria 1090
245 Ga0157369_10003395 3300013105 Bacteria 18891
246 Ga0157369_10089138 3300013105 Bacteria 3293
247 Ga0157369_10839036 3300013105 Bacteria 943
248 Ga0163162_10067426 3300013306 Bacteria 3629
249 Ga0163162_11258887 3300013306 Bacteria 840
250 Ga0157372_10136169 3300013307 Bacteria 2828
251 Ga0157372_11216371 3300013307 Bacteria 870
252 Ga0157372_12118444 3300013307 Bacteria 646
253 Ga0157375_10063069 3300013308 Bacteria 3685
254 Ga0163163_11056191 3300014325 Bacteria 875
255 Ga0163163_11272229 3300014325 Bacteria 798
256 Ga0157380_10044589 3300014326 Bacteria 3477
257 Ga0157380_10108444 3300014326 Bacteria 2328
258 Ga0157380_10141493 3300014326 Bacteria 2068
259 Ga0157380_10636479 3300014326 Bacteria 1061
260 Ga0157380_10816000 3300014326 Bacteria 951
261 Ga0157377_10009027 3300014745 Bacteria 4881
262 Ga0157377_10031119 3300014745 Bacteria 2897
263 Ga0157379_10263868 3300014968 Bacteria 1565
264 Ga0157376_10082355 3300014969 Bacteria 2765
265 Ga0157376_10497251 3300014969 Bacteria 1198
266 Ga0157376_12103061 3300014969 Bacteria 603
267 Ga0163161_10125486 3300017792 Bacteria 1932
268 Ga0163161_10738033 3300017792 Bacteria 823
269 Ga0206352_11025843 3300020078 Unclassified 736
270 Ga0206353_10543484 3300020082 Bacteria 1073
271 Ga0213876_10017107 3300021384 Bacteria 3828
272 Ga0207692_10015242 3300025898 Bacteria 3378
273 Ga0207692_10066064 3300025898 Bacteria 1890
274 Ga0207642_10048204 3300025899 Bacteria 1909
275 Ga0207642_10063473 3300025899 Bacteria 1728
276 Ga0207642_10309452 3300025899 Bacteria 919
277 Ga0207688_10008263 3300025901 Bacteria 5658
278 Ga0207688_10029532 3300025901 Bacteria 3019
279 Ga0207688_10173613 3300025901 Bacteria 1282
280 Ga0207688_10359597 3300025901 Bacteria 898
281 Ga0207647_10077036 3300025904 Bacteria 2005
282 Ga0207647_10091051 3300025904 Bacteria 1819
283 Ga0207645_10442738 3300025907 Bacteria 877
284 Ga0207643_10035934 3300025908 Bacteria 2779
285 Ga0207643_10037847 3300025908 Bacteria 2707
286 Ga0207684_10031135 3300025910 Bacteria 4540
287 Ga0207684_10037530 3300025910 Bacteria 4111
288 Ga0207684_10068064 3300025910 Bacteria 3026
289 Ga0207695_10000645 3300025913 Bacteria 69294
290 Ga0207671_10401924 3300025914 Bacteria 1089
291 Ga0207693_10378025 3300025915 Bacteria 1108
292 Ga0207663_10000440 3300025916 Bacteria 18042
293 Ga0207663_10435555 3300025916 Bacteria 1009
294 Ga0207660_10155492 3300025917 Bacteria 1760
295 Ga0207662_10214490 3300025918 Bacteria 1251
296 Ga0207662_10461143 3300025918 Bacteria 870
297 Ga0207657_10051907 3300025919 Bacteria 3562
298 Ga0207657_10068717 3300025919 Bacteria 3009
299 Ga0207652_10233490 3300025921 Bacteria 1658
300 Ga0207646_10002662 3300025922 Bacteria 20943
301 Ga0207646_10014117 3300025922 Archaea 7596
302 Ga0207646_10199930 3300025922 Unclassified 1805
303 Ga0207681_10280495 3300025923 Bacteria 1312
304 Ga0207650_10219468 3300025925 Bacteria 1530
305 Ga0207659_10056407 3300025926 Bacteria 2813
306 Ga0207687_10009967 3300025927 Bacteria 6218
307 Ga0207687_10017351 3300025927 Bacteria 4738
308 Ga0207687_10032774 3300025927 Bacteria 3520
309 Ga0207687_10052319 3300025927 Bacteria 2850
310 Ga0207700_10024007 3300025928 Bacteria 4216
311 Ga0207664_10011317 3300025929 Bacteria 6331
312 Ga0207644_10060386 3300025931 Bacteria 2743
313 Ga0207690_10037320 3300025932 Bacteria 3154
314 Ga0207690_10037735 3300025932 Bacteria 3139
315 Ga0207706_10018905 3300025933 Bacteria 6196
316 Ga0207709_10013641 3300025935 Bacteria 4483
317 Ga0207709_10053473 3300025935 Bacteria 2485
318 Ga0207709_10620823 3300025935 Bacteria 858
319 Ga0207670_10007519 3300025936 Bacteria 6086
320 Ga0207670_10448994 3300025936 Bacteria 1039
321 Ga0207669_10361287 3300025937 Bacteria 1125
322 Ga0207704_10062776 3300025938 Bacteria 2312
323 Ga0207704_10425176 3300025938 Bacteria 1054
324 Ga0207704_11166829 3300025938 Bacteria 656
325 Ga0207665_10311654 3300025939 Bacteria 1179
326 Ga0207691_10032872 3300025940 Bacteria 4834
327 Ga0207711_10728486 3300025941 Bacteria 925
328 Ga0207711_10790329 3300025941 Bacteria 884
329 Ga0207661_10181088 3300025944 Bacteria 1841
330 Ga0207661_10249075 3300025944 Bacteria 1578
331 Ga0207661_10428823 3300025944 Bacteria 1202
332 Ga0207661_10714581 3300025944 Bacteria 922
333 Ga0207661_10790202 3300025944 Bacteria 874
334 Ga0207679_10110851 3300025945 Bacteria 2166
335 Ga0207679_10615030 3300025945 Bacteria 980
336 Ga0207667_10001334 3300025949 Bacteria 30950
337 Ga0207667_10093435 3300025949 Bacteria 3106
338 Ga0207667_10105941 3300025949 Bacteria 2901
339 Ga0207712_10023527 3300025961 Bacteria 4067
340 Ga0207712_10117113 3300025961 Bacteria 2009
341 Ga0207712_10458822 3300025961 Bacteria 1082
342 Ga0207668_10100389 3300025972 Bacteria 2149
343 Ga0207668_10219656 3300025972 Bacteria 1525
344 Ga0207668_10492123 3300025972 Bacteria 1053
345 Ga0207668_10785857 3300025972 Bacteria 842
346 Ga0207640_10077420 3300025981 Bacteria 2261
347 Ga0207640_10455961 3300025981 Bacteria 1055
348 Ga0207677_10501524 3300026023 Bacteria 1049
349 Ga0207703_10034293 3300026035 Bacteria 4027
350 Ga0207703_10487329 3300026035 Bacteria 1156
351 Ga0207639_10848988 3300026041 Bacteria 852
352 Ga0207639_10895066 3300026041 Bacteria 829
353 Ga0207678_10084878 3300026067 Bacteria 2708
354 Ga0207708_10009406 3300026075 Bacteria 7236
355 Ga0207708_10016938 3300026075 Bacteria 5487
356 Ga0207708_10374526 3300026075 Bacteria 1173
357 Ga0207648_10070819 3300026089 Bacteria 3039
358 Ga0207648_10193174 3300026089 Bacteria 1805
359 Ga0207648_10252003 3300026089 Bacteria 1574
360 Ga0207676_10085366 3300026095 Bacteria 2576
361 Ga0207676_11028634 3300026095 Bacteria 812
362 Ga0207674_10359127 3300026116 Bacteria 1408
363 Ga0207675_100017719 3300026118 Bacteria 6645
364 Ga0207675_100153409 3300026118 Bacteria 2194
365 Ga0207675_100816073 3300026118 Bacteria 947
366 Ga0207675_100863532 3300026118 Bacteria 920
367 Ga0207683_10019407 3300026121 Bacteria 5805
368 Ga0207683_10176989 3300026121 Bacteria 1933
369 Ga0207683_10198005 3300026121 Bacteria 1825
370 Ga0207698_10181495 3300026142 Bacteria 1865
371 Ga0207698_10251155 3300026142 Bacteria 1618
372 Ga0207698_10258826 3300026142 Bacteria 1597
373 Ga0209588_1117007 3300027671 Unclassified 854
374 Ga0209974_10024563 3300027876 Bacteria 1994
375 Ga0207428_10016276 3300027907 Bacteria 6401
376 Ga0207428_10084137 3300027907 Bacteria 2480
377 Ga0207428_10822655 3300027907 Bacteria 659
378 Ga0268266_10287632 3300028379 Unclassified 1530
379 Ga0268266_10304449 3300028379 Bacteria 1488
380 Ga0268265_10499514 3300028380 Bacteria 1146
381 Ga0265323_10056678 3300028653 Bacteria 1373
382 Ga0316179_1114696 3300030734 Bacteria 1282
383 Ga0316178_1105115 3300030735 Bacteria 1052
384 Ga0316183_1036361 3300030742 Bacteria 1355
385 Ga0316181_1151150 3300030744 Bacteria 1395
386 Ga0316182_1366386 3300030745 Bacteria 1425
387 Ga0265760_10100213 3300031090 Bacteria 915
388 Ga0265327_10007924 3300031251 Bacteria 8046
389 Ga0307408_101207979 3300031548 Bacteria 705
390 Ga0307410_10276433 3300031852 Bacteria 1316
391 Ga0307410_10280687 3300031852 Bacteria 1307
392 Ga0307410_10374392 3300031852 Bacteria 1144
393 Ga0307410_10675321 3300031852 Bacteria 868
394 Ga0307406_10432164 3300031901 Bacteria 1052
395 Ga0307406_10551980 3300031901 Bacteria 943
396 Ga0307407_10101346 3300031903 Bacteria 1788
397 Ga0307409_100230970 3300031995 Bacteria 1677
398 Ga0307409_100667830 3300031995 Bacteria 1035
399 Ga0307409_100790275 3300031995 Bacteria 956
400 Ga0307409_101062555 3300031995 Bacteria 830
401 Ga0307416_101088907 3300032002 Bacteria 903
402 Ga0307416_101661918 3300032002 Bacteria 743
403 Ga0307411_10325853 3300032005 Bacteria 1242
404 Ga0307415_100023716 3300032126 Bacteria 3816
405 Ga0307415_100368143 3300032126 Bacteria 1216
406 Ga0307415_100501197 3300032126 Bacteria 1062
407 Ga0307415_100854663 3300032126 Bacteria 835
408 Ga0373958_0109418 3300034819 Bacteria 657
409 Ga0373934_0002343 3300035086 Bacteria 6972
410 Ga0373949_0159159 3300035090 Bacteria 658
411 Ga0373923_0191165 3300035111 Bacteria 943
412 Ga0373936_0186709 3300035113 Bacteria 911
413 Ga0373955_0003248 3300035172 Bacteria 7123
414 Ga0373933_0004445 3300035724 Bacteria 7694
415 Ga0373937_0002347 3300036401 Bacteria 15774
416 Ga0373937_0302930 3300036401 Bacteria 1511
417 Ga0395899_0002594 3300037312 Bacteria 14563
418 Ga0395899_0104951 3300037312 Bacteria 2036
419 Ga0395900_0005752 3300037418 Bacteria 12955
420 Ga0395900_0024584 3300037418 Bacteria 6168
421 Ga0395900_0050247 3300037418 Bacteria 4296
422 Ga0395900_0602941 3300037418 Bacteria 1039
423 Ga0395898_0001845 3300037466 Bacteria 27238
424 Ga0395898_0028599 3300037466 Bacteria 5585
425 Ga0395898_0087715 3300037466 Bacteria 2997
426 Ga0395898_0134536 3300037466 Bacteria 2367
427 Ga0395898_1358403 3300037466 Bacteria 639
428 Ga0395905_0001654 3300037471 Bacteria 26354
429 Ga0395905_0017743 3300037471 Bacteria 6758
430 Ga0395901_0000944 3300038443 Bacteria 31637
431 Ga0395901_0001895 3300038443 Bacteria 21606
432 Ga0395901_0212673 3300038443 Bacteria 2023
433 Ga0395901_0260080 3300038443 Bacteria 1807
434 Ga0395901_0540242 3300038443 Bacteria 1182
435 Ga0395901_1477304 3300038443 Bacteria 636
436 Ga0242420_000239 3300038996 Bacteria 5926
437 Ga0436362_0408950 3300039453 Bacteria 878
438 Ga0451791_0665612 3300041451 Bacteria 884
439 Ga0439450_106813 3300042008 Bacteria 714
440 Ga0439454_017031 3300042011 Bacteria 1034
441 Ga0439454_040069 3300042011 Bacteria 763
442 Ga0439459_0077778 3300042438 Bacteria 778
443 Ga0439464_0036772 3300042439 Bacteria 1386
444 Ga0439460_0170544 3300042461 Bacteria 732
445 Ga0439440_0003645 3300042993 Bacteria 2986
446 Ga0439440_0043477 3300042993 Bacteria 1102
447 Ga0466965_0075881 3300044683 Bacteria 1696
448 Ga0466966_0110784 3300044684 Bacteria 1692
449 Ga0453684_1190996 3300044712 Unclassified 800
450 Ga0466968_0119370 3300044735 Bacteria 1192
451 Ga0466957_0096294 3300044842 Bacteria 1860
452 Ga0466960_0114180 3300044901 Bacteria 1407
453 Ga0466960_0302729 3300044901 Bacteria 901
454 Ga0451576_0376478 3300045051 Bacteria 1488
455 Ga0466967_0433846 3300045976 Bacteria 1282
456 Ga0466967_0455350 3300045976 Bacteria 1251
457 Ga0466967_0957515 3300045976 Bacteria 852
458 Ga0466967_1028376 3300045976 Bacteria 820
459 Ga0495592_0003871 3300046454 Bacteria 10826
460 Ga0495603_0000672 3300046455 Bacteria 19385
461 Ga0495629_0121447 3300046459 Bacteria 1820
462 Ga0495641_0038426 3300046461 Unclassified 2236
463 Ga0495651_0006969 3300046462 Bacteria 8643
464 Ga0495653_0014567 3300046463 Bacteria 6418
465 Ga0495664_0026215 3300046477 Bacteria 3395
466 Ga0495584_0091635 3300046491 Bacteria 1533
467 Ga0495608_0019902 3300046511 Bacteria 4615
468 Ga0495618_0014747 3300046514 Bacteria 4765
469 Ga0495628_0049256 3300046516 Bacteria 3336
470 Ga0495630_0013215 3300046517 Bacteria 6004
471 Ga0495630_0331973 3300046517 Bacteria 1163
472 Ga0495637_0230717 3300046520 Bacteria 671
473 Ga0495652_0003785 3300046529 Bacteria 14768
474 Ga0495665_0060338 3300046531 Bacteria 2003
475 Ga0495640_0017255 3300046533 Bacteria 5383
476 Ga0495587_0006915 3300046536 Bacteria 7376
477 Ga0495645_0093987 3300046543 Unclassified 2139
478 Ga0495667_0005147 3300046559 Bacteria 8837
479 Ga0495656_0088206 3300046615 Bacteria 1414
480 Ga0495656_0428084 3300046615 Bacteria 695
481 Ga0495634_0030830 3300046642 Bacteria 3698
482 Ga0495635_0037379 3300046663 Bacteria 3361
483 Ga0495657_0030466 3300046675 Bacteria 3778
484 Ga0495599_0003777 3300046678 Bacteria 8895
485 Ga0495623_0063931 3300046679 Bacteria 2303
486 Ga0495646_0013182 3300046680 Bacteria 5253
487 Ga0495669_0004003 3300046684 Bacteria 6060
488 Ga0495613_0183235 3300046689 Bacteria 1482
489 Ga0495624_0321609 3300046690 Bacteria 932
490 Ga0495589_0267339 3300046794 Bacteria 797
491 Ga0495600_0022285 3300046809 Unclassified 4066
492 Ga0495581_0042813 3300047315 Bacteria 2620
493 Ga0495604_0007175 3300047317 Bacteria 8828
494 Ga0495674_0004827 3300047319 Bacteria 12965
495 Ga0495674_0192817 3300047319 Bacteria 1693
496 Ga0495672_0088505 3300047320 Bacteria 1706
497 Ga0495676_0132187 3300047321 Bacteria 1800
498 Ga0495676_0488966 3300047321 Bacteria 809
499 Ga0495680_0012831 3300047322 Bacteria 7343
500 Ga0495675_0034271 3300047444 Unclassified 3241
501 Ga0495602_0071262 3300048088 Unclassified 2968
502 Ga0496100_0003402 3300048903 Bacteria 8291
503 Ga0496100_0127769 3300048903 Bacteria 1786
504 Ga0496101_0121125 3300048904 Bacteria 1978
505 Ga0496101_0349790 3300048904 Bacteria 1161
506 Ga0496102_0082249 3300048905 Bacteria 2970
507 Ga0496102_0128905 3300048905 Bacteria 2366
508 Ga0496104_0076306 3300048907 Bacteria 3192
509 Ga0496105_0094060 3300048908 Bacteria 2475
510 Ga0496105_0350018 3300048908 Bacteria 1180
511 Ga0496107_0062654 3300048910 Bacteria 2694
512 Ga0496108_0073857 3300048911 Bacteria 2879
513 Ga0496108_0143127 3300048911 Bacteria 2060
514 Ga0496108_0212416 3300048911 Bacteria 1680
515 Ga0496109_0040039 3300048912 Bacteria 4244
516 Ga0496109_0107332 3300048912 Bacteria 2593
517 Ga0496109_0194463 3300048912 Bacteria 1906
518 Ga0496110_0732890 3300048913 Bacteria 891
519 Ga0496110_0836317 3300048913 Bacteria 826
520 Ga0496111_0046166 3300048914 Bacteria 3136
521 Ga0496111_0112751 3300048914 Bacteria 2003
522 Ga0496111_0161245 3300048914 Bacteria 1665
523 Ga0496111_0173939 3300048914 Bacteria 1600
524 Ga0496111_0911971 3300048914 Bacteria 632
525 Ga0496112_0008203 3300048915 Bacteria 9340
526 Ga0496112_0014384 3300048915 Bacteria 7338
527 Ga0496112_0175789 3300048915 Bacteria 2106
528 Ga0496112_0356788 3300048915 Bacteria 1404
529 Ga0496113_0027580 3300048916 Bacteria 4073
530 Ga0496113_0267690 3300048916 Bacteria 1365
531 Ga0496114_0586193 3300048917 Bacteria 984
532 Ga0496115_0017676 3300048918 Bacteria 5458
533 Ga0496115_0174682 3300048918 Bacteria 1776
534 Ga0496121_0260567 3300048924 Bacteria 1197
535 Ga0501031_0000099 3300049568 Bacteria 45863
536 Ga0501031_0049111 3300049568 Bacteria 2749
537 Ga0501031_0111322 3300049568 Bacteria 1788
538 Ga0501031_0187095 3300049568 Bacteria 1352
539 Ga0501032_0178308 3300049569 Bacteria 1392
540 Ga0501032_0246916 3300049569 Bacteria 1159
541 Ga0501033_0013201 3300049570 Bacteria 6292
542 Ga0501033_0055646 3300049570 Bacteria 2925
543 Ga0501033_0114446 3300049570 Bacteria 1961
544 Ga0501033_0274731 3300049570 Bacteria 1191
545 Ga0501033_0571257 3300049570 Bacteria 778
546 Ga0501034_0011583 3300049571 Bacteria 9132
547 Ga0501034_1243121 3300049571 Bacteria 623
548 Ga0501036_0016025 3300049572 Bacteria 6262
549 Ga0501036_0088163 3300049572 Bacteria 2622
550 Ga0501036_0103265 3300049572 Bacteria 2411
551 Ga0501036_0104620 3300049572 Bacteria 2393
552 Ga0501036_0112144 3300049572 Bacteria 2304
553 Ga0501036_0390676 3300049572 Bacteria 1161
554 Ga0501036_0687967 3300049572 Bacteria 845
555 Ga0501036_1051088 3300049572 Bacteria 666
556 Ga0501037_0060952 3300049573 Bacteria 2751
557 Ga0501037_0496466 3300049573 Bacteria 828
558 Ga0501038_0058161 3300049574 Bacteria 3315
559 Ga0501038_0061107 3300049574 Bacteria 3223
560 Ga0501038_0067097 3300049574 Bacteria 3053
561 Ga0501038_0119015 3300049574 Bacteria 2180
562 Ga0501038_0194591 3300049574 Bacteria 1630
563 Ga0501038_0221388 3300049574 Bacteria 1510
564 Ga0501038_0233070 3300049574 Bacteria 1464
565 Ga0501038_0589430 3300049574 Bacteria 842
566 Ga0501039_0058189 3300049575 Bacteria 2993
567 Ga0501039_0085413 3300049575 Bacteria 2458
568 Ga0501039_0163285 3300049575 Bacteria 1751
569 Ga0501039_0262834 3300049575 Bacteria 1356
570 Ga0501039_0287592 3300049575 Bacteria 1292
571 Ga0501039_0619699 3300049575 Bacteria 848
572 Ga0501039_0998736 3300049575 Bacteria 650
573 Ga0501040_0015040 3300049576 Bacteria 5114
574 Ga0501040_0023735 3300049576 Bacteria 4113
575 Ga0501040_0023849 3300049576 Bacteria 4103
576 Ga0501040_0035401 3300049576 Bacteria 3385
577 Ga0501040_0063243 3300049576 Bacteria 2546
578 Ga0501040_0116399 3300049576 Bacteria 1872
579 Ga0501040_0174763 3300049576 Bacteria 1522
580 Ga0501040_0371373 3300049576 Bacteria 1026
581 Ga0501040_0704249 3300049576 Bacteria 730
582 Ga0501040_0849933 3300049576 Bacteria 661
583 Ga0501040_0976833 3300049576 Bacteria 614
584 Ga0501041_0004438 3300049577 Bacteria 8121
585 Ga0501041_0008444 3300049577 Bacteria 6059
586 Ga0501041_0040909 3300049577 Bacteria 2815
587 Ga0501041_0041848 3300049577 Bacteria 2783
588 Ga0501041_0060345 3300049577 Bacteria 2321
589 Ga0501041_0085368 3300049577 Bacteria 1946
590 Ga0501041_0151290 3300049577 Bacteria 1449
591 Ga0501041_0263483 3300049577 Bacteria 1084
592 Ga0501042_0013117 3300049578 Bacteria 5637
593 Ga0501042_0025030 3300049578 Bacteria 4190
594 Ga0501042_0026169 3300049578 Bacteria 4101
595 Ga0501042_0075908 3300049578 Bacteria 2405
596 Ga0501042_0167763 3300049578 Bacteria 1584
597 Ga0501042_0215007 3300049578 Bacteria 1386
598 Ga0501042_0413034 3300049578 Bacteria 978
599 Ga0501042_0442697 3300049578 Bacteria 942
600 Ga0501042_0492972 3300049578 Bacteria 889
601 Ga0501042_0985772 3300049578 Bacteria 614
602 Ga0501043_0210256 3300049579 Bacteria 1508
603 Ga0501043_0224865 3300049579 Bacteria 1451
604 Ga0501043_0530363 3300049579 Bacteria 877
605 Ga0501043_0565897 3300049579 Bacteria 843
606 Ga0501043_0679055 3300049579 Bacteria 754
607 Ga0501046_0000122 3300049580 Bacteria 82617
608 Ga0501046_0260766 3300049580 Bacteria 1273
609 Ga0501047_0148899 3300049581 Bacteria 2217
610 Ga0501048_0064364 3300049582 Bacteria 2593
611 Ga0501048_0095601 3300049582 Bacteria 2095
612 Ga0501048_0100933 3300049582 Bacteria 2036
613 Ga0501048_0106735 3300049582 Bacteria 1977
614 Ga0501048_0202736 3300049582 Bacteria 1406
615 Ga0501048_0389936 3300049582 Bacteria 995
616 Ga0501067_0364650 3300049583 Bacteria 805
617 Ga0501068_0031080 3300049584 Bacteria 3171
618 Ga0501068_0122104 3300049584 Bacteria 1625
619 Ga0501068_0510818 3300049584 Bacteria 780
620 Ga0501069_0001681 3300049585 Bacteria 10991
621 Ga0501069_0040818 3300049585 Bacteria 2564
622 Ga0501069_0108418 3300049585 Bacteria 1580
623 Ga0501069_0228645 3300049585 Bacteria 1082
624 Ga0501070_0908664 3300049586 Bacteria 686
625 Ga0501071_0012359 3300049587 Bacteria 5789
626 Ga0501071_0017909 3300049587 Bacteria 4897
627 Ga0501071_0019660 3300049587 Bacteria 4687
628 Ga0501071_0020037 3300049587 Bacteria 4647
629 Ga0501071_0128954 3300049587 Bacteria 1878
630 Ga0501071_0174796 3300049587 Bacteria 1608
631 Ga0501071_0199642 3300049587 Bacteria 1502
632 Ga0501071_0218119 3300049587 Bacteria 1435
633 Ga0501071_0652605 3300049587 Bacteria 810
634 Ga0501071_0656781 3300049587 Bacteria 807
635 Ga0501071_0823095 3300049587 Bacteria 716
636 Ga0501072_0005024 3300049588 Bacteria 10060
637 Ga0501072_0006601 3300049588 Bacteria 8834
638 Ga0501072_0007632 3300049588 Bacteria 8211
639 Ga0501072_0015888 3300049588 Bacteria 5770
640 Ga0501072_0020027 3300049588 Bacteria 5180
641 Ga0501072_0042640 3300049588 Bacteria 3564
642 Ga0501072_0043020 3300049588 Bacteria 3550
643 Ga0501072_0070463 3300049588 Bacteria 2761
644 Ga0501072_0307017 3300049588 Bacteria 1261
645 Ga0501072_0549064 3300049588 Bacteria 912
646 Ga0501073_0027651 3300049589 Bacteria 4054
647 Ga0501073_0447707 3300049589 Bacteria 893
648 Ga0501074_0132284 3300049590 Bacteria 1784
649 Ga0501074_0215243 3300049590 Bacteria 1368
650 Ga0501074_0232083 3300049590 Bacteria 1313
651 Ga0501074_0523312 3300049590 Bacteria 840
652 Ga0501074_0560912 3300049590 Bacteria 808
653 Ga0501075_0008339 3300049591 Bacteria 7225
654 Ga0501075_0012281 3300049591 Bacteria 6083
655 Ga0501075_0021567 3300049591 Bacteria 4698
656 Ga0501075_0024782 3300049591 Bacteria 4404
657 Ga0501075_0045146 3300049591 Bacteria 3307
658 Ga0501075_0046081 3300049591 Bacteria 3275
659 Ga0501075_0096828 3300049591 Bacteria 2239
660 Ga0501075_0120504 3300049591 Bacteria 1996
661 Ga0501075_0541809 3300049591 Bacteria 888
662 Ga0501076_0015610 3300049592 Bacteria 5744
663 Ga0501076_0035018 3300049592 Bacteria 3927
664 Ga0501076_0040780 3300049592 Bacteria 3649
665 Ga0501076_0047187 3300049592 Bacteria 3405
666 Ga0501076_0079669 3300049592 Bacteria 2628
667 Ga0501076_0080181 3300049592 Bacteria 2619
668 Ga0501076_0108111 3300049592 Bacteria 2246
669 Ga0501076_0206082 3300049592 Bacteria 1606
670 Ga0501076_0218066 3300049592 Bacteria 1559
671 Ga0501076_0320378 3300049592 Bacteria 1271
672 Ga0501076_0586398 3300049592 Bacteria 919
673 Ga0501076_0716844 3300049592 Bacteria 826
674 Ga0501077_0006666 3300049593 Bacteria 7096
675 Ga0501077_0046364 3300049593 Bacteria 2761
676 Ga0501077_0062603 3300049593 Bacteria 2360
677 Ga0501077_0068511 3300049593 Bacteria 2249
678 Ga0501077_0095275 3300049593 Bacteria 1887
679 Ga0501077_0110822 3300049593 Bacteria 1739
680 Ga0501077_0242340 3300049593 Bacteria 1146
681 Ga0501077_0364638 3300049593 Bacteria 922
682 Ga0501077_0780278 3300049593 Bacteria 614
683 Ga0501206_028187 3300049653 Bacteria 825
684 Ga0501233_061565 3300049668 Bacteria 933
685 Ga0501252_036186 3300049682 Bacteria 701
686 Ga0501261_050705 3300049690 Bacteria 679
687 Ga0501079_0005376 3300049741 Bacteria 9536
688 Ga0501079_0007588 3300049741 Bacteria 8218
689 Ga0501079_0011708 3300049741 Bacteria 6699
690 Ga0501079_0049550 3300049741 Bacteria 3242
691 Ga0501079_0054007 3300049741 Bacteria 3099
692 Ga0501079_0095702 3300049741 Bacteria 2301
693 Ga0501079_0240496 3300049741 Bacteria 1414
694 Ga0501079_1008808 3300049741 Bacteria 656
695 Ga0501080_0018622 3300049742 Bacteria 6426
696 Ga0501080_0065323 3300049742 Bacteria 3385
697 Ga0501080_0077378 3300049742 Bacteria 3094
698 Ga0501080_0169721 3300049742 Bacteria 2012
699 Ga0501080_0173123 3300049742 Bacteria 1990
700 Ga0501080_0356608 3300049742 Bacteria 1320
701 Ga0501081_0000023 3300049743 Bacteria 55512
702 Ga0501081_0011053 3300049743 Bacteria 5903
703 Ga0501081_0017967 3300049743 Bacteria 4690
704 Ga0501081_0065976 3300049743 Bacteria 2517
705 Ga0501081_0076128 3300049743 Bacteria 2343
706 Ga0501081_0078132 3300049743 Bacteria 2313
707 Ga0501081_0096111 3300049743 Bacteria 2089
708 Ga0501081_0222910 3300049743 Bacteria 1371
709 Ga0501081_0498556 3300049743 Bacteria 907
710 Ga0501083_0126933 3300049744 Bacteria 1672
711 Ga0501083_0203509 3300049744 Bacteria 1291
712 Ga0501265_023860 3300049762 Bacteria 844
713 Ga0501283_062006 3300049779 Bacteria 677
714 Ga0501035_0013659 3300049822 Bacteria 7490
715 Ga0501035_0120875 3300049822 Bacteria 2290
716 Ga0501035_0282368 3300049822 Bacteria 1403
717 Ga0501035_0349204 3300049822 Bacteria 1238
718 Ga0501035_0570315 3300049822 Bacteria 925
719 Ga0501044_0002304 3300049823 Bacteria 21754
720 Ga0501044_0023721 3300049823 Bacteria 6524
721 Ga0501044_0474953 3300049823 Bacteria 1154
722 Ga0501045_0001188 3300049824 Bacteria 17315
723 Ga0501045_0011757 3300049824 Bacteria 6151
724 Ga0501045_0018651 3300049824 Bacteria 4938
725 Ga0501045_0061522 3300049824 Bacteria 2754
726 Ga0501045_0110887 3300049824 Bacteria 2034
727 Ga0501045_0271404 3300049824 Bacteria 1263
728 Ga0501204_021283 3300049850 Bacteria 849
729 Ga0501212_010954 3300049851 Bacteria 1300
730 nmdc:mga00v17_385998_c1 3300050491 Bacteria 910
731 nmdc:mga0yw44_238364_c1 3300050492 Bacteria 1208
732 nmdc:mga05p37_1137335_c1 3300050507 Bacteria 814
733 nmdc:mga05p37_529424_c1 3300050507 Bacteria 1346
734 nmdc:mga05p37_652597_c1 3300050507 Bacteria 1178
735 nmdc:mga05p37_75325_c1 3300050507 Bacteria 4154
736 nmdc:mga09592_1208825_c1 3300050508 Bacteria 624
737 nmdc:mga09592_67790_c1 3300050508 Bacteria 3027
738 nmdc:mga0qj67_29980_c1 3300050509 Bacteria 4230
739 nmdc:mga0qj67_577809_c1 3300050509 Bacteria 900
740 nmdc:mga06r32_273193_c1 3300050510 Bacteria 1678
741 nmdc:mga06r32_69438_c1 3300050510 Bacteria 3405
742 nmdc:mga06r32_87279_c1 3300050510 Bacteria 3044
743 nmdc:mga06r32_938158_c1 3300050510 Bacteria 820
744 nmdc:mga08y16_1036487_c1 3300050511 Bacteria 799
745 nmdc:mga08y16_242295_c1 3300050511 Bacteria 1864
746 nmdc:mga08y16_392854_c1 3300050511 Bacteria 1421
747 nmdc:mga08y16_720401_c1 3300050511 Bacteria 996
748 nmdc:mga0n895_59897_c1 3300050512 Bacteria 3757
749 nmdc:mga0rr50_194727_c1 3300050513 Bacteria 1663
750 nmdc:mga0rr50_23401_c1 3300050513 Bacteria 4260
751 nmdc:mga08x19_31888_c1 3300050514 Bacteria 3319
752 nmdc:mga0a205_55141_c1 3300050515 Bacteria 3839
753 nmdc:mga0a205_90836_c1 3300050515 Bacteria 2951
754 nmdc:mga0a205_90895_c1 3300050515 Bacteria 2949
755 Ga0495601_0028639 3300053077 Bacteria 3451
756 Ga0495612_0065871 3300053078 Bacteria 1505
757 Ga0495619_0001988 3300053085 Bacteria 13616
758 Ga0495619_0173787 3300053085 Bacteria 1490
759 Ga0495619_0459048 3300053085 Bacteria 878
760 Ga0500564_031579 3300053138 Bacteria 2441
761 Ga0500616_0001306 3300053153 Bacteria 24694
762 Ga0500616_0020473 3300053153 Bacteria 3715
763 Ga0501084_0003586 3300054114 Bacteria 12605
764 Ga0501084_0033997 3300054114 Bacteria 4263
765 Ga0501084_0051857 3300054114 Bacteria 3434
766 Ga0501084_0086030 3300054114 Bacteria 2639
767 Ga0501084_0117340 3300054114 Bacteria 2238
768 Ga0501084_0211927 3300054114 Bacteria 1634
769 Ga0501084_0225467 3300054114 Bacteria 1581
770 Ga0501084_0340961 3300054114 Bacteria 1266
771 Ga0501084_0539632 3300054114 Bacteria 985
772 Ga0501084_0828335 3300054114 Bacteria 779
773 Ga0590071_015101 3300059421 Bacteria 1812
774 Ga0590074_022556 3300059423 Bacteria 1088
775 Ga0590074_056468 3300059423 Bacteria 724
776 Ga0590075_001579 3300059424 Bacteria 5649
777 Ga0590077_030655 3300059426 Bacteria 1173
778 Ga0590077_041434 3300059426 Bacteria 1024
779 Ga0590077_063160 3300059426 Bacteria 841
780 Ga0501082_0004546 3300060353 Bacteria 12106
781 Ga0501082_0035222 3300060353 Bacteria 4315
782 Ga0501082_0077902 3300060353 Bacteria 2859
783 Ga0501082_0136127 3300060353 Bacteria 2131
784 Ga0501082_0282620 3300060353 Bacteria 1444
785 Ga0501082_0517242 3300060353 Bacteria 1043
786 Ga0501082_0523839 3300060353 Bacteria 1036
787 Ga0501082_0610599 3300060353 Bacteria 954
788 Ga0530510_0021868 3300061734 Bacteria 4552
789 Ga0530510_0049418 3300061734 Bacteria 3039
790 Ga0530510_0062074 3300061734 Bacteria 2705
791 Ga0530510_0166140 3300061734 Bacteria 1633
792 Ga0530510_0287678 3300061734 Bacteria 1228
793 Ga0530510_0602447 3300061734 Bacteria 835
794 Ga0530510_0605310 3300061734 Bacteria 833
795 2857473797 2857472729 Bacteria 6568124
796 Ga0501045_0087190
797 ARSoilOldRDRAFT_c009804
798 JGI24738J21930_10085178
799 JGI24034J26672_10046559
800 JGI24751J29686_10035565
801 JGI25406J46586_10007830
802 JGI25406J46586_10013166
803 JGI25407J50210_10006958
804 JGI25407J50210_10067342
805 Ga0058859_11098586
806 Ga0065704_10172706
807 Ga0070658_10365327
808 Ga0070658_10611448
809 Ga0070676_10099284
810 Ga0070683_100002245
811 Ga0070683_100006602
812 Ga0070683_100456794
813 Ga0070683_100657150
814 Ga0070683_101003017
815 Ga0070670_100176236
816 Ga0070666_10578049
817 Ga0070682_100090017
818 Ga0068868_100109240
819 Ga0068868_100203980
820 Ga0070660_100070005
821 Ga0070660_100419803
822 Ga0070689_100017734
823 Ga0070689_100063296
824 Ga0070691_10175702
825 Ga0070687_100467688
826 Ga0070661_100130931
827 Ga0070661_100916644
828 Ga0070692_10033492
829 Ga0070675_100042894
830 Ga0070675_100095895
831 Ga0070675_100180518
832 Ga0070671_100003760
833 Ga0070671_100528867
834 Ga0070674_100050783
835 Ga0070674_100517001
836 Ga0070688_100066082
837 Ga0070659_100041161
838 Ga0070659_100042093
839 Ga0070659_100351504
840 Ga0070659_100398389
841 Ga0070659_101042839
842 Ga0070714_100003434
843 Ga0070714_100181670
844 Ga0070713_100168840
845 Ga0070710_10046466
846 Ga0070710_10215290
847 Ga0070701_10025668
848 Ga0070701_10148844
849 Ga0070701_10274193
850 Ga0070701_10337891
851 Ga0070711_100995737
852 Ga0070705_100022393
853 Ga0070705_100453255
854 Ga0070700_100503871
855 Ga0070694_100318385
856 Ga0070694_100606784
857 Ga0070708_100005640
858 Ga0070708_100047574
859 Ga0070708_100125312
860 Ga0070708_100210268
861 Ga0070708_100316418
862 Ga0070678_100188557
863 Ga0070678_100593781
864 Ga0070662_100573727
865 Ga0068867_100480934
866 Ga0070685_10001384
867 Ga0070685_10018362
868 Ga0070685_10916973
869 Ga0070706_100032291
870 Ga0070706_100048489
871 Ga0070706_100148509
872 Ga0070706_100243351
873 Ga0070707_100043137
874 Ga0070707_100293170
875 Ga0070707_100418234
876 Ga0070698_100003594
877 Ga0070698_100008016
878 Ga0070698_100072154
879 Ga0070698_100524613
880 Ga0070699_100069744
881 Ga0070699_100269366
882 Ga0070679_100124223
883 Ga0070684_100141523
884 Ga0070684_100168920
885 Ga0070684_100303159
886 Ga0070684_100462619
887 Ga0070684_100870719
888 Ga0070697_100661068
889 Ga0068853_100055148
890 Ga0068853_100299707
891 Ga0068853_100952505
892 Ga0070672_100091084
893 Ga0070686_100009931
894 Ga0070686_100281092
895 Ga0070686_100503694
896 Ga0070686_100690521
897 Ga0070695_100511101
898 Ga0070665_100073402
899 Ga0070665_100219034
900 Ga0070704_100504766
901 Ga0070704_100574659
902 Ga0068855_100088586
903 Ga0068855_100090261
904 Ga0070664_100068326
905 Ga0070664_100489094
906 Ga0070664_100836088
907 Ga0068857_100353202
908 Ga0068857_100973727
909 Ga0068857_101067813
910 Ga0068854_100380053
911 Ga0068854_100477276
912 Ga0070702_100004623
913 Ga0070702_100028737
914 Ga0070702_100066193
915 Ga0068852_100082983
916 Ga0068852_100478847
917 Ga0068859_100120415
918 Ga0068859_100394940
919 Ga0068864_100140197
920 Ga0068864_100163592
921 Ga0068866_10083211
922 Ga0068866_10102282
923 Ga0068866_10263873
924 Ga0068861_100052951
925 Ga0068861_100926294
926 Ga0068851_10184151
927 Ga0068858_100060851
928 Ga0068860_100713595
929 Ga0068860_100917801
930 Ga0068862_100082720
931 Ga0081455_10015281
932 Ga0081455_10053771
933 Ga0081455_10055023
934 Ga0081455_10082368
935 Ga0081455_10090199
936 Ga0081455_10226958
937 Ga0081538_10000114
938 Ga0081538_10000349
939 Ga0081538_10000730
940 Ga0081538_10003250
941 Ga0081538_10003531
942 Ga0081538_10013921
943 Ga0081538_10019207
944 Ga0081538_10027999
945 Ga0081538_10033259
946 Ga0081538_10037575
947 Ga0081538_10054644
948 Ga0081538_10060149
949 Ga0081538_10126395
950 Ga0081540_1000554
951 Ga0081539_10001190
952 Ga0081539_10068329
953 Ga0070717_10037118
954 Ga0070717_10071516
955 Ga0075365_10127669
956 Ga0075365_10250750
957 Ga0075365_10293718
958 Ga0075364_10432055
959 Ga0075432_10019965
960 Ga0070716_100685898
961 Ga0070712_100042014
962 Ga0070712_100146852
963 Ga0068871_100621358
964 Ga0075428_100024386
965 Ga0075428_100032977
966 Ga0075428_100047490
967 Ga0075428_100249385
968 Ga0075428_100954196
969 Ga0075430_100005703
970 Ga0075431_100020956
971 Ga0075431_100077017
972 Ga0075431_100095039
973 Ga0075431_100617613
974 Ga0075433_10144164
975 Ga0075433_10245051
976 Ga0075434_100093322
977 Ga0075434_101110647
978 Ga0075429_100077693
979 Ga0075429_100418030
980 Ga0068865_100123799
981 Ga0068865_100161938
982 Ga0068865_100206624
983 Ga0068865_100952592
984 Ga0075436_100067131
985 Ga0097620_100120421
986 Ga0097620_100394927
987 Ga0075435_100011297
988 Ga0075435_100092790
989 Ga0075435_100426472
990 Ga0099794_10013103
991 Ga0099794_10028823
992 Ga0099794_10182212
993 Ga0105240_10001492
994 Ga0111539_10051520
995 Ga0111539_10082047
996 Ga0111539_10350075
997 Ga0111539_10592164
998 Ga0111539_10879408
999 Ga0111539_11233067
1000 Ga0105245_10009806
1001 Ga0105245_10021897
1002 Ga0105245_10202119
1003 Ga0105247_10241637
1004 Ga0105247_10440061
1005 Ga0114129_10041874
1006 Ga0114129_10127256
1007 Ga0114129_10354059
1008 Ga0114129_10474719
1009 Ga0114129_10496622
1010 Ga0114129_11044763
1011 Ga0105243_10012151
1012 Ga0105243_10074378
1013 Ga0105243_10095121
1014 Ga0105243_10181283
1015 Ga0105243_10912063
1016 Ga0105242_10072751
1017 Ga0105242_10802166
1018 Ga0105248_10173945
1019 Ga0105237_10442868
1020 Ga0105238_10355987
1021 Ga0105238_10852303
1022 Ga0105249_10003773
1023 Ga0105249_10032347
1024 Ga0105249_10044043
1025 Ga0105249_10347795
1026 Ga0105249_11709103
1027 Ga0105249_11729620
1028 Ga0105239_10059591
1029 Ga0105239_10156317
1030 Ga0105239_10343852
1031 Ga0105239_10377418
1032 Ga0105246_10193722
1033 Ga0157336_1000578
1034 Ga0157320_1001539
1035 Ga0157313_1000598
1036 Ga0157326_1018189
1037 Ga0157371_10400672
1038 Ga0157370_10040347
1039 Ga0157370_10521708
1040 Ga0157369_10003395
1041 Ga0157369_10089138
1042 Ga0157369_10839036
1043 Ga0163162_10067426
1044 Ga0163162_11258887
1045 Ga0157372_10136169
1046 Ga0157372_11216371
1047 Ga0157372_12118444
1048 Ga0157375_10063069
1049 Ga0163163_11056191
1050 Ga0163163_11272229
1051 Ga0157380_10044589
1052 Ga0157380_10108444
1053 Ga0157380_10141493
1054 Ga0157380_10636479
1055 Ga0157380_10816000
1056 Ga0157377_10009027
1057 Ga0157377_10031119
1058 Ga0157379_10263868
1059 Ga0157376_10082355
1060 Ga0157376_10497251
1061 Ga0157376_12103061
1062 Ga0163161_10125486
1063 Ga0163161_10738033
1064 Ga0206352_11025843
1065 Ga0206353_10543484
1066 Ga0213876_10017107
1067 Ga0207692_10015242
1068 Ga0207692_10066064
1069 Ga0207642_10048204
1070 Ga0207642_10063473
1071 Ga0207642_10309452
1072 Ga0207688_10008263
1073 Ga0207688_10029532
1074 Ga0207688_10173613
1075 Ga0207688_10359597
1076 Ga0207647_10077036
1077 Ga0207647_10091051
1078 Ga0207645_10442738
1079 Ga0207643_10035934
1080 Ga0207643_10037847
1081 Ga0207684_10031135
1082 Ga0207684_10037530
1083 Ga0207684_10068064
1084 Ga0207695_10000645
1085 Ga0207671_10401924
1086 Ga0207693_10378025
1087 Ga0207663_10000440
1088 Ga0207663_10435555
1089 Ga0207660_10155492
1090 Ga0207662_10214490
1091 Ga0207662_10461143
1092 Ga0207657_10051907
1093 Ga0207657_10068717
1094 Ga0207652_10233490
1095 Ga0207646_10002662
1096 Ga0207646_10014117
1097 Ga0207646_10199930
1098 Ga0207681_10280495
1099 Ga0207650_10219468
1100 Ga0207659_10056407
1101 Ga0207687_10009967
1102 Ga0207687_10017351
1103 Ga0207687_10032774
1104 Ga0207687_10052319
1105 Ga0207700_10024007
1106 Ga0207664_10011317
1107 Ga0207644_10060386
1108 Ga0207690_10037320
1109 Ga0207690_10037735
1110 Ga0207706_10018905
1111 Ga0207709_10013641
1112 Ga0207709_10053473
1113 Ga0207709_10620823
1114 Ga0207670_10007519
1115 Ga0207670_10448994
1116 Ga0207669_10361287
1117 Ga0207704_10062776
1118 Ga0207704_10425176
1119 Ga0207704_11166829
1120 Ga0207665_10311654
1121 Ga0207691_10032872
1122 Ga0207711_10728486
1123 Ga0207711_10790329
1124 Ga0207661_10181088
1125 Ga0207661_10249075
1126 Ga0207661_10428823
1127 Ga0207661_10714581
1128 Ga0207661_10790202
1129 Ga0207679_10110851
1130 Ga0207679_10615030
1131 Ga0207667_10001334
1132 Ga0207667_10093435
1133 Ga0207667_10105941
1134 Ga0207712_10023527
1135 Ga0207712_10117113
1136 Ga0207712_10458822
1137 Ga0207668_10100389
1138 Ga0207668_10219656
1139 Ga0207668_10492123
1140 Ga0207668_10785857
1141 Ga0207640_10077420
1142 Ga0207640_10455961
1143 Ga0207677_10501524
1144 Ga0207703_10034293
1145 Ga0207703_10487329
1146 Ga0207639_10848988
1147 Ga0207639_10895066
1148 Ga0207678_10084878
1149 Ga0207708_10009406
1150 Ga0207708_10016938
1151 Ga0207708_10374526
1152 Ga0207648_10070819
1153 Ga0207648_10193174
1154 Ga0207648_10252003
1155 Ga0207676_10085366
1156 Ga0207676_11028634
1157 Ga0207674_10359127
1158 Ga0207675_100017719
1159 Ga0207675_100153409
1160 Ga0207675_100816073
1161 Ga0207675_100863532
1162 Ga0207683_10019407
1163 Ga0207683_10176989
1164 Ga0207683_10198005
1165 Ga0207698_10181495
1166 Ga0207698_10251155
1167 Ga0207698_10258826
1168 Ga0209588_1117007
1169 Ga0209974_10024563
1170 Ga0207428_10016276
1171 Ga0207428_10084137
1172 Ga0207428_10822655
1173 Ga0268266_10287632
1174 Ga0268266_10304449
1175 Ga0268265_10499514
1176 Ga0265323_10056678
1177 Ga0316179_1114696
1178 Ga0316178_1105115
1179 Ga0316183_1036361
1180 Ga0316181_1151150
1181 Ga0316182_1366386
1182 Ga0265760_10100213
1183 Ga0265327_10007924
1184 Ga0307408_101207979
1185 Ga0307410_10276433
1186 Ga0307410_10280687
1187 Ga0307410_10374392
1188 Ga0307410_10675321
1189 Ga0307406_10432164
1190 Ga0307406_10551980
1191 Ga0307407_10101346
1192 Ga0307409_100230970
1193 Ga0307409_100667830
1194 Ga0307409_100790275
1195 Ga0307409_101062555
1196 Ga0307416_101088907
1197 Ga0307416_101661918
1198 Ga0307411_10325853
1199 Ga0307415_100023716
1200 Ga0307415_100368143
1201 Ga0307415_100501197
1202 Ga0307415_100854663
1203 Ga0373958_0109418
1204 Ga0373934_0002343
1205 Ga0373949_0159159
1206 Ga0373923_0191165
1207 Ga0373936_0186709
1208 Ga0373955_0003248
1209 Ga0373933_0004445
1210 Ga0373937_0002347
1211 Ga0373937_0302930
1212 Ga0395899_0002594
1213 Ga0395899_0104951
1214 Ga0395900_0005752
1215 Ga0395900_0024584
1216 Ga0395900_0050247
1217 Ga0395900_0602941
1218 Ga0395898_0001845
1219 Ga0395898_0028599
1220 Ga0395898_0087715
1221 Ga0395898_0134536
1222 Ga0395898_1358403
1223 Ga0395905_0001654
1224 Ga0395905_0017743
1225 Ga0395901_0000944
1226 Ga0395901_0001895
1227 Ga0395901_0212673
1228 Ga0395901_0260080
1229 Ga0395901_0540242
1230 Ga0395901_1477304
1231 Ga0242420_000239
1232 Ga0436362_0408950
1233 Ga0451791_0665612
1234 Ga0439450_106813
1235 Ga0439454_017031
1236 Ga0439454_040069
1237 Ga0439459_0077778
1238 Ga0439464_0036772
1239 Ga0439460_0170544
1240 Ga0439440_0003645
1241 Ga0439440_0043477
1242 Ga0466965_0075881
1243 Ga0466966_0110784
1244 Ga0453684_1190996
1245 Ga0466968_0119370
1246 Ga0466957_0096294
1247 Ga0466960_0114180
1248 Ga0466960_0302729
1249 Ga0451576_0376478
1250 Ga0466967_0433846
1251 Ga0466967_0455350
1252 Ga0466967_0957515
1253 Ga0466967_1028376
1254 Ga0495592_0003871
1255 Ga0495603_0000672
1256 Ga0495629_0121447
1257 Ga0495641_0038426
1258 Ga0495651_0006969
1259 Ga0495653_0014567
1260 Ga0495664_0026215
1261 Ga0495584_0091635
1262 Ga0495608_0019902
1263 Ga0495618_0014747
1264 Ga0495628_0049256
1265 Ga0495630_0013215
1266 Ga0495630_0331973
1267 Ga0495637_0230717
1268 Ga0495652_0003785
1269 Ga0495665_0060338
1270 Ga0495640_0017255
1271 Ga0495587_0006915
1272 Ga0495645_0093987
1273 Ga0495667_0005147
1274 Ga0495656_0088206
1275 Ga0495656_0428084
1276 Ga0495634_0030830
1277 Ga0495635_0037379
1278 Ga0495657_0030466
1279 Ga0495599_0003777
1280 Ga0495623_0063931
1281 Ga0495646_0013182
1282 Ga0495669_0004003
1283 Ga0495613_0183235
1284 Ga0495624_0321609
1285 Ga0495589_0267339
1286 Ga0495600_0022285
1287 Ga0495581_0042813
1288 Ga0495604_0007175
1289 Ga0495674_0004827
1290 Ga0495674_0192817
1291 Ga0495672_0088505
1292 Ga0495676_0132187
1293 Ga0495676_0488966
1294 Ga0495680_0012831
1295 Ga0495675_0034271
1296 Ga0495602_0071262
1297 Ga0496100_0003402
1298 Ga0496100_0127769
1299 Ga0496101_0121125
1300 Ga0496101_0349790
1301 Ga0496102_0082249
1302 Ga0496102_0128905
1303 Ga0496104_0076306
1304 Ga0496105_0094060
1305 Ga0496105_0350018
1306 Ga0496107_0062654
1307 Ga0496108_0073857
1308 Ga0496108_0143127
1309 Ga0496108_0212416
1310 Ga0496109_0040039
1311 Ga0496109_0107332
1312 Ga0496109_0194463
1313 Ga0496110_0732890
1314 Ga0496110_0836317
1315 Ga0496111_0046166
1316 Ga0496111_0112751
1317 Ga0496111_0161245
1318 Ga0496111_0173939
1319 Ga0496111_0911971
1320 Ga0496112_0008203
1321 Ga0496112_0014384
1322 Ga0496112_0175789
1323 Ga0496112_0356788
1324 Ga0496113_0027580
1325 Ga0496113_0267690
1326 Ga0496114_0586193
1327 Ga0496115_0017676
1328 Ga0496115_0174682
1329 Ga0496121_0260567
1330 Ga0501031_0000099
1331 Ga0501031_0049111
1332 Ga0501031_0111322
1333 Ga0501031_0187095
1334 Ga0501032_0178308
1335 Ga0501032_0246916
1336 Ga0501033_0013201
1337 Ga0501033_0055646
1338 Ga0501033_0114446
1339 Ga0501033_0274731
1340 Ga0501033_0571257
1341 Ga0501034_0011583
1342 Ga0501034_1243121
1343 Ga0501036_0016025
1344 Ga0501036_0088163
1345 Ga0501036_0103265
1346 Ga0501036_0104620
1347 Ga0501036_0112144
1348 Ga0501036_0390676
1349 Ga0501036_0687967
1350 Ga0501036_1051088
1351 Ga0501037_0060952
1352 Ga0501037_0496466
1353 Ga0501038_0058161
1354 Ga0501038_0061107
1355 Ga0501038_0067097
1356 Ga0501038_0119015
1357 Ga0501038_0194591
1358 Ga0501038_0221388
1359 Ga0501038_0233070
1360 Ga0501038_0589430
1361 Ga0501039_0058189
1362 Ga0501039_0085413
1363 Ga0501039_0163285
1364 Ga0501039_0262834
1365 Ga0501039_0287592
1366 Ga0501039_0619699
1367 Ga0501039_0998736
1368 Ga0501040_0015040
1369 Ga0501040_0023735
1370 Ga0501040_0023849
1371 Ga0501040_0035401
1372 Ga0501040_0063243
1373 Ga0501040_0116399
1374 Ga0501040_0174763
1375 Ga0501040_0371373
1376 Ga0501040_0704249
1377 Ga0501040_0849933
1378 Ga0501040_0976833
1379 Ga0501041_0004438
1380 Ga0501041_0008444
1381 Ga0501041_0040909
1382 Ga0501041_0041848
1383 Ga0501041_0060345
1384 Ga0501041_0085368
1385 Ga0501041_0151290
1386 Ga0501041_0263483
1387 Ga0501042_0013117
1388 Ga0501042_0025030
1389 Ga0501042_0026169
1390 Ga0501042_0075908
1391 Ga0501042_0167763
1392 Ga0501042_0215007
1393 Ga0501042_0413034
1394 Ga0501042_0442697
1395 Ga0501042_0492972
1396 Ga0501042_0985772
1397 Ga0501043_0210256
1398 Ga0501043_0224865
1399 Ga0501043_0530363
1400 Ga0501043_0565897
1401 Ga0501043_0679055
1402 Ga0501046_0000122
1403 Ga0501046_0260766
1404 Ga0501047_0148899
1405 Ga0501048_0064364
1406 Ga0501048_0095601
1407 Ga0501048_0100933
1408 Ga0501048_0106735
1409 Ga0501048_0202736
1410 Ga0501048_0389936
1411 Ga0501067_0364650
1412 Ga0501068_0031080
1413 Ga0501068_0122104
1414 Ga0501068_0510818
1415 Ga0501069_0001681
1416 Ga0501069_0040818
1417 Ga0501069_0108418
1418 Ga0501069_0228645
1419 Ga0501070_0908664
1420 Ga0501071_0012359
1421 Ga0501071_0017909
1422 Ga0501071_0019660
1423 Ga0501071_0020037
1424 Ga0501071_0128954
1425 Ga0501071_0174796
1426 Ga0501071_0199642
1427 Ga0501071_0218119
1428 Ga0501071_0652605
1429 Ga0501071_0656781
1430 Ga0501071_0823095
1431 Ga0501072_0005024
1432 Ga0501072_0006601
1433 Ga0501072_0007632
1434 Ga0501072_0015888
1435 Ga0501072_0020027
1436 Ga0501072_0042640
1437 Ga0501072_0043020
1438 Ga0501072_0070463
1439 Ga0501072_0307017
1440 Ga0501072_0549064
1441 Ga0501073_0027651
1442 Ga0501073_0447707
1443 Ga0501074_0132284
1444 Ga0501074_0215243
1445 Ga0501074_0232083
1446 Ga0501074_0523312
1447 Ga0501074_0560912
1448 Ga0501075_0008339
1449 Ga0501075_0012281
1450 Ga0501075_0021567
1451 Ga0501075_0024782
1452 Ga0501075_0045146
1453 Ga0501075_0046081
1454 Ga0501075_0096828
1455 Ga0501075_0120504
1456 Ga0501075_0541809
1457 Ga0501076_0015610
1458 Ga0501076_0035018
1459 Ga0501076_0040780
1460 Ga0501076_0047187
1461 Ga0501076_0079669
1462 Ga0501076_0080181
1463 Ga0501076_0108111
1464 Ga0501076_0206082
1465 Ga0501076_0218066
1466 Ga0501076_0320378
1467 Ga0501076_0586398
1468 Ga0501076_0716844
1469 Ga0501077_0006666
1470 Ga0501077_0046364
1471 Ga0501077_0062603
1472 Ga0501077_0068511
1473 Ga0501077_0095275
1474 Ga0501077_0110822
1475 Ga0501077_0242340
1476 Ga0501077_0364638
1477 Ga0501077_0780278
1478 Ga0501206_028187
1479 Ga0501233_061565
1480 Ga0501252_036186
1481 Ga0501261_050705
1482 Ga0501079_0005376
1483 Ga0501079_0007588
1484 Ga0501079_0011708
1485 Ga0501079_0049550
1486 Ga0501079_0054007
1487 Ga0501079_0095702
1488 Ga0501079_0240496
1489 Ga0501079_1008808
1490 Ga0501080_0018622
1491 Ga0501080_0065323
1492 Ga0501080_0077378
1493 Ga0501080_0169721
1494 Ga0501080_0173123
1495 Ga0501080_0356608
1496 Ga0501081_0000023
1497 Ga0501081_0011053
1498 Ga0501081_0017967
1499 Ga0501081_0065976
1500 Ga0501081_0076128
1501 Ga0501081_0078132
1502 Ga0501081_0096111
1503 Ga0501081_0222910
1504 Ga0501081_0498556
1505 Ga0501083_0126933
1506 Ga0501083_0203509
1507 Ga0501265_023860
1508 Ga0501283_062006
1509 Ga0501035_0013659
1510 Ga0501035_0120875
1511 Ga0501035_0282368
1512 Ga0501035_0349204
1513 Ga0501035_0570315
1514 Ga0501044_0002304
1515 Ga0501044_0023721
1516 Ga0501044_0474953
1517 Ga0501045_0001188
1518 Ga0501045_0011757
1519 Ga0501045_0018651
1520 Ga0501045_0061522
1521 Ga0501045_0110887
1522 Ga0501045_0271404
1523 Ga0501204_021283
1524 Ga0501212_010954
1525 nmdc:mga00v17_385998_c1
1526 nmdc:mga0yw44_238364_c1
1527 nmdc:mga05p37_1137335_c1
1528 nmdc:mga05p37_529424_c1
1529 nmdc:mga05p37_652597_c1
1530 nmdc:mga05p37_75325_c1
1531 nmdc:mga09592_1208825_c1
1532 nmdc:mga09592_67790_c1
1533 nmdc:mga0qj67_29980_c1
1534 nmdc:mga0qj67_577809_c1
1535 nmdc:mga06r32_273193_c1
1536 nmdc:mga06r32_69438_c1
1537 nmdc:mga06r32_87279_c1
1538 nmdc:mga06r32_938158_c1
1539 nmdc:mga08y16_1036487_c1
1540 nmdc:mga08y16_242295_c1
1541 nmdc:mga08y16_392854_c1
1542 nmdc:mga08y16_720401_c1
1543 nmdc:mga0n895_59897_c1
1544 nmdc:mga0rr50_194727_c1
1545 nmdc:mga0rr50_23401_c1
1546 nmdc:mga08x19_31888_c1
1547 nmdc:mga0a205_55141_c1
1548 nmdc:mga0a205_90836_c1
1549 nmdc:mga0a205_90895_c1
1550 Ga0495601_0028639
1551 Ga0495612_0065871
1552 Ga0495619_0001988
1553 Ga0495619_0173787
1554 Ga0495619_0459048
1555 Ga0500564_031579
1556 Ga0500616_0001306
1557 Ga0500616_0020473
1558 Ga0501084_0003586
1559 Ga0501084_0033997
1560 Ga0501084_0051857
1561 Ga0501084_0086030
1562 Ga0501084_0117340
1563 Ga0501084_0211927
1564 Ga0501084_0225467
1565 Ga0501084_0340961
1566 Ga0501084_0539632
1567 Ga0501084_0828335
1568 Ga0590071_015101
1569 Ga0590074_022556
1570 Ga0590074_056468
1571 Ga0590075_001579
1572 Ga0590077_030655
1573 Ga0590077_041434
1574 Ga0590077_063160
1575 Ga0501082_0004546
1576 Ga0501082_0035222
1577 Ga0501082_0077902
1578 Ga0501082_0136127
1579 Ga0501082_0282620
1580 Ga0501082_0517242
1581 Ga0501082_0523839
1582 Ga0501082_0610599
1583 Ga0530510_0021868
1584 Ga0530510_0049418
1585 Ga0530510_0062074
1586 Ga0530510_0166140
1587 Ga0530510_0287678
1588 Ga0530510_0602447
1589 Ga0530510_0605310
1590 2857473797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

32

212

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8708 1 187
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8662 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8653 1 187
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8606 1 187
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8385 1 185
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8581 1 187 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8534 1 187 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8197 2 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8155 3 184 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.814 2 191 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A536N3B8-F1-model_v4 Dihydrofolate reductase 0.9886 1 161 GO:0008703
GO:0009231
AF-A0A7J9YUU4-F1-model_v4 Dihydrofolate reductase 0.9884 1 188 GO:0008703
GO:0009231
AF-A0A538J2D1-F1-model_v4 Dihydrofolate reductase 0.9852 33 187 GO:0008703
GO:0009231
AF-A0A3N5K9Y5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9823 50 187 GO:0008703
GO:0009231
AF-A0A536N3B8-F1-model_v4 Dihydrofolate reductase 0.9766 1 161 GO:0008703
GO:0009231

Map