F480661

General Info

Members Datasets Scaffolds Average Seq Length
783 383 1566 206

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10419907|Ga0207644_104199072
Length 239
Sequence MILLIDNYDSFTFNLVHYLGGLGAEVAVHRNDKIGVRDVIAANPDAIVMSPGPCTPNEAGICLDLIAAAAPTIPMLGVCLGHQAIGQAFGGKVVRAPVPVHGKLSDIKHQGQSVFRGINGSFKATRYHSLVVDRANLPTELSVTAETSDRLIMGVAHRTLPVHGVQFHPESIASEHGHLILKNFLEIAAQWNAATGRRARRAFTTGWSMRQAVRTSRSSAPPRAPRPIPSWRCWRAAAC

Samples

Sample ID Description Type Environment
1 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
161 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
211 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
214 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
217 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
218 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
219 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
354 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
355 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
356 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
357 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
358 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
361 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
367 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
368 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
372 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
373 2508501050 Microvirga lupini Lut6 Isolate Nodule
374 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
375 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
376 2643221733 Bosea sp. Root381 Isolate Unclassified
377 2773857925 Microvirga vignae BR3299 Isolate Unclassified
378 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
379 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
380 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
381 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
382 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
383 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.26
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0.51
Rhizoplane 6
Rhizosphere 83.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207644_10419907 3300025931 Bacteria 1096
2 JGI25153J46596_10010210 3300003215 Bacteria 4268
3 Ga0065715_10270174 3300005293 Bacteria 1081
4 Ga0070658_10318421 3300005327 Bacteria 1328
5 Ga0070676_10021207 3300005328 Bacteria 3636
6 Ga0070676_10024845 3300005328 Bacteria 3380
7 Ga0068869_100625194 3300005334 Bacteria 912
8 Ga0070680_100020040 3300005336 Bacteria 5302
9 Ga0068868_100053089 3300005338 Bacteria 3193
10 Ga0070660_100088699 3300005339 Bacteria 2436
11 Ga0070689_100013410 3300005340 Bacteria 5930
12 Ga0070687_100187930 3300005343 Bacteria 1242
13 Ga0070687_100198733 3300005343 Bacteria 1213
14 Ga0070668_100314298 3300005347 Bacteria 1317
15 Ga0070669_100257802 3300005353 Bacteria 1390
16 Ga0070675_100094611 3300005354 Bacteria 2507
17 Ga0070675_100142304 3300005354 Bacteria 2051
18 Ga0070671_100271832 3300005355 Bacteria 1440
19 Ga0070674_100003109 3300005356 Bacteria 9242
20 Ga0070674_100049922 3300005356 Bacteria 2879
21 Ga0070667_100418776 3300005367 Bacteria 1221
22 Ga0070714_100047550 3300005435 Bacteria 3645
23 Ga0070714_100371499 3300005435 Bacteria 1346
24 Ga0070710_10158146 3300005437 Bacteria 1403
25 Ga0070711_100014324 3300005439 Bacteria 4996
26 Ga0070711_100148362 3300005439 Bacteria 1766
27 Ga0070711_100242823 3300005439 Bacteria 1409
28 Ga0070678_100034607 3300005456 Bacteria 3519
29 Ga0070678_100041449 3300005456 Bacteria 3264
30 Ga0070678_100398110 3300005456 Bacteria 1196
31 Ga0070662_100678082 3300005457 Bacteria 871
32 Ga0070681_10004738 3300005458 Bacteria 13025
33 Ga0070681_10089187 3300005458 Bacteria 3035
34 Ga0070681_10132888 3300005458 Bacteria 2420
35 Ga0070681_10331805 3300005458 Bacteria 1431
36 Ga0068867_100008373 3300005459 Bacteria 7295
37 Ga0068867_100733588 3300005459 Bacteria 875
38 Ga0070706_100596953 3300005467 Bacteria 1026
39 Ga0070706_100624282 3300005467 Bacteria 1001
40 Ga0070698_100549605 3300005471 Bacteria 1094
41 Ga0070699_100176213 3300005518 Bacteria 1896
42 Ga0070679_100005303 3300005530 Bacteria 11934
43 Ga0070679_100463543 3300005530 Bacteria 1212
44 Ga0070684_100307568 3300005535 Bacteria 1455
45 Ga0070684_100327883 3300005535 Bacteria 1407
46 Ga0070697_100019164 3300005536 Bacteria 5402
47 Ga0070697_100319534 3300005536 Bacteria 1337
48 Ga0068853_100605522 3300005539 Bacteria 1041
49 Ga0070672_100094374 3300005543 Bacteria 2418
50 Ga0070672_100489371 3300005543 Bacteria 1063
51 Ga0070686_100090036 3300005544 Bacteria 2051
52 Ga0070686_100169807 3300005544 Bacteria 1542
53 Ga0070695_100060831 3300005545 Bacteria 2448
54 Ga0070696_100110288 3300005546 Bacteria 1981
55 Ga0070693_100232379 3300005547 Bacteria 1214
56 Ga0070665_100000913 3300005548 Bacteria 37936
57 Ga0070665_100653267 3300005548 Bacteria 1065
58 Ga0070665_100672664 3300005548 Bacteria 1048
59 Ga0070704_100160281 3300005549 Bacteria 1779
60 Ga0070704_100973458 3300005549 Bacteria 766
61 Ga0068855_100168776 3300005563 Bacteria 2479
62 Ga0068855_100367664 3300005563 Bacteria 1581
63 Ga0068855_100482946 3300005563 Bacteria 1348
64 Ga0068855_101044525 3300005563 Bacteria 856
65 Ga0070664_100165002 3300005564 Bacteria 1962
66 Ga0068854_100132511 3300005578 Bacteria 1904
67 Ga0070702_100029594 3300005615 Bacteria 2980
68 Ga0068852_100054067 3300005616 Bacteria 3459
69 Ga0068852_100146896 3300005616 Bacteria 2188
70 Ga0068864_100061280 3300005618 Bacteria 3259
71 Ga0068861_100075201 3300005719 Bacteria 2629
72 Ga0068863_100227726 3300005841 Bacteria 1797
73 Ga0068858_100245757 3300005842 Bacteria 1699
74 Ga0068862_100167529 3300005844 Bacteria 1965
75 Ga0081455_10025722 3300005937 Bacteria 5428
76 Ga0081455_10125296 3300005937 Bacteria 2017
77 Ga0081455_10367252 3300005937 Bacteria 1010
78 Ga0081538_10005050 3300005981 Bacteria 11996
79 Ga0081540_1000194 3300005983 Bacteria 62934
80 Ga0081540_1003980 3300005983 Bacteria 11462
81 Ga0081540_1030141 3300005983 Bacteria 3010
82 Ga0081539_10005651 3300005985 Bacteria 12568
83 Ga0070717_10084664 3300006028 Bacteria 2667
84 Ga0070717_10169379 3300006028 Bacteria 1899
85 Ga0070717_10254567 3300006028 Bacteria 1552
86 Ga0075365_10005800 3300006038 Bacteria 6706
87 Ga0075365_10394613 3300006038 Bacteria 976
88 Ga0075368_10028231 3300006042 Bacteria 2167
89 Ga0075368_10065693 3300006042 Bacteria 1458
90 Ga0075363_100017907 3300006048 Bacteria 3521
91 Ga0075363_100083400 3300006048 Bacteria 1751
92 Ga0075364_10071882 3300006051 Bacteria 2279
93 Ga0075364_10104975 3300006051 Bacteria 1883
94 Ga0075364_10241015 3300006051 Bacteria 1228
95 Ga0070715_10390494 3300006163 Bacteria 771
96 Ga0070716_100269755 3300006173 Bacteria 1169
97 Ga0070712_100010707 3300006175 Bacteria 5793
98 Ga0070712_100017711 3300006175 Bacteria 4615
99 Ga0070712_100374239 3300006175 Bacteria 1171
100 Ga0075362_10034328 3300006177 Bacteria 2211
101 Ga0075362_10180539 3300006177 Bacteria 1022
102 Ga0075362_10244644 3300006177 Bacteria 881
103 Ga0075367_10010802 3300006178 Bacteria 4810
104 Ga0075367_10020548 3300006178 Bacteria 3680
105 Ga0075367_10549803 3300006178 Bacteria 733
106 Ga0075369_10003352 3300006186 Bacteria 5823
107 Ga0075369_10135902 3300006186 Bacteria 1119
108 Ga0075366_10019201 3300006195 Bacteria 3952
109 Ga0075366_10032023 3300006195 Bacteria 3095
110 Ga0097621_101088944 3300006237 Bacteria 750
111 Ga0075370_10155584 3300006353 Bacteria 1340
112 Ga0075370_10234177 3300006353 Bacteria 1087
113 Ga0068871_100497857 3300006358 Bacteria 1098
114 Ga0075428_100001228 3300006844 Bacteria 27445
115 Ga0075428_100192634 3300006844 Bacteria 2205
116 Ga0075428_100427705 3300006844 Bacteria 1419
117 Ga0075428_100442547 3300006844 Bacteria 1392
118 Ga0075428_101027531 3300006844 Bacteria 872
119 Ga0075430_100000170 3300006846 Bacteria 42897
120 Ga0075430_100014636 3300006846 Bacteria 6682
121 Ga0075430_100256346 3300006846 Bacteria 1449
122 Ga0075430_100500405 3300006846 Bacteria 1003
123 Ga0075431_100000812 3300006847 Bacteria 27315
124 Ga0075431_100087543 3300006847 Bacteria 3214
125 Ga0075431_100178864 3300006847 Bacteria 2177
126 Ga0075431_100191421 3300006847 Bacteria 2096
127 Ga0075434_100042112 3300006871 Bacteria 4527
128 Ga0075434_100068602 3300006871 Bacteria 3533
129 Ga0075434_100414112 3300006871 Bacteria 1369
130 Ga0075429_100010495 3300006880 Bacteria 8011
131 Ga0075429_100012850 3300006880 Bacteria 7263
132 Ga0075429_100318630 3300006880 Bacteria 1361
133 Ga0075429_100787714 3300006880 Bacteria 833
134 Ga0075436_100003022 3300006914 Bacteria 11527
135 Ga0075436_100013301 3300006914 Bacteria 5637
136 Ga0075435_100037566 3300007076 Bacteria 3857
137 Ga0075435_100067785 3300007076 Bacteria 2906
138 Ga0075435_100083024 3300007076 Bacteria 2634
139 Ga0099795_10006014 3300007788 Bacteria 3276
140 Ga0099795_10026882 3300007788 Bacteria 1943
141 Ga0105240_10143434 3300009093 Bacteria 2853
142 Ga0105240_10154842 3300009093 Bacteria 2727
143 Ga0105240_10163960 3300009093 Bacteria 2637
144 Ga0105240_10770582 3300009093 Bacteria 1044
145 Ga0105240_11265897 3300009093 Bacteria 779
146 Ga0111539_10001371 3300009094 Bacteria 32392
147 Ga0111539_10042732 3300009094 Bacteria 5440
148 Ga0105245_10024476 3300009098 Bacteria 5302
149 Ga0105245_10785919 3300009098 Bacteria 989
150 Ga0105245_10838684 3300009098 Bacteria 959
151 Ga0105245_10853148 3300009098 Bacteria 951
152 Ga0105247_10410716 3300009101 Bacteria 967
153 Ga0114129_10005694 3300009147 Bacteria 17649
154 Ga0114129_10005820 3300009147 Bacteria 17459
155 Ga0114129_10440750 3300009147 Bacteria 1710
156 Ga0114129_10523361 3300009147 Bacteria 1546
157 Ga0114129_10639134 3300009147 Bacteria 1374
158 Ga0114129_10939959 3300009147 Bacteria 1093
159 Ga0105243_10461069 3300009148 Bacteria 1195
160 Ga0105248_10174924 3300009177 Bacteria 2420
161 Ga0105248_10175545 3300009177 Bacteria 2415
162 Ga0105248_10674573 3300009177 Bacteria 1166
163 Ga0105237_10690991 3300009545 Bacteria 1027
164 Ga0105237_11089809 3300009545 Bacteria 805
165 Ga0105238_10031321 3300009551 Bacteria 5413
166 Ga0105238_10039306 3300009551 Bacteria 4797
167 Ga0105238_10088301 3300009551 Bacteria 3087
168 Ga0105238_10099775 3300009551 Bacteria 2886
169 Ga0105238_10272795 3300009551 Bacteria 1672
170 Ga0105249_10278254 3300009553 Bacteria 1670
171 Ga0105249_10349699 3300009553 Bacteria 1497
172 Ga0105249_10579172 3300009553 Bacteria 1175
173 Ga0105239_10124928 3300010375 Bacteria 2859
174 Ga0105246_10111898 3300011119 Bacteria 2007
175 Ga0157370_10351288 3300013104 Bacteria 1359
176 Ga0157378_10105957 3300013297 Bacteria 2571
177 Ga0157378_10318584 3300013297 Bacteria 1510
178 Ga0157378_10531941 3300013297 Bacteria 1178
179 Ga0157378_11628366 3300013297 Bacteria 692
180 Ga0157375_10117613 3300013308 Bacteria 2764
181 Ga0157375_10310554 3300013308 Bacteria 1741
182 Ga0157375_10542899 3300013308 Bacteria 1325
183 Ga0157375_10603940 3300013308 Bacteria 1256
184 Ga0157380_10146522 3300014326 Bacteria 2035
185 Ga0157380_10935645 3300014326 Bacteria 895
186 Ga0157377_10687316 3300014745 Bacteria 741
187 Ga0157379_10341441 3300014968 Bacteria 1370
188 Ga0157376_10095816 3300014969 Bacteria 2581
189 Ga0163161_10291441 3300017792 Bacteria 1283
190 Ga0206353_10806976 3300020082 Bacteria 1422
191 Ga0213874_10031623 3300021377 Bacteria 1532
192 Ga0213876_10099014 3300021384 Bacteria 1545
193 Ga0213871_10100434 3300021441 Bacteria 846
194 Ga0209646_1000030 3300025246 Bacteria 384216
195 Ga0209758_1000385 3300025297 Bacteria 76280
196 Ga0207697_10019432 3300025315 Bacteria 2783
197 Ga0207697_10091181 3300025315 Bacteria 1291
198 Ga0207692_10020829 3300025898 Bacteria 2990
199 Ga0207692_10045877 3300025898 Bacteria 2188
200 Ga0207710_10204562 3300025900 Bacteria 976
201 Ga0207688_10105026 3300025901 Bacteria 1635
202 Ga0207688_10116658 3300025901 Bacteria 1554
203 Ga0207685_10102251 3300025905 Bacteria 1227
204 Ga0207699_10068772 3300025906 Bacteria 2157
205 Ga0207699_10106311 3300025906 Bacteria 1791
206 Ga0207699_10618816 3300025906 Bacteria 789
207 Ga0207645_10015040 3300025907 Bacteria 5156
208 Ga0207645_10097906 3300025907 Bacteria 1891
209 Ga0207705_10074153 3300025909 Bacteria 2470
210 Ga0207705_10419316 3300025909 Bacteria 1036
211 Ga0207705_10604251 3300025909 Bacteria 853
212 Ga0207684_10097529 3300025910 Bacteria 2510
213 Ga0207684_10552109 3300025910 Bacteria 985
214 Ga0207707_10022094 3300025912 Bacteria 5561
215 Ga0207707_10033427 3300025912 Bacteria 4501
216 Ga0207707_10069780 3300025912 Bacteria 3063
217 Ga0207695_10103484 3300025913 Bacteria 2838
218 Ga0207695_10147056 3300025913 Bacteria 2299
219 Ga0207695_10764735 3300025913 Bacteria 846
220 Ga0207693_10013809 3300025915 Bacteria 6502
221 Ga0207693_10177987 3300025915 Bacteria 1673
222 Ga0207693_10287955 3300025915 Bacteria 1287
223 Ga0207663_10024626 3300025916 Bacteria 3468
224 Ga0207663_10101049 3300025916 Bacteria 1937
225 Ga0207660_10016056 3300025917 Bacteria 4951
226 Ga0207660_10204767 3300025917 Bacteria 1542
227 Ga0207657_10020194 3300025919 Bacteria 6302
228 Ga0207657_10381290 3300025919 Bacteria 1110
229 Ga0207652_10017504 3300025921 Bacteria 5865
230 Ga0207652_10089042 3300025921 Bacteria 2709
231 Ga0207694_10014321 3300025924 Bacteria 5979
232 Ga0207694_10376808 3300025924 Bacteria 1177
233 Ga0207694_10609709 3300025924 Bacteria 918
234 Ga0207659_10274437 3300025926 Bacteria 1376
235 Ga0207659_10457160 3300025926 Bacteria 1076
236 Ga0207700_10808342 3300025928 Bacteria 839
237 Ga0207690_10608024 3300025932 Bacteria 893
238 Ga0207706_10167446 3300025933 Bacteria 1931
239 Ga0207670_10001629 3300025936 Bacteria 11705
240 Ga0207669_10002621 3300025937 Bacteria 7697
241 Ga0207669_10012717 3300025937 Bacteria 4149
242 Ga0207704_10590653 3300025938 Bacteria 908
243 Ga0207665_10082598 3300025939 Bacteria 2214
244 Ga0207691_10008224 3300025940 Bacteria 10021
245 Ga0207691_10157908 3300025940 Bacteria 1991
246 Ga0207711_10077903 3300025941 Bacteria 2890
247 Ga0207711_10424825 3300025941 Bacteria 1236
248 Ga0207689_10264720 3300025942 Bacteria 1423
249 Ga0207689_10355200 3300025942 Bacteria 1219
250 Ga0207679_10088406 3300025945 Bacteria 2389
251 Ga0207667_10016783 3300025949 Bacteria 8260
252 Ga0207667_10131297 3300025949 Bacteria 2580
253 Ga0207667_10167227 3300025949 Bacteria 2260
254 Ga0207667_10737557 3300025949 Bacteria 985
255 Ga0207667_10863042 3300025949 Bacteria 899
256 Ga0207651_10576854 3300025960 Bacteria 981
257 Ga0207712_10545110 3300025961 Bacteria 997
258 Ga0207668_10356255 3300025972 Bacteria 1225
259 Ga0207668_10632870 3300025972 Bacteria 935
260 Ga0207640_10235668 3300025981 Bacteria 1411
261 Ga0207658_10206373 3300025986 Bacteria 1644
262 Ga0207677_10031527 3300026023 Bacteria 3396
263 Ga0207703_10235063 3300026035 Bacteria 1645
264 Ga0207708_10213686 3300026075 Bacteria 1543
265 Ga0207648_10005736 3300026089 Bacteria 12444
266 Ga0207648_10474852 3300026089 Bacteria 1141
267 Ga0207648_10554002 3300026089 Bacteria 1056
268 Ga0207676_10024100 3300026095 Bacteria 4500
269 Ga0207676_10697966 3300026095 Bacteria 983
270 Ga0207675_100426118 3300026118 Bacteria 1311
271 Ga0207683_10007234 3300026121 Bacteria 9515
272 Ga0207683_10130944 3300026121 Bacteria 2256
273 Ga0207428_10002878 3300027907 Bacteria 17058
274 Ga0268266_10000346 3300028379 Bacteria 72336
275 Ga0268266_10168092 3300028379 Bacteria 1989
276 Ga0268266_11362415 3300028379 Bacteria 685
277 Ga0268265_10080958 3300028380 Bacteria 2563
278 Ga0265318_10082322 3300028577 Bacteria 1188
279 Ga0265338_10131800 3300028800 Bacteria 1972
280 Ga0265330_10041409 3300031235 Bacteria 2042
281 Ga0265330_10184443 3300031235 Bacteria 883
282 Ga0265328_10000445 3300031239 Bacteria 19251
283 Ga0265328_10021331 3300031239 Bacteria 2472
284 Ga0265328_10200917 3300031239 Bacteria 757
285 Ga0265325_10018262 3300031241 Bacteria 3889
286 Ga0265325_10036906 3300031241 Bacteria 2586
287 Ga0265325_10065711 3300031241 Bacteria 1831
288 Ga0265325_10080223 3300031241 Bacteria 1623
289 Ga0265325_10144439 3300031241 Bacteria 1129
290 Ga0265329_10004861 3300031242 Bacteria 5509
291 Ga0265340_10000814 3300031247 Bacteria 17718
292 Ga0265340_10021426 3300031247 Bacteria 3315
293 Ga0265340_10041676 3300031247 Bacteria 2256
294 Ga0265340_10046379 3300031247 Bacteria 2120
295 Ga0265340_10112894 3300031247 Bacteria 1255
296 Ga0265339_10029504 3300031249 Bacteria 3111
297 Ga0265339_10103546 3300031249 Bacteria 1478
298 Ga0265339_10109397 3300031249 Bacteria 1431
299 Ga0265339_10116796 3300031249 Bacteria 1375
300 Ga0265339_10154000 3300031249 Bacteria 1160
301 Ga0265339_10168824 3300031249 Bacteria 1097
302 Ga0265339_10316441 3300031249 Bacteria 741
303 Ga0265331_10000082 3300031250 Bacteria 133041
304 Ga0265331_10119367 3300031250 Bacteria 1206
305 Ga0265316_10135699 3300031344 Bacteria 1851
306 Ga0265316_10186232 3300031344 Bacteria 1544
307 Ga0265316_10276061 3300031344 Bacteria 1229
308 Ga0265316_10386047 3300031344 Bacteria 1010
309 Ga0307513_10124887 3300031456 Bacteria 2532
310 Ga0307408_100093673 3300031548 Bacteria 2273
311 Ga0307408_100183139 3300031548 Bacteria 1681
312 Ga0307408_100328195 3300031548 Bacteria 1291
313 Ga0265313_10000554 3300031595 Bacteria 38970
314 Ga0265313_10013708 3300031595 Bacteria 4840
315 Ga0316575_10016371 3300031665 Bacteria 2806
316 Ga0316579_10139624 3300031691 Bacteria 1168
317 Ga0316579_10290113 3300031691 Bacteria 791
318 Ga0265314_10004396 3300031711 Bacteria 13094
319 Ga0265314_10022913 3300031711 Bacteria 4774
320 Ga0265314_10079643 3300031711 Bacteria 2165
321 Ga0265342_10001033 3300031712 Bacteria 27336
322 Ga0265342_10034165 3300031712 Bacteria 3121
323 Ga0265342_10038515 3300031712 Bacteria 2911
324 Ga0265342_10056104 3300031712 Bacteria 2336
325 Ga0265342_10097528 3300031712 Bacteria 1678
326 Ga0265342_10199325 3300031712 Bacteria 1089
327 Ga0316576_10206978 3300031727 Bacteria 1477
328 Ga0316576_10614320 3300031727 Bacteria 793
329 Ga0307413_10210830 3300031824 Bacteria 1411
330 Ga0307413_10357204 3300031824 Bacteria 1130
331 Ga0307413_10572795 3300031824 Bacteria 920
332 Ga0307410_10220931 3300031852 Bacteria 1457
333 Ga0307407_10260546 3300031903 Bacteria 1192
334 Ga0307409_100129350 3300031995 Bacteria 2154
335 Ga0307409_100288234 3300031995 Bacteria 1521
336 Ga0307416_100054363 3300032002 Bacteria 3218
337 Ga0307416_100287067 3300032002 Bacteria 1626
338 Ga0307414_10149142 3300032004 Bacteria 1842
339 Ga0307414_10528206 3300032004 Bacteria 1048
340 Ga0307411_10090026 3300032005 Bacteria 2139
341 Ga0316583_10016520 3300032133 Bacteria 2656
342 Ga0373930_0049440 3300034816 Bacteria 915
343 Ga0373958_0057270 3300034819 Bacteria 836
344 Ga0373959_0053882 3300034820 Bacteria 875
345 Ga0373929_0029912 3300035085 Bacteria 1159
346 Ga0373949_0062383 3300035090 Bacteria 962
347 Ga0373951_0087938 3300035091 Bacteria 812
348 Ga0373952_0018052 3300035092 Bacteria 1456
349 Ga0373936_0005310 3300035113 Bacteria 4849
350 Ga0373936_0195284 3300035113 Bacteria 892
351 Ga0373939_0008035 3300035114 Bacteria 2577
352 Ga0373941_0092888 3300035115 Bacteria 1038
353 Ga0373945_0007389 3300035116 Bacteria 3562
354 Ga0373945_0100759 3300035116 Bacteria 1130
355 Ga0373953_0013201 3300035117 Bacteria 2945
356 Ga0373954_0010307 3300035118 Bacteria 4123
357 Ga0373954_0081122 3300035118 Bacteria 1550
358 Ga0373957_0032542 3300035120 Bacteria 1921
359 Ga0373960_0035058 3300035121 Bacteria 1422
360 Ga0373943_0000268 3300035170 Bacteria 21475
361 Ga0373943_0012004 3300035170 Bacteria 3899
362 Ga0373943_0298335 3300035170 Bacteria 914
363 Ga0373946_0001967 3300035171 Bacteria 7189
364 Ga0373946_0016212 3300035171 Bacteria 2836
365 Ga0373955_0010606 3300035172 Bacteria 4358
366 Ga0373955_0021860 3300035172 Bacteria 3236
367 Ga0373955_0160983 3300035172 Bacteria 1325
368 Ga0373961_0043358 3300035241 Bacteria 1308
369 Ga0316574_0000507 3300035398 Bacteria 15818
370 Ga0373924_0030653 3300035410 Bacteria 2157
371 Ga0373931_0003730 3300035691 Bacteria 6894
372 Ga0373931_0019831 3300035691 Bacteria 3359
373 Ga0373931_0060117 3300035691 Bacteria 2045
374 Ga0373935_0002242 3300035692 Bacteria 11003
375 Ga0373935_0011850 3300035692 Bacteria 5238
376 Ga0373935_0036347 3300035692 Bacteria 3078
377 Ga0373935_0341103 3300035692 Bacteria 1067
378 Ga0373935_0655331 3300035692 Bacteria 770
379 Ga0373935_0955459 3300035692 Bacteria 636
380 Ga0373927_0001748 3300035695 Bacteria 16212
381 Ga0373927_0017897 3300035695 Bacteria 4660
382 Ga0373927_0038320 3300035695 Bacteria 3112
383 Ga0373927_0055513 3300035695 Bacteria 2561
384 Ga0373927_0090278 3300035695 Bacteria 1990
385 Ga0373927_0110273 3300035695 Bacteria 1793
386 Ga0373927_0177145 3300035695 Bacteria 1398
387 Ga0373933_0007061 3300035724 Bacteria 6120
388 Ga0373947_0001270 3300035725 Bacteria 15552
389 Ga0373947_0009494 3300035725 Bacteria 5586
390 Ga0373947_0021720 3300035725 Bacteria 3717
391 Ga0373947_0049699 3300035725 Bacteria 2519
392 Ga0373947_0058781 3300035725 Bacteria 2330
393 Ga0373937_0000326 3300036401 Bacteria 45214
394 Ga0373937_0319117 3300036401 Bacteria 1470
395 Ga0373937_1062777 3300036401 Bacteria 758
396 Ga0316582_0295883 3300036647 Bacteria 1112
397 Ga0316582_0507851 3300036647 Bacteria 831
398 Ga0373925_0002641 3300037068 Bacteria 14221
399 Ga0373925_0010083 3300037068 Bacteria 6863
400 Ga0373925_0024003 3300037068 Bacteria 4450
401 Ga0373925_0057672 3300037068 Bacteria 2910
402 Ga0373925_0104794 3300037068 Bacteria 2178
403 Ga0373925_0191946 3300037068 Bacteria 1621
404 Ga0373925_0217079 3300037068 Bacteria 1525
405 Ga0373925_0409492 3300037068 Bacteria 1107
406 Ga0373925_0965104 3300037068 Bacteria 702
407 Ga0395899_0006002 3300037312 Bacteria 9433
408 Ga0395899_0027248 3300037312 Bacteria 4309
409 Ga0395900_0003929 3300037418 Bacteria 15866
410 Ga0395898_0043976 3300037466 Bacteria 4399
411 Ga0395898_0061629 3300037466 Bacteria 3644
412 Ga0395905_0092047 3300037471 Bacteria 2843
413 Ga0395905_0997286 3300037471 Bacteria 741
414 Ga0436364_0850496 3300037853 Bacteria 1470
415 Ga0436364_0885754 3300037853 Bacteria 833
416 Ga0436364_1109044 3300037853 Bacteria 1371
417 Ga0436364_1228402 3300037853 Bacteria 36853
418 Ga0436364_1338625 3300037853 Bacteria 1137
419 Ga0395901_0022173 3300038443 Bacteria 6507
420 Ga0395901_0031439 3300038443 Bacteria 5474
421 Ga0395901_0267709 3300038443 Bacteria 1778
422 Ga0436365_0158765 3300039437 Bacteria 1780
423 Ga0436365_0243474 3300039437 Bacteria 977
424 Ga0436365_1324643 3300039437 Bacteria 1627
425 Ga0436360_0945414 3300039438 Bacteria 1167
426 Ga0436360_1180969 3300039438 Bacteria 2359
427 Ga0436361_0393934 3300039447 Bacteria 3755
428 Ga0436361_0958976 3300039447 Bacteria 1730
429 Ga0436363_0940222 3300039450 Bacteria 2748
430 Ga0436363_1409348 3300039450 Bacteria 1385
431 Ga0436362_0173993 3300039453 Bacteria 1567
432 Ga0439453_0003358 3300041408 Bacteria 2297
433 Ga0439465_0053468 3300041413 Bacteria 1327
434 Ga0439431_0078030 3300041997 Bacteria 890
435 Ga0439443_001515 3300042003 Bacteria 2586
436 Ga0439432_067982 3300042006 Bacteria 1090
437 Ga0439450_011703 3300042008 Bacteria 1725
438 Ga0450923_020616 3300042125 Bacteria 1279
439 Ga0439446_0164304 3300042156 Bacteria 735
440 Ga0439458_0067302 3300042157 Bacteria 901
441 Ga0439435_0008721 3300042436 Bacteria 2358
442 Ga0439460_0011049 3300042461 Bacteria 2323
443 Ga0466972_0034647 3300044658 Bacteria 2472
444 Ga0466966_0130821 3300044684 Bacteria 1537
445 Ga0466970_0410242 3300044765 Bacteria 774
446 Ga0466957_0018226 3300044842 Bacteria 4120
447 Ga0466959_0107292 3300045049 Bacteria 1996
448 Ga0466959_0218707 3300045049 Bacteria 1322
449 Ga0451576_0384614 3300045051 Bacteria 1471
450 Ga0495592_0001009 3300046454 Bacteria 19522
451 Ga0495592_0125594 3300046454 Bacteria 1801
452 Ga0495603_0198710 3300046455 Bacteria 1159
453 Ga0495603_0405815 3300046455 Bacteria 781
454 Ga0495590_0026819 3300046457 Bacteria 2022
455 Ga0495629_0023536 3300046459 Bacteria 4388
456 Ga0495629_0122320 3300046459 Bacteria 1813
457 Ga0495629_0208237 3300046459 Bacteria 1351
458 Ga0495651_0001005 3300046462 Bacteria 21899
459 Ga0495651_0570203 3300046462 Bacteria 717
460 Ga0495653_0001279 3300046463 Bacteria 19468
461 Ga0495653_0044827 3300046463 Bacteria 3431
462 Ga0495580_0059860 3300046472 Bacteria 2676
463 Ga0495605_0098558 3300046474 Bacteria 1346
464 Ga0495639_0113280 3300046475 Bacteria 1289
465 Ga0495662_0012656 3300046476 Bacteria 4114
466 Ga0495662_0026024 3300046476 Bacteria 2826
467 Ga0495662_0427421 3300046476 Bacteria 650
468 Ga0495664_0000518 3300046477 Bacteria 19283
469 Ga0495664_0004700 3300046477 Bacteria 7469
470 Ga0495584_0120464 3300046491 Bacteria 1329
471 Ga0495594_0214649 3300046499 Bacteria 1097
472 Ga0495608_0001062 3300046511 Bacteria 19343
473 Ga0495610_0044499 3300046512 Bacteria 2203
474 Ga0495618_0001010 3300046514 Bacteria 19277
475 Ga0495618_0014498 3300046514 Bacteria 4803
476 Ga0495628_0000010 3300046516 Bacteria 234932
477 Ga0495628_0219859 3300046516 Bacteria 1427
478 Ga0495630_0016239 3300046517 Bacteria 5439
479 Ga0495630_0017046 3300046517 Bacteria 5317
480 Ga0495630_0121268 3300046517 Bacteria 1983
481 Ga0495663_0049329 3300046525 Bacteria 1300
482 Ga0495652_0000008 3300046529 Bacteria 343637
483 Ga0495652_0021286 3300046529 Bacteria 5766
484 Ga0495652_0597314 3300046529 Bacteria 753
485 Ga0495665_0204709 3300046531 Bacteria 1022
486 Ga0495640_0000947 3300046533 Bacteria 22435
487 Ga0495640_0001350 3300046533 Bacteria 19280
488 Ga0495640_0058699 3300046533 Bacteria 2623
489 Ga0495640_0108055 3300046533 Bacteria 1820
490 Ga0495586_0097826 3300046535 Bacteria 1626
491 Ga0495587_0000009 3300046536 Bacteria 241480
492 Ga0495598_0005799 3300046537 Bacteria 2759
493 Ga0495621_0032930 3300046539 Bacteria 1784
494 Ga0495645_0000005 3300046543 Bacteria 443917
495 Ga0495622_0063970 3300046557 Bacteria 1702
496 Ga0495633_0241963 3300046558 Bacteria 824
497 Ga0495667_0000145 3300046559 Bacteria 48423
498 Ga0495667_0200847 3300046559 Bacteria 1276
499 Ga0495656_0083290 3300046615 Bacteria 1448
500 Ga0495634_0000941 3300046642 Bacteria 27590
501 Ga0495634_0001750 3300046642 Bacteria 18799
502 Ga0495635_0000014 3300046663 Bacteria 218080
503 Ga0495635_0218677 3300046663 Bacteria 1289
504 Ga0495635_0331048 3300046663 Bacteria 1018
505 Ga0495659_0197067 3300046664 Bacteria 825
506 Ga0495599_0000010 3300046678 Bacteria 211658
507 Ga0495623_0000119 3300046679 Bacteria 48268
508 Ga0495646_0000008 3300046680 Bacteria 214486
509 Ga0495658_0095603 3300046683 Bacteria 1766
510 Ga0495658_0212797 3300046683 Bacteria 1208
511 Ga0495658_0431538 3300046683 Bacteria 841
512 Ga0495613_0011650 3300046689 Bacteria 6537
513 Ga0495613_0073397 3300046689 Bacteria 2493
514 Ga0495613_0351236 3300046689 Bacteria 1013
515 Ga0495624_0001454 3300046690 Bacteria 18421
516 Ga0495671_0290710 3300046692 Bacteria 787
517 Ga0495600_0021058 3300046809 Bacteria 4172
518 Ga0495581_0004424 3300047315 Bacteria 8125
519 Ga0495581_0027761 3300047315 Bacteria 3283
520 Ga0495604_0000006 3300047317 Bacteria 420480
521 Ga0495674_0000005 3300047319 Bacteria 375129
522 Ga0495674_0225588 3300047319 Bacteria 1548
523 Ga0495674_0575517 3300047319 Bacteria 894
524 Ga0495672_0107168 3300047320 Bacteria 1505
525 Ga0495680_0002789 3300047322 Bacteria 17613
526 Ga0495683_0136558 3300047323 Bacteria 1152
527 Ga0495675_0000806 3300047444 Bacteria 19300
528 Ga0495684_0001275 3300047471 Bacteria 20286
529 Ga0495684_0001418 3300047471 Bacteria 19212
530 Ga0495684_0002706 3300047471 Bacteria 14030
531 Ga0495684_0092094 3300047471 Bacteria 2296
532 Ga0495684_0252665 3300047471 Bacteria 1282
533 Ga0495593_0013626 3300047673 Bacteria 4634
534 Ga0495602_0002313 3300048088 Bacteria 19257
535 Ga0495602_0144206 3300048088 Bacteria 1881
536 Ga0495602_0313315 3300048088 Bacteria 1144
537 Ga0496100_0005878 3300048903 Bacteria 6643
538 Ga0496100_0331867 3300048903 Bacteria 1145
539 Ga0496100_0360116 3300048903 Bacteria 1100
540 Ga0496100_0674129 3300048903 Bacteria 806
541 Ga0496100_0775006 3300048903 Bacteria 751
542 Ga0496101_0003932 3300048904 Bacteria 9286
543 Ga0496101_0142534 3300048904 Bacteria 1827
544 Ga0496102_0020461 3300048905 Bacteria 5847
545 Ga0496103_0085548 3300048906 Bacteria 1987
546 Ga0496104_0043112 3300048907 Bacteria 4237
547 Ga0496104_0566079 3300048907 Bacteria 1047
548 Ga0496104_0573984 3300048907 Bacteria 1038
549 Ga0496105_0036916 3300048908 Bacteria 4026
550 Ga0496105_0098214 3300048908 Bacteria 2418
551 Ga0496105_0404475 3300048908 Bacteria 1083
552 Ga0496106_0004676 3300048909 Bacteria 10151
553 Ga0496106_0173603 3300048909 Bacteria 1709
554 Ga0496107_0110560 3300048910 Bacteria 2019
555 Ga0496108_0002173 3300048911 Bacteria 15728
556 Ga0496108_0031731 3300048911 Bacteria 4385
557 Ga0496108_0161326 3300048911 Bacteria 1938
558 Ga0496108_0347890 3300048911 Bacteria 1293
559 Ga0496109_0010264 3300048912 Bacteria 7996
560 Ga0496109_0011371 3300048912 Bacteria 7647
561 Ga0496109_0054252 3300048912 Bacteria 3656
562 Ga0496109_0164829 3300048912 Bacteria 2077
563 Ga0496109_0876997 3300048912 Bacteria 835
564 Ga0496110_0013717 3300048913 Bacteria 6713
565 Ga0496110_0014973 3300048913 Bacteria 6447
566 Ga0496110_0029499 3300048913 Bacteria 4722
567 Ga0496110_0046849 3300048913 Bacteria 3783
568 Ga0496110_0635142 3300048913 Bacteria 967
569 Ga0496110_1119444 3300048913 Bacteria 696
570 Ga0496111_0019435 3300048914 Bacteria 4718
571 Ga0496111_0041404 3300048914 Bacteria 3305
572 Ga0496111_0065815 3300048914 Bacteria 2631
573 Ga0496112_0038561 3300048915 Bacteria 4666
574 Ga0496112_0044780 3300048915 Bacteria 4336
575 Ga0496112_0877617 3300048915 Bacteria 820
576 Ga0496113_0062234 3300048916 Bacteria 2818
577 Ga0496113_0982552 3300048916 Bacteria 665
578 Ga0496114_0119673 3300048917 Bacteria 2264
579 Ga0496114_0125346 3300048917 Bacteria 2213
580 Ga0496114_0129965 3300048917 Bacteria 2174
581 Ga0496115_0007155 3300048918 Bacteria 8195
582 Ga0496115_0020530 3300048918 Bacteria 5096
583 Ga0496115_0035648 3300048918 Bacteria 3937
584 Ga0496117_0320067 3300048920 Bacteria 813
585 Ga0496119_0001342 3300048922 Bacteria 30120
586 Ga0496122_0001850 3300048925 Bacteria 32258
587 Ga0496123_0000498 3300048926 Bacteria 68151
588 Ga0496126_0250313 3300048929 Bacteria 1477
589 Ga0501318_018481 3300049534 Bacteria 861
590 Ga0501031_0050004 3300049568 Bacteria 2724
591 Ga0501031_0063665 3300049568 Bacteria 2402
592 Ga0501031_0255318 3300049568 Bacteria 1139
593 Ga0501031_0640911 3300049568 Bacteria 683
594 Ga0501032_0035499 3300049569 Bacteria 3408
595 Ga0501032_0249344 3300049569 Bacteria 1153
596 Ga0501033_0041023 3300049570 Bacteria 3454
597 Ga0501033_0050805 3300049570 Bacteria 3074
598 Ga0501033_0089925 3300049570 Bacteria 2246
599 Ga0501033_0133042 3300049570 Bacteria 1801
600 Ga0501033_0285339 3300049570 Bacteria 1165
601 Ga0501034_0003327 3300049571 Bacteria 18346
602 Ga0501034_0012125 3300049571 Bacteria 8911
603 Ga0501034_0080885 3300049571 Bacteria 3252
604 Ga0501034_0200457 3300049571 Bacteria 1954
605 Ga0501034_0216274 3300049571 Bacteria 1870
606 Ga0501034_0524092 3300049571 Bacteria 1097
607 Ga0501034_0643165 3300049571 Bacteria 963
608 Ga0501034_0658676 3300049571 Bacteria 948
609 Ga0501036_0004998 3300049572 Bacteria 10727
610 Ga0501036_0014273 3300049572 Bacteria 6609
611 Ga0501037_0012864 3300049573 Bacteria 6167
612 Ga0501037_0117643 3300049573 Bacteria 1912
613 Ga0501037_0121310 3300049573 Bacteria 1879
614 Ga0501037_0138863 3300049573 Bacteria 1740
615 Ga0501038_0004685 3300049574 Bacteria 12731
616 Ga0501038_0017105 3300049574 Bacteria 6559
617 Ga0501038_0107515 3300049574 Bacteria 2314
618 Ga0501038_0187675 3300049574 Bacteria 1665
619 Ga0501039_0160326 3300049575 Bacteria 1768
620 Ga0501039_0169351 3300049575 Bacteria 1717
621 Ga0501039_0349722 3300049575 Bacteria 1161
622 Ga0501039_0528803 3300049575 Bacteria 926
623 Ga0501040_0031976 3300049576 Bacteria 3559
624 Ga0501041_0611848 3300049577 Bacteria 696
625 Ga0501042_0105107 3300049578 Bacteria 2032
626 Ga0501043_0045796 3300049579 Bacteria 3439
627 Ga0501043_0063973 3300049579 Bacteria 2889
628 Ga0501043_0236833 3300049579 Bacteria 1409
629 Ga0501046_0034143 3300049580 Bacteria 4107
630 Ga0501046_0431621 3300049580 Bacteria 949
631 Ga0501047_0023678 3300049581 Bacteria 5895
632 Ga0501047_0036351 3300049581 Bacteria 4760
633 Ga0501047_0277904 3300049581 Bacteria 1520
634 Ga0501047_0296365 3300049581 Bacteria 1460
635 Ga0501048_0091551 3300049582 Bacteria 2145
636 Ga0501048_0319704 3300049582 Bacteria 1106
637 Ga0501067_0012909 3300049583 Bacteria 4625
638 Ga0501069_0001745 3300049585 Bacteria 10845
639 Ga0501069_0057521 3300049585 Bacteria 2168
640 Ga0501070_0027558 3300049586 Bacteria 4765
641 Ga0501070_0074851 3300049586 Bacteria 2803
642 Ga0501070_0123101 3300049586 Bacteria 2143
643 Ga0501070_0222736 3300049586 Bacteria 1546
644 Ga0501070_0313004 3300049586 Bacteria 1278
645 Ga0501070_0333902 3300049586 Bacteria 1232
646 Ga0501070_0854900 3300049586 Bacteria 712
647 Ga0501071_0015644 3300049587 Bacteria 5209
648 Ga0501071_0034014 3300049587 Bacteria 3625
649 Ga0501071_0467130 3300049587 Bacteria 966
650 Ga0501071_0592771 3300049587 Bacteria 852
651 Ga0501072_0000939 3300049588 Bacteria 21461
652 Ga0501072_0004815 3300049588 Bacteria 10278
653 Ga0501072_0125897 3300049588 Bacteria 2042
654 Ga0501072_0699507 3300049588 Bacteria 797
655 Ga0501073_0020046 3300049589 Bacteria 4822
656 Ga0501073_0020369 3300049589 Bacteria 4784
657 Ga0501073_0191426 3300049589 Bacteria 1415
658 Ga0501073_0266151 3300049589 Bacteria 1183
659 Ga0501074_0054425 3300049590 Bacteria 2885
660 Ga0501074_0248668 3300049590 Bacteria 1264
661 Ga0501074_0388708 3300049590 Bacteria 990
662 Ga0501074_0389034 3300049590 Bacteria 989
663 Ga0501075_0018333 3300049591 Bacteria 5065
664 Ga0501076_0071225 3300049592 Bacteria 2781
665 Ga0501076_0227319 3300049592 Bacteria 1525
666 Ga0501076_0488549 3300049592 Bacteria 1015
667 Ga0501238_026423 3300049671 Bacteria 833
668 Ga0501079_0205755 3300049741 Bacteria 1537
669 Ga0501080_0015948 3300049742 Bacteria 6930
670 Ga0501080_0207096 3300049742 Bacteria 1798
671 Ga0501080_0279661 3300049742 Bacteria 1517
672 Ga0501080_0594570 3300049742 Bacteria 983
673 Ga0501083_0004516 3300049744 Bacteria 9834
674 Ga0501083_0005650 3300049744 Bacteria 8855
675 Ga0501083_0033066 3300049744 Bacteria 3542
676 Ga0501083_0046272 3300049744 Bacteria 2942
677 Ga0501083_0047806 3300049744 Bacteria 2889
678 Ga0501083_0150465 3300049744 Bacteria 1524
679 Ga0501083_0285392 3300049744 Bacteria 1073
680 Ga0501083_0330378 3300049744 Bacteria 991
681 Ga0501083_0431474 3300049744 Bacteria 857
682 Ga0501035_0038212 3300049822 Bacteria 4346
683 Ga0501035_0115496 3300049822 Bacteria 2349
684 Ga0501035_0279600 3300049822 Bacteria 1411
685 Ga0501035_0293448 3300049822 Bacteria 1372
686 Ga0501035_1064728 3300049822 Bacteria 633
687 Ga0501044_0000116 3300049823 Bacteria 96626
688 Ga0501044_0097872 3300049823 Bacteria 2954
689 Ga0501044_0120610 3300049823 Bacteria 2624
690 Ga0501044_0279809 3300049823 Bacteria 1602
691 Ga0501044_0420910 3300049823 Bacteria 1246
692 Ga0501045_0073422 3300049824 Bacteria 2519
693 nmdc:mga03683_156698_c1 3300050489 Bacteria 1030
694 nmdc:mga03683_224071_c1 3300050489 Bacteria 868
695 nmdc:mga00v17_109964_c1 3300050491 Bacteria 1748
696 nmdc:mga00v17_69278_c2 3300050491 Bacteria 1592
697 nmdc:mga0yw44_406600_c1 3300050492 Bacteria 921
698 nmdc:mga0k408_517470_c1 3300050493 Bacteria 706
699 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
700 nmdc:mga05p37_31141_c1 3300050507 Bacteria 6515
701 nmdc:mga05p37_390210_c1 3300050507 Bacteria 1628
702 nmdc:mga05p37_530592_c1 3300050507 Bacteria 1344
703 nmdc:mga05p37_981084_c1 3300050507 Bacteria 900
704 nmdc:mga09592_12508_c1 3300050508 Bacteria 6916
705 nmdc:mga09592_300860_c1 3300050508 Bacteria 1391
706 nmdc:mga09592_37448_c1 3300050508 Bacteria 4069
707 nmdc:mga0qj67_16354_c1 3300050509 Bacteria 5625
708 nmdc:mga0qj67_74899_c1 3300050509 Bacteria 2705
709 nmdc:mga06r32_196385_c1 3300050510 Bacteria 2005
710 nmdc:mga06r32_50328_c1 3300050510 Bacteria 3985
711 nmdc:mga06r32_688060_c1 3300050510 Bacteria 989
712 nmdc:mga06r32_714_c1 3300050510 Bacteria 29059
713 nmdc:mga08y16_105351_c1 3300050511 Bacteria 2936
714 nmdc:mga08y16_1811_c1 3300050511 Bacteria 21663
715 nmdc:mga08y16_412218_c1 3300050511 Bacteria 1382
716 nmdc:mga0n895_1057743_c1 3300050512 Bacteria 790
717 nmdc:mga0n895_247314_c1 3300050512 Bacteria 1810
718 nmdc:mga0n895_43372_c1 3300050512 Bacteria 4383
719 nmdc:mga0n895_517937_c1 3300050512 Bacteria 1200
720 nmdc:mga0rr50_31471_c1 3300050513 Bacteria 3768
721 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
722 nmdc:mga08x19_52556_c1 3300050514 Bacteria 2620
723 nmdc:mga08x19_80915_c1 3300050514 Bacteria 2133
724 nmdc:mga0a205_4829_c1 3300050515 Bacteria 9802
725 Ga0495601_0000005 3300053077 Bacteria 387079
726 Ga0495601_0019966 3300053077 Bacteria 4089
727 Ga0495601_0042296 3300053077 Bacteria 2858
728 Ga0495612_0000001 3300053078 Bacteria 418244
729 Ga0495612_0000692 3300053078 Bacteria 13609
730 Ga0495655_0058963 3300053083 Bacteria 1041
731 Ga0495595_0000304 3300053084 Bacteria 19110
732 Ga0495595_0002561 3300053084 Bacteria 7137
733 Ga0495595_0025981 3300053084 Bacteria 2598
734 Ga0495595_0226797 3300053084 Bacteria 933
735 Ga0495619_0000017 3300053085 Bacteria 219276
736 Ga0495619_0003188 3300053085 Bacteria 10626
737 Ga0495619_0066341 3300053085 Bacteria 2408
738 Ga0495619_0193370 3300053085 Bacteria 1408
739 Ga0500647_0092134 3300053091 Bacteria 1450
740 Ga0500566_0062547 3300053094 Bacteria 2104
741 Ga0500641_0008839 3300053096 Bacteria 3607
742 Ga0500641_0030155 3300053096 Bacteria 2129
743 Ga0500556_0000048 3300053104 Bacteria 123558
744 Ga0500562_070743 3300053108 Bacteria 941
745 Ga0500593_000013 3300053117 Bacteria 59669
746 Ga0500595_009162 3300053119 Bacteria 4009
747 Ga0500595_028262 3300053119 Bacteria 1913
748 Ga0500642_0076693 3300053130 Bacteria 1529
749 Ga0500652_000002 3300053131 Bacteria 273315
750 Ga0500652_105140 3300053131 Bacteria 1180
751 Ga0500568_0000001 3300053139 Bacteria 988705
752 Ga0500568_0049428 3300053139 Bacteria 1660
753 Ga0500588_0004399 3300053146 Bacteria 3052
754 Ga0500604_0000091 3300053151 Bacteria 29061
755 Ga0500616_0011123 3300053153 Bacteria 5341
756 Ga0500616_0027109 3300053153 Bacteria 3166
757 Ga0500616_0237159 3300053153 Bacteria 786
758 Ga0500624_021962 3300053157 Bacteria 1035
759 Ga0500627_0282631 3300053158 Bacteria 728
760 Ga0500637_0001399 3300053178 Bacteria 10262
761 Ga0501084_0078951 3300054114 Bacteria 2758
762 Ga0501084_0126127 3300054114 Bacteria 2154
763 Ga0501084_0232939 3300054114 Bacteria 1554
764 Ga0501084_0255752 3300054114 Bacteria 1478
765 Ga0501084_0643646 3300054114 Bacteria 895
766 Ga0590071_047627 3300059421 Bacteria 1037
767 Ga0501082_0000084 3300060353 Bacteria 70644
768 Ga0501082_0051027 3300060353 Bacteria 3566
769 Ga0501082_0097787 3300060353 Bacteria 2538
770 Ga0501082_0151854 3300060353 Bacteria 2012
771 Ga0501082_0218798 3300060353 Bacteria 1657
772 Ga0530510_0015528 3300061734 Bacteria 5383
773 2508733221 2508501050 Bacteria 9633614
774 2509075534 2508501114 Bacteria 7082538
775 2524612123 2524023250 Bacteria 5457705
776 2644728674 2643221733 Bacteria 5690728
777 2774868633 2773857925 Bacteria 6472445
778 2776260441 2775506901 Bacteria 9631051
779 2828309677 2828305725 Bacteria 4916900
780 2835316985 2835312727 Bacteria 7413381
781 2882460031 2882456835 Bacteria 6863978
782 2894234015 2894232714 Bacteria 8834183
783 8004215515 8004212874 Bacteria 2861420
784 Ga0207644_10419907
785 JGI25153J46596_10010210
786 Ga0065715_10270174
787 Ga0070658_10318421
788 Ga0070676_10021207
789 Ga0070676_10024845
790 Ga0068869_100625194
791 Ga0070680_100020040
792 Ga0068868_100053089
793 Ga0070660_100088699
794 Ga0070689_100013410
795 Ga0070687_100187930
796 Ga0070687_100198733
797 Ga0070668_100314298
798 Ga0070669_100257802
799 Ga0070675_100094611
800 Ga0070675_100142304
801 Ga0070671_100271832
802 Ga0070674_100003109
803 Ga0070674_100049922
804 Ga0070667_100418776
805 Ga0070714_100047550
806 Ga0070714_100371499
807 Ga0070710_10158146
808 Ga0070711_100014324
809 Ga0070711_100148362
810 Ga0070711_100242823
811 Ga0070678_100034607
812 Ga0070678_100041449
813 Ga0070678_100398110
814 Ga0070662_100678082
815 Ga0070681_10004738
816 Ga0070681_10089187
817 Ga0070681_10132888
818 Ga0070681_10331805
819 Ga0068867_100008373
820 Ga0068867_100733588
821 Ga0070706_100596953
822 Ga0070706_100624282
823 Ga0070698_100549605
824 Ga0070699_100176213
825 Ga0070679_100005303
826 Ga0070679_100463543
827 Ga0070684_100307568
828 Ga0070684_100327883
829 Ga0070697_100019164
830 Ga0070697_100319534
831 Ga0068853_100605522
832 Ga0070672_100094374
833 Ga0070672_100489371
834 Ga0070686_100090036
835 Ga0070686_100169807
836 Ga0070695_100060831
837 Ga0070696_100110288
838 Ga0070693_100232379
839 Ga0070665_100000913
840 Ga0070665_100653267
841 Ga0070665_100672664
842 Ga0070704_100160281
843 Ga0070704_100973458
844 Ga0068855_100168776
845 Ga0068855_100367664
846 Ga0068855_100482946
847 Ga0068855_101044525
848 Ga0070664_100165002
849 Ga0068854_100132511
850 Ga0070702_100029594
851 Ga0068852_100054067
852 Ga0068852_100146896
853 Ga0068864_100061280
854 Ga0068861_100075201
855 Ga0068863_100227726
856 Ga0068858_100245757
857 Ga0068862_100167529
858 Ga0081455_10025722
859 Ga0081455_10125296
860 Ga0081455_10367252
861 Ga0081538_10005050
862 Ga0081540_1000194
863 Ga0081540_1003980
864 Ga0081540_1030141
865 Ga0081539_10005651
866 Ga0070717_10084664
867 Ga0070717_10169379
868 Ga0070717_10254567
869 Ga0075365_10005800
870 Ga0075365_10394613
871 Ga0075368_10028231
872 Ga0075368_10065693
873 Ga0075363_100017907
874 Ga0075363_100083400
875 Ga0075364_10071882
876 Ga0075364_10104975
877 Ga0075364_10241015
878 Ga0070715_10390494
879 Ga0070716_100269755
880 Ga0070712_100010707
881 Ga0070712_100017711
882 Ga0070712_100374239
883 Ga0075362_10034328
884 Ga0075362_10180539
885 Ga0075362_10244644
886 Ga0075367_10010802
887 Ga0075367_10020548
888 Ga0075367_10549803
889 Ga0075369_10003352
890 Ga0075369_10135902
891 Ga0075366_10019201
892 Ga0075366_10032023
893 Ga0097621_101088944
894 Ga0075370_10155584
895 Ga0075370_10234177
896 Ga0068871_100497857
897 Ga0075428_100001228
898 Ga0075428_100192634
899 Ga0075428_100427705
900 Ga0075428_100442547
901 Ga0075428_101027531
902 Ga0075430_100000170
903 Ga0075430_100014636
904 Ga0075430_100256346
905 Ga0075430_100500405
906 Ga0075431_100000812
907 Ga0075431_100087543
908 Ga0075431_100178864
909 Ga0075431_100191421
910 Ga0075434_100042112
911 Ga0075434_100068602
912 Ga0075434_100414112
913 Ga0075429_100010495
914 Ga0075429_100012850
915 Ga0075429_100318630
916 Ga0075429_100787714
917 Ga0075436_100003022
918 Ga0075436_100013301
919 Ga0075435_100037566
920 Ga0075435_100067785
921 Ga0075435_100083024
922 Ga0099795_10006014
923 Ga0099795_10026882
924 Ga0105240_10143434
925 Ga0105240_10154842
926 Ga0105240_10163960
927 Ga0105240_10770582
928 Ga0105240_11265897
929 Ga0111539_10001371
930 Ga0111539_10042732
931 Ga0105245_10024476
932 Ga0105245_10785919
933 Ga0105245_10838684
934 Ga0105245_10853148
935 Ga0105247_10410716
936 Ga0114129_10005694
937 Ga0114129_10005820
938 Ga0114129_10440750
939 Ga0114129_10523361
940 Ga0114129_10639134
941 Ga0114129_10939959
942 Ga0105243_10461069
943 Ga0105248_10174924
944 Ga0105248_10175545
945 Ga0105248_10674573
946 Ga0105237_10690991
947 Ga0105237_11089809
948 Ga0105238_10031321
949 Ga0105238_10039306
950 Ga0105238_10088301
951 Ga0105238_10099775
952 Ga0105238_10272795
953 Ga0105249_10278254
954 Ga0105249_10349699
955 Ga0105249_10579172
956 Ga0105239_10124928
957 Ga0105246_10111898
958 Ga0157370_10351288
959 Ga0157378_10105957
960 Ga0157378_10318584
961 Ga0157378_10531941
962 Ga0157378_11628366
963 Ga0157375_10117613
964 Ga0157375_10310554
965 Ga0157375_10542899
966 Ga0157375_10603940
967 Ga0157380_10146522
968 Ga0157380_10935645
969 Ga0157377_10687316
970 Ga0157379_10341441
971 Ga0157376_10095816
972 Ga0163161_10291441
973 Ga0206353_10806976
974 Ga0213874_10031623
975 Ga0213876_10099014
976 Ga0213871_10100434
977 Ga0209646_1000030
978 Ga0209758_1000385
979 Ga0207697_10019432
980 Ga0207697_10091181
981 Ga0207692_10020829
982 Ga0207692_10045877
983 Ga0207710_10204562
984 Ga0207688_10105026
985 Ga0207688_10116658
986 Ga0207685_10102251
987 Ga0207699_10068772
988 Ga0207699_10106311
989 Ga0207699_10618816
990 Ga0207645_10015040
991 Ga0207645_10097906
992 Ga0207705_10074153
993 Ga0207705_10419316
994 Ga0207705_10604251
995 Ga0207684_10097529
996 Ga0207684_10552109
997 Ga0207707_10022094
998 Ga0207707_10033427
999 Ga0207707_10069780
1000 Ga0207695_10103484
1001 Ga0207695_10147056
1002 Ga0207695_10764735
1003 Ga0207693_10013809
1004 Ga0207693_10177987
1005 Ga0207693_10287955
1006 Ga0207663_10024626
1007 Ga0207663_10101049
1008 Ga0207660_10016056
1009 Ga0207660_10204767
1010 Ga0207657_10020194
1011 Ga0207657_10381290
1012 Ga0207652_10017504
1013 Ga0207652_10089042
1014 Ga0207694_10014321
1015 Ga0207694_10376808
1016 Ga0207694_10609709
1017 Ga0207659_10274437
1018 Ga0207659_10457160
1019 Ga0207700_10808342
1020 Ga0207690_10608024
1021 Ga0207706_10167446
1022 Ga0207670_10001629
1023 Ga0207669_10002621
1024 Ga0207669_10012717
1025 Ga0207704_10590653
1026 Ga0207665_10082598
1027 Ga0207691_10008224
1028 Ga0207691_10157908
1029 Ga0207711_10077903
1030 Ga0207711_10424825
1031 Ga0207689_10264720
1032 Ga0207689_10355200
1033 Ga0207679_10088406
1034 Ga0207667_10016783
1035 Ga0207667_10131297
1036 Ga0207667_10167227
1037 Ga0207667_10737557
1038 Ga0207667_10863042
1039 Ga0207651_10576854
1040 Ga0207712_10545110
1041 Ga0207668_10356255
1042 Ga0207668_10632870
1043 Ga0207640_10235668
1044 Ga0207658_10206373
1045 Ga0207677_10031527
1046 Ga0207703_10235063
1047 Ga0207708_10213686
1048 Ga0207648_10005736
1049 Ga0207648_10474852
1050 Ga0207648_10554002
1051 Ga0207676_10024100
1052 Ga0207676_10697966
1053 Ga0207675_100426118
1054 Ga0207683_10007234
1055 Ga0207683_10130944
1056 Ga0207428_10002878
1057 Ga0268266_10000346
1058 Ga0268266_10168092
1059 Ga0268266_11362415
1060 Ga0268265_10080958
1061 Ga0265318_10082322
1062 Ga0265338_10131800
1063 Ga0265330_10041409
1064 Ga0265330_10184443
1065 Ga0265328_10000445
1066 Ga0265328_10021331
1067 Ga0265328_10200917
1068 Ga0265325_10018262
1069 Ga0265325_10036906
1070 Ga0265325_10065711
1071 Ga0265325_10080223
1072 Ga0265325_10144439
1073 Ga0265329_10004861
1074 Ga0265340_10000814
1075 Ga0265340_10021426
1076 Ga0265340_10041676
1077 Ga0265340_10046379
1078 Ga0265340_10112894
1079 Ga0265339_10029504
1080 Ga0265339_10103546
1081 Ga0265339_10109397
1082 Ga0265339_10116796
1083 Ga0265339_10154000
1084 Ga0265339_10168824
1085 Ga0265339_10316441
1086 Ga0265331_10000082
1087 Ga0265331_10119367
1088 Ga0265316_10135699
1089 Ga0265316_10186232
1090 Ga0265316_10276061
1091 Ga0265316_10386047
1092 Ga0307513_10124887
1093 Ga0307408_100093673
1094 Ga0307408_100183139
1095 Ga0307408_100328195
1096 Ga0265313_10000554
1097 Ga0265313_10013708
1098 Ga0316575_10016371
1099 Ga0316579_10139624
1100 Ga0316579_10290113
1101 Ga0265314_10004396
1102 Ga0265314_10022913
1103 Ga0265314_10079643
1104 Ga0265342_10001033
1105 Ga0265342_10034165
1106 Ga0265342_10038515
1107 Ga0265342_10056104
1108 Ga0265342_10097528
1109 Ga0265342_10199325
1110 Ga0316576_10206978
1111 Ga0316576_10614320
1112 Ga0307413_10210830
1113 Ga0307413_10357204
1114 Ga0307413_10572795
1115 Ga0307410_10220931
1116 Ga0307407_10260546
1117 Ga0307409_100129350
1118 Ga0307409_100288234
1119 Ga0307416_100054363
1120 Ga0307416_100287067
1121 Ga0307414_10149142
1122 Ga0307414_10528206
1123 Ga0307411_10090026
1124 Ga0316583_10016520
1125 Ga0373930_0049440
1126 Ga0373958_0057270
1127 Ga0373959_0053882
1128 Ga0373929_0029912
1129 Ga0373949_0062383
1130 Ga0373951_0087938
1131 Ga0373952_0018052
1132 Ga0373936_0005310
1133 Ga0373936_0195284
1134 Ga0373939_0008035
1135 Ga0373941_0092888
1136 Ga0373945_0007389
1137 Ga0373945_0100759
1138 Ga0373953_0013201
1139 Ga0373954_0010307
1140 Ga0373954_0081122
1141 Ga0373957_0032542
1142 Ga0373960_0035058
1143 Ga0373943_0000268
1144 Ga0373943_0012004
1145 Ga0373943_0298335
1146 Ga0373946_0001967
1147 Ga0373946_0016212
1148 Ga0373955_0010606
1149 Ga0373955_0021860
1150 Ga0373955_0160983
1151 Ga0373961_0043358
1152 Ga0316574_0000507
1153 Ga0373924_0030653
1154 Ga0373931_0003730
1155 Ga0373931_0019831
1156 Ga0373931_0060117
1157 Ga0373935_0002242
1158 Ga0373935_0011850
1159 Ga0373935_0036347
1160 Ga0373935_0341103
1161 Ga0373935_0655331
1162 Ga0373935_0955459
1163 Ga0373927_0001748
1164 Ga0373927_0017897
1165 Ga0373927_0038320
1166 Ga0373927_0055513
1167 Ga0373927_0090278
1168 Ga0373927_0110273
1169 Ga0373927_0177145
1170 Ga0373933_0007061
1171 Ga0373947_0001270
1172 Ga0373947_0009494
1173 Ga0373947_0021720
1174 Ga0373947_0049699
1175 Ga0373947_0058781
1176 Ga0373937_0000326
1177 Ga0373937_0319117
1178 Ga0373937_1062777
1179 Ga0316582_0295883
1180 Ga0316582_0507851
1181 Ga0373925_0002641
1182 Ga0373925_0010083
1183 Ga0373925_0024003
1184 Ga0373925_0057672
1185 Ga0373925_0104794
1186 Ga0373925_0191946
1187 Ga0373925_0217079
1188 Ga0373925_0409492
1189 Ga0373925_0965104
1190 Ga0395899_0006002
1191 Ga0395899_0027248
1192 Ga0395900_0003929
1193 Ga0395898_0043976
1194 Ga0395898_0061629
1195 Ga0395905_0092047
1196 Ga0395905_0997286
1197 Ga0436364_0850496
1198 Ga0436364_0885754
1199 Ga0436364_1109044
1200 Ga0436364_1228402
1201 Ga0436364_1338625
1202 Ga0395901_0022173
1203 Ga0395901_0031439
1204 Ga0395901_0267709
1205 Ga0436365_0158765
1206 Ga0436365_0243474
1207 Ga0436365_1324643
1208 Ga0436360_0945414
1209 Ga0436360_1180969
1210 Ga0436361_0393934
1211 Ga0436361_0958976
1212 Ga0436363_0940222
1213 Ga0436363_1409348
1214 Ga0436362_0173993
1215 Ga0439453_0003358
1216 Ga0439465_0053468
1217 Ga0439431_0078030
1218 Ga0439443_001515
1219 Ga0439432_067982
1220 Ga0439450_011703
1221 Ga0450923_020616
1222 Ga0439446_0164304
1223 Ga0439458_0067302
1224 Ga0439435_0008721
1225 Ga0439460_0011049
1226 Ga0466972_0034647
1227 Ga0466966_0130821
1228 Ga0466970_0410242
1229 Ga0466957_0018226
1230 Ga0466959_0107292
1231 Ga0466959_0218707
1232 Ga0451576_0384614
1233 Ga0495592_0001009
1234 Ga0495592_0125594
1235 Ga0495603_0198710
1236 Ga0495603_0405815
1237 Ga0495590_0026819
1238 Ga0495629_0023536
1239 Ga0495629_0122320
1240 Ga0495629_0208237
1241 Ga0495651_0001005
1242 Ga0495651_0570203
1243 Ga0495653_0001279
1244 Ga0495653_0044827
1245 Ga0495580_0059860
1246 Ga0495605_0098558
1247 Ga0495639_0113280
1248 Ga0495662_0012656
1249 Ga0495662_0026024
1250 Ga0495662_0427421
1251 Ga0495664_0000518
1252 Ga0495664_0004700
1253 Ga0495584_0120464
1254 Ga0495594_0214649
1255 Ga0495608_0001062
1256 Ga0495610_0044499
1257 Ga0495618_0001010
1258 Ga0495618_0014498
1259 Ga0495628_0000010
1260 Ga0495628_0219859
1261 Ga0495630_0016239
1262 Ga0495630_0017046
1263 Ga0495630_0121268
1264 Ga0495663_0049329
1265 Ga0495652_0000008
1266 Ga0495652_0021286
1267 Ga0495652_0597314
1268 Ga0495665_0204709
1269 Ga0495640_0000947
1270 Ga0495640_0001350
1271 Ga0495640_0058699
1272 Ga0495640_0108055
1273 Ga0495586_0097826
1274 Ga0495587_0000009
1275 Ga0495598_0005799
1276 Ga0495621_0032930
1277 Ga0495645_0000005
1278 Ga0495622_0063970
1279 Ga0495633_0241963
1280 Ga0495667_0000145
1281 Ga0495667_0200847
1282 Ga0495656_0083290
1283 Ga0495634_0000941
1284 Ga0495634_0001750
1285 Ga0495635_0000014
1286 Ga0495635_0218677
1287 Ga0495635_0331048
1288 Ga0495659_0197067
1289 Ga0495599_0000010
1290 Ga0495623_0000119
1291 Ga0495646_0000008
1292 Ga0495658_0095603
1293 Ga0495658_0212797
1294 Ga0495658_0431538
1295 Ga0495613_0011650
1296 Ga0495613_0073397
1297 Ga0495613_0351236
1298 Ga0495624_0001454
1299 Ga0495671_0290710
1300 Ga0495600_0021058
1301 Ga0495581_0004424
1302 Ga0495581_0027761
1303 Ga0495604_0000006
1304 Ga0495674_0000005
1305 Ga0495674_0225588
1306 Ga0495674_0575517
1307 Ga0495672_0107168
1308 Ga0495680_0002789
1309 Ga0495683_0136558
1310 Ga0495675_0000806
1311 Ga0495684_0001275
1312 Ga0495684_0001418
1313 Ga0495684_0002706
1314 Ga0495684_0092094
1315 Ga0495684_0252665
1316 Ga0495593_0013626
1317 Ga0495602_0002313
1318 Ga0495602_0144206
1319 Ga0495602_0313315
1320 Ga0496100_0005878
1321 Ga0496100_0331867
1322 Ga0496100_0360116
1323 Ga0496100_0674129
1324 Ga0496100_0775006
1325 Ga0496101_0003932
1326 Ga0496101_0142534
1327 Ga0496102_0020461
1328 Ga0496103_0085548
1329 Ga0496104_0043112
1330 Ga0496104_0566079
1331 Ga0496104_0573984
1332 Ga0496105_0036916
1333 Ga0496105_0098214
1334 Ga0496105_0404475
1335 Ga0496106_0004676
1336 Ga0496106_0173603
1337 Ga0496107_0110560
1338 Ga0496108_0002173
1339 Ga0496108_0031731
1340 Ga0496108_0161326
1341 Ga0496108_0347890
1342 Ga0496109_0010264
1343 Ga0496109_0011371
1344 Ga0496109_0054252
1345 Ga0496109_0164829
1346 Ga0496109_0876997
1347 Ga0496110_0013717
1348 Ga0496110_0014973
1349 Ga0496110_0029499
1350 Ga0496110_0046849
1351 Ga0496110_0635142
1352 Ga0496110_1119444
1353 Ga0496111_0019435
1354 Ga0496111_0041404
1355 Ga0496111_0065815
1356 Ga0496112_0038561
1357 Ga0496112_0044780
1358 Ga0496112_0877617
1359 Ga0496113_0062234
1360 Ga0496113_0982552
1361 Ga0496114_0119673
1362 Ga0496114_0125346
1363 Ga0496114_0129965
1364 Ga0496115_0007155
1365 Ga0496115_0020530
1366 Ga0496115_0035648
1367 Ga0496117_0320067
1368 Ga0496119_0001342
1369 Ga0496122_0001850
1370 Ga0496123_0000498
1371 Ga0496126_0250313
1372 Ga0501318_018481
1373 Ga0501031_0050004
1374 Ga0501031_0063665
1375 Ga0501031_0255318
1376 Ga0501031_0640911
1377 Ga0501032_0035499
1378 Ga0501032_0249344
1379 Ga0501033_0041023
1380 Ga0501033_0050805
1381 Ga0501033_0089925
1382 Ga0501033_0133042
1383 Ga0501033_0285339
1384 Ga0501034_0003327
1385 Ga0501034_0012125
1386 Ga0501034_0080885
1387 Ga0501034_0200457
1388 Ga0501034_0216274
1389 Ga0501034_0524092
1390 Ga0501034_0643165
1391 Ga0501034_0658676
1392 Ga0501036_0004998
1393 Ga0501036_0014273
1394 Ga0501037_0012864
1395 Ga0501037_0117643
1396 Ga0501037_0121310
1397 Ga0501037_0138863
1398 Ga0501038_0004685
1399 Ga0501038_0017105
1400 Ga0501038_0107515
1401 Ga0501038_0187675
1402 Ga0501039_0160326
1403 Ga0501039_0169351
1404 Ga0501039_0349722
1405 Ga0501039_0528803
1406 Ga0501040_0031976
1407 Ga0501041_0611848
1408 Ga0501042_0105107
1409 Ga0501043_0045796
1410 Ga0501043_0063973
1411 Ga0501043_0236833
1412 Ga0501046_0034143
1413 Ga0501046_0431621
1414 Ga0501047_0023678
1415 Ga0501047_0036351
1416 Ga0501047_0277904
1417 Ga0501047_0296365
1418 Ga0501048_0091551
1419 Ga0501048_0319704
1420 Ga0501067_0012909
1421 Ga0501069_0001745
1422 Ga0501069_0057521
1423 Ga0501070_0027558
1424 Ga0501070_0074851
1425 Ga0501070_0123101
1426 Ga0501070_0222736
1427 Ga0501070_0313004
1428 Ga0501070_0333902
1429 Ga0501070_0854900
1430 Ga0501071_0015644
1431 Ga0501071_0034014
1432 Ga0501071_0467130
1433 Ga0501071_0592771
1434 Ga0501072_0000939
1435 Ga0501072_0004815
1436 Ga0501072_0125897
1437 Ga0501072_0699507
1438 Ga0501073_0020046
1439 Ga0501073_0020369
1440 Ga0501073_0191426
1441 Ga0501073_0266151
1442 Ga0501074_0054425
1443 Ga0501074_0248668
1444 Ga0501074_0388708
1445 Ga0501074_0389034
1446 Ga0501075_0018333
1447 Ga0501076_0071225
1448 Ga0501076_0227319
1449 Ga0501076_0488549
1450 Ga0501238_026423
1451 Ga0501079_0205755
1452 Ga0501080_0015948
1453 Ga0501080_0207096
1454 Ga0501080_0279661
1455 Ga0501080_0594570
1456 Ga0501083_0004516
1457 Ga0501083_0005650
1458 Ga0501083_0033066
1459 Ga0501083_0046272
1460 Ga0501083_0047806
1461 Ga0501083_0150465
1462 Ga0501083_0285392
1463 Ga0501083_0330378
1464 Ga0501083_0431474
1465 Ga0501035_0038212
1466 Ga0501035_0115496
1467 Ga0501035_0279600
1468 Ga0501035_0293448
1469 Ga0501035_1064728
1470 Ga0501044_0000116
1471 Ga0501044_0097872
1472 Ga0501044_0120610
1473 Ga0501044_0279809
1474 Ga0501044_0420910
1475 Ga0501045_0073422
1476 nmdc:mga03683_156698_c1
1477 nmdc:mga03683_224071_c1
1478 nmdc:mga00v17_109964_c1
1479 nmdc:mga00v17_69278_c2
1480 nmdc:mga0yw44_406600_c1
1481 nmdc:mga0k408_517470_c1
1482 nmdc:mga05p37_14_c1
1483 nmdc:mga05p37_31141_c1
1484 nmdc:mga05p37_390210_c1
1485 nmdc:mga05p37_530592_c1
1486 nmdc:mga05p37_981084_c1
1487 nmdc:mga09592_12508_c1
1488 nmdc:mga09592_300860_c1
1489 nmdc:mga09592_37448_c1
1490 nmdc:mga0qj67_16354_c1
1491 nmdc:mga0qj67_74899_c1
1492 nmdc:mga06r32_196385_c1
1493 nmdc:mga06r32_50328_c1
1494 nmdc:mga06r32_688060_c1
1495 nmdc:mga06r32_714_c1
1496 nmdc:mga08y16_105351_c1
1497 nmdc:mga08y16_1811_c1
1498 nmdc:mga08y16_412218_c1
1499 nmdc:mga0n895_1057743_c1
1500 nmdc:mga0n895_247314_c1
1501 nmdc:mga0n895_43372_c1
1502 nmdc:mga0n895_517937_c1
1503 nmdc:mga0rr50_31471_c1
1504 nmdc:mga08x19_14_c1
1505 nmdc:mga08x19_52556_c1
1506 nmdc:mga08x19_80915_c1
1507 nmdc:mga0a205_4829_c1
1508 Ga0495601_0000005
1509 Ga0495601_0019966
1510 Ga0495601_0042296
1511 Ga0495612_0000001
1512 Ga0495612_0000692
1513 Ga0495655_0058963
1514 Ga0495595_0000304
1515 Ga0495595_0002561
1516 Ga0495595_0025981
1517 Ga0495595_0226797
1518 Ga0495619_0000017
1519 Ga0495619_0003188
1520 Ga0495619_0066341
1521 Ga0495619_0193370
1522 Ga0500647_0092134
1523 Ga0500566_0062547
1524 Ga0500641_0008839
1525 Ga0500641_0030155
1526 Ga0500556_0000048
1527 Ga0500562_070743
1528 Ga0500593_000013
1529 Ga0500595_009162
1530 Ga0500595_028262
1531 Ga0500642_0076693
1532 Ga0500652_000002
1533 Ga0500652_105140
1534 Ga0500568_0000001
1535 Ga0500568_0049428
1536 Ga0500588_0004399
1537 Ga0500604_0000091
1538 Ga0500616_0011123
1539 Ga0500616_0027109
1540 Ga0500616_0237159
1541 Ga0500624_021962
1542 Ga0500627_0282631
1543 Ga0500637_0001399
1544 Ga0501084_0078951
1545 Ga0501084_0126127
1546 Ga0501084_0232939
1547 Ga0501084_0255752
1548 Ga0501084_0643646
1549 Ga0590071_047627
1550 Ga0501082_0000084
1551 Ga0501082_0051027
1552 Ga0501082_0097787
1553 Ga0501082_0151854
1554 Ga0501082_0218798
1555 Ga0530510_0015528
1556 2508733221
1557 2509075534
1558 2524612123
1559 2644728674
1560 2774868633
1561 2776260441
1562 2828309677
1563 2835316985
1564 2882460031
1565 2894234015
1566 8004215515

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

3

188

0.96

PF07722

Peptidase_C26

Peptidase C26

61

170

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9403 2 186
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9385 2 195
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9378 2 195
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9354 2 195
8hx8-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate 0.9335 2 195
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9786 1 186 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9694 1 186 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9683 1 186 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9667 2 186 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9548 1 189 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2W2ANN0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9844 1 190 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-M9MHV9-F1-model_v4 deleted 0.9839 1 189
AF-A0A238W3H8-F1-model_v4 Anthranilate synthase, component II 0.9834 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0046654
GO:0046820
AF-A0A328YFL9-F1-model_v4 Anthranilate synthase component 2 0.9827 1 185 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2S9UDB9-F1-model_v4 Aminodeoxychorismate synthase component II 0.9825 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0046654
GO:0046820

Map