F480661
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 383 | 1566 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300025931|Ga0207644_10419907|Ga0207644_104199072 |
| Length | 239 |
| Sequence | MILLIDNYDSFTFNLVHYLGGLGAEVAVHRNDKIGVRDVIAANPDAIVMSPGPCTPNEAGICLDLIAAAAPTIPMLGVCLGHQAIGQAFGGKVVRAPVPVHGKLSDIKHQGQSVFRGINGSFKATRYHSLVVDRANLPTELSVTAETSDRLIMGVAHRTLPVHGVQFHPESIASEHGHLILKNFLEIAAQWNAATGRRARRAFTTGWSMRQAVRTSRSSAPPRAPRPIPSWRCWRAAAC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 152 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 161 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 173 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 175 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 187 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 211 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 212 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 213 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 214 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 217 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 218 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 219 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 220 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 221 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 222 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 223 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 300 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 301 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 339 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 354 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 355 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 356 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 358 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 359 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 360 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 361 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 362 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 364 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 367 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 371 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 373 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 374 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 375 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 376 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 377 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 378 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 379 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 380 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 381 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 382 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 383 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 0.26 |
| Isolates | 1.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.51 |
| Nodule | 0.51 |
| Rhizoplane | 6 |
| Rhizosphere | 83.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207644_10419907 | 3300025931 | Bacteria | 1096 |
| 2 | JGI25153J46596_10010210 | 3300003215 | Bacteria | 4268 |
| 3 | Ga0065715_10270174 | 3300005293 | Bacteria | 1081 |
| 4 | Ga0070658_10318421 | 3300005327 | Bacteria | 1328 |
| 5 | Ga0070676_10021207 | 3300005328 | Bacteria | 3636 |
| 6 | Ga0070676_10024845 | 3300005328 | Bacteria | 3380 |
| 7 | Ga0068869_100625194 | 3300005334 | Bacteria | 912 |
| 8 | Ga0070680_100020040 | 3300005336 | Bacteria | 5302 |
| 9 | Ga0068868_100053089 | 3300005338 | Bacteria | 3193 |
| 10 | Ga0070660_100088699 | 3300005339 | Bacteria | 2436 |
| 11 | Ga0070689_100013410 | 3300005340 | Bacteria | 5930 |
| 12 | Ga0070687_100187930 | 3300005343 | Bacteria | 1242 |
| 13 | Ga0070687_100198733 | 3300005343 | Bacteria | 1213 |
| 14 | Ga0070668_100314298 | 3300005347 | Bacteria | 1317 |
| 15 | Ga0070669_100257802 | 3300005353 | Bacteria | 1390 |
| 16 | Ga0070675_100094611 | 3300005354 | Bacteria | 2507 |
| 17 | Ga0070675_100142304 | 3300005354 | Bacteria | 2051 |
| 18 | Ga0070671_100271832 | 3300005355 | Bacteria | 1440 |
| 19 | Ga0070674_100003109 | 3300005356 | Bacteria | 9242 |
| 20 | Ga0070674_100049922 | 3300005356 | Bacteria | 2879 |
| 21 | Ga0070667_100418776 | 3300005367 | Bacteria | 1221 |
| 22 | Ga0070714_100047550 | 3300005435 | Bacteria | 3645 |
| 23 | Ga0070714_100371499 | 3300005435 | Bacteria | 1346 |
| 24 | Ga0070710_10158146 | 3300005437 | Bacteria | 1403 |
| 25 | Ga0070711_100014324 | 3300005439 | Bacteria | 4996 |
| 26 | Ga0070711_100148362 | 3300005439 | Bacteria | 1766 |
| 27 | Ga0070711_100242823 | 3300005439 | Bacteria | 1409 |
| 28 | Ga0070678_100034607 | 3300005456 | Bacteria | 3519 |
| 29 | Ga0070678_100041449 | 3300005456 | Bacteria | 3264 |
| 30 | Ga0070678_100398110 | 3300005456 | Bacteria | 1196 |
| 31 | Ga0070662_100678082 | 3300005457 | Bacteria | 871 |
| 32 | Ga0070681_10004738 | 3300005458 | Bacteria | 13025 |
| 33 | Ga0070681_10089187 | 3300005458 | Bacteria | 3035 |
| 34 | Ga0070681_10132888 | 3300005458 | Bacteria | 2420 |
| 35 | Ga0070681_10331805 | 3300005458 | Bacteria | 1431 |
| 36 | Ga0068867_100008373 | 3300005459 | Bacteria | 7295 |
| 37 | Ga0068867_100733588 | 3300005459 | Bacteria | 875 |
| 38 | Ga0070706_100596953 | 3300005467 | Bacteria | 1026 |
| 39 | Ga0070706_100624282 | 3300005467 | Bacteria | 1001 |
| 40 | Ga0070698_100549605 | 3300005471 | Bacteria | 1094 |
| 41 | Ga0070699_100176213 | 3300005518 | Bacteria | 1896 |
| 42 | Ga0070679_100005303 | 3300005530 | Bacteria | 11934 |
| 43 | Ga0070679_100463543 | 3300005530 | Bacteria | 1212 |
| 44 | Ga0070684_100307568 | 3300005535 | Bacteria | 1455 |
| 45 | Ga0070684_100327883 | 3300005535 | Bacteria | 1407 |
| 46 | Ga0070697_100019164 | 3300005536 | Bacteria | 5402 |
| 47 | Ga0070697_100319534 | 3300005536 | Bacteria | 1337 |
| 48 | Ga0068853_100605522 | 3300005539 | Bacteria | 1041 |
| 49 | Ga0070672_100094374 | 3300005543 | Bacteria | 2418 |
| 50 | Ga0070672_100489371 | 3300005543 | Bacteria | 1063 |
| 51 | Ga0070686_100090036 | 3300005544 | Bacteria | 2051 |
| 52 | Ga0070686_100169807 | 3300005544 | Bacteria | 1542 |
| 53 | Ga0070695_100060831 | 3300005545 | Bacteria | 2448 |
| 54 | Ga0070696_100110288 | 3300005546 | Bacteria | 1981 |
| 55 | Ga0070693_100232379 | 3300005547 | Bacteria | 1214 |
| 56 | Ga0070665_100000913 | 3300005548 | Bacteria | 37936 |
| 57 | Ga0070665_100653267 | 3300005548 | Bacteria | 1065 |
| 58 | Ga0070665_100672664 | 3300005548 | Bacteria | 1048 |
| 59 | Ga0070704_100160281 | 3300005549 | Bacteria | 1779 |
| 60 | Ga0070704_100973458 | 3300005549 | Bacteria | 766 |
| 61 | Ga0068855_100168776 | 3300005563 | Bacteria | 2479 |
| 62 | Ga0068855_100367664 | 3300005563 | Bacteria | 1581 |
| 63 | Ga0068855_100482946 | 3300005563 | Bacteria | 1348 |
| 64 | Ga0068855_101044525 | 3300005563 | Bacteria | 856 |
| 65 | Ga0070664_100165002 | 3300005564 | Bacteria | 1962 |
| 66 | Ga0068854_100132511 | 3300005578 | Bacteria | 1904 |
| 67 | Ga0070702_100029594 | 3300005615 | Bacteria | 2980 |
| 68 | Ga0068852_100054067 | 3300005616 | Bacteria | 3459 |
| 69 | Ga0068852_100146896 | 3300005616 | Bacteria | 2188 |
| 70 | Ga0068864_100061280 | 3300005618 | Bacteria | 3259 |
| 71 | Ga0068861_100075201 | 3300005719 | Bacteria | 2629 |
| 72 | Ga0068863_100227726 | 3300005841 | Bacteria | 1797 |
| 73 | Ga0068858_100245757 | 3300005842 | Bacteria | 1699 |
| 74 | Ga0068862_100167529 | 3300005844 | Bacteria | 1965 |
| 75 | Ga0081455_10025722 | 3300005937 | Bacteria | 5428 |
| 76 | Ga0081455_10125296 | 3300005937 | Bacteria | 2017 |
| 77 | Ga0081455_10367252 | 3300005937 | Bacteria | 1010 |
| 78 | Ga0081538_10005050 | 3300005981 | Bacteria | 11996 |
| 79 | Ga0081540_1000194 | 3300005983 | Bacteria | 62934 |
| 80 | Ga0081540_1003980 | 3300005983 | Bacteria | 11462 |
| 81 | Ga0081540_1030141 | 3300005983 | Bacteria | 3010 |
| 82 | Ga0081539_10005651 | 3300005985 | Bacteria | 12568 |
| 83 | Ga0070717_10084664 | 3300006028 | Bacteria | 2667 |
| 84 | Ga0070717_10169379 | 3300006028 | Bacteria | 1899 |
| 85 | Ga0070717_10254567 | 3300006028 | Bacteria | 1552 |
| 86 | Ga0075365_10005800 | 3300006038 | Bacteria | 6706 |
| 87 | Ga0075365_10394613 | 3300006038 | Bacteria | 976 |
| 88 | Ga0075368_10028231 | 3300006042 | Bacteria | 2167 |
| 89 | Ga0075368_10065693 | 3300006042 | Bacteria | 1458 |
| 90 | Ga0075363_100017907 | 3300006048 | Bacteria | 3521 |
| 91 | Ga0075363_100083400 | 3300006048 | Bacteria | 1751 |
| 92 | Ga0075364_10071882 | 3300006051 | Bacteria | 2279 |
| 93 | Ga0075364_10104975 | 3300006051 | Bacteria | 1883 |
| 94 | Ga0075364_10241015 | 3300006051 | Bacteria | 1228 |
| 95 | Ga0070715_10390494 | 3300006163 | Bacteria | 771 |
| 96 | Ga0070716_100269755 | 3300006173 | Bacteria | 1169 |
| 97 | Ga0070712_100010707 | 3300006175 | Bacteria | 5793 |
| 98 | Ga0070712_100017711 | 3300006175 | Bacteria | 4615 |
| 99 | Ga0070712_100374239 | 3300006175 | Bacteria | 1171 |
| 100 | Ga0075362_10034328 | 3300006177 | Bacteria | 2211 |
| 101 | Ga0075362_10180539 | 3300006177 | Bacteria | 1022 |
| 102 | Ga0075362_10244644 | 3300006177 | Bacteria | 881 |
| 103 | Ga0075367_10010802 | 3300006178 | Bacteria | 4810 |
| 104 | Ga0075367_10020548 | 3300006178 | Bacteria | 3680 |
| 105 | Ga0075367_10549803 | 3300006178 | Bacteria | 733 |
| 106 | Ga0075369_10003352 | 3300006186 | Bacteria | 5823 |
| 107 | Ga0075369_10135902 | 3300006186 | Bacteria | 1119 |
| 108 | Ga0075366_10019201 | 3300006195 | Bacteria | 3952 |
| 109 | Ga0075366_10032023 | 3300006195 | Bacteria | 3095 |
| 110 | Ga0097621_101088944 | 3300006237 | Bacteria | 750 |
| 111 | Ga0075370_10155584 | 3300006353 | Bacteria | 1340 |
| 112 | Ga0075370_10234177 | 3300006353 | Bacteria | 1087 |
| 113 | Ga0068871_100497857 | 3300006358 | Bacteria | 1098 |
| 114 | Ga0075428_100001228 | 3300006844 | Bacteria | 27445 |
| 115 | Ga0075428_100192634 | 3300006844 | Bacteria | 2205 |
| 116 | Ga0075428_100427705 | 3300006844 | Bacteria | 1419 |
| 117 | Ga0075428_100442547 | 3300006844 | Bacteria | 1392 |
| 118 | Ga0075428_101027531 | 3300006844 | Bacteria | 872 |
| 119 | Ga0075430_100000170 | 3300006846 | Bacteria | 42897 |
| 120 | Ga0075430_100014636 | 3300006846 | Bacteria | 6682 |
| 121 | Ga0075430_100256346 | 3300006846 | Bacteria | 1449 |
| 122 | Ga0075430_100500405 | 3300006846 | Bacteria | 1003 |
| 123 | Ga0075431_100000812 | 3300006847 | Bacteria | 27315 |
| 124 | Ga0075431_100087543 | 3300006847 | Bacteria | 3214 |
| 125 | Ga0075431_100178864 | 3300006847 | Bacteria | 2177 |
| 126 | Ga0075431_100191421 | 3300006847 | Bacteria | 2096 |
| 127 | Ga0075434_100042112 | 3300006871 | Bacteria | 4527 |
| 128 | Ga0075434_100068602 | 3300006871 | Bacteria | 3533 |
| 129 | Ga0075434_100414112 | 3300006871 | Bacteria | 1369 |
| 130 | Ga0075429_100010495 | 3300006880 | Bacteria | 8011 |
| 131 | Ga0075429_100012850 | 3300006880 | Bacteria | 7263 |
| 132 | Ga0075429_100318630 | 3300006880 | Bacteria | 1361 |
| 133 | Ga0075429_100787714 | 3300006880 | Bacteria | 833 |
| 134 | Ga0075436_100003022 | 3300006914 | Bacteria | 11527 |
| 135 | Ga0075436_100013301 | 3300006914 | Bacteria | 5637 |
| 136 | Ga0075435_100037566 | 3300007076 | Bacteria | 3857 |
| 137 | Ga0075435_100067785 | 3300007076 | Bacteria | 2906 |
| 138 | Ga0075435_100083024 | 3300007076 | Bacteria | 2634 |
| 139 | Ga0099795_10006014 | 3300007788 | Bacteria | 3276 |
| 140 | Ga0099795_10026882 | 3300007788 | Bacteria | 1943 |
| 141 | Ga0105240_10143434 | 3300009093 | Bacteria | 2853 |
| 142 | Ga0105240_10154842 | 3300009093 | Bacteria | 2727 |
| 143 | Ga0105240_10163960 | 3300009093 | Bacteria | 2637 |
| 144 | Ga0105240_10770582 | 3300009093 | Bacteria | 1044 |
| 145 | Ga0105240_11265897 | 3300009093 | Bacteria | 779 |
| 146 | Ga0111539_10001371 | 3300009094 | Bacteria | 32392 |
| 147 | Ga0111539_10042732 | 3300009094 | Bacteria | 5440 |
| 148 | Ga0105245_10024476 | 3300009098 | Bacteria | 5302 |
| 149 | Ga0105245_10785919 | 3300009098 | Bacteria | 989 |
| 150 | Ga0105245_10838684 | 3300009098 | Bacteria | 959 |
| 151 | Ga0105245_10853148 | 3300009098 | Bacteria | 951 |
| 152 | Ga0105247_10410716 | 3300009101 | Bacteria | 967 |
| 153 | Ga0114129_10005694 | 3300009147 | Bacteria | 17649 |
| 154 | Ga0114129_10005820 | 3300009147 | Bacteria | 17459 |
| 155 | Ga0114129_10440750 | 3300009147 | Bacteria | 1710 |
| 156 | Ga0114129_10523361 | 3300009147 | Bacteria | 1546 |
| 157 | Ga0114129_10639134 | 3300009147 | Bacteria | 1374 |
| 158 | Ga0114129_10939959 | 3300009147 | Bacteria | 1093 |
| 159 | Ga0105243_10461069 | 3300009148 | Bacteria | 1195 |
| 160 | Ga0105248_10174924 | 3300009177 | Bacteria | 2420 |
| 161 | Ga0105248_10175545 | 3300009177 | Bacteria | 2415 |
| 162 | Ga0105248_10674573 | 3300009177 | Bacteria | 1166 |
| 163 | Ga0105237_10690991 | 3300009545 | Bacteria | 1027 |
| 164 | Ga0105237_11089809 | 3300009545 | Bacteria | 805 |
| 165 | Ga0105238_10031321 | 3300009551 | Bacteria | 5413 |
| 166 | Ga0105238_10039306 | 3300009551 | Bacteria | 4797 |
| 167 | Ga0105238_10088301 | 3300009551 | Bacteria | 3087 |
| 168 | Ga0105238_10099775 | 3300009551 | Bacteria | 2886 |
| 169 | Ga0105238_10272795 | 3300009551 | Bacteria | 1672 |
| 170 | Ga0105249_10278254 | 3300009553 | Bacteria | 1670 |
| 171 | Ga0105249_10349699 | 3300009553 | Bacteria | 1497 |
| 172 | Ga0105249_10579172 | 3300009553 | Bacteria | 1175 |
| 173 | Ga0105239_10124928 | 3300010375 | Bacteria | 2859 |
| 174 | Ga0105246_10111898 | 3300011119 | Bacteria | 2007 |
| 175 | Ga0157370_10351288 | 3300013104 | Bacteria | 1359 |
| 176 | Ga0157378_10105957 | 3300013297 | Bacteria | 2571 |
| 177 | Ga0157378_10318584 | 3300013297 | Bacteria | 1510 |
| 178 | Ga0157378_10531941 | 3300013297 | Bacteria | 1178 |
| 179 | Ga0157378_11628366 | 3300013297 | Bacteria | 692 |
| 180 | Ga0157375_10117613 | 3300013308 | Bacteria | 2764 |
| 181 | Ga0157375_10310554 | 3300013308 | Bacteria | 1741 |
| 182 | Ga0157375_10542899 | 3300013308 | Bacteria | 1325 |
| 183 | Ga0157375_10603940 | 3300013308 | Bacteria | 1256 |
| 184 | Ga0157380_10146522 | 3300014326 | Bacteria | 2035 |
| 185 | Ga0157380_10935645 | 3300014326 | Bacteria | 895 |
| 186 | Ga0157377_10687316 | 3300014745 | Bacteria | 741 |
| 187 | Ga0157379_10341441 | 3300014968 | Bacteria | 1370 |
| 188 | Ga0157376_10095816 | 3300014969 | Bacteria | 2581 |
| 189 | Ga0163161_10291441 | 3300017792 | Bacteria | 1283 |
| 190 | Ga0206353_10806976 | 3300020082 | Bacteria | 1422 |
| 191 | Ga0213874_10031623 | 3300021377 | Bacteria | 1532 |
| 192 | Ga0213876_10099014 | 3300021384 | Bacteria | 1545 |
| 193 | Ga0213871_10100434 | 3300021441 | Bacteria | 846 |
| 194 | Ga0209646_1000030 | 3300025246 | Bacteria | 384216 |
| 195 | Ga0209758_1000385 | 3300025297 | Bacteria | 76280 |
| 196 | Ga0207697_10019432 | 3300025315 | Bacteria | 2783 |
| 197 | Ga0207697_10091181 | 3300025315 | Bacteria | 1291 |
| 198 | Ga0207692_10020829 | 3300025898 | Bacteria | 2990 |
| 199 | Ga0207692_10045877 | 3300025898 | Bacteria | 2188 |
| 200 | Ga0207710_10204562 | 3300025900 | Bacteria | 976 |
| 201 | Ga0207688_10105026 | 3300025901 | Bacteria | 1635 |
| 202 | Ga0207688_10116658 | 3300025901 | Bacteria | 1554 |
| 203 | Ga0207685_10102251 | 3300025905 | Bacteria | 1227 |
| 204 | Ga0207699_10068772 | 3300025906 | Bacteria | 2157 |
| 205 | Ga0207699_10106311 | 3300025906 | Bacteria | 1791 |
| 206 | Ga0207699_10618816 | 3300025906 | Bacteria | 789 |
| 207 | Ga0207645_10015040 | 3300025907 | Bacteria | 5156 |
| 208 | Ga0207645_10097906 | 3300025907 | Bacteria | 1891 |
| 209 | Ga0207705_10074153 | 3300025909 | Bacteria | 2470 |
| 210 | Ga0207705_10419316 | 3300025909 | Bacteria | 1036 |
| 211 | Ga0207705_10604251 | 3300025909 | Bacteria | 853 |
| 212 | Ga0207684_10097529 | 3300025910 | Bacteria | 2510 |
| 213 | Ga0207684_10552109 | 3300025910 | Bacteria | 985 |
| 214 | Ga0207707_10022094 | 3300025912 | Bacteria | 5561 |
| 215 | Ga0207707_10033427 | 3300025912 | Bacteria | 4501 |
| 216 | Ga0207707_10069780 | 3300025912 | Bacteria | 3063 |
| 217 | Ga0207695_10103484 | 3300025913 | Bacteria | 2838 |
| 218 | Ga0207695_10147056 | 3300025913 | Bacteria | 2299 |
| 219 | Ga0207695_10764735 | 3300025913 | Bacteria | 846 |
| 220 | Ga0207693_10013809 | 3300025915 | Bacteria | 6502 |
| 221 | Ga0207693_10177987 | 3300025915 | Bacteria | 1673 |
| 222 | Ga0207693_10287955 | 3300025915 | Bacteria | 1287 |
| 223 | Ga0207663_10024626 | 3300025916 | Bacteria | 3468 |
| 224 | Ga0207663_10101049 | 3300025916 | Bacteria | 1937 |
| 225 | Ga0207660_10016056 | 3300025917 | Bacteria | 4951 |
| 226 | Ga0207660_10204767 | 3300025917 | Bacteria | 1542 |
| 227 | Ga0207657_10020194 | 3300025919 | Bacteria | 6302 |
| 228 | Ga0207657_10381290 | 3300025919 | Bacteria | 1110 |
| 229 | Ga0207652_10017504 | 3300025921 | Bacteria | 5865 |
| 230 | Ga0207652_10089042 | 3300025921 | Bacteria | 2709 |
| 231 | Ga0207694_10014321 | 3300025924 | Bacteria | 5979 |
| 232 | Ga0207694_10376808 | 3300025924 | Bacteria | 1177 |
| 233 | Ga0207694_10609709 | 3300025924 | Bacteria | 918 |
| 234 | Ga0207659_10274437 | 3300025926 | Bacteria | 1376 |
| 235 | Ga0207659_10457160 | 3300025926 | Bacteria | 1076 |
| 236 | Ga0207700_10808342 | 3300025928 | Bacteria | 839 |
| 237 | Ga0207690_10608024 | 3300025932 | Bacteria | 893 |
| 238 | Ga0207706_10167446 | 3300025933 | Bacteria | 1931 |
| 239 | Ga0207670_10001629 | 3300025936 | Bacteria | 11705 |
| 240 | Ga0207669_10002621 | 3300025937 | Bacteria | 7697 |
| 241 | Ga0207669_10012717 | 3300025937 | Bacteria | 4149 |
| 242 | Ga0207704_10590653 | 3300025938 | Bacteria | 908 |
| 243 | Ga0207665_10082598 | 3300025939 | Bacteria | 2214 |
| 244 | Ga0207691_10008224 | 3300025940 | Bacteria | 10021 |
| 245 | Ga0207691_10157908 | 3300025940 | Bacteria | 1991 |
| 246 | Ga0207711_10077903 | 3300025941 | Bacteria | 2890 |
| 247 | Ga0207711_10424825 | 3300025941 | Bacteria | 1236 |
| 248 | Ga0207689_10264720 | 3300025942 | Bacteria | 1423 |
| 249 | Ga0207689_10355200 | 3300025942 | Bacteria | 1219 |
| 250 | Ga0207679_10088406 | 3300025945 | Bacteria | 2389 |
| 251 | Ga0207667_10016783 | 3300025949 | Bacteria | 8260 |
| 252 | Ga0207667_10131297 | 3300025949 | Bacteria | 2580 |
| 253 | Ga0207667_10167227 | 3300025949 | Bacteria | 2260 |
| 254 | Ga0207667_10737557 | 3300025949 | Bacteria | 985 |
| 255 | Ga0207667_10863042 | 3300025949 | Bacteria | 899 |
| 256 | Ga0207651_10576854 | 3300025960 | Bacteria | 981 |
| 257 | Ga0207712_10545110 | 3300025961 | Bacteria | 997 |
| 258 | Ga0207668_10356255 | 3300025972 | Bacteria | 1225 |
| 259 | Ga0207668_10632870 | 3300025972 | Bacteria | 935 |
| 260 | Ga0207640_10235668 | 3300025981 | Bacteria | 1411 |
| 261 | Ga0207658_10206373 | 3300025986 | Bacteria | 1644 |
| 262 | Ga0207677_10031527 | 3300026023 | Bacteria | 3396 |
| 263 | Ga0207703_10235063 | 3300026035 | Bacteria | 1645 |
| 264 | Ga0207708_10213686 | 3300026075 | Bacteria | 1543 |
| 265 | Ga0207648_10005736 | 3300026089 | Bacteria | 12444 |
| 266 | Ga0207648_10474852 | 3300026089 | Bacteria | 1141 |
| 267 | Ga0207648_10554002 | 3300026089 | Bacteria | 1056 |
| 268 | Ga0207676_10024100 | 3300026095 | Bacteria | 4500 |
| 269 | Ga0207676_10697966 | 3300026095 | Bacteria | 983 |
| 270 | Ga0207675_100426118 | 3300026118 | Bacteria | 1311 |
| 271 | Ga0207683_10007234 | 3300026121 | Bacteria | 9515 |
| 272 | Ga0207683_10130944 | 3300026121 | Bacteria | 2256 |
| 273 | Ga0207428_10002878 | 3300027907 | Bacteria | 17058 |
| 274 | Ga0268266_10000346 | 3300028379 | Bacteria | 72336 |
| 275 | Ga0268266_10168092 | 3300028379 | Bacteria | 1989 |
| 276 | Ga0268266_11362415 | 3300028379 | Bacteria | 685 |
| 277 | Ga0268265_10080958 | 3300028380 | Bacteria | 2563 |
| 278 | Ga0265318_10082322 | 3300028577 | Bacteria | 1188 |
| 279 | Ga0265338_10131800 | 3300028800 | Bacteria | 1972 |
| 280 | Ga0265330_10041409 | 3300031235 | Bacteria | 2042 |
| 281 | Ga0265330_10184443 | 3300031235 | Bacteria | 883 |
| 282 | Ga0265328_10000445 | 3300031239 | Bacteria | 19251 |
| 283 | Ga0265328_10021331 | 3300031239 | Bacteria | 2472 |
| 284 | Ga0265328_10200917 | 3300031239 | Bacteria | 757 |
| 285 | Ga0265325_10018262 | 3300031241 | Bacteria | 3889 |
| 286 | Ga0265325_10036906 | 3300031241 | Bacteria | 2586 |
| 287 | Ga0265325_10065711 | 3300031241 | Bacteria | 1831 |
| 288 | Ga0265325_10080223 | 3300031241 | Bacteria | 1623 |
| 289 | Ga0265325_10144439 | 3300031241 | Bacteria | 1129 |
| 290 | Ga0265329_10004861 | 3300031242 | Bacteria | 5509 |
| 291 | Ga0265340_10000814 | 3300031247 | Bacteria | 17718 |
| 292 | Ga0265340_10021426 | 3300031247 | Bacteria | 3315 |
| 293 | Ga0265340_10041676 | 3300031247 | Bacteria | 2256 |
| 294 | Ga0265340_10046379 | 3300031247 | Bacteria | 2120 |
| 295 | Ga0265340_10112894 | 3300031247 | Bacteria | 1255 |
| 296 | Ga0265339_10029504 | 3300031249 | Bacteria | 3111 |
| 297 | Ga0265339_10103546 | 3300031249 | Bacteria | 1478 |
| 298 | Ga0265339_10109397 | 3300031249 | Bacteria | 1431 |
| 299 | Ga0265339_10116796 | 3300031249 | Bacteria | 1375 |
| 300 | Ga0265339_10154000 | 3300031249 | Bacteria | 1160 |
| 301 | Ga0265339_10168824 | 3300031249 | Bacteria | 1097 |
| 302 | Ga0265339_10316441 | 3300031249 | Bacteria | 741 |
| 303 | Ga0265331_10000082 | 3300031250 | Bacteria | 133041 |
| 304 | Ga0265331_10119367 | 3300031250 | Bacteria | 1206 |
| 305 | Ga0265316_10135699 | 3300031344 | Bacteria | 1851 |
| 306 | Ga0265316_10186232 | 3300031344 | Bacteria | 1544 |
| 307 | Ga0265316_10276061 | 3300031344 | Bacteria | 1229 |
| 308 | Ga0265316_10386047 | 3300031344 | Bacteria | 1010 |
| 309 | Ga0307513_10124887 | 3300031456 | Bacteria | 2532 |
| 310 | Ga0307408_100093673 | 3300031548 | Bacteria | 2273 |
| 311 | Ga0307408_100183139 | 3300031548 | Bacteria | 1681 |
| 312 | Ga0307408_100328195 | 3300031548 | Bacteria | 1291 |
| 313 | Ga0265313_10000554 | 3300031595 | Bacteria | 38970 |
| 314 | Ga0265313_10013708 | 3300031595 | Bacteria | 4840 |
| 315 | Ga0316575_10016371 | 3300031665 | Bacteria | 2806 |
| 316 | Ga0316579_10139624 | 3300031691 | Bacteria | 1168 |
| 317 | Ga0316579_10290113 | 3300031691 | Bacteria | 791 |
| 318 | Ga0265314_10004396 | 3300031711 | Bacteria | 13094 |
| 319 | Ga0265314_10022913 | 3300031711 | Bacteria | 4774 |
| 320 | Ga0265314_10079643 | 3300031711 | Bacteria | 2165 |
| 321 | Ga0265342_10001033 | 3300031712 | Bacteria | 27336 |
| 322 | Ga0265342_10034165 | 3300031712 | Bacteria | 3121 |
| 323 | Ga0265342_10038515 | 3300031712 | Bacteria | 2911 |
| 324 | Ga0265342_10056104 | 3300031712 | Bacteria | 2336 |
| 325 | Ga0265342_10097528 | 3300031712 | Bacteria | 1678 |
| 326 | Ga0265342_10199325 | 3300031712 | Bacteria | 1089 |
| 327 | Ga0316576_10206978 | 3300031727 | Bacteria | 1477 |
| 328 | Ga0316576_10614320 | 3300031727 | Bacteria | 793 |
| 329 | Ga0307413_10210830 | 3300031824 | Bacteria | 1411 |
| 330 | Ga0307413_10357204 | 3300031824 | Bacteria | 1130 |
| 331 | Ga0307413_10572795 | 3300031824 | Bacteria | 920 |
| 332 | Ga0307410_10220931 | 3300031852 | Bacteria | 1457 |
| 333 | Ga0307407_10260546 | 3300031903 | Bacteria | 1192 |
| 334 | Ga0307409_100129350 | 3300031995 | Bacteria | 2154 |
| 335 | Ga0307409_100288234 | 3300031995 | Bacteria | 1521 |
| 336 | Ga0307416_100054363 | 3300032002 | Bacteria | 3218 |
| 337 | Ga0307416_100287067 | 3300032002 | Bacteria | 1626 |
| 338 | Ga0307414_10149142 | 3300032004 | Bacteria | 1842 |
| 339 | Ga0307414_10528206 | 3300032004 | Bacteria | 1048 |
| 340 | Ga0307411_10090026 | 3300032005 | Bacteria | 2139 |
| 341 | Ga0316583_10016520 | 3300032133 | Bacteria | 2656 |
| 342 | Ga0373930_0049440 | 3300034816 | Bacteria | 915 |
| 343 | Ga0373958_0057270 | 3300034819 | Bacteria | 836 |
| 344 | Ga0373959_0053882 | 3300034820 | Bacteria | 875 |
| 345 | Ga0373929_0029912 | 3300035085 | Bacteria | 1159 |
| 346 | Ga0373949_0062383 | 3300035090 | Bacteria | 962 |
| 347 | Ga0373951_0087938 | 3300035091 | Bacteria | 812 |
| 348 | Ga0373952_0018052 | 3300035092 | Bacteria | 1456 |
| 349 | Ga0373936_0005310 | 3300035113 | Bacteria | 4849 |
| 350 | Ga0373936_0195284 | 3300035113 | Bacteria | 892 |
| 351 | Ga0373939_0008035 | 3300035114 | Bacteria | 2577 |
| 352 | Ga0373941_0092888 | 3300035115 | Bacteria | 1038 |
| 353 | Ga0373945_0007389 | 3300035116 | Bacteria | 3562 |
| 354 | Ga0373945_0100759 | 3300035116 | Bacteria | 1130 |
| 355 | Ga0373953_0013201 | 3300035117 | Bacteria | 2945 |
| 356 | Ga0373954_0010307 | 3300035118 | Bacteria | 4123 |
| 357 | Ga0373954_0081122 | 3300035118 | Bacteria | 1550 |
| 358 | Ga0373957_0032542 | 3300035120 | Bacteria | 1921 |
| 359 | Ga0373960_0035058 | 3300035121 | Bacteria | 1422 |
| 360 | Ga0373943_0000268 | 3300035170 | Bacteria | 21475 |
| 361 | Ga0373943_0012004 | 3300035170 | Bacteria | 3899 |
| 362 | Ga0373943_0298335 | 3300035170 | Bacteria | 914 |
| 363 | Ga0373946_0001967 | 3300035171 | Bacteria | 7189 |
| 364 | Ga0373946_0016212 | 3300035171 | Bacteria | 2836 |
| 365 | Ga0373955_0010606 | 3300035172 | Bacteria | 4358 |
| 366 | Ga0373955_0021860 | 3300035172 | Bacteria | 3236 |
| 367 | Ga0373955_0160983 | 3300035172 | Bacteria | 1325 |
| 368 | Ga0373961_0043358 | 3300035241 | Bacteria | 1308 |
| 369 | Ga0316574_0000507 | 3300035398 | Bacteria | 15818 |
| 370 | Ga0373924_0030653 | 3300035410 | Bacteria | 2157 |
| 371 | Ga0373931_0003730 | 3300035691 | Bacteria | 6894 |
| 372 | Ga0373931_0019831 | 3300035691 | Bacteria | 3359 |
| 373 | Ga0373931_0060117 | 3300035691 | Bacteria | 2045 |
| 374 | Ga0373935_0002242 | 3300035692 | Bacteria | 11003 |
| 375 | Ga0373935_0011850 | 3300035692 | Bacteria | 5238 |
| 376 | Ga0373935_0036347 | 3300035692 | Bacteria | 3078 |
| 377 | Ga0373935_0341103 | 3300035692 | Bacteria | 1067 |
| 378 | Ga0373935_0655331 | 3300035692 | Bacteria | 770 |
| 379 | Ga0373935_0955459 | 3300035692 | Bacteria | 636 |
| 380 | Ga0373927_0001748 | 3300035695 | Bacteria | 16212 |
| 381 | Ga0373927_0017897 | 3300035695 | Bacteria | 4660 |
| 382 | Ga0373927_0038320 | 3300035695 | Bacteria | 3112 |
| 383 | Ga0373927_0055513 | 3300035695 | Bacteria | 2561 |
| 384 | Ga0373927_0090278 | 3300035695 | Bacteria | 1990 |
| 385 | Ga0373927_0110273 | 3300035695 | Bacteria | 1793 |
| 386 | Ga0373927_0177145 | 3300035695 | Bacteria | 1398 |
| 387 | Ga0373933_0007061 | 3300035724 | Bacteria | 6120 |
| 388 | Ga0373947_0001270 | 3300035725 | Bacteria | 15552 |
| 389 | Ga0373947_0009494 | 3300035725 | Bacteria | 5586 |
| 390 | Ga0373947_0021720 | 3300035725 | Bacteria | 3717 |
| 391 | Ga0373947_0049699 | 3300035725 | Bacteria | 2519 |
| 392 | Ga0373947_0058781 | 3300035725 | Bacteria | 2330 |
| 393 | Ga0373937_0000326 | 3300036401 | Bacteria | 45214 |
| 394 | Ga0373937_0319117 | 3300036401 | Bacteria | 1470 |
| 395 | Ga0373937_1062777 | 3300036401 | Bacteria | 758 |
| 396 | Ga0316582_0295883 | 3300036647 | Bacteria | 1112 |
| 397 | Ga0316582_0507851 | 3300036647 | Bacteria | 831 |
| 398 | Ga0373925_0002641 | 3300037068 | Bacteria | 14221 |
| 399 | Ga0373925_0010083 | 3300037068 | Bacteria | 6863 |
| 400 | Ga0373925_0024003 | 3300037068 | Bacteria | 4450 |
| 401 | Ga0373925_0057672 | 3300037068 | Bacteria | 2910 |
| 402 | Ga0373925_0104794 | 3300037068 | Bacteria | 2178 |
| 403 | Ga0373925_0191946 | 3300037068 | Bacteria | 1621 |
| 404 | Ga0373925_0217079 | 3300037068 | Bacteria | 1525 |
| 405 | Ga0373925_0409492 | 3300037068 | Bacteria | 1107 |
| 406 | Ga0373925_0965104 | 3300037068 | Bacteria | 702 |
| 407 | Ga0395899_0006002 | 3300037312 | Bacteria | 9433 |
| 408 | Ga0395899_0027248 | 3300037312 | Bacteria | 4309 |
| 409 | Ga0395900_0003929 | 3300037418 | Bacteria | 15866 |
| 410 | Ga0395898_0043976 | 3300037466 | Bacteria | 4399 |
| 411 | Ga0395898_0061629 | 3300037466 | Bacteria | 3644 |
| 412 | Ga0395905_0092047 | 3300037471 | Bacteria | 2843 |
| 413 | Ga0395905_0997286 | 3300037471 | Bacteria | 741 |
| 414 | Ga0436364_0850496 | 3300037853 | Bacteria | 1470 |
| 415 | Ga0436364_0885754 | 3300037853 | Bacteria | 833 |
| 416 | Ga0436364_1109044 | 3300037853 | Bacteria | 1371 |
| 417 | Ga0436364_1228402 | 3300037853 | Bacteria | 36853 |
| 418 | Ga0436364_1338625 | 3300037853 | Bacteria | 1137 |
| 419 | Ga0395901_0022173 | 3300038443 | Bacteria | 6507 |
| 420 | Ga0395901_0031439 | 3300038443 | Bacteria | 5474 |
| 421 | Ga0395901_0267709 | 3300038443 | Bacteria | 1778 |
| 422 | Ga0436365_0158765 | 3300039437 | Bacteria | 1780 |
| 423 | Ga0436365_0243474 | 3300039437 | Bacteria | 977 |
| 424 | Ga0436365_1324643 | 3300039437 | Bacteria | 1627 |
| 425 | Ga0436360_0945414 | 3300039438 | Bacteria | 1167 |
| 426 | Ga0436360_1180969 | 3300039438 | Bacteria | 2359 |
| 427 | Ga0436361_0393934 | 3300039447 | Bacteria | 3755 |
| 428 | Ga0436361_0958976 | 3300039447 | Bacteria | 1730 |
| 429 | Ga0436363_0940222 | 3300039450 | Bacteria | 2748 |
| 430 | Ga0436363_1409348 | 3300039450 | Bacteria | 1385 |
| 431 | Ga0436362_0173993 | 3300039453 | Bacteria | 1567 |
| 432 | Ga0439453_0003358 | 3300041408 | Bacteria | 2297 |
| 433 | Ga0439465_0053468 | 3300041413 | Bacteria | 1327 |
| 434 | Ga0439431_0078030 | 3300041997 | Bacteria | 890 |
| 435 | Ga0439443_001515 | 3300042003 | Bacteria | 2586 |
| 436 | Ga0439432_067982 | 3300042006 | Bacteria | 1090 |
| 437 | Ga0439450_011703 | 3300042008 | Bacteria | 1725 |
| 438 | Ga0450923_020616 | 3300042125 | Bacteria | 1279 |
| 439 | Ga0439446_0164304 | 3300042156 | Bacteria | 735 |
| 440 | Ga0439458_0067302 | 3300042157 | Bacteria | 901 |
| 441 | Ga0439435_0008721 | 3300042436 | Bacteria | 2358 |
| 442 | Ga0439460_0011049 | 3300042461 | Bacteria | 2323 |
| 443 | Ga0466972_0034647 | 3300044658 | Bacteria | 2472 |
| 444 | Ga0466966_0130821 | 3300044684 | Bacteria | 1537 |
| 445 | Ga0466970_0410242 | 3300044765 | Bacteria | 774 |
| 446 | Ga0466957_0018226 | 3300044842 | Bacteria | 4120 |
| 447 | Ga0466959_0107292 | 3300045049 | Bacteria | 1996 |
| 448 | Ga0466959_0218707 | 3300045049 | Bacteria | 1322 |
| 449 | Ga0451576_0384614 | 3300045051 | Bacteria | 1471 |
| 450 | Ga0495592_0001009 | 3300046454 | Bacteria | 19522 |
| 451 | Ga0495592_0125594 | 3300046454 | Bacteria | 1801 |
| 452 | Ga0495603_0198710 | 3300046455 | Bacteria | 1159 |
| 453 | Ga0495603_0405815 | 3300046455 | Bacteria | 781 |
| 454 | Ga0495590_0026819 | 3300046457 | Bacteria | 2022 |
| 455 | Ga0495629_0023536 | 3300046459 | Bacteria | 4388 |
| 456 | Ga0495629_0122320 | 3300046459 | Bacteria | 1813 |
| 457 | Ga0495629_0208237 | 3300046459 | Bacteria | 1351 |
| 458 | Ga0495651_0001005 | 3300046462 | Bacteria | 21899 |
| 459 | Ga0495651_0570203 | 3300046462 | Bacteria | 717 |
| 460 | Ga0495653_0001279 | 3300046463 | Bacteria | 19468 |
| 461 | Ga0495653_0044827 | 3300046463 | Bacteria | 3431 |
| 462 | Ga0495580_0059860 | 3300046472 | Bacteria | 2676 |
| 463 | Ga0495605_0098558 | 3300046474 | Bacteria | 1346 |
| 464 | Ga0495639_0113280 | 3300046475 | Bacteria | 1289 |
| 465 | Ga0495662_0012656 | 3300046476 | Bacteria | 4114 |
| 466 | Ga0495662_0026024 | 3300046476 | Bacteria | 2826 |
| 467 | Ga0495662_0427421 | 3300046476 | Bacteria | 650 |
| 468 | Ga0495664_0000518 | 3300046477 | Bacteria | 19283 |
| 469 | Ga0495664_0004700 | 3300046477 | Bacteria | 7469 |
| 470 | Ga0495584_0120464 | 3300046491 | Bacteria | 1329 |
| 471 | Ga0495594_0214649 | 3300046499 | Bacteria | 1097 |
| 472 | Ga0495608_0001062 | 3300046511 | Bacteria | 19343 |
| 473 | Ga0495610_0044499 | 3300046512 | Bacteria | 2203 |
| 474 | Ga0495618_0001010 | 3300046514 | Bacteria | 19277 |
| 475 | Ga0495618_0014498 | 3300046514 | Bacteria | 4803 |
| 476 | Ga0495628_0000010 | 3300046516 | Bacteria | 234932 |
| 477 | Ga0495628_0219859 | 3300046516 | Bacteria | 1427 |
| 478 | Ga0495630_0016239 | 3300046517 | Bacteria | 5439 |
| 479 | Ga0495630_0017046 | 3300046517 | Bacteria | 5317 |
| 480 | Ga0495630_0121268 | 3300046517 | Bacteria | 1983 |
| 481 | Ga0495663_0049329 | 3300046525 | Bacteria | 1300 |
| 482 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 483 | Ga0495652_0021286 | 3300046529 | Bacteria | 5766 |
| 484 | Ga0495652_0597314 | 3300046529 | Bacteria | 753 |
| 485 | Ga0495665_0204709 | 3300046531 | Bacteria | 1022 |
| 486 | Ga0495640_0000947 | 3300046533 | Bacteria | 22435 |
| 487 | Ga0495640_0001350 | 3300046533 | Bacteria | 19280 |
| 488 | Ga0495640_0058699 | 3300046533 | Bacteria | 2623 |
| 489 | Ga0495640_0108055 | 3300046533 | Bacteria | 1820 |
| 490 | Ga0495586_0097826 | 3300046535 | Bacteria | 1626 |
| 491 | Ga0495587_0000009 | 3300046536 | Bacteria | 241480 |
| 492 | Ga0495598_0005799 | 3300046537 | Bacteria | 2759 |
| 493 | Ga0495621_0032930 | 3300046539 | Bacteria | 1784 |
| 494 | Ga0495645_0000005 | 3300046543 | Bacteria | 443917 |
| 495 | Ga0495622_0063970 | 3300046557 | Bacteria | 1702 |
| 496 | Ga0495633_0241963 | 3300046558 | Bacteria | 824 |
| 497 | Ga0495667_0000145 | 3300046559 | Bacteria | 48423 |
| 498 | Ga0495667_0200847 | 3300046559 | Bacteria | 1276 |
| 499 | Ga0495656_0083290 | 3300046615 | Bacteria | 1448 |
| 500 | Ga0495634_0000941 | 3300046642 | Bacteria | 27590 |
| 501 | Ga0495634_0001750 | 3300046642 | Bacteria | 18799 |
| 502 | Ga0495635_0000014 | 3300046663 | Bacteria | 218080 |
| 503 | Ga0495635_0218677 | 3300046663 | Bacteria | 1289 |
| 504 | Ga0495635_0331048 | 3300046663 | Bacteria | 1018 |
| 505 | Ga0495659_0197067 | 3300046664 | Bacteria | 825 |
| 506 | Ga0495599_0000010 | 3300046678 | Bacteria | 211658 |
| 507 | Ga0495623_0000119 | 3300046679 | Bacteria | 48268 |
| 508 | Ga0495646_0000008 | 3300046680 | Bacteria | 214486 |
| 509 | Ga0495658_0095603 | 3300046683 | Bacteria | 1766 |
| 510 | Ga0495658_0212797 | 3300046683 | Bacteria | 1208 |
| 511 | Ga0495658_0431538 | 3300046683 | Bacteria | 841 |
| 512 | Ga0495613_0011650 | 3300046689 | Bacteria | 6537 |
| 513 | Ga0495613_0073397 | 3300046689 | Bacteria | 2493 |
| 514 | Ga0495613_0351236 | 3300046689 | Bacteria | 1013 |
| 515 | Ga0495624_0001454 | 3300046690 | Bacteria | 18421 |
| 516 | Ga0495671_0290710 | 3300046692 | Bacteria | 787 |
| 517 | Ga0495600_0021058 | 3300046809 | Bacteria | 4172 |
| 518 | Ga0495581_0004424 | 3300047315 | Bacteria | 8125 |
| 519 | Ga0495581_0027761 | 3300047315 | Bacteria | 3283 |
| 520 | Ga0495604_0000006 | 3300047317 | Bacteria | 420480 |
| 521 | Ga0495674_0000005 | 3300047319 | Bacteria | 375129 |
| 522 | Ga0495674_0225588 | 3300047319 | Bacteria | 1548 |
| 523 | Ga0495674_0575517 | 3300047319 | Bacteria | 894 |
| 524 | Ga0495672_0107168 | 3300047320 | Bacteria | 1505 |
| 525 | Ga0495680_0002789 | 3300047322 | Bacteria | 17613 |
| 526 | Ga0495683_0136558 | 3300047323 | Bacteria | 1152 |
| 527 | Ga0495675_0000806 | 3300047444 | Bacteria | 19300 |
| 528 | Ga0495684_0001275 | 3300047471 | Bacteria | 20286 |
| 529 | Ga0495684_0001418 | 3300047471 | Bacteria | 19212 |
| 530 | Ga0495684_0002706 | 3300047471 | Bacteria | 14030 |
| 531 | Ga0495684_0092094 | 3300047471 | Bacteria | 2296 |
| 532 | Ga0495684_0252665 | 3300047471 | Bacteria | 1282 |
| 533 | Ga0495593_0013626 | 3300047673 | Bacteria | 4634 |
| 534 | Ga0495602_0002313 | 3300048088 | Bacteria | 19257 |
| 535 | Ga0495602_0144206 | 3300048088 | Bacteria | 1881 |
| 536 | Ga0495602_0313315 | 3300048088 | Bacteria | 1144 |
| 537 | Ga0496100_0005878 | 3300048903 | Bacteria | 6643 |
| 538 | Ga0496100_0331867 | 3300048903 | Bacteria | 1145 |
| 539 | Ga0496100_0360116 | 3300048903 | Bacteria | 1100 |
| 540 | Ga0496100_0674129 | 3300048903 | Bacteria | 806 |
| 541 | Ga0496100_0775006 | 3300048903 | Bacteria | 751 |
| 542 | Ga0496101_0003932 | 3300048904 | Bacteria | 9286 |
| 543 | Ga0496101_0142534 | 3300048904 | Bacteria | 1827 |
| 544 | Ga0496102_0020461 | 3300048905 | Bacteria | 5847 |
| 545 | Ga0496103_0085548 | 3300048906 | Bacteria | 1987 |
| 546 | Ga0496104_0043112 | 3300048907 | Bacteria | 4237 |
| 547 | Ga0496104_0566079 | 3300048907 | Bacteria | 1047 |
| 548 | Ga0496104_0573984 | 3300048907 | Bacteria | 1038 |
| 549 | Ga0496105_0036916 | 3300048908 | Bacteria | 4026 |
| 550 | Ga0496105_0098214 | 3300048908 | Bacteria | 2418 |
| 551 | Ga0496105_0404475 | 3300048908 | Bacteria | 1083 |
| 552 | Ga0496106_0004676 | 3300048909 | Bacteria | 10151 |
| 553 | Ga0496106_0173603 | 3300048909 | Bacteria | 1709 |
| 554 | Ga0496107_0110560 | 3300048910 | Bacteria | 2019 |
| 555 | Ga0496108_0002173 | 3300048911 | Bacteria | 15728 |
| 556 | Ga0496108_0031731 | 3300048911 | Bacteria | 4385 |
| 557 | Ga0496108_0161326 | 3300048911 | Bacteria | 1938 |
| 558 | Ga0496108_0347890 | 3300048911 | Bacteria | 1293 |
| 559 | Ga0496109_0010264 | 3300048912 | Bacteria | 7996 |
| 560 | Ga0496109_0011371 | 3300048912 | Bacteria | 7647 |
| 561 | Ga0496109_0054252 | 3300048912 | Bacteria | 3656 |
| 562 | Ga0496109_0164829 | 3300048912 | Bacteria | 2077 |
| 563 | Ga0496109_0876997 | 3300048912 | Bacteria | 835 |
| 564 | Ga0496110_0013717 | 3300048913 | Bacteria | 6713 |
| 565 | Ga0496110_0014973 | 3300048913 | Bacteria | 6447 |
| 566 | Ga0496110_0029499 | 3300048913 | Bacteria | 4722 |
| 567 | Ga0496110_0046849 | 3300048913 | Bacteria | 3783 |
| 568 | Ga0496110_0635142 | 3300048913 | Bacteria | 967 |
| 569 | Ga0496110_1119444 | 3300048913 | Bacteria | 696 |
| 570 | Ga0496111_0019435 | 3300048914 | Bacteria | 4718 |
| 571 | Ga0496111_0041404 | 3300048914 | Bacteria | 3305 |
| 572 | Ga0496111_0065815 | 3300048914 | Bacteria | 2631 |
| 573 | Ga0496112_0038561 | 3300048915 | Bacteria | 4666 |
| 574 | Ga0496112_0044780 | 3300048915 | Bacteria | 4336 |
| 575 | Ga0496112_0877617 | 3300048915 | Bacteria | 820 |
| 576 | Ga0496113_0062234 | 3300048916 | Bacteria | 2818 |
| 577 | Ga0496113_0982552 | 3300048916 | Bacteria | 665 |
| 578 | Ga0496114_0119673 | 3300048917 | Bacteria | 2264 |
| 579 | Ga0496114_0125346 | 3300048917 | Bacteria | 2213 |
| 580 | Ga0496114_0129965 | 3300048917 | Bacteria | 2174 |
| 581 | Ga0496115_0007155 | 3300048918 | Bacteria | 8195 |
| 582 | Ga0496115_0020530 | 3300048918 | Bacteria | 5096 |
| 583 | Ga0496115_0035648 | 3300048918 | Bacteria | 3937 |
| 584 | Ga0496117_0320067 | 3300048920 | Bacteria | 813 |
| 585 | Ga0496119_0001342 | 3300048922 | Bacteria | 30120 |
| 586 | Ga0496122_0001850 | 3300048925 | Bacteria | 32258 |
| 587 | Ga0496123_0000498 | 3300048926 | Bacteria | 68151 |
| 588 | Ga0496126_0250313 | 3300048929 | Bacteria | 1477 |
| 589 | Ga0501318_018481 | 3300049534 | Bacteria | 861 |
| 590 | Ga0501031_0050004 | 3300049568 | Bacteria | 2724 |
| 591 | Ga0501031_0063665 | 3300049568 | Bacteria | 2402 |
| 592 | Ga0501031_0255318 | 3300049568 | Bacteria | 1139 |
| 593 | Ga0501031_0640911 | 3300049568 | Bacteria | 683 |
| 594 | Ga0501032_0035499 | 3300049569 | Bacteria | 3408 |
| 595 | Ga0501032_0249344 | 3300049569 | Bacteria | 1153 |
| 596 | Ga0501033_0041023 | 3300049570 | Bacteria | 3454 |
| 597 | Ga0501033_0050805 | 3300049570 | Bacteria | 3074 |
| 598 | Ga0501033_0089925 | 3300049570 | Bacteria | 2246 |
| 599 | Ga0501033_0133042 | 3300049570 | Bacteria | 1801 |
| 600 | Ga0501033_0285339 | 3300049570 | Bacteria | 1165 |
| 601 | Ga0501034_0003327 | 3300049571 | Bacteria | 18346 |
| 602 | Ga0501034_0012125 | 3300049571 | Bacteria | 8911 |
| 603 | Ga0501034_0080885 | 3300049571 | Bacteria | 3252 |
| 604 | Ga0501034_0200457 | 3300049571 | Bacteria | 1954 |
| 605 | Ga0501034_0216274 | 3300049571 | Bacteria | 1870 |
| 606 | Ga0501034_0524092 | 3300049571 | Bacteria | 1097 |
| 607 | Ga0501034_0643165 | 3300049571 | Bacteria | 963 |
| 608 | Ga0501034_0658676 | 3300049571 | Bacteria | 948 |
| 609 | Ga0501036_0004998 | 3300049572 | Bacteria | 10727 |
| 610 | Ga0501036_0014273 | 3300049572 | Bacteria | 6609 |
| 611 | Ga0501037_0012864 | 3300049573 | Bacteria | 6167 |
| 612 | Ga0501037_0117643 | 3300049573 | Bacteria | 1912 |
| 613 | Ga0501037_0121310 | 3300049573 | Bacteria | 1879 |
| 614 | Ga0501037_0138863 | 3300049573 | Bacteria | 1740 |
| 615 | Ga0501038_0004685 | 3300049574 | Bacteria | 12731 |
| 616 | Ga0501038_0017105 | 3300049574 | Bacteria | 6559 |
| 617 | Ga0501038_0107515 | 3300049574 | Bacteria | 2314 |
| 618 | Ga0501038_0187675 | 3300049574 | Bacteria | 1665 |
| 619 | Ga0501039_0160326 | 3300049575 | Bacteria | 1768 |
| 620 | Ga0501039_0169351 | 3300049575 | Bacteria | 1717 |
| 621 | Ga0501039_0349722 | 3300049575 | Bacteria | 1161 |
| 622 | Ga0501039_0528803 | 3300049575 | Bacteria | 926 |
| 623 | Ga0501040_0031976 | 3300049576 | Bacteria | 3559 |
| 624 | Ga0501041_0611848 | 3300049577 | Bacteria | 696 |
| 625 | Ga0501042_0105107 | 3300049578 | Bacteria | 2032 |
| 626 | Ga0501043_0045796 | 3300049579 | Bacteria | 3439 |
| 627 | Ga0501043_0063973 | 3300049579 | Bacteria | 2889 |
| 628 | Ga0501043_0236833 | 3300049579 | Bacteria | 1409 |
| 629 | Ga0501046_0034143 | 3300049580 | Bacteria | 4107 |
| 630 | Ga0501046_0431621 | 3300049580 | Bacteria | 949 |
| 631 | Ga0501047_0023678 | 3300049581 | Bacteria | 5895 |
| 632 | Ga0501047_0036351 | 3300049581 | Bacteria | 4760 |
| 633 | Ga0501047_0277904 | 3300049581 | Bacteria | 1520 |
| 634 | Ga0501047_0296365 | 3300049581 | Bacteria | 1460 |
| 635 | Ga0501048_0091551 | 3300049582 | Bacteria | 2145 |
| 636 | Ga0501048_0319704 | 3300049582 | Bacteria | 1106 |
| 637 | Ga0501067_0012909 | 3300049583 | Bacteria | 4625 |
| 638 | Ga0501069_0001745 | 3300049585 | Bacteria | 10845 |
| 639 | Ga0501069_0057521 | 3300049585 | Bacteria | 2168 |
| 640 | Ga0501070_0027558 | 3300049586 | Bacteria | 4765 |
| 641 | Ga0501070_0074851 | 3300049586 | Bacteria | 2803 |
| 642 | Ga0501070_0123101 | 3300049586 | Bacteria | 2143 |
| 643 | Ga0501070_0222736 | 3300049586 | Bacteria | 1546 |
| 644 | Ga0501070_0313004 | 3300049586 | Bacteria | 1278 |
| 645 | Ga0501070_0333902 | 3300049586 | Bacteria | 1232 |
| 646 | Ga0501070_0854900 | 3300049586 | Bacteria | 712 |
| 647 | Ga0501071_0015644 | 3300049587 | Bacteria | 5209 |
| 648 | Ga0501071_0034014 | 3300049587 | Bacteria | 3625 |
| 649 | Ga0501071_0467130 | 3300049587 | Bacteria | 966 |
| 650 | Ga0501071_0592771 | 3300049587 | Bacteria | 852 |
| 651 | Ga0501072_0000939 | 3300049588 | Bacteria | 21461 |
| 652 | Ga0501072_0004815 | 3300049588 | Bacteria | 10278 |
| 653 | Ga0501072_0125897 | 3300049588 | Bacteria | 2042 |
| 654 | Ga0501072_0699507 | 3300049588 | Bacteria | 797 |
| 655 | Ga0501073_0020046 | 3300049589 | Bacteria | 4822 |
| 656 | Ga0501073_0020369 | 3300049589 | Bacteria | 4784 |
| 657 | Ga0501073_0191426 | 3300049589 | Bacteria | 1415 |
| 658 | Ga0501073_0266151 | 3300049589 | Bacteria | 1183 |
| 659 | Ga0501074_0054425 | 3300049590 | Bacteria | 2885 |
| 660 | Ga0501074_0248668 | 3300049590 | Bacteria | 1264 |
| 661 | Ga0501074_0388708 | 3300049590 | Bacteria | 990 |
| 662 | Ga0501074_0389034 | 3300049590 | Bacteria | 989 |
| 663 | Ga0501075_0018333 | 3300049591 | Bacteria | 5065 |
| 664 | Ga0501076_0071225 | 3300049592 | Bacteria | 2781 |
| 665 | Ga0501076_0227319 | 3300049592 | Bacteria | 1525 |
| 666 | Ga0501076_0488549 | 3300049592 | Bacteria | 1015 |
| 667 | Ga0501238_026423 | 3300049671 | Bacteria | 833 |
| 668 | Ga0501079_0205755 | 3300049741 | Bacteria | 1537 |
| 669 | Ga0501080_0015948 | 3300049742 | Bacteria | 6930 |
| 670 | Ga0501080_0207096 | 3300049742 | Bacteria | 1798 |
| 671 | Ga0501080_0279661 | 3300049742 | Bacteria | 1517 |
| 672 | Ga0501080_0594570 | 3300049742 | Bacteria | 983 |
| 673 | Ga0501083_0004516 | 3300049744 | Bacteria | 9834 |
| 674 | Ga0501083_0005650 | 3300049744 | Bacteria | 8855 |
| 675 | Ga0501083_0033066 | 3300049744 | Bacteria | 3542 |
| 676 | Ga0501083_0046272 | 3300049744 | Bacteria | 2942 |
| 677 | Ga0501083_0047806 | 3300049744 | Bacteria | 2889 |
| 678 | Ga0501083_0150465 | 3300049744 | Bacteria | 1524 |
| 679 | Ga0501083_0285392 | 3300049744 | Bacteria | 1073 |
| 680 | Ga0501083_0330378 | 3300049744 | Bacteria | 991 |
| 681 | Ga0501083_0431474 | 3300049744 | Bacteria | 857 |
| 682 | Ga0501035_0038212 | 3300049822 | Bacteria | 4346 |
| 683 | Ga0501035_0115496 | 3300049822 | Bacteria | 2349 |
| 684 | Ga0501035_0279600 | 3300049822 | Bacteria | 1411 |
| 685 | Ga0501035_0293448 | 3300049822 | Bacteria | 1372 |
| 686 | Ga0501035_1064728 | 3300049822 | Bacteria | 633 |
| 687 | Ga0501044_0000116 | 3300049823 | Bacteria | 96626 |
| 688 | Ga0501044_0097872 | 3300049823 | Bacteria | 2954 |
| 689 | Ga0501044_0120610 | 3300049823 | Bacteria | 2624 |
| 690 | Ga0501044_0279809 | 3300049823 | Bacteria | 1602 |
| 691 | Ga0501044_0420910 | 3300049823 | Bacteria | 1246 |
| 692 | Ga0501045_0073422 | 3300049824 | Bacteria | 2519 |
| 693 | nmdc:mga03683_156698_c1 | 3300050489 | Bacteria | 1030 |
| 694 | nmdc:mga03683_224071_c1 | 3300050489 | Bacteria | 868 |
| 695 | nmdc:mga00v17_109964_c1 | 3300050491 | Bacteria | 1748 |
| 696 | nmdc:mga00v17_69278_c2 | 3300050491 | Bacteria | 1592 |
| 697 | nmdc:mga0yw44_406600_c1 | 3300050492 | Bacteria | 921 |
| 698 | nmdc:mga0k408_517470_c1 | 3300050493 | Bacteria | 706 |
| 699 | nmdc:mga05p37_14_c1 | 3300050507 | Bacteria | 137209 |
| 700 | nmdc:mga05p37_31141_c1 | 3300050507 | Bacteria | 6515 |
| 701 | nmdc:mga05p37_390210_c1 | 3300050507 | Bacteria | 1628 |
| 702 | nmdc:mga05p37_530592_c1 | 3300050507 | Bacteria | 1344 |
| 703 | nmdc:mga05p37_981084_c1 | 3300050507 | Bacteria | 900 |
| 704 | nmdc:mga09592_12508_c1 | 3300050508 | Bacteria | 6916 |
| 705 | nmdc:mga09592_300860_c1 | 3300050508 | Bacteria | 1391 |
| 706 | nmdc:mga09592_37448_c1 | 3300050508 | Bacteria | 4069 |
| 707 | nmdc:mga0qj67_16354_c1 | 3300050509 | Bacteria | 5625 |
| 708 | nmdc:mga0qj67_74899_c1 | 3300050509 | Bacteria | 2705 |
| 709 | nmdc:mga06r32_196385_c1 | 3300050510 | Bacteria | 2005 |
| 710 | nmdc:mga06r32_50328_c1 | 3300050510 | Bacteria | 3985 |
| 711 | nmdc:mga06r32_688060_c1 | 3300050510 | Bacteria | 989 |
| 712 | nmdc:mga06r32_714_c1 | 3300050510 | Bacteria | 29059 |
| 713 | nmdc:mga08y16_105351_c1 | 3300050511 | Bacteria | 2936 |
| 714 | nmdc:mga08y16_1811_c1 | 3300050511 | Bacteria | 21663 |
| 715 | nmdc:mga08y16_412218_c1 | 3300050511 | Bacteria | 1382 |
| 716 | nmdc:mga0n895_1057743_c1 | 3300050512 | Bacteria | 790 |
| 717 | nmdc:mga0n895_247314_c1 | 3300050512 | Bacteria | 1810 |
| 718 | nmdc:mga0n895_43372_c1 | 3300050512 | Bacteria | 4383 |
| 719 | nmdc:mga0n895_517937_c1 | 3300050512 | Bacteria | 1200 |
| 720 | nmdc:mga0rr50_31471_c1 | 3300050513 | Bacteria | 3768 |
| 721 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 722 | nmdc:mga08x19_52556_c1 | 3300050514 | Bacteria | 2620 |
| 723 | nmdc:mga08x19_80915_c1 | 3300050514 | Bacteria | 2133 |
| 724 | nmdc:mga0a205_4829_c1 | 3300050515 | Bacteria | 9802 |
| 725 | Ga0495601_0000005 | 3300053077 | Bacteria | 387079 |
| 726 | Ga0495601_0019966 | 3300053077 | Bacteria | 4089 |
| 727 | Ga0495601_0042296 | 3300053077 | Bacteria | 2858 |
| 728 | Ga0495612_0000001 | 3300053078 | Bacteria | 418244 |
| 729 | Ga0495612_0000692 | 3300053078 | Bacteria | 13609 |
| 730 | Ga0495655_0058963 | 3300053083 | Bacteria | 1041 |
| 731 | Ga0495595_0000304 | 3300053084 | Bacteria | 19110 |
| 732 | Ga0495595_0002561 | 3300053084 | Bacteria | 7137 |
| 733 | Ga0495595_0025981 | 3300053084 | Bacteria | 2598 |
| 734 | Ga0495595_0226797 | 3300053084 | Bacteria | 933 |
| 735 | Ga0495619_0000017 | 3300053085 | Bacteria | 219276 |
| 736 | Ga0495619_0003188 | 3300053085 | Bacteria | 10626 |
| 737 | Ga0495619_0066341 | 3300053085 | Bacteria | 2408 |
| 738 | Ga0495619_0193370 | 3300053085 | Bacteria | 1408 |
| 739 | Ga0500647_0092134 | 3300053091 | Bacteria | 1450 |
| 740 | Ga0500566_0062547 | 3300053094 | Bacteria | 2104 |
| 741 | Ga0500641_0008839 | 3300053096 | Bacteria | 3607 |
| 742 | Ga0500641_0030155 | 3300053096 | Bacteria | 2129 |
| 743 | Ga0500556_0000048 | 3300053104 | Bacteria | 123558 |
| 744 | Ga0500562_070743 | 3300053108 | Bacteria | 941 |
| 745 | Ga0500593_000013 | 3300053117 | Bacteria | 59669 |
| 746 | Ga0500595_009162 | 3300053119 | Bacteria | 4009 |
| 747 | Ga0500595_028262 | 3300053119 | Bacteria | 1913 |
| 748 | Ga0500642_0076693 | 3300053130 | Bacteria | 1529 |
| 749 | Ga0500652_000002 | 3300053131 | Bacteria | 273315 |
| 750 | Ga0500652_105140 | 3300053131 | Bacteria | 1180 |
| 751 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 752 | Ga0500568_0049428 | 3300053139 | Bacteria | 1660 |
| 753 | Ga0500588_0004399 | 3300053146 | Bacteria | 3052 |
| 754 | Ga0500604_0000091 | 3300053151 | Bacteria | 29061 |
| 755 | Ga0500616_0011123 | 3300053153 | Bacteria | 5341 |
| 756 | Ga0500616_0027109 | 3300053153 | Bacteria | 3166 |
| 757 | Ga0500616_0237159 | 3300053153 | Bacteria | 786 |
| 758 | Ga0500624_021962 | 3300053157 | Bacteria | 1035 |
| 759 | Ga0500627_0282631 | 3300053158 | Bacteria | 728 |
| 760 | Ga0500637_0001399 | 3300053178 | Bacteria | 10262 |
| 761 | Ga0501084_0078951 | 3300054114 | Bacteria | 2758 |
| 762 | Ga0501084_0126127 | 3300054114 | Bacteria | 2154 |
| 763 | Ga0501084_0232939 | 3300054114 | Bacteria | 1554 |
| 764 | Ga0501084_0255752 | 3300054114 | Bacteria | 1478 |
| 765 | Ga0501084_0643646 | 3300054114 | Bacteria | 895 |
| 766 | Ga0590071_047627 | 3300059421 | Bacteria | 1037 |
| 767 | Ga0501082_0000084 | 3300060353 | Bacteria | 70644 |
| 768 | Ga0501082_0051027 | 3300060353 | Bacteria | 3566 |
| 769 | Ga0501082_0097787 | 3300060353 | Bacteria | 2538 |
| 770 | Ga0501082_0151854 | 3300060353 | Bacteria | 2012 |
| 771 | Ga0501082_0218798 | 3300060353 | Bacteria | 1657 |
| 772 | Ga0530510_0015528 | 3300061734 | Bacteria | 5383 |
| 773 | 2508733221 | 2508501050 | Bacteria | 9633614 |
| 774 | 2509075534 | 2508501114 | Bacteria | 7082538 |
| 775 | 2524612123 | 2524023250 | Bacteria | 5457705 |
| 776 | 2644728674 | 2643221733 | Bacteria | 5690728 |
| 777 | 2774868633 | 2773857925 | Bacteria | 6472445 |
| 778 | 2776260441 | 2775506901 | Bacteria | 9631051 |
| 779 | 2828309677 | 2828305725 | Bacteria | 4916900 |
| 780 | 2835316985 | 2835312727 | Bacteria | 7413381 |
| 781 | 2882460031 | 2882456835 | Bacteria | 6863978 |
| 782 | 2894234015 | 2894232714 | Bacteria | 8834183 |
| 783 | 8004215515 | 8004212874 | Bacteria | 2861420 |
| 784 | Ga0207644_10419907 | |||
| 785 | JGI25153J46596_10010210 | |||
| 786 | Ga0065715_10270174 | |||
| 787 | Ga0070658_10318421 | |||
| 788 | Ga0070676_10021207 | |||
| 789 | Ga0070676_10024845 | |||
| 790 | Ga0068869_100625194 | |||
| 791 | Ga0070680_100020040 | |||
| 792 | Ga0068868_100053089 | |||
| 793 | Ga0070660_100088699 | |||
| 794 | Ga0070689_100013410 | |||
| 795 | Ga0070687_100187930 | |||
| 796 | Ga0070687_100198733 | |||
| 797 | Ga0070668_100314298 | |||
| 798 | Ga0070669_100257802 | |||
| 799 | Ga0070675_100094611 | |||
| 800 | Ga0070675_100142304 | |||
| 801 | Ga0070671_100271832 | |||
| 802 | Ga0070674_100003109 | |||
| 803 | Ga0070674_100049922 | |||
| 804 | Ga0070667_100418776 | |||
| 805 | Ga0070714_100047550 | |||
| 806 | Ga0070714_100371499 | |||
| 807 | Ga0070710_10158146 | |||
| 808 | Ga0070711_100014324 | |||
| 809 | Ga0070711_100148362 | |||
| 810 | Ga0070711_100242823 | |||
| 811 | Ga0070678_100034607 | |||
| 812 | Ga0070678_100041449 | |||
| 813 | Ga0070678_100398110 | |||
| 814 | Ga0070662_100678082 | |||
| 815 | Ga0070681_10004738 | |||
| 816 | Ga0070681_10089187 | |||
| 817 | Ga0070681_10132888 | |||
| 818 | Ga0070681_10331805 | |||
| 819 | Ga0068867_100008373 | |||
| 820 | Ga0068867_100733588 | |||
| 821 | Ga0070706_100596953 | |||
| 822 | Ga0070706_100624282 | |||
| 823 | Ga0070698_100549605 | |||
| 824 | Ga0070699_100176213 | |||
| 825 | Ga0070679_100005303 | |||
| 826 | Ga0070679_100463543 | |||
| 827 | Ga0070684_100307568 | |||
| 828 | Ga0070684_100327883 | |||
| 829 | Ga0070697_100019164 | |||
| 830 | Ga0070697_100319534 | |||
| 831 | Ga0068853_100605522 | |||
| 832 | Ga0070672_100094374 | |||
| 833 | Ga0070672_100489371 | |||
| 834 | Ga0070686_100090036 | |||
| 835 | Ga0070686_100169807 | |||
| 836 | Ga0070695_100060831 | |||
| 837 | Ga0070696_100110288 | |||
| 838 | Ga0070693_100232379 | |||
| 839 | Ga0070665_100000913 | |||
| 840 | Ga0070665_100653267 | |||
| 841 | Ga0070665_100672664 | |||
| 842 | Ga0070704_100160281 | |||
| 843 | Ga0070704_100973458 | |||
| 844 | Ga0068855_100168776 | |||
| 845 | Ga0068855_100367664 | |||
| 846 | Ga0068855_100482946 | |||
| 847 | Ga0068855_101044525 | |||
| 848 | Ga0070664_100165002 | |||
| 849 | Ga0068854_100132511 | |||
| 850 | Ga0070702_100029594 | |||
| 851 | Ga0068852_100054067 | |||
| 852 | Ga0068852_100146896 | |||
| 853 | Ga0068864_100061280 | |||
| 854 | Ga0068861_100075201 | |||
| 855 | Ga0068863_100227726 | |||
| 856 | Ga0068858_100245757 | |||
| 857 | Ga0068862_100167529 | |||
| 858 | Ga0081455_10025722 | |||
| 859 | Ga0081455_10125296 | |||
| 860 | Ga0081455_10367252 | |||
| 861 | Ga0081538_10005050 | |||
| 862 | Ga0081540_1000194 | |||
| 863 | Ga0081540_1003980 | |||
| 864 | Ga0081540_1030141 | |||
| 865 | Ga0081539_10005651 | |||
| 866 | Ga0070717_10084664 | |||
| 867 | Ga0070717_10169379 | |||
| 868 | Ga0070717_10254567 | |||
| 869 | Ga0075365_10005800 | |||
| 870 | Ga0075365_10394613 | |||
| 871 | Ga0075368_10028231 | |||
| 872 | Ga0075368_10065693 | |||
| 873 | Ga0075363_100017907 | |||
| 874 | Ga0075363_100083400 | |||
| 875 | Ga0075364_10071882 | |||
| 876 | Ga0075364_10104975 | |||
| 877 | Ga0075364_10241015 | |||
| 878 | Ga0070715_10390494 | |||
| 879 | Ga0070716_100269755 | |||
| 880 | Ga0070712_100010707 | |||
| 881 | Ga0070712_100017711 | |||
| 882 | Ga0070712_100374239 | |||
| 883 | Ga0075362_10034328 | |||
| 884 | Ga0075362_10180539 | |||
| 885 | Ga0075362_10244644 | |||
| 886 | Ga0075367_10010802 | |||
| 887 | Ga0075367_10020548 | |||
| 888 | Ga0075367_10549803 | |||
| 889 | Ga0075369_10003352 | |||
| 890 | Ga0075369_10135902 | |||
| 891 | Ga0075366_10019201 | |||
| 892 | Ga0075366_10032023 | |||
| 893 | Ga0097621_101088944 | |||
| 894 | Ga0075370_10155584 | |||
| 895 | Ga0075370_10234177 | |||
| 896 | Ga0068871_100497857 | |||
| 897 | Ga0075428_100001228 | |||
| 898 | Ga0075428_100192634 | |||
| 899 | Ga0075428_100427705 | |||
| 900 | Ga0075428_100442547 | |||
| 901 | Ga0075428_101027531 | |||
| 902 | Ga0075430_100000170 | |||
| 903 | Ga0075430_100014636 | |||
| 904 | Ga0075430_100256346 | |||
| 905 | Ga0075430_100500405 | |||
| 906 | Ga0075431_100000812 | |||
| 907 | Ga0075431_100087543 | |||
| 908 | Ga0075431_100178864 | |||
| 909 | Ga0075431_100191421 | |||
| 910 | Ga0075434_100042112 | |||
| 911 | Ga0075434_100068602 | |||
| 912 | Ga0075434_100414112 | |||
| 913 | Ga0075429_100010495 | |||
| 914 | Ga0075429_100012850 | |||
| 915 | Ga0075429_100318630 | |||
| 916 | Ga0075429_100787714 | |||
| 917 | Ga0075436_100003022 | |||
| 918 | Ga0075436_100013301 | |||
| 919 | Ga0075435_100037566 | |||
| 920 | Ga0075435_100067785 | |||
| 921 | Ga0075435_100083024 | |||
| 922 | Ga0099795_10006014 | |||
| 923 | Ga0099795_10026882 | |||
| 924 | Ga0105240_10143434 | |||
| 925 | Ga0105240_10154842 | |||
| 926 | Ga0105240_10163960 | |||
| 927 | Ga0105240_10770582 | |||
| 928 | Ga0105240_11265897 | |||
| 929 | Ga0111539_10001371 | |||
| 930 | Ga0111539_10042732 | |||
| 931 | Ga0105245_10024476 | |||
| 932 | Ga0105245_10785919 | |||
| 933 | Ga0105245_10838684 | |||
| 934 | Ga0105245_10853148 | |||
| 935 | Ga0105247_10410716 | |||
| 936 | Ga0114129_10005694 | |||
| 937 | Ga0114129_10005820 | |||
| 938 | Ga0114129_10440750 | |||
| 939 | Ga0114129_10523361 | |||
| 940 | Ga0114129_10639134 | |||
| 941 | Ga0114129_10939959 | |||
| 942 | Ga0105243_10461069 | |||
| 943 | Ga0105248_10174924 | |||
| 944 | Ga0105248_10175545 | |||
| 945 | Ga0105248_10674573 | |||
| 946 | Ga0105237_10690991 | |||
| 947 | Ga0105237_11089809 | |||
| 948 | Ga0105238_10031321 | |||
| 949 | Ga0105238_10039306 | |||
| 950 | Ga0105238_10088301 | |||
| 951 | Ga0105238_10099775 | |||
| 952 | Ga0105238_10272795 | |||
| 953 | Ga0105249_10278254 | |||
| 954 | Ga0105249_10349699 | |||
| 955 | Ga0105249_10579172 | |||
| 956 | Ga0105239_10124928 | |||
| 957 | Ga0105246_10111898 | |||
| 958 | Ga0157370_10351288 | |||
| 959 | Ga0157378_10105957 | |||
| 960 | Ga0157378_10318584 | |||
| 961 | Ga0157378_10531941 | |||
| 962 | Ga0157378_11628366 | |||
| 963 | Ga0157375_10117613 | |||
| 964 | Ga0157375_10310554 | |||
| 965 | Ga0157375_10542899 | |||
| 966 | Ga0157375_10603940 | |||
| 967 | Ga0157380_10146522 | |||
| 968 | Ga0157380_10935645 | |||
| 969 | Ga0157377_10687316 | |||
| 970 | Ga0157379_10341441 | |||
| 971 | Ga0157376_10095816 | |||
| 972 | Ga0163161_10291441 | |||
| 973 | Ga0206353_10806976 | |||
| 974 | Ga0213874_10031623 | |||
| 975 | Ga0213876_10099014 | |||
| 976 | Ga0213871_10100434 | |||
| 977 | Ga0209646_1000030 | |||
| 978 | Ga0209758_1000385 | |||
| 979 | Ga0207697_10019432 | |||
| 980 | Ga0207697_10091181 | |||
| 981 | Ga0207692_10020829 | |||
| 982 | Ga0207692_10045877 | |||
| 983 | Ga0207710_10204562 | |||
| 984 | Ga0207688_10105026 | |||
| 985 | Ga0207688_10116658 | |||
| 986 | Ga0207685_10102251 | |||
| 987 | Ga0207699_10068772 | |||
| 988 | Ga0207699_10106311 | |||
| 989 | Ga0207699_10618816 | |||
| 990 | Ga0207645_10015040 | |||
| 991 | Ga0207645_10097906 | |||
| 992 | Ga0207705_10074153 | |||
| 993 | Ga0207705_10419316 | |||
| 994 | Ga0207705_10604251 | |||
| 995 | Ga0207684_10097529 | |||
| 996 | Ga0207684_10552109 | |||
| 997 | Ga0207707_10022094 | |||
| 998 | Ga0207707_10033427 | |||
| 999 | Ga0207707_10069780 | |||
| 1000 | Ga0207695_10103484 | |||
| 1001 | Ga0207695_10147056 | |||
| 1002 | Ga0207695_10764735 | |||
| 1003 | Ga0207693_10013809 | |||
| 1004 | Ga0207693_10177987 | |||
| 1005 | Ga0207693_10287955 | |||
| 1006 | Ga0207663_10024626 | |||
| 1007 | Ga0207663_10101049 | |||
| 1008 | Ga0207660_10016056 | |||
| 1009 | Ga0207660_10204767 | |||
| 1010 | Ga0207657_10020194 | |||
| 1011 | Ga0207657_10381290 | |||
| 1012 | Ga0207652_10017504 | |||
| 1013 | Ga0207652_10089042 | |||
| 1014 | Ga0207694_10014321 | |||
| 1015 | Ga0207694_10376808 | |||
| 1016 | Ga0207694_10609709 | |||
| 1017 | Ga0207659_10274437 | |||
| 1018 | Ga0207659_10457160 | |||
| 1019 | Ga0207700_10808342 | |||
| 1020 | Ga0207690_10608024 | |||
| 1021 | Ga0207706_10167446 | |||
| 1022 | Ga0207670_10001629 | |||
| 1023 | Ga0207669_10002621 | |||
| 1024 | Ga0207669_10012717 | |||
| 1025 | Ga0207704_10590653 | |||
| 1026 | Ga0207665_10082598 | |||
| 1027 | Ga0207691_10008224 | |||
| 1028 | Ga0207691_10157908 | |||
| 1029 | Ga0207711_10077903 | |||
| 1030 | Ga0207711_10424825 | |||
| 1031 | Ga0207689_10264720 | |||
| 1032 | Ga0207689_10355200 | |||
| 1033 | Ga0207679_10088406 | |||
| 1034 | Ga0207667_10016783 | |||
| 1035 | Ga0207667_10131297 | |||
| 1036 | Ga0207667_10167227 | |||
| 1037 | Ga0207667_10737557 | |||
| 1038 | Ga0207667_10863042 | |||
| 1039 | Ga0207651_10576854 | |||
| 1040 | Ga0207712_10545110 | |||
| 1041 | Ga0207668_10356255 | |||
| 1042 | Ga0207668_10632870 | |||
| 1043 | Ga0207640_10235668 | |||
| 1044 | Ga0207658_10206373 | |||
| 1045 | Ga0207677_10031527 | |||
| 1046 | Ga0207703_10235063 | |||
| 1047 | Ga0207708_10213686 | |||
| 1048 | Ga0207648_10005736 | |||
| 1049 | Ga0207648_10474852 | |||
| 1050 | Ga0207648_10554002 | |||
| 1051 | Ga0207676_10024100 | |||
| 1052 | Ga0207676_10697966 | |||
| 1053 | Ga0207675_100426118 | |||
| 1054 | Ga0207683_10007234 | |||
| 1055 | Ga0207683_10130944 | |||
| 1056 | Ga0207428_10002878 | |||
| 1057 | Ga0268266_10000346 | |||
| 1058 | Ga0268266_10168092 | |||
| 1059 | Ga0268266_11362415 | |||
| 1060 | Ga0268265_10080958 | |||
| 1061 | Ga0265318_10082322 | |||
| 1062 | Ga0265338_10131800 | |||
| 1063 | Ga0265330_10041409 | |||
| 1064 | Ga0265330_10184443 | |||
| 1065 | Ga0265328_10000445 | |||
| 1066 | Ga0265328_10021331 | |||
| 1067 | Ga0265328_10200917 | |||
| 1068 | Ga0265325_10018262 | |||
| 1069 | Ga0265325_10036906 | |||
| 1070 | Ga0265325_10065711 | |||
| 1071 | Ga0265325_10080223 | |||
| 1072 | Ga0265325_10144439 | |||
| 1073 | Ga0265329_10004861 | |||
| 1074 | Ga0265340_10000814 | |||
| 1075 | Ga0265340_10021426 | |||
| 1076 | Ga0265340_10041676 | |||
| 1077 | Ga0265340_10046379 | |||
| 1078 | Ga0265340_10112894 | |||
| 1079 | Ga0265339_10029504 | |||
| 1080 | Ga0265339_10103546 | |||
| 1081 | Ga0265339_10109397 | |||
| 1082 | Ga0265339_10116796 | |||
| 1083 | Ga0265339_10154000 | |||
| 1084 | Ga0265339_10168824 | |||
| 1085 | Ga0265339_10316441 | |||
| 1086 | Ga0265331_10000082 | |||
| 1087 | Ga0265331_10119367 | |||
| 1088 | Ga0265316_10135699 | |||
| 1089 | Ga0265316_10186232 | |||
| 1090 | Ga0265316_10276061 | |||
| 1091 | Ga0265316_10386047 | |||
| 1092 | Ga0307513_10124887 | |||
| 1093 | Ga0307408_100093673 | |||
| 1094 | Ga0307408_100183139 | |||
| 1095 | Ga0307408_100328195 | |||
| 1096 | Ga0265313_10000554 | |||
| 1097 | Ga0265313_10013708 | |||
| 1098 | Ga0316575_10016371 | |||
| 1099 | Ga0316579_10139624 | |||
| 1100 | Ga0316579_10290113 | |||
| 1101 | Ga0265314_10004396 | |||
| 1102 | Ga0265314_10022913 | |||
| 1103 | Ga0265314_10079643 | |||
| 1104 | Ga0265342_10001033 | |||
| 1105 | Ga0265342_10034165 | |||
| 1106 | Ga0265342_10038515 | |||
| 1107 | Ga0265342_10056104 | |||
| 1108 | Ga0265342_10097528 | |||
| 1109 | Ga0265342_10199325 | |||
| 1110 | Ga0316576_10206978 | |||
| 1111 | Ga0316576_10614320 | |||
| 1112 | Ga0307413_10210830 | |||
| 1113 | Ga0307413_10357204 | |||
| 1114 | Ga0307413_10572795 | |||
| 1115 | Ga0307410_10220931 | |||
| 1116 | Ga0307407_10260546 | |||
| 1117 | Ga0307409_100129350 | |||
| 1118 | Ga0307409_100288234 | |||
| 1119 | Ga0307416_100054363 | |||
| 1120 | Ga0307416_100287067 | |||
| 1121 | Ga0307414_10149142 | |||
| 1122 | Ga0307414_10528206 | |||
| 1123 | Ga0307411_10090026 | |||
| 1124 | Ga0316583_10016520 | |||
| 1125 | Ga0373930_0049440 | |||
| 1126 | Ga0373958_0057270 | |||
| 1127 | Ga0373959_0053882 | |||
| 1128 | Ga0373929_0029912 | |||
| 1129 | Ga0373949_0062383 | |||
| 1130 | Ga0373951_0087938 | |||
| 1131 | Ga0373952_0018052 | |||
| 1132 | Ga0373936_0005310 | |||
| 1133 | Ga0373936_0195284 | |||
| 1134 | Ga0373939_0008035 | |||
| 1135 | Ga0373941_0092888 | |||
| 1136 | Ga0373945_0007389 | |||
| 1137 | Ga0373945_0100759 | |||
| 1138 | Ga0373953_0013201 | |||
| 1139 | Ga0373954_0010307 | |||
| 1140 | Ga0373954_0081122 | |||
| 1141 | Ga0373957_0032542 | |||
| 1142 | Ga0373960_0035058 | |||
| 1143 | Ga0373943_0000268 | |||
| 1144 | Ga0373943_0012004 | |||
| 1145 | Ga0373943_0298335 | |||
| 1146 | Ga0373946_0001967 | |||
| 1147 | Ga0373946_0016212 | |||
| 1148 | Ga0373955_0010606 | |||
| 1149 | Ga0373955_0021860 | |||
| 1150 | Ga0373955_0160983 | |||
| 1151 | Ga0373961_0043358 | |||
| 1152 | Ga0316574_0000507 | |||
| 1153 | Ga0373924_0030653 | |||
| 1154 | Ga0373931_0003730 | |||
| 1155 | Ga0373931_0019831 | |||
| 1156 | Ga0373931_0060117 | |||
| 1157 | Ga0373935_0002242 | |||
| 1158 | Ga0373935_0011850 | |||
| 1159 | Ga0373935_0036347 | |||
| 1160 | Ga0373935_0341103 | |||
| 1161 | Ga0373935_0655331 | |||
| 1162 | Ga0373935_0955459 | |||
| 1163 | Ga0373927_0001748 | |||
| 1164 | Ga0373927_0017897 | |||
| 1165 | Ga0373927_0038320 | |||
| 1166 | Ga0373927_0055513 | |||
| 1167 | Ga0373927_0090278 | |||
| 1168 | Ga0373927_0110273 | |||
| 1169 | Ga0373927_0177145 | |||
| 1170 | Ga0373933_0007061 | |||
| 1171 | Ga0373947_0001270 | |||
| 1172 | Ga0373947_0009494 | |||
| 1173 | Ga0373947_0021720 | |||
| 1174 | Ga0373947_0049699 | |||
| 1175 | Ga0373947_0058781 | |||
| 1176 | Ga0373937_0000326 | |||
| 1177 | Ga0373937_0319117 | |||
| 1178 | Ga0373937_1062777 | |||
| 1179 | Ga0316582_0295883 | |||
| 1180 | Ga0316582_0507851 | |||
| 1181 | Ga0373925_0002641 | |||
| 1182 | Ga0373925_0010083 | |||
| 1183 | Ga0373925_0024003 | |||
| 1184 | Ga0373925_0057672 | |||
| 1185 | Ga0373925_0104794 | |||
| 1186 | Ga0373925_0191946 | |||
| 1187 | Ga0373925_0217079 | |||
| 1188 | Ga0373925_0409492 | |||
| 1189 | Ga0373925_0965104 | |||
| 1190 | Ga0395899_0006002 | |||
| 1191 | Ga0395899_0027248 | |||
| 1192 | Ga0395900_0003929 | |||
| 1193 | Ga0395898_0043976 | |||
| 1194 | Ga0395898_0061629 | |||
| 1195 | Ga0395905_0092047 | |||
| 1196 | Ga0395905_0997286 | |||
| 1197 | Ga0436364_0850496 | |||
| 1198 | Ga0436364_0885754 | |||
| 1199 | Ga0436364_1109044 | |||
| 1200 | Ga0436364_1228402 | |||
| 1201 | Ga0436364_1338625 | |||
| 1202 | Ga0395901_0022173 | |||
| 1203 | Ga0395901_0031439 | |||
| 1204 | Ga0395901_0267709 | |||
| 1205 | Ga0436365_0158765 | |||
| 1206 | Ga0436365_0243474 | |||
| 1207 | Ga0436365_1324643 | |||
| 1208 | Ga0436360_0945414 | |||
| 1209 | Ga0436360_1180969 | |||
| 1210 | Ga0436361_0393934 | |||
| 1211 | Ga0436361_0958976 | |||
| 1212 | Ga0436363_0940222 | |||
| 1213 | Ga0436363_1409348 | |||
| 1214 | Ga0436362_0173993 | |||
| 1215 | Ga0439453_0003358 | |||
| 1216 | Ga0439465_0053468 | |||
| 1217 | Ga0439431_0078030 | |||
| 1218 | Ga0439443_001515 | |||
| 1219 | Ga0439432_067982 | |||
| 1220 | Ga0439450_011703 | |||
| 1221 | Ga0450923_020616 | |||
| 1222 | Ga0439446_0164304 | |||
| 1223 | Ga0439458_0067302 | |||
| 1224 | Ga0439435_0008721 | |||
| 1225 | Ga0439460_0011049 | |||
| 1226 | Ga0466972_0034647 | |||
| 1227 | Ga0466966_0130821 | |||
| 1228 | Ga0466970_0410242 | |||
| 1229 | Ga0466957_0018226 | |||
| 1230 | Ga0466959_0107292 | |||
| 1231 | Ga0466959_0218707 | |||
| 1232 | Ga0451576_0384614 | |||
| 1233 | Ga0495592_0001009 | |||
| 1234 | Ga0495592_0125594 | |||
| 1235 | Ga0495603_0198710 | |||
| 1236 | Ga0495603_0405815 | |||
| 1237 | Ga0495590_0026819 | |||
| 1238 | Ga0495629_0023536 | |||
| 1239 | Ga0495629_0122320 | |||
| 1240 | Ga0495629_0208237 | |||
| 1241 | Ga0495651_0001005 | |||
| 1242 | Ga0495651_0570203 | |||
| 1243 | Ga0495653_0001279 | |||
| 1244 | Ga0495653_0044827 | |||
| 1245 | Ga0495580_0059860 | |||
| 1246 | Ga0495605_0098558 | |||
| 1247 | Ga0495639_0113280 | |||
| 1248 | Ga0495662_0012656 | |||
| 1249 | Ga0495662_0026024 | |||
| 1250 | Ga0495662_0427421 | |||
| 1251 | Ga0495664_0000518 | |||
| 1252 | Ga0495664_0004700 | |||
| 1253 | Ga0495584_0120464 | |||
| 1254 | Ga0495594_0214649 | |||
| 1255 | Ga0495608_0001062 | |||
| 1256 | Ga0495610_0044499 | |||
| 1257 | Ga0495618_0001010 | |||
| 1258 | Ga0495618_0014498 | |||
| 1259 | Ga0495628_0000010 | |||
| 1260 | Ga0495628_0219859 | |||
| 1261 | Ga0495630_0016239 | |||
| 1262 | Ga0495630_0017046 | |||
| 1263 | Ga0495630_0121268 | |||
| 1264 | Ga0495663_0049329 | |||
| 1265 | Ga0495652_0000008 | |||
| 1266 | Ga0495652_0021286 | |||
| 1267 | Ga0495652_0597314 | |||
| 1268 | Ga0495665_0204709 | |||
| 1269 | Ga0495640_0000947 | |||
| 1270 | Ga0495640_0001350 | |||
| 1271 | Ga0495640_0058699 | |||
| 1272 | Ga0495640_0108055 | |||
| 1273 | Ga0495586_0097826 | |||
| 1274 | Ga0495587_0000009 | |||
| 1275 | Ga0495598_0005799 | |||
| 1276 | Ga0495621_0032930 | |||
| 1277 | Ga0495645_0000005 | |||
| 1278 | Ga0495622_0063970 | |||
| 1279 | Ga0495633_0241963 | |||
| 1280 | Ga0495667_0000145 | |||
| 1281 | Ga0495667_0200847 | |||
| 1282 | Ga0495656_0083290 | |||
| 1283 | Ga0495634_0000941 | |||
| 1284 | Ga0495634_0001750 | |||
| 1285 | Ga0495635_0000014 | |||
| 1286 | Ga0495635_0218677 | |||
| 1287 | Ga0495635_0331048 | |||
| 1288 | Ga0495659_0197067 | |||
| 1289 | Ga0495599_0000010 | |||
| 1290 | Ga0495623_0000119 | |||
| 1291 | Ga0495646_0000008 | |||
| 1292 | Ga0495658_0095603 | |||
| 1293 | Ga0495658_0212797 | |||
| 1294 | Ga0495658_0431538 | |||
| 1295 | Ga0495613_0011650 | |||
| 1296 | Ga0495613_0073397 | |||
| 1297 | Ga0495613_0351236 | |||
| 1298 | Ga0495624_0001454 | |||
| 1299 | Ga0495671_0290710 | |||
| 1300 | Ga0495600_0021058 | |||
| 1301 | Ga0495581_0004424 | |||
| 1302 | Ga0495581_0027761 | |||
| 1303 | Ga0495604_0000006 | |||
| 1304 | Ga0495674_0000005 | |||
| 1305 | Ga0495674_0225588 | |||
| 1306 | Ga0495674_0575517 | |||
| 1307 | Ga0495672_0107168 | |||
| 1308 | Ga0495680_0002789 | |||
| 1309 | Ga0495683_0136558 | |||
| 1310 | Ga0495675_0000806 | |||
| 1311 | Ga0495684_0001275 | |||
| 1312 | Ga0495684_0001418 | |||
| 1313 | Ga0495684_0002706 | |||
| 1314 | Ga0495684_0092094 | |||
| 1315 | Ga0495684_0252665 | |||
| 1316 | Ga0495593_0013626 | |||
| 1317 | Ga0495602_0002313 | |||
| 1318 | Ga0495602_0144206 | |||
| 1319 | Ga0495602_0313315 | |||
| 1320 | Ga0496100_0005878 | |||
| 1321 | Ga0496100_0331867 | |||
| 1322 | Ga0496100_0360116 | |||
| 1323 | Ga0496100_0674129 | |||
| 1324 | Ga0496100_0775006 | |||
| 1325 | Ga0496101_0003932 | |||
| 1326 | Ga0496101_0142534 | |||
| 1327 | Ga0496102_0020461 | |||
| 1328 | Ga0496103_0085548 | |||
| 1329 | Ga0496104_0043112 | |||
| 1330 | Ga0496104_0566079 | |||
| 1331 | Ga0496104_0573984 | |||
| 1332 | Ga0496105_0036916 | |||
| 1333 | Ga0496105_0098214 | |||
| 1334 | Ga0496105_0404475 | |||
| 1335 | Ga0496106_0004676 | |||
| 1336 | Ga0496106_0173603 | |||
| 1337 | Ga0496107_0110560 | |||
| 1338 | Ga0496108_0002173 | |||
| 1339 | Ga0496108_0031731 | |||
| 1340 | Ga0496108_0161326 | |||
| 1341 | Ga0496108_0347890 | |||
| 1342 | Ga0496109_0010264 | |||
| 1343 | Ga0496109_0011371 | |||
| 1344 | Ga0496109_0054252 | |||
| 1345 | Ga0496109_0164829 | |||
| 1346 | Ga0496109_0876997 | |||
| 1347 | Ga0496110_0013717 | |||
| 1348 | Ga0496110_0014973 | |||
| 1349 | Ga0496110_0029499 | |||
| 1350 | Ga0496110_0046849 | |||
| 1351 | Ga0496110_0635142 | |||
| 1352 | Ga0496110_1119444 | |||
| 1353 | Ga0496111_0019435 | |||
| 1354 | Ga0496111_0041404 | |||
| 1355 | Ga0496111_0065815 | |||
| 1356 | Ga0496112_0038561 | |||
| 1357 | Ga0496112_0044780 | |||
| 1358 | Ga0496112_0877617 | |||
| 1359 | Ga0496113_0062234 | |||
| 1360 | Ga0496113_0982552 | |||
| 1361 | Ga0496114_0119673 | |||
| 1362 | Ga0496114_0125346 | |||
| 1363 | Ga0496114_0129965 | |||
| 1364 | Ga0496115_0007155 | |||
| 1365 | Ga0496115_0020530 | |||
| 1366 | Ga0496115_0035648 | |||
| 1367 | Ga0496117_0320067 | |||
| 1368 | Ga0496119_0001342 | |||
| 1369 | Ga0496122_0001850 | |||
| 1370 | Ga0496123_0000498 | |||
| 1371 | Ga0496126_0250313 | |||
| 1372 | Ga0501318_018481 | |||
| 1373 | Ga0501031_0050004 | |||
| 1374 | Ga0501031_0063665 | |||
| 1375 | Ga0501031_0255318 | |||
| 1376 | Ga0501031_0640911 | |||
| 1377 | Ga0501032_0035499 | |||
| 1378 | Ga0501032_0249344 | |||
| 1379 | Ga0501033_0041023 | |||
| 1380 | Ga0501033_0050805 | |||
| 1381 | Ga0501033_0089925 | |||
| 1382 | Ga0501033_0133042 | |||
| 1383 | Ga0501033_0285339 | |||
| 1384 | Ga0501034_0003327 | |||
| 1385 | Ga0501034_0012125 | |||
| 1386 | Ga0501034_0080885 | |||
| 1387 | Ga0501034_0200457 | |||
| 1388 | Ga0501034_0216274 | |||
| 1389 | Ga0501034_0524092 | |||
| 1390 | Ga0501034_0643165 | |||
| 1391 | Ga0501034_0658676 | |||
| 1392 | Ga0501036_0004998 | |||
| 1393 | Ga0501036_0014273 | |||
| 1394 | Ga0501037_0012864 | |||
| 1395 | Ga0501037_0117643 | |||
| 1396 | Ga0501037_0121310 | |||
| 1397 | Ga0501037_0138863 | |||
| 1398 | Ga0501038_0004685 | |||
| 1399 | Ga0501038_0017105 | |||
| 1400 | Ga0501038_0107515 | |||
| 1401 | Ga0501038_0187675 | |||
| 1402 | Ga0501039_0160326 | |||
| 1403 | Ga0501039_0169351 | |||
| 1404 | Ga0501039_0349722 | |||
| 1405 | Ga0501039_0528803 | |||
| 1406 | Ga0501040_0031976 | |||
| 1407 | Ga0501041_0611848 | |||
| 1408 | Ga0501042_0105107 | |||
| 1409 | Ga0501043_0045796 | |||
| 1410 | Ga0501043_0063973 | |||
| 1411 | Ga0501043_0236833 | |||
| 1412 | Ga0501046_0034143 | |||
| 1413 | Ga0501046_0431621 | |||
| 1414 | Ga0501047_0023678 | |||
| 1415 | Ga0501047_0036351 | |||
| 1416 | Ga0501047_0277904 | |||
| 1417 | Ga0501047_0296365 | |||
| 1418 | Ga0501048_0091551 | |||
| 1419 | Ga0501048_0319704 | |||
| 1420 | Ga0501067_0012909 | |||
| 1421 | Ga0501069_0001745 | |||
| 1422 | Ga0501069_0057521 | |||
| 1423 | Ga0501070_0027558 | |||
| 1424 | Ga0501070_0074851 | |||
| 1425 | Ga0501070_0123101 | |||
| 1426 | Ga0501070_0222736 | |||
| 1427 | Ga0501070_0313004 | |||
| 1428 | Ga0501070_0333902 | |||
| 1429 | Ga0501070_0854900 | |||
| 1430 | Ga0501071_0015644 | |||
| 1431 | Ga0501071_0034014 | |||
| 1432 | Ga0501071_0467130 | |||
| 1433 | Ga0501071_0592771 | |||
| 1434 | Ga0501072_0000939 | |||
| 1435 | Ga0501072_0004815 | |||
| 1436 | Ga0501072_0125897 | |||
| 1437 | Ga0501072_0699507 | |||
| 1438 | Ga0501073_0020046 | |||
| 1439 | Ga0501073_0020369 | |||
| 1440 | Ga0501073_0191426 | |||
| 1441 | Ga0501073_0266151 | |||
| 1442 | Ga0501074_0054425 | |||
| 1443 | Ga0501074_0248668 | |||
| 1444 | Ga0501074_0388708 | |||
| 1445 | Ga0501074_0389034 | |||
| 1446 | Ga0501075_0018333 | |||
| 1447 | Ga0501076_0071225 | |||
| 1448 | Ga0501076_0227319 | |||
| 1449 | Ga0501076_0488549 | |||
| 1450 | Ga0501238_026423 | |||
| 1451 | Ga0501079_0205755 | |||
| 1452 | Ga0501080_0015948 | |||
| 1453 | Ga0501080_0207096 | |||
| 1454 | Ga0501080_0279661 | |||
| 1455 | Ga0501080_0594570 | |||
| 1456 | Ga0501083_0004516 | |||
| 1457 | Ga0501083_0005650 | |||
| 1458 | Ga0501083_0033066 | |||
| 1459 | Ga0501083_0046272 | |||
| 1460 | Ga0501083_0047806 | |||
| 1461 | Ga0501083_0150465 | |||
| 1462 | Ga0501083_0285392 | |||
| 1463 | Ga0501083_0330378 | |||
| 1464 | Ga0501083_0431474 | |||
| 1465 | Ga0501035_0038212 | |||
| 1466 | Ga0501035_0115496 | |||
| 1467 | Ga0501035_0279600 | |||
| 1468 | Ga0501035_0293448 | |||
| 1469 | Ga0501035_1064728 | |||
| 1470 | Ga0501044_0000116 | |||
| 1471 | Ga0501044_0097872 | |||
| 1472 | Ga0501044_0120610 | |||
| 1473 | Ga0501044_0279809 | |||
| 1474 | Ga0501044_0420910 | |||
| 1475 | Ga0501045_0073422 | |||
| 1476 | nmdc:mga03683_156698_c1 | |||
| 1477 | nmdc:mga03683_224071_c1 | |||
| 1478 | nmdc:mga00v17_109964_c1 | |||
| 1479 | nmdc:mga00v17_69278_c2 | |||
| 1480 | nmdc:mga0yw44_406600_c1 | |||
| 1481 | nmdc:mga0k408_517470_c1 | |||
| 1482 | nmdc:mga05p37_14_c1 | |||
| 1483 | nmdc:mga05p37_31141_c1 | |||
| 1484 | nmdc:mga05p37_390210_c1 | |||
| 1485 | nmdc:mga05p37_530592_c1 | |||
| 1486 | nmdc:mga05p37_981084_c1 | |||
| 1487 | nmdc:mga09592_12508_c1 | |||
| 1488 | nmdc:mga09592_300860_c1 | |||
| 1489 | nmdc:mga09592_37448_c1 | |||
| 1490 | nmdc:mga0qj67_16354_c1 | |||
| 1491 | nmdc:mga0qj67_74899_c1 | |||
| 1492 | nmdc:mga06r32_196385_c1 | |||
| 1493 | nmdc:mga06r32_50328_c1 | |||
| 1494 | nmdc:mga06r32_688060_c1 | |||
| 1495 | nmdc:mga06r32_714_c1 | |||
| 1496 | nmdc:mga08y16_105351_c1 | |||
| 1497 | nmdc:mga08y16_1811_c1 | |||
| 1498 | nmdc:mga08y16_412218_c1 | |||
| 1499 | nmdc:mga0n895_1057743_c1 | |||
| 1500 | nmdc:mga0n895_247314_c1 | |||
| 1501 | nmdc:mga0n895_43372_c1 | |||
| 1502 | nmdc:mga0n895_517937_c1 | |||
| 1503 | nmdc:mga0rr50_31471_c1 | |||
| 1504 | nmdc:mga08x19_14_c1 | |||
| 1505 | nmdc:mga08x19_52556_c1 | |||
| 1506 | nmdc:mga08x19_80915_c1 | |||
| 1507 | nmdc:mga0a205_4829_c1 | |||
| 1508 | Ga0495601_0000005 | |||
| 1509 | Ga0495601_0019966 | |||
| 1510 | Ga0495601_0042296 | |||
| 1511 | Ga0495612_0000001 | |||
| 1512 | Ga0495612_0000692 | |||
| 1513 | Ga0495655_0058963 | |||
| 1514 | Ga0495595_0000304 | |||
| 1515 | Ga0495595_0002561 | |||
| 1516 | Ga0495595_0025981 | |||
| 1517 | Ga0495595_0226797 | |||
| 1518 | Ga0495619_0000017 | |||
| 1519 | Ga0495619_0003188 | |||
| 1520 | Ga0495619_0066341 | |||
| 1521 | Ga0495619_0193370 | |||
| 1522 | Ga0500647_0092134 | |||
| 1523 | Ga0500566_0062547 | |||
| 1524 | Ga0500641_0008839 | |||
| 1525 | Ga0500641_0030155 | |||
| 1526 | Ga0500556_0000048 | |||
| 1527 | Ga0500562_070743 | |||
| 1528 | Ga0500593_000013 | |||
| 1529 | Ga0500595_009162 | |||
| 1530 | Ga0500595_028262 | |||
| 1531 | Ga0500642_0076693 | |||
| 1532 | Ga0500652_000002 | |||
| 1533 | Ga0500652_105140 | |||
| 1534 | Ga0500568_0000001 | |||
| 1535 | Ga0500568_0049428 | |||
| 1536 | Ga0500588_0004399 | |||
| 1537 | Ga0500604_0000091 | |||
| 1538 | Ga0500616_0011123 | |||
| 1539 | Ga0500616_0027109 | |||
| 1540 | Ga0500616_0237159 | |||
| 1541 | Ga0500624_021962 | |||
| 1542 | Ga0500627_0282631 | |||
| 1543 | Ga0500637_0001399 | |||
| 1544 | Ga0501084_0078951 | |||
| 1545 | Ga0501084_0126127 | |||
| 1546 | Ga0501084_0232939 | |||
| 1547 | Ga0501084_0255752 | |||
| 1548 | Ga0501084_0643646 | |||
| 1549 | Ga0590071_047627 | |||
| 1550 | Ga0501082_0000084 | |||
| 1551 | Ga0501082_0051027 | |||
| 1552 | Ga0501082_0097787 | |||
| 1553 | Ga0501082_0151854 | |||
| 1554 | Ga0501082_0218798 | |||
| 1555 | Ga0530510_0015528 | |||
| 1556 | 2508733221 | |||
| 1557 | 2509075534 | |||
| 1558 | 2524612123 | |||
| 1559 | 2644728674 | |||
| 1560 | 2774868633 | |||
| 1561 | 2776260441 | |||
| 1562 | 2828309677 | |||
| 1563 | 2835316985 | |||
| 1564 | 2882460031 | |||
| 1565 | 2894234015 | |||
| 1566 | 8004215515 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.9403 | 2 | 186 |
| 8hx6-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae | 0.9385 | 2 | 195 |
| 8hx7-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9378 | 2 | 195 |
| 8hx7-assembly1.cif.gz_A | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine | 0.9354 | 2 | 195 |
| 8hx8-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate | 0.9335 | 2 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9786 | 1 | 186 | 3.40.50.880 |
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9694 | 1 | 186 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9683 | 1 | 186 | 3.40.50.880 |
| af_K7L2D7_74_267_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9667 | 2 | 186 | 3.40.50.880 |
| af_P9WN35_1_200_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9548 | 1 | 189 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W2ANN0-F1-model_v4 | Aminodeoxychorismate/anthranilate synthase component II | 0.9844 | 1 | 190 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-M9MHV9-F1-model_v4 | deleted | 0.9839 | 1 | 189 |
|
| AF-A0A238W3H8-F1-model_v4 | Anthranilate synthase, component II | 0.9834 | 1 | 186 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 GO:0046654 GO:0046820 |
| AF-A0A328YFL9-F1-model_v4 | Anthranilate synthase component 2 | 0.9827 | 1 | 185 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A2S9UDB9-F1-model_v4 | Aminodeoxychorismate synthase component II | 0.9825 | 1 | 186 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 GO:0046654 GO:0046820 |