F480732

General Info

Members Datasets Scaffolds Average Seq Length
785 309 1570 77

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_101469255|Ga0068859_1014692552
Length 87
Sequence MIQAQVNERTIMANKYERLPENSPGAYYVDSTCIDCDLCRSSVPEVFSRIAETGSSFVQRQPVTQDEITRVEEVRQACPTDSIGNDG

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
231 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
232 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
233 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
234 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
235 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
236 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
237 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
247 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
248 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
249 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
250 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
251 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
252 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
253 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
254 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
255 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
256 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
257 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
258 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
259 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
260 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
261 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
262 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
263 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
264 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
265 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
266 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
267 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
268 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
269 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
270 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
271 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
272 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
273 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
274 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
275 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
276 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
277 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
278 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
279 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
280 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
281 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
282 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
283 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
284 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
285 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
286 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
287 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
288 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
289 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
290 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
291 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
292 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
293 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
294 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
295 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
298 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
299 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.18
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 15.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_101469255 3300005617 Bacteria 752
2 JGI25406J46586_10094646 3300003203 Bacteria 897
3 rootL2_10190483 3300003322 Bacteria 1169
4 Ga0065714_10002185 3300005288 Bacteria 199213
5 Ga0065714_10431544 3300005288 Bacteria 567
6 Ga0065704_10005451 3300005289 Bacteria 8389
7 Ga0065704_10125357 3300005289 Bacteria 1704
8 Ga0065704_10608349 3300005289 Bacteria 603
9 Ga0065712_10021539 3300005290 Bacteria 1648
10 Ga0065712_10067734 3300005290 Bacteria 110577
11 Ga0065712_10075367 3300005290 Bacteria 3877
12 Ga0065712_10095650 3300005290 Unclassified 2189
13 Ga0065712_10326036 3300005290 Unclassified 821
14 Ga0065712_10337352 3300005290 Bacteria 805
15 Ga0065712_10600750 3300005290 Bacteria 591
16 Ga0065715_10000580 3300005293 Bacteria 11926
17 Ga0065715_10006619 3300005293 Bacteria 5027
18 Ga0065715_10032490 3300005293 Bacteria 1469
19 Ga0065715_10090269 3300005293 Bacteria 7315
20 Ga0065715_10261740 3300005293 Bacteria 1136
21 Ga0065715_10461824 3300005293 Unclassified 815
22 Ga0065715_10506810 3300005293 Bacteria 775
23 Ga0065715_10647861 3300005293 Bacteria 680
24 Ga0065707_10277224 3300005295 Bacteria 1056
25 Ga0065707_10594958 3300005295 Bacteria 693
26 Ga0070676_10105504 3300005328 Bacteria 1747
27 Ga0070690_100055917 3300005330 Bacteria 2528
28 Ga0070690_100064414 3300005330 Bacteria 2368
29 Ga0070690_100077648 3300005330 Bacteria 2168
30 Ga0070690_101193856 3300005330 Bacteria 607
31 Ga0070670_100151225 3300005331 Unclassified 2009
32 Ga0070670_101129887 3300005331 Bacteria 715
33 Ga0068869_100093474 3300005334 Bacteria 2266
34 Ga0068869_100427653 3300005334 Bacteria 1094
35 Ga0068869_100512973 3300005334 Bacteria 1002
36 Ga0068869_101429305 3300005334 Unclassified 613
37 Ga0070680_100001391 3300005336 Bacteria 17468
38 Ga0070682_100006768 3300005337 Bacteria 6429
39 Ga0068868_100133673 3300005338 Unclassified 2032
40 Ga0068868_100572033 3300005338 Bacteria 998
41 Ga0068868_101123723 3300005338 Unclassified 724
42 Ga0068868_101433914 3300005338 Bacteria 645
43 Ga0070660_100847538 3300005339 Bacteria 770
44 Ga0070689_100104531 3300005340 Bacteria 2245
45 Ga0070689_100126369 3300005340 Bacteria 2046
46 Ga0070689_100870601 3300005340 Bacteria 796
47 Ga0070691_10229334 3300005341 Bacteria 987
48 Ga0070687_100079950 3300005343 Bacteria 1781
49 Ga0070687_100165077 3300005343 Bacteria 1313
50 Ga0070687_101313319 3300005343 Bacteria 538
51 Ga0070661_100437671 3300005344 Bacteria 1039
52 Ga0070692_10011475 3300005345 Bacteria 4070
53 Ga0070692_10242482 3300005345 Bacteria 1075
54 Ga0070692_10416762 3300005345 Bacteria 852
55 Ga0070692_10429047 3300005345 Bacteria 841
56 Ga0070692_10890210 3300005345 Bacteria 615
57 Ga0070668_100431089 3300005347 Bacteria 1130
58 Ga0070669_100074228 3300005353 Bacteria 2521
59 Ga0070669_100395666 3300005353 Bacteria 1129
60 Ga0070675_100649630 3300005354 Bacteria 959
61 Ga0070671_100033606 3300005355 Bacteria 4244
62 Ga0070671_100860061 3300005355 Bacteria 791
63 Ga0070673_100008510 3300005364 Bacteria 6824
64 Ga0070673_100443301 3300005364 Bacteria 1167
65 Ga0070673_100543685 3300005364 Bacteria 1055
66 Ga0070673_100574784 3300005364 Bacteria 1026
67 Ga0070673_100588726 3300005364 Bacteria 1014
68 Ga0070673_100641707 3300005364 Bacteria 971
69 Ga0070673_100886709 3300005364 Bacteria 827
70 Ga0070688_100298551 3300005365 Bacteria 1164
71 Ga0070688_100698080 3300005365 Bacteria 786
72 Ga0070659_100493475 3300005366 Bacteria 1043
73 Ga0070659_100546062 3300005366 Unclassified 992
74 Ga0070667_100482851 3300005367 Bacteria 1134
75 Ga0070667_101821053 3300005367 Bacteria 573
76 Ga0070703_10017835 3300005406 Bacteria 2047
77 Ga0070703_10287370 3300005406 Bacteria 681
78 Ga0070709_10079698 3300005434 Bacteria 2134
79 Ga0070701_10102149 3300005438 Unclassified 1590
80 Ga0070701_10112055 3300005438 Bacteria 1526
81 Ga0070701_10188623 3300005438 Bacteria 1212
82 Ga0070705_100021860 3300005440 Bacteria 3408
83 Ga0070705_100109019 3300005440 Bacteria 1765
84 Ga0070705_100142576 3300005440 Bacteria 1579
85 Ga0070705_100256803 3300005440 Bacteria 1230
86 Ga0070705_100725381 3300005440 Bacteria 783
87 Ga0070705_101035959 3300005440 Unclassified 668
88 Ga0070700_100003997 3300005441 Bacteria 7665
89 Ga0070700_100105624 3300005441 Bacteria 1863
90 Ga0070700_100139127 3300005441 Unclassified 1648
91 Ga0070700_100922494 3300005441 Bacteria 712
92 Ga0070700_101220969 3300005441 Bacteria 629
93 Ga0070700_101424369 3300005441 Bacteria 586
94 Ga0070694_100011053 3300005444 Bacteria 5586
95 Ga0070694_100026866 3300005444 Bacteria 3734
96 Ga0070694_100106328 3300005444 Bacteria 1993
97 Ga0070694_100344154 3300005444 Bacteria 1153
98 Ga0070694_100350497 3300005444 Bacteria 1143
99 Ga0070694_100512645 3300005444 Unclassified 956
100 Ga0070694_100925921 3300005444 Bacteria 720
101 Ga0070694_101192393 3300005444 Unclassified 638
102 Ga0070694_101372899 3300005444 Unclassified 596
103 Ga0070708_101181053 3300005445 Bacteria 716
104 Ga0070678_100103428 3300005456 Bacteria 2213
105 Ga0070662_100130240 3300005457 Unclassified 1939
106 Ga0070662_100940111 3300005457 Bacteria 739
107 Ga0070681_10000158 3300005458 Bacteria 52016
108 Ga0070681_10115238 3300005458 Bacteria 2626
109 Ga0070681_10649468 3300005458 Unclassified 970
110 Ga0068867_100063591 3300005459 Bacteria 2743
111 Ga0068867_100375811 3300005459 Bacteria 1192
112 Ga0068867_101837790 3300005459 Bacteria 570
113 Ga0070685_10026412 3300005466 Bacteria 3200
114 Ga0070685_10111281 3300005466 Bacteria 1687
115 Ga0070706_100000001 3300005467 Bacteria 342302
116 Ga0070706_100023731 3300005467 Bacteria 5647
117 Ga0070707_100063545 3300005468 Bacteria 3543
118 Ga0070698_100114111 3300005471 Bacteria 2666
119 Ga0070698_100347409 3300005471 Unclassified 1415
120 Ga0070699_100053617 3300005518 Bacteria 3490
121 Ga0070679_100000173 3300005530 Bacteria 51987
122 Ga0070679_100767707 3300005530 Bacteria 907
123 Ga0070684_102171128 3300005535 Bacteria 524
124 Ga0070697_100448891 3300005536 Bacteria 1123
125 Ga0070697_101069526 3300005536 Bacteria 718
126 Ga0070697_101475106 3300005536 Bacteria 608
127 Ga0068853_100037366 3300005539 Bacteria 4131
128 Ga0068853_100219123 3300005539 Bacteria 1737
129 Ga0068853_100856924 3300005539 Bacteria 872
130 Ga0068853_101526440 3300005539 Bacteria 647
131 Ga0068853_101976209 3300005539 Bacteria 565
132 Ga0070672_100140381 3300005543 Bacteria 1992
133 Ga0070672_101539589 3300005543 Bacteria 596
134 Ga0070686_100011712 3300005544 Bacteria 4982
135 Ga0070686_100835991 3300005544 Bacteria 745
136 Ga0070695_100069244 3300005545 Bacteria 2306
137 Ga0070695_100127620 3300005545 Bacteria 1749
138 Ga0070695_100529343 3300005545 Bacteria 916
139 Ga0070695_100630450 3300005545 Bacteria 844
140 Ga0070695_100933081 3300005545 Bacteria 703
141 Ga0070695_101077739 3300005545 Bacteria 656
142 Ga0070696_100014666 3300005546 Bacteria 5261
143 Ga0070696_100087067 3300005546 Bacteria 2219
144 Ga0070696_100857771 3300005546 Bacteria 751
145 Ga0070693_100012454 3300005547 Bacteria 4303
146 Ga0070693_100018935 3300005547 Bacteria 3602
147 Ga0070693_100073876 3300005547 Bacteria 2015
148 Ga0070693_100111949 3300005547 Bacteria 1680
149 Ga0070693_100157748 3300005547 Bacteria 1443
150 Ga0070693_100531942 3300005547 Unclassified 839
151 Ga0070693_100570251 3300005547 Bacteria 813
152 Ga0070693_100829230 3300005547 Bacteria 688
153 Ga0070704_100030558 3300005549 Bacteria 3611
154 Ga0070704_100073095 3300005549 Bacteria 2497
155 Ga0070704_100091003 3300005549 Unclassified 2274
156 Ga0070704_100243821 3300005549 Bacteria 1472
157 Ga0070704_100691334 3300005549 Bacteria 904
158 Ga0070704_101738303 3300005549 Bacteria 576
159 Ga0070704_102081982 3300005549 Unclassified 527
160 Ga0070704_102198804 3300005549 Unclassified 513
161 Ga0068855_100013341 3300005563 Bacteria 9912
162 Ga0068855_100070853 3300005563 Bacteria 4055
163 Ga0068855_100556635 3300005563 Bacteria 1241
164 Ga0068855_100997854 3300005563 Bacteria 880
165 Ga0068855_101002225 3300005563 Bacteria 878
166 Ga0068855_101260650 3300005563 Bacteria 767
167 Ga0070664_100181916 3300005564 Bacteria 1868
168 Ga0070664_100640165 3300005564 Bacteria 988
169 Ga0070664_101141009 3300005564 Unclassified 735
170 Ga0070664_101615880 3300005564 Unclassified 614
171 Ga0068857_100452114 3300005577 Unclassified 1201
172 Ga0068857_102393065 3300005577 Bacteria 519
173 Ga0068854_100061435 3300005578 Bacteria 2721
174 Ga0068854_100121549 3300005578 Bacteria 1983
175 Ga0068854_100729922 3300005578 Bacteria 857
176 Ga0068854_101005022 3300005578 Bacteria 739
177 Ga0068854_101159841 3300005578 Bacteria 691
178 Ga0068856_100064640 3300005614 Bacteria 3615
179 Ga0070702_100000970 3300005615 Bacteria 11317
180 Ga0070702_100004313 3300005615 Bacteria 6484
181 Ga0070702_100010729 3300005615 Bacteria 4526
182 Ga0070702_100026361 3300005615 Bacteria 3123
183 Ga0070702_100312504 3300005615 Bacteria 1091
184 Ga0070702_100398632 3300005615 Bacteria 984
185 Ga0070702_100868967 3300005615 Bacteria 703
186 Ga0068852_100621980 3300005616 Bacteria 1085
187 Ga0068852_100943555 3300005616 Bacteria 881
188 Ga0068852_101322066 3300005616 Bacteria 743
189 Ga0068859_100030451 3300005617 Bacteria 5415
190 Ga0068859_100036166 3300005617 Bacteria 4957
191 Ga0068859_100044334 3300005617 Bacteria 4469
192 Ga0068859_100151595 3300005617 Bacteria 2394
193 Ga0068859_100156063 3300005617 Bacteria 2359
194 Ga0068859_100339055 3300005617 Bacteria 1597
195 Ga0068859_100420055 3300005617 Bacteria 1433
196 Ga0068859_100605597 3300005617 Bacteria 1188
197 Ga0068859_101136805 3300005617 Bacteria 859
198 Ga0068859_101471741 3300005617 Unclassified 751
199 Ga0068859_101874591 3300005617 Bacteria 662
200 Ga0068859_102153195 3300005617 Bacteria 615
201 Ga0068859_103134441 3300005617 Unclassified 504
202 Ga0068864_100005548 3300005618 Bacteria 10347
203 Ga0068864_100143241 3300005618 Bacteria 2158
204 Ga0068864_100307508 3300005618 Bacteria 1485
205 Ga0068864_100421670 3300005618 Bacteria 1272
206 Ga0068864_101331530 3300005618 Bacteria 719
207 Ga0068864_101711527 3300005618 Unclassified 634
208 Ga0068866_10045645 3300005718 Bacteria 2199
209 Ga0068866_10430944 3300005718 Bacteria 858
210 Ga0068861_100009430 3300005719 Bacteria 6738
211 Ga0068861_100036485 3300005719 Bacteria 3648
212 Ga0068861_100788944 3300005719 Bacteria 890
213 Ga0068861_100936397 3300005719 Bacteria 823
214 Ga0068861_101108652 3300005719 Bacteria 761
215 Ga0068861_101679780 3300005719 Bacteria 627
216 Ga0068861_102697341 3300005719 Bacteria 501
217 Ga0068870_10566687 3300005840 Unclassified 767
218 Ga0068863_100019538 3300005841 Bacteria 6480
219 Ga0068863_100042182 3300005841 Bacteria 4335
220 Ga0068863_100543580 3300005841 Bacteria 1147
221 Ga0068863_101274152 3300005841 Bacteria 742
222 Ga0068863_101510830 3300005841 Bacteria 680
223 Ga0068858_100082289 3300005842 Bacteria 2992
224 Ga0068858_100148631 3300005842 Bacteria 2202
225 Ga0068858_100385753 3300005842 Bacteria 1345
226 Ga0068858_100515718 3300005842 Bacteria 1156
227 Ga0068858_101019042 3300005842 Bacteria 811
228 Ga0068858_101136496 3300005842 Bacteria 767
229 Ga0068860_100013328 3300005843 Bacteria 8059
230 Ga0068860_100016110 3300005843 Bacteria 7293
231 Ga0068860_100027739 3300005843 Bacteria 5453
232 Ga0068860_100332848 3300005843 Bacteria 1492
233 Ga0068860_102022857 3300005843 Unclassified 597
234 Ga0068862_100075144 3300005844 Bacteria 2922
235 Ga0068862_100377990 3300005844 Bacteria 1321
236 Ga0068862_100751747 3300005844 Unclassified 949
237 Ga0068862_101157560 3300005844 Unclassified 770
238 Ga0068862_101326847 3300005844 Bacteria 721
239 Ga0068862_101826134 3300005844 Unclassified 617
240 Ga0068862_101924148 3300005844 Bacteria 601
241 Ga0068862_102478123 3300005844 Unclassified 530
242 Ga0081539_10000413 3300005985 Bacteria 91117
243 Ga0081539_10053113 3300005985 Bacteria 2271
244 Ga0070716_100173835 3300006173 Bacteria 1408
245 Ga0070712_100584267 3300006175 Bacteria 944
246 Ga0097621_100004275 3300006237 Bacteria 9920
247 Ga0097621_100016892 3300006237 Bacteria 5531
248 Ga0068871_100137953 3300006358 Bacteria 2072
249 Ga0068871_100377511 3300006358 Bacteria 1259
250 Ga0068871_100881440 3300006358 Bacteria 829
251 Ga0075428_100701389 3300006844 Bacteria 1078
252 Ga0075428_101236851 3300006844 Bacteria 786
253 Ga0075430_100006164 3300006846 Bacteria 10104
254 Ga0075430_100031137 3300006846 Bacteria 4528
255 Ga0075430_100272764 3300006846 Bacteria 1400
256 Ga0075431_100045420 3300006847 Bacteria 4529
257 Ga0075431_100493356 3300006847 Bacteria 1216
258 Ga0075431_100648834 3300006847 Bacteria 1036
259 Ga0075433_10159005 3300006852 Bacteria 2010
260 Ga0075433_10305343 3300006852 Bacteria 1409
261 Ga0075433_10526771 3300006852 Unclassified 1039
262 Ga0075433_11482946 3300006852 Unclassified 586
263 Ga0075434_100177073 3300006871 Bacteria 2153
264 Ga0075434_100189709 3300006871 Bacteria 2075
265 Ga0075434_100793223 3300006871 Bacteria 963
266 Ga0075429_100344945 3300006880 Bacteria 1304
267 Ga0075429_101893776 3300006880 Unclassified 517
268 Ga0068865_100030752 3300006881 Bacteria 3573
269 Ga0068865_100766480 3300006881 Bacteria 830
270 Ga0068865_102058314 3300006881 Bacteria 519
271 Ga0075436_100038652 3300006914 Bacteria 3294
272 Ga0075436_100185218 3300006914 Bacteria 1472
273 Ga0075436_100436006 3300006914 Bacteria 953
274 Ga0097620_100030450 3300006931 Bacteria 5415
275 Ga0097620_100036169 3300006931 Bacteria 4957
276 Ga0097620_100044335 3300006931 Bacteria 4469
277 Ga0097620_100151591 3300006931 Bacteria 2394
278 Ga0097620_100156070 3300006931 Bacteria 2359
279 Ga0097620_100339028 3300006931 Bacteria 1597
280 Ga0097620_100420074 3300006931 Bacteria 1433
281 Ga0097620_100605610 3300006931 Bacteria 1188
282 Ga0097620_101136835 3300006931 Bacteria 859
283 Ga0097620_101380988 3300006931 Bacteria 777
284 Ga0097620_101468847 3300006931 Bacteria 752
285 Ga0097620_101471736 3300006931 Unclassified 751
286 Ga0097620_101874010 3300006931 Bacteria 662
287 Ga0097620_102153142 3300006931 Bacteria 615
288 Ga0097620_103135261 3300006931 Unclassified 504
289 Ga0075435_100197577 3300007076 Bacteria 1703
290 Ga0075435_100695266 3300007076 Bacteria 884
291 Ga0075435_100942584 3300007076 Unclassified 753
292 Ga0075435_101573431 3300007076 Unclassified 577
293 Ga0099795_10225144 3300007788 Unclassified 800
294 Ga0105251_10392612 3300009011 Bacteria 637
295 Ga0105240_10373947 3300009093 Bacteria 1610
296 Ga0105240_10566053 3300009093 Bacteria 1255
297 Ga0105240_11132593 3300009093 Bacteria 831
298 Ga0105240_11242441 3300009093 Bacteria 787
299 Ga0105240_11484604 3300009093 Bacteria 711
300 Ga0105240_12107083 3300009093 Bacteria 585
301 Ga0111539_10183325 3300009094 Bacteria 2445
302 Ga0111539_11176680 3300009094 Bacteria 891
303 Ga0111539_11410734 3300009094 Bacteria 808
304 Ga0105245_10409603 3300009098 Bacteria 1357
305 Ga0105245_10754156 3300009098 Bacteria 1009
306 Ga0105245_11000783 3300009098 Bacteria 880
307 Ga0105245_11053345 3300009098 Bacteria 859
308 Ga0105245_11208664 3300009098 Bacteria 804
309 Ga0105245_11818622 3300009098 Unclassified 662
310 Ga0105245_12331997 3300009098 Bacteria 589
311 Ga0105247_10003827 3300009101 Bacteria 9742
312 Ga0105247_10168187 3300009101 Bacteria 1456
313 Ga0105247_10459265 3300009101 Bacteria 920
314 Ga0114129_10238648 3300009147 Bacteria 2444
315 Ga0114129_10855339 3300009147 Bacteria 1156
316 Ga0114129_11335788 3300009147 Bacteria 887
317 Ga0105243_10428107 3300009148 Bacteria 1236
318 Ga0105243_11015305 3300009148 Bacteria 833
319 Ga0105243_11493334 3300009148 Bacteria 699
320 Ga0105243_11580461 3300009148 Unclassified 682
321 Ga0105243_12382747 3300009148 Bacteria 567
322 Ga0105241_10079101 3300009174 Bacteria 2570
323 Ga0105241_10357513 3300009174 Bacteria 1270
324 Ga0105241_10365530 3300009174 Bacteria 1257
325 Ga0105241_10608130 3300009174 Bacteria 988
326 Ga0105241_10943782 3300009174 Bacteria 804
327 Ga0105241_11403729 3300009174 Bacteria 669
328 Ga0105242_10077496 3300009176 Unclassified 2773
329 Ga0105242_10909240 3300009176 Bacteria 881
330 Ga0105242_11820013 3300009176 Unclassified 648
331 Ga0105242_12593378 3300009176 Bacteria 556
332 Ga0105248_10027183 3300009177 Bacteria 6364
333 Ga0105248_10107751 3300009177 Bacteria 3142
334 Ga0105248_10140273 3300009177 Bacteria 2727
335 Ga0105248_10236201 3300009177 Bacteria 2058
336 Ga0105248_10275062 3300009177 Bacteria 1896
337 Ga0105248_10477644 3300009177 Bacteria 1405
338 Ga0105248_10843934 3300009177 Bacteria 1034
339 Ga0105248_12043887 3300009177 Bacteria 651
340 Ga0105237_10005164 3300009545 Bacteria 14771
341 Ga0105237_11227846 3300009545 Bacteria 756
342 Ga0105237_11673364 3300009545 Bacteria 643
343 Ga0105238_10008488 3300009551 Bacteria 10285
344 Ga0105238_10024008 3300009551 Bacteria 6217
345 Ga0105238_11357087 3300009551 Bacteria 738
346 Ga0105238_12437857 3300009551 Bacteria 559
347 Ga0105238_12776079 3300009551 Unclassified 526
348 Ga0105249_10047648 3300009553 Bacteria 3906
349 Ga0105249_10086697 3300009553 Bacteria 2920
350 Ga0105249_10223089 3300009553 Bacteria 1855
351 Ga0105249_11390745 3300009553 Bacteria 774
352 Ga0105249_11884541 3300009553 Bacteria 670
353 Ga0105249_12581051 3300009553 Bacteria 580
354 Ga0105239_10918458 3300010375 Bacteria 1005
355 Ga0105239_11918752 3300010375 Unclassified 687
356 Ga0105239_12269472 3300010375 Unclassified 631
357 Ga0105239_12556519 3300010375 Bacteria 595
358 Ga0105239_13036012 3300010375 Bacteria 547
359 Ga0105246_10062867 3300011119 Bacteria 2587
360 Ga0105246_10140948 3300011119 Bacteria 1813
361 Ga0105246_10186148 3300011119 Bacteria 1603
362 Ga0105246_10323071 3300011119 Bacteria 1255
363 Ga0105246_11209804 3300011119 Bacteria 696
364 Ga0105246_11528297 3300011119 Unclassified 628
365 Ga0157373_10018081 3300013100 Bacteria 5133
366 Ga0157373_10340307 3300013100 Bacteria 1069
367 Ga0157373_10426524 3300013100 Bacteria 952
368 Ga0157371_10589551 3300013102 Bacteria 826
369 Ga0157371_11134546 3300013102 Bacteria 600
370 Ga0157369_12558420 3300013105 Unclassified 516
371 Ga0157374_10943800 3300013296 Unclassified 881
372 Ga0157378_10630324 3300013297 Bacteria 1086
373 Ga0157378_10823724 3300013297 Bacteria 955
374 Ga0157378_11194395 3300013297 Unclassified 800
375 Ga0157378_11231643 3300013297 Bacteria 788
376 Ga0157378_11491291 3300013297 Bacteria 721
377 Ga0163162_10028725 3300013306 Bacteria 5505
378 Ga0163162_10042724 3300013306 Bacteria 4538
379 Ga0163162_10235478 3300013306 Bacteria 1961
380 Ga0163162_10331135 3300013306 Bacteria 1655
381 Ga0163162_10825831 3300013306 Unclassified 1043
382 Ga0163162_13241678 3300013306 Unclassified 522
383 Ga0157372_10004597 3300013307 Bacteria 14670
384 Ga0157372_10471873 3300013307 Bacteria 1463
385 Ga0157372_10509849 3300013307 Bacteria 1402
386 Ga0157372_10539984 3300013307 Bacteria 1359
387 Ga0157372_10549498 3300013307 Bacteria 1346
388 Ga0157372_11380923 3300013307 Bacteria 812
389 Ga0157372_11981229 3300013307 Unclassified 669
390 Ga0157372_13399601 3300013307 Bacteria 506
391 Ga0157375_10332298 3300013308 Bacteria 1685
392 Ga0157375_10559855 3300013308 Bacteria 1304
393 Ga0157375_10613708 3300013308 Bacteria 1246
394 Ga0157375_11082751 3300013308 Bacteria 938
395 Ga0157375_12757674 3300013308 Bacteria 587
396 Ga0163163_10084131 3300014325 Bacteria 3187
397 Ga0163163_10471268 3300014325 Unclassified 1316
398 Ga0163163_11103055 3300014325 Unclassified 856
399 Ga0163163_11737404 3300014325 Bacteria 684
400 Ga0163163_12833429 3300014325 Bacteria 541
401 Ga0157380_10001847 3300014326 Bacteria 13998
402 Ga0157380_10021382 3300014326 Bacteria 4852
403 Ga0157380_10912546 3300014326 Bacteria 905
404 Ga0157380_12570670 3300014326 Unclassified 575
405 Ga0157380_12726457 3300014326 Bacteria 561
406 Ga0157377_10815893 3300014745 Unclassified 689
407 Ga0157379_10176941 3300014968 Bacteria 1927
408 Ga0157379_10178177 3300014968 Bacteria 1920
409 Ga0157379_10671024 3300014968 Bacteria 972
410 Ga0157379_10772546 3300014968 Bacteria 905
411 Ga0157379_12387069 3300014968 Unclassified 528
412 Ga0182007_10296205 3300015262 Bacteria 593
413 Ga0163161_10114948 3300017792 Bacteria 2016
414 Ga0207697_10011576 3300025315 Bacteria 3728
415 Ga0207656_10049763 3300025321 Bacteria 1808
416 Ga0207696_1151715 3300025711 Bacteria 618
417 Ga0207682_10280226 3300025893 Unclassified 779
418 Ga0207710_10000541 3300025900 Bacteria 22847
419 Ga0207688_10112630 3300025901 Bacteria 1581
420 Ga0207647_10003749 3300025904 Bacteria 11360
421 Ga0207647_10133922 3300025904 Bacteria 1455
422 Ga0207647_10384166 3300025904 Bacteria 792
423 Ga0207645_10209118 3300025907 Bacteria 1285
424 Ga0207645_10799869 3300025907 Unclassified 641
425 Ga0207643_10056452 3300025908 Bacteria 2234
426 Ga0207643_10198396 3300025908 Bacteria 1221
427 Ga0207643_10199042 3300025908 Bacteria 1219
428 Ga0207643_10787535 3300025908 Unclassified 616
429 Ga0207684_10000030 3300025910 Bacteria 300037
430 Ga0207684_10377591 3300025910 Bacteria 1219
431 Ga0207654_10248837 3300025911 Bacteria 1191
432 Ga0207654_10394522 3300025911 Bacteria 961
433 Ga0207707_10177470 3300025912 Bacteria 1860
434 Ga0207695_10328137 3300025913 Bacteria 1419
435 Ga0207695_10602394 3300025913 Bacteria 980
436 Ga0207671_10003070 3300025914 Bacteria 17063
437 Ga0207671_10098464 3300025914 Bacteria 2212
438 Ga0207671_10499574 3300025914 Bacteria 970
439 Ga0207693_10381247 3300025915 Bacteria 1103
440 Ga0207660_10602576 3300025917 Unclassified 895
441 Ga0207662_10084922 3300025918 Bacteria 1938
442 Ga0207662_10156129 3300025918 Bacteria 1455
443 Ga0207662_11030961 3300025918 Bacteria 584
444 Ga0207662_11271666 3300025918 Bacteria 523
445 Ga0207657_10457155 3300025919 Bacteria 1002
446 Ga0207652_11076021 3300025921 Bacteria 704
447 Ga0207681_10059745 3300025923 Bacteria 2614
448 Ga0207681_11258312 3300025923 Unclassified 621
449 Ga0207681_11591398 3300025923 Bacteria 547
450 Ga0207694_10006884 3300025924 Bacteria 8635
451 Ga0207694_10011554 3300025924 Bacteria 6661
452 Ga0207694_11187050 3300025924 Bacteria 646
453 Ga0207650_10109832 3300025925 Bacteria 2133
454 Ga0207650_10814130 3300025925 Bacteria 792
455 Ga0207650_11410157 3300025925 Unclassified 593
456 Ga0207650_11681315 3300025925 Bacteria 538
457 Ga0207659_10390075 3300025926 Bacteria 1163
458 Ga0207659_10895181 3300025926 Bacteria 763
459 Ga0207687_11027741 3300025927 Bacteria 707
460 Ga0207687_11847549 3300025927 Bacteria 517
461 Ga0207644_10291642 3300025931 Bacteria 1312
462 Ga0207644_10417629 3300025931 Bacteria 1099
463 Ga0207690_10558546 3300025932 Bacteria 931
464 Ga0207706_10410203 3300025933 Bacteria 1174
465 Ga0207706_10410576 3300025933 Bacteria 1173
466 Ga0207686_10056025 3300025934 Bacteria 2476
467 Ga0207686_10735928 3300025934 Bacteria 786
468 Ga0207709_10205384 3300025935 Bacteria 1410
469 Ga0207709_10488346 3300025935 Unclassified 959
470 Ga0207709_10950106 3300025935 Bacteria 701
471 Ga0207709_11275517 3300025935 Unclassified 607
472 Ga0207670_10013945 3300025936 Bacteria 4757
473 Ga0207670_10595578 3300025936 Unclassified 907
474 Ga0207670_11002448 3300025936 Bacteria 703
475 Ga0207670_11566411 3300025936 Unclassified 560
476 Ga0207669_10150880 3300025937 Bacteria 1628
477 Ga0207704_10234701 3300025938 Unclassified 1366
478 Ga0207665_10034981 3300025939 Bacteria 3333
479 Ga0207665_10212156 3300025939 Bacteria 1415
480 Ga0207691_10103800 3300025940 Bacteria 2534
481 Ga0207691_10433971 3300025940 Bacteria 1119
482 Ga0207711_10120498 3300025941 Bacteria 2342
483 Ga0207711_10132784 3300025941 Bacteria 2233
484 Ga0207711_10200579 3300025941 Unclassified 1820
485 Ga0207711_10302827 3300025941 Bacteria 1474
486 Ga0207711_10562237 3300025941 Bacteria 1064
487 Ga0207711_10821033 3300025941 Bacteria 866
488 Ga0207711_11782887 3300025941 Unclassified 559
489 Ga0207689_10161715 3300025942 Bacteria 1845
490 Ga0207689_10189162 3300025942 Bacteria 1698
491 Ga0207689_10438054 3300025942 Bacteria 1091
492 Ga0207689_10527144 3300025942 Bacteria 991
493 Ga0207689_10608896 3300025942 Bacteria 919
494 Ga0207661_10497863 3300025944 Bacteria 1113
495 Ga0207679_10466183 3300025945 Bacteria 1122
496 Ga0207667_10003711 3300025949 Bacteria 18839
497 Ga0207667_10052050 3300025949 Bacteria 4315
498 Ga0207667_10382935 3300025949 Bacteria 1433
499 Ga0207667_11435937 3300025949 Unclassified 663
500 Ga0207667_11545640 3300025949 Bacteria 633
501 Ga0207651_10374269 3300025960 Bacteria 1206
502 Ga0207651_10426470 3300025960 Bacteria 1133
503 Ga0207651_10579299 3300025960 Bacteria 979
504 Ga0207651_10714450 3300025960 Bacteria 884
505 Ga0207651_10736940 3300025960 Bacteria 870
506 Ga0207712_10015444 3300025961 Bacteria 4927
507 Ga0207712_10259996 3300025961 Bacteria 1407
508 Ga0207712_10345984 3300025961 Bacteria 1234
509 Ga0207712_10848112 3300025961 Bacteria 805
510 Ga0207712_11660714 3300025961 Unclassified 573
511 Ga0207640_10110192 3300025981 Bacteria 1949
512 Ga0207640_10132056 3300025981 Bacteria 1807
513 Ga0207640_10471710 3300025981 Bacteria 1039
514 Ga0207640_10737666 3300025981 Unclassified 848
515 Ga0207658_10088704 3300025986 Bacteria 2392
516 Ga0207677_10331159 3300026023 Bacteria 1269
517 Ga0207677_11867028 3300026023 Unclassified 558
518 Ga0207703_10125846 3300026035 Bacteria 2206
519 Ga0207703_10210256 3300026035 Bacteria 1734
520 Ga0207703_10275417 3300026035 Bacteria 1526
521 Ga0207703_10347318 3300026035 Bacteria 1365
522 Ga0207703_10454768 3300026035 Bacteria 1196
523 Ga0207639_10011788 3300026041 Bacteria 6079
524 Ga0207639_10140735 3300026041 Bacteria 2010
525 Ga0207639_10240569 3300026041 Bacteria 1573
526 Ga0207639_11246026 3300026041 Bacteria 698
527 Ga0207708_10002753 3300026075 Bacteria 12916
528 Ga0207708_10015737 3300026075 Bacteria 5675
529 Ga0207708_10155402 3300026075 Bacteria 1804
530 Ga0207708_10183469 3300026075 Bacteria 1662
531 Ga0207708_11013498 3300026075 Bacteria 722
532 Ga0207708_11214469 3300026075 Bacteria 659
533 Ga0207708_12040817 3300026075 Bacteria 502
534 Ga0207702_10046815 3300026078 Bacteria 3642
535 Ga0207641_10148781 3300026088 Bacteria 2119
536 Ga0207641_10527196 3300026088 Bacteria 1150
537 Ga0207641_10934896 3300026088 Unclassified 862
538 Ga0207641_11133093 3300026088 Bacteria 781
539 Ga0207648_10752222 3300026089 Unclassified 905
540 Ga0207648_11601163 3300026089 Unclassified 612
541 Ga0207648_12266682 3300026089 Bacteria 504
542 Ga0207676_10312654 3300026095 Bacteria 1439
543 Ga0207676_10413361 3300026095 Bacteria 1263
544 Ga0207676_11748454 3300026095 Unclassified 620
545 Ga0207676_11853423 3300026095 Bacteria 602
546 Ga0207674_10126653 3300026116 Bacteria 2520
547 Ga0207674_10230736 3300026116 Bacteria 1798
548 Ga0207675_100061930 3300026118 Bacteria 3493
549 Ga0207675_100104677 3300026118 Bacteria 2667
550 Ga0207675_100816713 3300026118 Bacteria 946
551 Ga0207675_101331594 3300026118 Unclassified 739
552 Ga0207675_102120353 3300026118 Bacteria 578
553 Ga0207698_10361656 3300026142 Bacteria 1374
554 Ga0207698_11046134 3300026142 Bacteria 828
555 Ga0268265_10034182 3300028380 Bacteria 3703
556 Ga0268265_10173863 3300028380 Bacteria 1844
557 Ga0268265_10670306 3300028380 Bacteria 999
558 Ga0268265_12518458 3300028380 Unclassified 520
559 Ga0268264_10023534 3300028381 Bacteria 5023
560 Ga0268264_10064434 3300028381 Bacteria 3084
561 Ga0268264_10069701 3300028381 Bacteria 2975
562 Ga0268264_10173857 3300028381 Bacteria 1950
563 Ga0268264_10932392 3300028381 Bacteria 873
564 Ga0268264_11304245 3300028381 Bacteria 736
565 Ga0265319_1181683 3300028563 Unclassified 648
566 Ga0265318_10245436 3300028577 Unclassified 653
567 Ga0314311_1196721 3300030733 Bacteria 858
568 Ga0316182_1067558 3300030745 Bacteria 574
569 Ga0265320_10113549 3300031240 Unclassified 1239
570 Ga0307408_100081350 3300031548 Bacteria 2421
571 Ga0307408_102395285 3300031548 Bacteria 512
572 Ga0316575_10133153 3300031665 Bacteria 1020
573 Ga0307405_10015829 3300031731 Bacteria 4095
574 Ga0307405_11380737 3300031731 Bacteria 615
575 Ga0307413_10020880 3300031824 Bacteria 3494
576 Ga0307413_10637828 3300031824 Unclassified 877
577 Ga0307410_10173378 3300031852 Bacteria 1627
578 Ga0307406_10015258 3300031901 Bacteria 4441
579 Ga0307406_10325260 3300031901 Bacteria 1191
580 Ga0307407_10020826 3300031903 Bacteria 3368
581 Ga0307412_10001035 3300031911 Bacteria 15896
582 Ga0307412_10991535 3300031911 Unclassified 742
583 Ga0307409_102133664 3300031995 Unclassified 590
584 Ga0307416_100050329 3300032002 Bacteria 3320
585 Ga0307416_101387842 3300032002 Bacteria 808
586 Ga0307416_101538477 3300032002 Bacteria 771
587 Ga0307414_10015725 3300032004 Bacteria 4576
588 Ga0307414_10916107 3300032004 Bacteria 804
589 Ga0307411_10352583 3300032005 Bacteria 1200
590 Ga0307415_100000545 3300032126 Bacteria 16479
591 Ga0373949_0284868 3300035090 Unclassified 520
592 Ga0373951_0000927 3300035091 Bacteria 7899
593 Ga0373951_0041589 3300035091 Bacteria 1110
594 Ga0373951_0284492 3300035091 Unclassified 506
595 Ga0373923_0591908 3300035111 Bacteria 546
596 Ga0373941_0204865 3300035115 Bacteria 751
597 Ga0373960_0264933 3300035121 Bacteria 629
598 Ga0373942_0004403 3300035207 Bacteria 3273
599 Ga0373942_0032533 3300035207 Bacteria 1386
600 Ga0373961_0052379 3300035241 Bacteria 1215
601 Ga0373962_0237979 3300035242 Bacteria 628
602 Ga0373962_0273140 3300035242 Unclassified 593
603 Ga0373931_0043674 3300035691 Bacteria 2362
604 Ga0373931_0596343 3300035691 Bacteria 722
605 Ga0373947_1084884 3300035725 Unclassified 546
606 Ga0373937_1578592 3300036401 Unclassified 603
607 Ga0395900_1030068 3300037418 Unclassified 742
608 Ga0395898_0383604 3300037466 Unclassified 1340
609 Ga0395905_0000015 3300037471 Bacteria 393880
610 Ga0395905_0582720 3300037471 Unclassified 1020
611 Ga0395901_0098906 3300038443 Bacteria 3059
612 Ga0395901_0276770 3300038443 Unclassified 1745
613 Ga0242419_010752 3300038698 Bacteria 702
614 Ga0436361_0196373 3300039447 Bacteria 667
615 Ga0439455_0140308 3300042012 Bacteria 684
616 Ga0439458_0000936 3300042157 Bacteria 7512
617 Ga0451577_0062783 3300042876 Unclassified 3313
618 Ga0439440_0293719 3300042993 Unclassified 505
619 Ga0453683_0000298 3300044673 Bacteria 63091
620 Ga0453683_0012885 3300044673 Bacteria 5469
621 Ga0453683_0043401 3300044673 Bacteria 2822
622 Ga0453683_0465782 3300044673 Unclassified 818
623 Ga0453683_0618773 3300044673 Bacteria 707
624 Ga0453683_0787513 3300044673 Bacteria 626
625 Ga0453684_0000295 3300044712 Bacteria 211570
626 Ga0453684_0432095 3300044712 Unclassified 1469
627 Ga0451576_0005894 3300045051 Bacteria 15208
628 Ga0451576_0543913 3300045051 Bacteria 1220
629 Ga0451576_0545242 3300045051 Bacteria 1218
630 Ga0451576_0787292 3300045051 Bacteria 999
631 Ga0495628_0859045 3300046516 Unclassified 632
632 Ga0495658_0006690 3300046683 Bacteria 5667
633 Ga0496101_1148220 3300048904 Bacteria 609
634 Ga0496102_0054812 3300048905 Bacteria 3636
635 Ga0496102_0328498 3300048905 Bacteria 1441
636 Ga0496102_0440511 3300048905 Bacteria 1223
637 Ga0496103_0165328 3300048906 Bacteria 1420
638 Ga0496104_0308605 3300048907 Bacteria 1495
639 Ga0496106_0007213 3300048909 Bacteria 8211
640 Ga0496107_0912025 3300048910 Bacteria 640
641 Ga0496108_0022553 3300048911 Bacteria 5177
642 Ga0496108_0228460 3300048911 Bacteria 1618
643 Ga0496108_0777070 3300048911 Bacteria 827
644 Ga0496108_1617959 3300048911 Unclassified 535
645 Ga0496109_0131107 3300048912 Bacteria 2340
646 Ga0496110_1566018 3300048913 Unclassified 569
647 Ga0496111_0218511 3300048914 Bacteria 1416
648 Ga0496112_0188919 3300048915 Bacteria 2023
649 Ga0496112_0332843 3300048915 Bacteria 1462
650 Ga0496112_0342152 3300048915 Bacteria 1439
651 Ga0496112_0379433 3300048915 Bacteria 1355
652 Ga0496112_0556949 3300048915 Bacteria 1080
653 Ga0496112_0600287 3300048915 Bacteria 1033
654 Ga0496112_1176543 3300048915 Bacteria 684
655 Ga0496113_0528087 3300048916 Unclassified 947
656 Ga0496113_0919622 3300048916 Unclassified 691
657 Ga0496115_0701334 3300048918 Bacteria 796
658 Ga0496126_0313155 3300048929 Bacteria 1292
659 Ga0501291_003484 3300049514 Bacteria 1958
660 Ga0501291_016528 3300049514 Bacteria 1128
661 Ga0501292_015577 3300049515 Bacteria 1190
662 Ga0501295_070896 3300049518 Bacteria 779
663 Ga0501295_165978 3300049518 Bacteria 550
664 Ga0501296_004564 3300049519 Bacteria 1515
665 Ga0501297_032695 3300049520 Unclassified 700
666 Ga0501298_006839 3300049521 Bacteria 1877
667 Ga0501298_054771 3300049521 Unclassified 834
668 Ga0501298_122897 3300049521 Bacteria 613
669 Ga0501299_004228 3300049522 Bacteria 2132
670 Ga0501300_064921 3300049523 Bacteria 583
671 Ga0501033_0152060 3300049570 Bacteria 1669
672 Ga0501034_0350802 3300049571 Bacteria 1404
673 Ga0501037_0601890 3300049573 Unclassified 738
674 Ga0501038_0006694 3300049574 Bacteria 10652
675 Ga0501047_0880504 3300049581 Bacteria 709
676 Ga0501048_1405585 3300049582 Unclassified 502
677 Ga0501070_0216651 3300049586 Bacteria 1571
678 Ga0501070_0248376 3300049586 Bacteria 1456
679 Ga0501072_1011998 3300049588 Unclassified 648
680 Ga0501198_003243 3300049649 Bacteria 2218
681 Ga0501198_015520 3300049649 Bacteria 1170
682 Ga0501198_126004 3300049649 Bacteria 544
683 Ga0501199_008977 3300049650 Bacteria 1053
684 Ga0501201_004866 3300049651 Bacteria 1250
685 Ga0501202_015313 3300049652 Bacteria 1476
686 Ga0501206_016014 3300049653 Bacteria 1041
687 Ga0501207_041347 3300049654 Bacteria 802
688 Ga0501208_004600 3300049655 Bacteria 1637
689 Ga0501209_009980 3300049656 Bacteria 1936
690 Ga0501209_152768 3300049656 Bacteria 696
691 Ga0501211_021876 3300049658 Unclassified 676
692 Ga0501214_001479 3300049659 Bacteria 1840
693 Ga0501216_007452 3300049660 Bacteria 1704
694 Ga0501217_016415 3300049661 Bacteria 1696
695 Ga0501217_078919 3300049661 Bacteria 908
696 Ga0501222_022702 3300049662 Bacteria 845
697 Ga0501223_008341 3300049663 Bacteria 2112
698 Ga0501223_022138 3300049663 Bacteria 1242
699 Ga0501224_003803 3300049664 Bacteria 2124
700 Ga0501224_005090 3300049664 Bacteria 1875
701 Ga0501227_000153 3300049665 Bacteria 12914
702 Ga0501227_027902 3300049665 Bacteria 1338
703 Ga0501228_067084 3300049666 Unclassified 518
704 Ga0501230_003507 3300049667 Bacteria 2091
705 Ga0501230_104171 3300049667 Unclassified 615
706 Ga0501230_165716 3300049667 Bacteria 506
707 Ga0501233_004100 3300049668 Bacteria 2653
708 Ga0501233_058590 3300049668 Bacteria 950
709 Ga0501235_005030 3300049669 Bacteria 2868
710 Ga0501236_007000 3300049670 Bacteria 1399
711 Ga0501240_094952 3300049673 Bacteria 568
712 Ga0501240_108866 3300049673 Bacteria 539
713 Ga0501243_000499 3300049675 Bacteria 5201
714 Ga0501243_009452 3300049675 Bacteria 1516
715 Ga0501243_012717 3300049675 Bacteria 1331
716 Ga0501243_013060 3300049675 Bacteria 1315
717 Ga0501247_008177 3300049677 Bacteria 1216
718 Ga0501249_029220 3300049679 Bacteria 1225
719 Ga0501249_039512 3300049679 Bacteria 1067
720 Ga0501250_029335 3300049680 Bacteria 756
721 Ga0501250_108395 3300049680 Unclassified 502
722 Ga0501251_090489 3300049681 Bacteria 548
723 Ga0501252_005868 3300049682 Bacteria 1349
724 Ga0501253_011633 3300049683 Unclassified 1358
725 Ga0501257_033499 3300049686 Bacteria 1245
726 Ga0501257_064363 3300049686 Bacteria 930
727 Ga0501257_191932 3300049686 Bacteria 583
728 Ga0501259_004033 3300049688 Bacteria 2334
729 Ga0501260_026630 3300049689 Unclassified 649
730 Ga0501261_015544 3300049690 Bacteria 1050
731 Ga0501221_004274 3300049704 Bacteria 2367
732 Ga0501221_017835 3300049704 Bacteria 1360
733 Ga0501221_174922 3300049704 Unclassified 583
734 Ga0501225_0004984 3300049705 Bacteria 3924
735 Ga0501225_0030827 3300049705 Bacteria 1475
736 Ga0501229_004854 3300049706 Bacteria 1639
737 Ga0501229_033876 3300049706 Unclassified 709
738 Ga0501234_005166 3300049707 Bacteria 2043
739 Ga0501245_080319 3300049708 Unclassified 629
740 Ga0501241_047501 3300049758 Bacteria 842
741 Ga0501241_083120 3300049758 Bacteria 669
742 Ga0501262_015769 3300049759 Bacteria 995
743 Ga0501262_016354 3300049759 Bacteria 981
744 Ga0501264_026391 3300049761 Bacteria 645
745 Ga0501264_048688 3300049761 Bacteria 541
746 Ga0501265_039090 3300049762 Bacteria 711
747 Ga0501268_077728 3300049765 Bacteria 681
748 Ga0501270_015643 3300049767 Bacteria 1086
749 Ga0501272_069461 3300049769 Unclassified 513
750 Ga0501273_044135 3300049770 Bacteria 667
751 Ga0501278_007065 3300049774 Unclassified 849
752 Ga0501279_036694 3300049775 Bacteria 741
753 Ga0501280_056381 3300049776 Unclassified 673
754 Ga0501283_001249 3300049779 Bacteria 3351
755 Ga0501283_018577 3300049779 Bacteria 1095
756 Ga0501044_0047277 3300049823 Bacteria 4451
757 Ga0501200_04943 3300049849 Bacteria 624
758 Ga0501212_005293 3300049851 Bacteria 1698
759 Ga0501212_008305 3300049851 Bacteria 1442
760 Ga0501212_020715 3300049851 Bacteria 1015
761 Ga0501212_021567 3300049851 Bacteria 1000
762 Ga0501226_001370 3300049853 Bacteria 3148
763 nmdc:mga05p37_108111_c1 3300050507 Bacteria 3421
764 nmdc:mga05p37_1848222_c1 3300050507 Bacteria 580
765 nmdc:mga05p37_548864_c1 3300050507 Bacteria 1316
766 nmdc:mga09592_312899_c1 3300050508 Bacteria 1361
767 nmdc:mga09592_92917_c1 3300050508 Bacteria 2579
768 nmdc:mga0qj67_122944_c1 3300050509 Bacteria 2100
769 nmdc:mga0qj67_569626_c1 3300050509 Bacteria 908
770 nmdc:mga06r32_355725_c1 3300050510 Bacteria 1449
771 nmdc:mga06r32_592444_c1 3300050510 Bacteria 1080
772 nmdc:mga08y16_42627_c1 3300050511 Bacteria 4752
773 nmdc:mga08y16_603769_c1 3300050511 Bacteria 1106
774 nmdc:mga08y16_861755_c1 3300050511 Bacteria 894
775 nmdc:mga0n895_116774_c1 3300050512 Bacteria 2687
776 nmdc:mga0n895_382160_c1 3300050512 Bacteria 1425
777 nmdc:mga0n895_764717_c1 3300050512 Bacteria 958
778 nmdc:mga0rr50_114293_c1 3300050513 Bacteria 2140
779 nmdc:mga0rr50_14012_c1 3300050513 Bacteria 5242
780 nmdc:mga0rr50_175150_c1 3300050513 Bacteria 1750
781 nmdc:mga08x19_33485_c1 3300050514 Bacteria 3243
782 nmdc:mga08x19_707947_c1 3300050514 Bacteria 715
783 nmdc:mga0a205_235925_c1 3300050515 Bacteria 1711
784 nmdc:mga0a205_53715_c1 3300050515 Bacteria 3889
785 Ga0495619_0609837 3300053085 Unclassified 746
786 Ga0068859_101469255
787 JGI25406J46586_10094646
788 rootL2_10190483
789 Ga0065714_10002185
790 Ga0065714_10431544
791 Ga0065704_10005451
792 Ga0065704_10125357
793 Ga0065704_10608349
794 Ga0065712_10021539
795 Ga0065712_10067734
796 Ga0065712_10075367
797 Ga0065712_10095650
798 Ga0065712_10326036
799 Ga0065712_10337352
800 Ga0065712_10600750
801 Ga0065715_10000580
802 Ga0065715_10006619
803 Ga0065715_10032490
804 Ga0065715_10090269
805 Ga0065715_10261740
806 Ga0065715_10461824
807 Ga0065715_10506810
808 Ga0065715_10647861
809 Ga0065707_10277224
810 Ga0065707_10594958
811 Ga0070676_10105504
812 Ga0070690_100055917
813 Ga0070690_100064414
814 Ga0070690_100077648
815 Ga0070690_101193856
816 Ga0070670_100151225
817 Ga0070670_101129887
818 Ga0068869_100093474
819 Ga0068869_100427653
820 Ga0068869_100512973
821 Ga0068869_101429305
822 Ga0070680_100001391
823 Ga0070682_100006768
824 Ga0068868_100133673
825 Ga0068868_100572033
826 Ga0068868_101123723
827 Ga0068868_101433914
828 Ga0070660_100847538
829 Ga0070689_100104531
830 Ga0070689_100126369
831 Ga0070689_100870601
832 Ga0070691_10229334
833 Ga0070687_100079950
834 Ga0070687_100165077
835 Ga0070687_101313319
836 Ga0070661_100437671
837 Ga0070692_10011475
838 Ga0070692_10242482
839 Ga0070692_10416762
840 Ga0070692_10429047
841 Ga0070692_10890210
842 Ga0070668_100431089
843 Ga0070669_100074228
844 Ga0070669_100395666
845 Ga0070675_100649630
846 Ga0070671_100033606
847 Ga0070671_100860061
848 Ga0070673_100008510
849 Ga0070673_100443301
850 Ga0070673_100543685
851 Ga0070673_100574784
852 Ga0070673_100588726
853 Ga0070673_100641707
854 Ga0070673_100886709
855 Ga0070688_100298551
856 Ga0070688_100698080
857 Ga0070659_100493475
858 Ga0070659_100546062
859 Ga0070667_100482851
860 Ga0070667_101821053
861 Ga0070703_10017835
862 Ga0070703_10287370
863 Ga0070709_10079698
864 Ga0070701_10102149
865 Ga0070701_10112055
866 Ga0070701_10188623
867 Ga0070705_100021860
868 Ga0070705_100109019
869 Ga0070705_100142576
870 Ga0070705_100256803
871 Ga0070705_100725381
872 Ga0070705_101035959
873 Ga0070700_100003997
874 Ga0070700_100105624
875 Ga0070700_100139127
876 Ga0070700_100922494
877 Ga0070700_101220969
878 Ga0070700_101424369
879 Ga0070694_100011053
880 Ga0070694_100026866
881 Ga0070694_100106328
882 Ga0070694_100344154
883 Ga0070694_100350497
884 Ga0070694_100512645
885 Ga0070694_100925921
886 Ga0070694_101192393
887 Ga0070694_101372899
888 Ga0070708_101181053
889 Ga0070678_100103428
890 Ga0070662_100130240
891 Ga0070662_100940111
892 Ga0070681_10000158
893 Ga0070681_10115238
894 Ga0070681_10649468
895 Ga0068867_100063591
896 Ga0068867_100375811
897 Ga0068867_101837790
898 Ga0070685_10026412
899 Ga0070685_10111281
900 Ga0070706_100000001
901 Ga0070706_100023731
902 Ga0070707_100063545
903 Ga0070698_100114111
904 Ga0070698_100347409
905 Ga0070699_100053617
906 Ga0070679_100000173
907 Ga0070679_100767707
908 Ga0070684_102171128
909 Ga0070697_100448891
910 Ga0070697_101069526
911 Ga0070697_101475106
912 Ga0068853_100037366
913 Ga0068853_100219123
914 Ga0068853_100856924
915 Ga0068853_101526440
916 Ga0068853_101976209
917 Ga0070672_100140381
918 Ga0070672_101539589
919 Ga0070686_100011712
920 Ga0070686_100835991
921 Ga0070695_100069244
922 Ga0070695_100127620
923 Ga0070695_100529343
924 Ga0070695_100630450
925 Ga0070695_100933081
926 Ga0070695_101077739
927 Ga0070696_100014666
928 Ga0070696_100087067
929 Ga0070696_100857771
930 Ga0070693_100012454
931 Ga0070693_100018935
932 Ga0070693_100073876
933 Ga0070693_100111949
934 Ga0070693_100157748
935 Ga0070693_100531942
936 Ga0070693_100570251
937 Ga0070693_100829230
938 Ga0070704_100030558
939 Ga0070704_100073095
940 Ga0070704_100091003
941 Ga0070704_100243821
942 Ga0070704_100691334
943 Ga0070704_101738303
944 Ga0070704_102081982
945 Ga0070704_102198804
946 Ga0068855_100013341
947 Ga0068855_100070853
948 Ga0068855_100556635
949 Ga0068855_100997854
950 Ga0068855_101002225
951 Ga0068855_101260650
952 Ga0070664_100181916
953 Ga0070664_100640165
954 Ga0070664_101141009
955 Ga0070664_101615880
956 Ga0068857_100452114
957 Ga0068857_102393065
958 Ga0068854_100061435
959 Ga0068854_100121549
960 Ga0068854_100729922
961 Ga0068854_101005022
962 Ga0068854_101159841
963 Ga0068856_100064640
964 Ga0070702_100000970
965 Ga0070702_100004313
966 Ga0070702_100010729
967 Ga0070702_100026361
968 Ga0070702_100312504
969 Ga0070702_100398632
970 Ga0070702_100868967
971 Ga0068852_100621980
972 Ga0068852_100943555
973 Ga0068852_101322066
974 Ga0068859_100030451
975 Ga0068859_100036166
976 Ga0068859_100044334
977 Ga0068859_100151595
978 Ga0068859_100156063
979 Ga0068859_100339055
980 Ga0068859_100420055
981 Ga0068859_100605597
982 Ga0068859_101136805
983 Ga0068859_101471741
984 Ga0068859_101874591
985 Ga0068859_102153195
986 Ga0068859_103134441
987 Ga0068864_100005548
988 Ga0068864_100143241
989 Ga0068864_100307508
990 Ga0068864_100421670
991 Ga0068864_101331530
992 Ga0068864_101711527
993 Ga0068866_10045645
994 Ga0068866_10430944
995 Ga0068861_100009430
996 Ga0068861_100036485
997 Ga0068861_100788944
998 Ga0068861_100936397
999 Ga0068861_101108652
1000 Ga0068861_101679780
1001 Ga0068861_102697341
1002 Ga0068870_10566687
1003 Ga0068863_100019538
1004 Ga0068863_100042182
1005 Ga0068863_100543580
1006 Ga0068863_101274152
1007 Ga0068863_101510830
1008 Ga0068858_100082289
1009 Ga0068858_100148631
1010 Ga0068858_100385753
1011 Ga0068858_100515718
1012 Ga0068858_101019042
1013 Ga0068858_101136496
1014 Ga0068860_100013328
1015 Ga0068860_100016110
1016 Ga0068860_100027739
1017 Ga0068860_100332848
1018 Ga0068860_102022857
1019 Ga0068862_100075144
1020 Ga0068862_100377990
1021 Ga0068862_100751747
1022 Ga0068862_101157560
1023 Ga0068862_101326847
1024 Ga0068862_101826134
1025 Ga0068862_101924148
1026 Ga0068862_102478123
1027 Ga0081539_10000413
1028 Ga0081539_10053113
1029 Ga0070716_100173835
1030 Ga0070712_100584267
1031 Ga0097621_100004275
1032 Ga0097621_100016892
1033 Ga0068871_100137953
1034 Ga0068871_100377511
1035 Ga0068871_100881440
1036 Ga0075428_100701389
1037 Ga0075428_101236851
1038 Ga0075430_100006164
1039 Ga0075430_100031137
1040 Ga0075430_100272764
1041 Ga0075431_100045420
1042 Ga0075431_100493356
1043 Ga0075431_100648834
1044 Ga0075433_10159005
1045 Ga0075433_10305343
1046 Ga0075433_10526771
1047 Ga0075433_11482946
1048 Ga0075434_100177073
1049 Ga0075434_100189709
1050 Ga0075434_100793223
1051 Ga0075429_100344945
1052 Ga0075429_101893776
1053 Ga0068865_100030752
1054 Ga0068865_100766480
1055 Ga0068865_102058314
1056 Ga0075436_100038652
1057 Ga0075436_100185218
1058 Ga0075436_100436006
1059 Ga0097620_100030450
1060 Ga0097620_100036169
1061 Ga0097620_100044335
1062 Ga0097620_100151591
1063 Ga0097620_100156070
1064 Ga0097620_100339028
1065 Ga0097620_100420074
1066 Ga0097620_100605610
1067 Ga0097620_101136835
1068 Ga0097620_101380988
1069 Ga0097620_101468847
1070 Ga0097620_101471736
1071 Ga0097620_101874010
1072 Ga0097620_102153142
1073 Ga0097620_103135261
1074 Ga0075435_100197577
1075 Ga0075435_100695266
1076 Ga0075435_100942584
1077 Ga0075435_101573431
1078 Ga0099795_10225144
1079 Ga0105251_10392612
1080 Ga0105240_10373947
1081 Ga0105240_10566053
1082 Ga0105240_11132593
1083 Ga0105240_11242441
1084 Ga0105240_11484604
1085 Ga0105240_12107083
1086 Ga0111539_10183325
1087 Ga0111539_11176680
1088 Ga0111539_11410734
1089 Ga0105245_10409603
1090 Ga0105245_10754156
1091 Ga0105245_11000783
1092 Ga0105245_11053345
1093 Ga0105245_11208664
1094 Ga0105245_11818622
1095 Ga0105245_12331997
1096 Ga0105247_10003827
1097 Ga0105247_10168187
1098 Ga0105247_10459265
1099 Ga0114129_10238648
1100 Ga0114129_10855339
1101 Ga0114129_11335788
1102 Ga0105243_10428107
1103 Ga0105243_11015305
1104 Ga0105243_11493334
1105 Ga0105243_11580461
1106 Ga0105243_12382747
1107 Ga0105241_10079101
1108 Ga0105241_10357513
1109 Ga0105241_10365530
1110 Ga0105241_10608130
1111 Ga0105241_10943782
1112 Ga0105241_11403729
1113 Ga0105242_10077496
1114 Ga0105242_10909240
1115 Ga0105242_11820013
1116 Ga0105242_12593378
1117 Ga0105248_10027183
1118 Ga0105248_10107751
1119 Ga0105248_10140273
1120 Ga0105248_10236201
1121 Ga0105248_10275062
1122 Ga0105248_10477644
1123 Ga0105248_10843934
1124 Ga0105248_12043887
1125 Ga0105237_10005164
1126 Ga0105237_11227846
1127 Ga0105237_11673364
1128 Ga0105238_10008488
1129 Ga0105238_10024008
1130 Ga0105238_11357087
1131 Ga0105238_12437857
1132 Ga0105238_12776079
1133 Ga0105249_10047648
1134 Ga0105249_10086697
1135 Ga0105249_10223089
1136 Ga0105249_11390745
1137 Ga0105249_11884541
1138 Ga0105249_12581051
1139 Ga0105239_10918458
1140 Ga0105239_11918752
1141 Ga0105239_12269472
1142 Ga0105239_12556519
1143 Ga0105239_13036012
1144 Ga0105246_10062867
1145 Ga0105246_10140948
1146 Ga0105246_10186148
1147 Ga0105246_10323071
1148 Ga0105246_11209804
1149 Ga0105246_11528297
1150 Ga0157373_10018081
1151 Ga0157373_10340307
1152 Ga0157373_10426524
1153 Ga0157371_10589551
1154 Ga0157371_11134546
1155 Ga0157369_12558420
1156 Ga0157374_10943800
1157 Ga0157378_10630324
1158 Ga0157378_10823724
1159 Ga0157378_11194395
1160 Ga0157378_11231643
1161 Ga0157378_11491291
1162 Ga0163162_10028725
1163 Ga0163162_10042724
1164 Ga0163162_10235478
1165 Ga0163162_10331135
1166 Ga0163162_10825831
1167 Ga0163162_13241678
1168 Ga0157372_10004597
1169 Ga0157372_10471873
1170 Ga0157372_10509849
1171 Ga0157372_10539984
1172 Ga0157372_10549498
1173 Ga0157372_11380923
1174 Ga0157372_11981229
1175 Ga0157372_13399601
1176 Ga0157375_10332298
1177 Ga0157375_10559855
1178 Ga0157375_10613708
1179 Ga0157375_11082751
1180 Ga0157375_12757674
1181 Ga0163163_10084131
1182 Ga0163163_10471268
1183 Ga0163163_11103055
1184 Ga0163163_11737404
1185 Ga0163163_12833429
1186 Ga0157380_10001847
1187 Ga0157380_10021382
1188 Ga0157380_10912546
1189 Ga0157380_12570670
1190 Ga0157380_12726457
1191 Ga0157377_10815893
1192 Ga0157379_10176941
1193 Ga0157379_10178177
1194 Ga0157379_10671024
1195 Ga0157379_10772546
1196 Ga0157379_12387069
1197 Ga0182007_10296205
1198 Ga0163161_10114948
1199 Ga0207697_10011576
1200 Ga0207656_10049763
1201 Ga0207696_1151715
1202 Ga0207682_10280226
1203 Ga0207710_10000541
1204 Ga0207688_10112630
1205 Ga0207647_10003749
1206 Ga0207647_10133922
1207 Ga0207647_10384166
1208 Ga0207645_10209118
1209 Ga0207645_10799869
1210 Ga0207643_10056452
1211 Ga0207643_10198396
1212 Ga0207643_10199042
1213 Ga0207643_10787535
1214 Ga0207684_10000030
1215 Ga0207684_10377591
1216 Ga0207654_10248837
1217 Ga0207654_10394522
1218 Ga0207707_10177470
1219 Ga0207695_10328137
1220 Ga0207695_10602394
1221 Ga0207671_10003070
1222 Ga0207671_10098464
1223 Ga0207671_10499574
1224 Ga0207693_10381247
1225 Ga0207660_10602576
1226 Ga0207662_10084922
1227 Ga0207662_10156129
1228 Ga0207662_11030961
1229 Ga0207662_11271666
1230 Ga0207657_10457155
1231 Ga0207652_11076021
1232 Ga0207681_10059745
1233 Ga0207681_11258312
1234 Ga0207681_11591398
1235 Ga0207694_10006884
1236 Ga0207694_10011554
1237 Ga0207694_11187050
1238 Ga0207650_10109832
1239 Ga0207650_10814130
1240 Ga0207650_11410157
1241 Ga0207650_11681315
1242 Ga0207659_10390075
1243 Ga0207659_10895181
1244 Ga0207687_11027741
1245 Ga0207687_11847549
1246 Ga0207644_10291642
1247 Ga0207644_10417629
1248 Ga0207690_10558546
1249 Ga0207706_10410203
1250 Ga0207706_10410576
1251 Ga0207686_10056025
1252 Ga0207686_10735928
1253 Ga0207709_10205384
1254 Ga0207709_10488346
1255 Ga0207709_10950106
1256 Ga0207709_11275517
1257 Ga0207670_10013945
1258 Ga0207670_10595578
1259 Ga0207670_11002448
1260 Ga0207670_11566411
1261 Ga0207669_10150880
1262 Ga0207704_10234701
1263 Ga0207665_10034981
1264 Ga0207665_10212156
1265 Ga0207691_10103800
1266 Ga0207691_10433971
1267 Ga0207711_10120498
1268 Ga0207711_10132784
1269 Ga0207711_10200579
1270 Ga0207711_10302827
1271 Ga0207711_10562237
1272 Ga0207711_10821033
1273 Ga0207711_11782887
1274 Ga0207689_10161715
1275 Ga0207689_10189162
1276 Ga0207689_10438054
1277 Ga0207689_10527144
1278 Ga0207689_10608896
1279 Ga0207661_10497863
1280 Ga0207679_10466183
1281 Ga0207667_10003711
1282 Ga0207667_10052050
1283 Ga0207667_10382935
1284 Ga0207667_11435937
1285 Ga0207667_11545640
1286 Ga0207651_10374269
1287 Ga0207651_10426470
1288 Ga0207651_10579299
1289 Ga0207651_10714450
1290 Ga0207651_10736940
1291 Ga0207712_10015444
1292 Ga0207712_10259996
1293 Ga0207712_10345984
1294 Ga0207712_10848112
1295 Ga0207712_11660714
1296 Ga0207640_10110192
1297 Ga0207640_10132056
1298 Ga0207640_10471710
1299 Ga0207640_10737666
1300 Ga0207658_10088704
1301 Ga0207677_10331159
1302 Ga0207677_11867028
1303 Ga0207703_10125846
1304 Ga0207703_10210256
1305 Ga0207703_10275417
1306 Ga0207703_10347318
1307 Ga0207703_10454768
1308 Ga0207639_10011788
1309 Ga0207639_10140735
1310 Ga0207639_10240569
1311 Ga0207639_11246026
1312 Ga0207708_10002753
1313 Ga0207708_10015737
1314 Ga0207708_10155402
1315 Ga0207708_10183469
1316 Ga0207708_11013498
1317 Ga0207708_11214469
1318 Ga0207708_12040817
1319 Ga0207702_10046815
1320 Ga0207641_10148781
1321 Ga0207641_10527196
1322 Ga0207641_10934896
1323 Ga0207641_11133093
1324 Ga0207648_10752222
1325 Ga0207648_11601163
1326 Ga0207648_12266682
1327 Ga0207676_10312654
1328 Ga0207676_10413361
1329 Ga0207676_11748454
1330 Ga0207676_11853423
1331 Ga0207674_10126653
1332 Ga0207674_10230736
1333 Ga0207675_100061930
1334 Ga0207675_100104677
1335 Ga0207675_100816713
1336 Ga0207675_101331594
1337 Ga0207675_102120353
1338 Ga0207698_10361656
1339 Ga0207698_11046134
1340 Ga0268265_10034182
1341 Ga0268265_10173863
1342 Ga0268265_10670306
1343 Ga0268265_12518458
1344 Ga0268264_10023534
1345 Ga0268264_10064434
1346 Ga0268264_10069701
1347 Ga0268264_10173857
1348 Ga0268264_10932392
1349 Ga0268264_11304245
1350 Ga0265319_1181683
1351 Ga0265318_10245436
1352 Ga0314311_1196721
1353 Ga0316182_1067558
1354 Ga0265320_10113549
1355 Ga0307408_100081350
1356 Ga0307408_102395285
1357 Ga0316575_10133153
1358 Ga0307405_10015829
1359 Ga0307405_11380737
1360 Ga0307413_10020880
1361 Ga0307413_10637828
1362 Ga0307410_10173378
1363 Ga0307406_10015258
1364 Ga0307406_10325260
1365 Ga0307407_10020826
1366 Ga0307412_10001035
1367 Ga0307412_10991535
1368 Ga0307409_102133664
1369 Ga0307416_100050329
1370 Ga0307416_101387842
1371 Ga0307416_101538477
1372 Ga0307414_10015725
1373 Ga0307414_10916107
1374 Ga0307411_10352583
1375 Ga0307415_100000545
1376 Ga0373949_0284868
1377 Ga0373951_0000927
1378 Ga0373951_0041589
1379 Ga0373951_0284492
1380 Ga0373923_0591908
1381 Ga0373941_0204865
1382 Ga0373960_0264933
1383 Ga0373942_0004403
1384 Ga0373942_0032533
1385 Ga0373961_0052379
1386 Ga0373962_0237979
1387 Ga0373962_0273140
1388 Ga0373931_0043674
1389 Ga0373931_0596343
1390 Ga0373947_1084884
1391 Ga0373937_1578592
1392 Ga0395900_1030068
1393 Ga0395898_0383604
1394 Ga0395905_0000015
1395 Ga0395905_0582720
1396 Ga0395901_0098906
1397 Ga0395901_0276770
1398 Ga0242419_010752
1399 Ga0436361_0196373
1400 Ga0439455_0140308
1401 Ga0439458_0000936
1402 Ga0451577_0062783
1403 Ga0439440_0293719
1404 Ga0453683_0000298
1405 Ga0453683_0012885
1406 Ga0453683_0043401
1407 Ga0453683_0465782
1408 Ga0453683_0618773
1409 Ga0453683_0787513
1410 Ga0453684_0000295
1411 Ga0453684_0432095
1412 Ga0451576_0005894
1413 Ga0451576_0543913
1414 Ga0451576_0545242
1415 Ga0451576_0787292
1416 Ga0495628_0859045
1417 Ga0495658_0006690
1418 Ga0496101_1148220
1419 Ga0496102_0054812
1420 Ga0496102_0328498
1421 Ga0496102_0440511
1422 Ga0496103_0165328
1423 Ga0496104_0308605
1424 Ga0496106_0007213
1425 Ga0496107_0912025
1426 Ga0496108_0022553
1427 Ga0496108_0228460
1428 Ga0496108_0777070
1429 Ga0496108_1617959
1430 Ga0496109_0131107
1431 Ga0496110_1566018
1432 Ga0496111_0218511
1433 Ga0496112_0188919
1434 Ga0496112_0332843
1435 Ga0496112_0342152
1436 Ga0496112_0379433
1437 Ga0496112_0556949
1438 Ga0496112_0600287
1439 Ga0496112_1176543
1440 Ga0496113_0528087
1441 Ga0496113_0919622
1442 Ga0496115_0701334
1443 Ga0496126_0313155
1444 Ga0501291_003484
1445 Ga0501291_016528
1446 Ga0501292_015577
1447 Ga0501295_070896
1448 Ga0501295_165978
1449 Ga0501296_004564
1450 Ga0501297_032695
1451 Ga0501298_006839
1452 Ga0501298_054771
1453 Ga0501298_122897
1454 Ga0501299_004228
1455 Ga0501300_064921
1456 Ga0501033_0152060
1457 Ga0501034_0350802
1458 Ga0501037_0601890
1459 Ga0501038_0006694
1460 Ga0501047_0880504
1461 Ga0501048_1405585
1462 Ga0501070_0216651
1463 Ga0501070_0248376
1464 Ga0501072_1011998
1465 Ga0501198_003243
1466 Ga0501198_015520
1467 Ga0501198_126004
1468 Ga0501199_008977
1469 Ga0501201_004866
1470 Ga0501202_015313
1471 Ga0501206_016014
1472 Ga0501207_041347
1473 Ga0501208_004600
1474 Ga0501209_009980
1475 Ga0501209_152768
1476 Ga0501211_021876
1477 Ga0501214_001479
1478 Ga0501216_007452
1479 Ga0501217_016415
1480 Ga0501217_078919
1481 Ga0501222_022702
1482 Ga0501223_008341
1483 Ga0501223_022138
1484 Ga0501224_003803
1485 Ga0501224_005090
1486 Ga0501227_000153
1487 Ga0501227_027902
1488 Ga0501228_067084
1489 Ga0501230_003507
1490 Ga0501230_104171
1491 Ga0501230_165716
1492 Ga0501233_004100
1493 Ga0501233_058590
1494 Ga0501235_005030
1495 Ga0501236_007000
1496 Ga0501240_094952
1497 Ga0501240_108866
1498 Ga0501243_000499
1499 Ga0501243_009452
1500 Ga0501243_012717
1501 Ga0501243_013060
1502 Ga0501247_008177
1503 Ga0501249_029220
1504 Ga0501249_039512
1505 Ga0501250_029335
1506 Ga0501250_108395
1507 Ga0501251_090489
1508 Ga0501252_005868
1509 Ga0501253_011633
1510 Ga0501257_033499
1511 Ga0501257_064363
1512 Ga0501257_191932
1513 Ga0501259_004033
1514 Ga0501260_026630
1515 Ga0501261_015544
1516 Ga0501221_004274
1517 Ga0501221_017835
1518 Ga0501221_174922
1519 Ga0501225_0004984
1520 Ga0501225_0030827
1521 Ga0501229_004854
1522 Ga0501229_033876
1523 Ga0501234_005166
1524 Ga0501245_080319
1525 Ga0501241_047501
1526 Ga0501241_083120
1527 Ga0501262_015769
1528 Ga0501262_016354
1529 Ga0501264_026391
1530 Ga0501264_048688
1531 Ga0501265_039090
1532 Ga0501268_077728
1533 Ga0501270_015643
1534 Ga0501272_069461
1535 Ga0501273_044135
1536 Ga0501278_007065
1537 Ga0501279_036694
1538 Ga0501280_056381
1539 Ga0501283_001249
1540 Ga0501283_018577
1541 Ga0501044_0047277
1542 Ga0501200_04943
1543 Ga0501212_005293
1544 Ga0501212_008305
1545 Ga0501212_020715
1546 Ga0501212_021567
1547 Ga0501226_001370
1548 nmdc:mga05p37_108111_c1
1549 nmdc:mga05p37_1848222_c1
1550 nmdc:mga05p37_548864_c1
1551 nmdc:mga09592_312899_c1
1552 nmdc:mga09592_92917_c1
1553 nmdc:mga0qj67_122944_c1
1554 nmdc:mga0qj67_569626_c1
1555 nmdc:mga06r32_355725_c1
1556 nmdc:mga06r32_592444_c1
1557 nmdc:mga08y16_42627_c1
1558 nmdc:mga08y16_603769_c1
1559 nmdc:mga08y16_861755_c1
1560 nmdc:mga0n895_116774_c1
1561 nmdc:mga0n895_382160_c1
1562 nmdc:mga0n895_764717_c1
1563 nmdc:mga0rr50_114293_c1
1564 nmdc:mga0rr50_14012_c1
1565 nmdc:mga0rr50_175150_c1
1566 nmdc:mga08x19_33485_c1
1567 nmdc:mga08x19_707947_c1
1568 nmdc:mga0a205_235925_c1
1569 nmdc:mga0a205_53715_c1
1570 Ga0495619_0609837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

29

85

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1siz-assembly1.cif.gz_C crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus 0.9043 15 76
1fxd-assembly1.cif.gz_A-2 refined crystal structure of ferredoxin ii from desulfovibrio gigas at 1.7 angstroms 0.8737 16 72
4id8-assembly1.cif.gz_A the crystal structure of a [3fe-4s] ferredoxin associated with cyp194a4 from r. palustris haa2 0.8718 15 76
4dhv-assembly1.cif.gz_A crystal structure of the pyrococcus furiosus ferredoxin d14c variant containing the heterometallic [agfe3s4] cluster 0.8657 15 76
3pni-assembly1.cif.gz_A crystal structure of d14c [3fe-4s] pyrococcus furiosus ferredoxin 0.8619 15 76
ID Description Score Start End Superfamily
af_Q8RWE1_65_123_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9718 16 75 3.30.70.20
af_Q8RWE1_65_123_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9402 16 75 3.30.70.20
af_Q5JNF3_161_221_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9044 15 76 3.30.70.20
1sizA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9036 15 76 3.30.70.20
af_A0A0R0E5N2_164_226_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8951 15 73 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A2V6BP78-F1-model_v4 Ferredoxin 1.01 11 76
AF-A8DJL2-F1-model_v4 Conserved domain protein 1.008 16 76
AF-A0A7V4II35-F1-model_v4 Ferredoxin 1.007 7 76
AF-A0A7W1R927-F1-model_v4 Ferredoxin 1.006 1 76
AF-A0A6N6PZY6-F1-model_v4 Ferredoxin 1.006 1 74

Map