F480620

General Info

Members Datasets Scaffolds Average Seq Length
782 384 782 80

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_1437416|Ga0373925_1437416_121_408
Length 95
Sequence VTVSILVKLDDMLYKRRMTLTELSERIGITLANLSVLKTGKARAIRFSTLDAICAALQCQPGDLLEFAPASLAASTEAASAPGHETETALCDQEK

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
247 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
248 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
249 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
252 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
253 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
295 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
296 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
297 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
311 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
312 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
313 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
314 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
317 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
318 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
319 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
320 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
321 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
322 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
323 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
324 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
325 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
326 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
327 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
328 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
329 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
330 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
331 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
332 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
333 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
334 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
335 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
336 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
337 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
338 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
339 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
345 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
346 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
347 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
348 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
349 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
350 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
351 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
352 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
356 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
369 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
370 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
371 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
372 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
373 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
374 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
375 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
376 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
377 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
378 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
379 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
380 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
381 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
382 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 1.53
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1052156 3300001904 Bacteria 630
2 JGI24747J21853_1012191 3300001978 Bacteria 876
3 JGI24739J22299_10048843 3300001989 Bacteria 1374
4 JGI24739J22299_10194073 3300001989 Bacteria 597
5 JGI24035J26624_1005731 3300002126 Bacteria 1191
6 JGI25406J46586_10069815 3300003203 Bacteria 1106
7 rootH2_10160658 3300003320 Bacteria 5083
8 rootL2_10070106 3300003322 Bacteria 1445
9 rootL2_10073661 3300003322 Bacteria 7556
10 rootL2_10091401 3300003322 Bacteria 5185
11 rootL2_10184100 3300003322 Bacteria 4327
12 rootH1_10105934 3300003323 Bacteria 15610
13 rootH1_10383511 3300003323 Bacteria 1710
14 Ga0006562J51391_1119555 3300003578 Bacteria 5890
15 Ga0006562J51391_1119556 3300003578 Bacteria 1533
16 Ga0055536_1006393 3300003781 Bacteria 5515
17 Ga0055530_10036705 3300003791 Bacteria 1231
18 Ga0055531_10029761 3300003794 Bacteria 1852
19 Ga0065712_10725522 3300005290 Bacteria 537
20 Ga0065715_10449225 3300005293 Unclassified 828
21 Ga0065707_11145933 3300005295 Bacteria 506
22 Ga0070658_10010053 3300005327 Bacteria 7599
23 Ga0070658_10030908 3300005327 Bacteria 4301
24 Ga0070658_10159387 3300005327 Bacteria 1893
25 Ga0070658_10521310 3300005327 Bacteria 1027
26 Ga0070658_10901181 3300005327 Bacteria 769
27 Ga0070658_11199205 3300005327 Bacteria 660
28 Ga0070676_10010398 3300005328 Bacteria 5048
29 Ga0070676_10061929 3300005328 Bacteria 2225
30 Ga0070676_10414761 3300005328 Bacteria 940
31 Ga0070683_100146345 3300005329 Bacteria 2239
32 Ga0070690_100143048 3300005330 Unclassified 1625
33 Ga0070670_100007844 3300005331 Bacteria 9082
34 Ga0070670_100014544 3300005331 Bacteria 6757
35 Ga0070677_10002785 3300005333 Bacteria 5598
36 Ga0070677_10151832 3300005333 Unclassified 1079
37 Ga0068869_100182584 3300005334 Bacteria 1645
38 Ga0068869_100250964 3300005334 Bacteria 1413
39 Ga0068869_100384877 3300005334 Bacteria 1150
40 Ga0068869_100710112 3300005334 Bacteria 858
41 Ga0070666_10000388 3300005335 Bacteria 27657
42 Ga0070666_10005249 3300005335 Bacteria 7936
43 Ga0070666_10160576 3300005335 Unclassified 1571
44 Ga0070680_100053130 3300005336 Bacteria 3307
45 Ga0070682_100953854 3300005337 Bacteria 709
46 Ga0068868_100018131 3300005338 Bacteria 5256
47 Ga0068868_100269493 3300005338 Bacteria 1438
48 Ga0068868_100348892 3300005338 Bacteria 1267
49 Ga0068868_100417975 3300005338 Bacteria 1160
50 Ga0070660_100116819 3300005339 Bacteria 2127
51 Ga0070660_100168453 3300005339 Bacteria 1768
52 Ga0070660_100188129 3300005339 Bacteria 1672
53 Ga0070660_100442553 3300005339 Bacteria 1078
54 Ga0070660_101360589 3300005339 Bacteria 603
55 Ga0070689_100032234 3300005340 Bacteria 3985
56 Ga0070689_100202779 3300005340 Bacteria 1620
57 Ga0070687_100313852 3300005343 Bacteria 999
58 Ga0070661_100002976 3300005344 Bacteria 11677
59 Ga0070661_100005691 3300005344 Bacteria 8587
60 Ga0070661_100108162 3300005344 Bacteria 2074
61 Ga0070661_100275393 3300005344 Bacteria 1304
62 Ga0070661_100601760 3300005344 Bacteria 889
63 Ga0070661_100678884 3300005344 Bacteria 838
64 Ga0070668_100016390 3300005347 Bacteria 5541
65 Ga0070668_100953672 3300005347 Bacteria 769
66 Ga0070668_101494269 3300005347 Bacteria 617
67 Ga0070669_100007475 3300005353 Bacteria 7828
68 Ga0070669_100077191 3300005353 Bacteria 2474
69 Ga0070669_100706011 3300005353 Bacteria 852
70 Ga0070669_101694824 3300005353 Bacteria 551
71 Ga0070675_100015430 3300005354 Bacteria 6039
72 Ga0070675_100040566 3300005354 Bacteria 3801
73 Ga0070675_100079115 3300005354 Bacteria 2739
74 Ga0070675_100340640 3300005354 Bacteria 1328
75 Ga0070671_100035411 3300005355 Bacteria 4136
76 Ga0070671_100102643 3300005355 Bacteria 2399
77 Ga0070671_101626043 3300005355 Bacteria 573
78 Ga0070674_100021041 3300005356 Bacteria 4181
79 Ga0070674_100522718 3300005356 Bacteria 992
80 Ga0070674_100531266 3300005356 Bacteria 984
81 Ga0070673_100234382 3300005364 Bacteria 1593
82 Ga0070673_100519402 3300005364 Bacteria 1079
83 Ga0070673_100552015 3300005364 Bacteria 1047
84 Ga0070673_100744826 3300005364 Bacteria 902
85 Ga0070673_101281039 3300005364 Bacteria 688
86 Ga0070688_100047056 3300005365 Bacteria 2674
87 Ga0070688_100088207 3300005365 Bacteria 2022
88 Ga0070659_100066587 3300005366 Bacteria 2854
89 Ga0070659_100343086 3300005366 Bacteria 1252
90 Ga0070659_100480995 3300005366 Bacteria 1057
91 Ga0070659_101133068 3300005366 Bacteria 690
92 Ga0070667_100034883 3300005367 Bacteria 4212
93 Ga0070667_100397497 3300005367 Bacteria 1254
94 Ga0070667_101946813 3300005367 Bacteria 554
95 Ga0070714_101093563 3300005435 Bacteria 777
96 Ga0070713_100340293 3300005436 Bacteria 1390
97 Ga0070701_10056419 3300005438 Bacteria 2055
98 Ga0070711_100048957 3300005439 Bacteria 2893
99 Ga0070700_100137718 3300005441 Bacteria 1655
100 Ga0070700_100749855 3300005441 Bacteria 781
101 Ga0070700_101021707 3300005441 Bacteria 681
102 Ga0070694_100542464 3300005444 Bacteria 930
103 Ga0070708_100007994 3300005445 Bacteria 8472
104 Ga0070708_100556570 3300005445 Bacteria 1082
105 Ga0070663_100265701 3300005455 Bacteria 1362
106 Ga0070663_101560047 3300005455 Bacteria 588
107 Ga0070678_100012385 3300005456 Bacteria 5297
108 Ga0070678_100670259 3300005456 Bacteria 932
109 Ga0070662_100040247 3300005457 Bacteria 3327
110 Ga0070662_101488481 3300005457 Bacteria 584
111 Ga0070662_102000758 3300005457 Bacteria 501
112 Ga0070681_10013929 3300005458 Bacteria 8001
113 Ga0070681_10019453 3300005458 Bacteria 6797
114 Ga0068867_100016610 3300005459 Bacteria 5227
115 Ga0068867_100067192 3300005459 Bacteria 2672
116 Ga0068867_100130323 3300005459 Bacteria 1953
117 Ga0070685_10394697 3300005466 Bacteria 957
118 Ga0070706_100130225 3300005467 Bacteria 2348
119 Ga0070707_100276737 3300005468 Bacteria 1632
120 Ga0070698_100057454 3300005471 Bacteria 3937
121 Ga0070698_100106360 3300005471 Bacteria 2775
122 Ga0070698_100666886 3300005471 Bacteria 981
123 Ga0070698_100842955 3300005471 Bacteria 861
124 Ga0070699_100808819 3300005518 Bacteria 858
125 Ga0070679_100008268 3300005530 Bacteria 9788
126 Ga0070679_100008928 3300005530 Bacteria 9457
127 Ga0070679_100084368 3300005530 Bacteria 3165
128 Ga0070679_100213471 3300005530 Bacteria 1893
129 Ga0070679_100656327 3300005530 Bacteria 992
130 Ga0070679_100720910 3300005530 Bacteria 940
131 Ga0070679_102127708 3300005530 Bacteria 511
132 Ga0070684_100095266 3300005535 Unclassified 2652
133 Ga0070684_100178542 3300005535 Bacteria 1930
134 Ga0070684_100543603 3300005535 Bacteria 1078
135 Ga0070684_100771932 3300005535 Bacteria 898
136 Ga0070697_100502780 3300005536 Bacteria 1060
137 Ga0070697_101155573 3300005536 Unclassified 690
138 Ga0068853_100019875 3300005539 Bacteria 5579
139 Ga0068853_100162420 3300005539 Bacteria 2017
140 Ga0068853_101168231 3300005539 Bacteria 743
141 Ga0068853_101299531 3300005539 Bacteria 703
142 Ga0070672_100017344 3300005543 Bacteria 5179
143 Ga0070672_100043660 3300005543 Bacteria 3458
144 Ga0070672_100240776 3300005543 Bacteria 1521
145 Ga0070672_100513187 3300005543 Bacteria 1038
146 Ga0070686_101877681 3300005544 Bacteria 511
147 Ga0070695_101625235 3300005545 Bacteria 540
148 Ga0070696_100040310 3300005546 Bacteria 3225
149 Ga0070696_101290577 3300005546 Bacteria 619
150 Ga0070696_101478602 3300005546 Unclassified 581
151 Ga0070696_101773459 3300005546 Bacteria 533
152 Ga0070693_100960539 3300005547 Bacteria 644
153 Ga0070665_100000177 3300005548 Bacteria 113201
154 Ga0070665_100335899 3300005548 Bacteria 1515
155 Ga0070665_100546294 3300005548 Bacteria 1171
156 Ga0070665_100920963 3300005548 Bacteria 887
157 Ga0070704_102163481 3300005549 Bacteria 517
158 Ga0068855_100014514 3300005563 Bacteria 9488
159 Ga0068855_100043739 3300005563 Bacteria 5303
160 Ga0068855_100724191 3300005563 Bacteria 1063
161 Ga0070664_100010339 3300005564 Bacteria 7571
162 Ga0070664_100036054 3300005564 Bacteria 4154
163 Ga0070664_101376567 3300005564 Bacteria 667
164 Ga0070664_101384068 3300005564 Bacteria 665
165 Ga0070664_101543241 3300005564 Bacteria 629
166 Ga0068857_100025106 3300005577 Bacteria 5249
167 Ga0068857_100026776 3300005577 Bacteria 5084
168 Ga0068857_100768169 3300005577 Bacteria 919
169 Ga0068854_100194027 3300005578 Bacteria 1593
170 Ga0068854_100250679 3300005578 Bacteria 1413
171 Ga0068854_101181698 3300005578 Bacteria 685
172 Ga0068856_100858403 3300005614 Bacteria 927
173 Ga0070702_100261172 3300005615 Bacteria 1179
174 Ga0070702_100713622 3300005615 Bacteria 766
175 Ga0070702_100804902 3300005615 Bacteria 727
176 Ga0068852_100032090 3300005616 Bacteria 4344
177 Ga0068852_101351117 3300005616 Bacteria 734
178 Ga0068852_101791592 3300005616 Bacteria 636
179 Ga0068852_101898609 3300005616 Bacteria 618
180 Ga0068852_102332195 3300005616 Bacteria 556
181 Ga0068859_100021389 3300005617 Bacteria 6493
182 Ga0068859_100090103 3300005617 Bacteria 3117
183 Ga0068859_100128919 3300005617 Bacteria 2600
184 Ga0068859_100447557 3300005617 Bacteria 1388
185 Ga0068859_102018840 3300005617 Bacteria 637
186 Ga0068859_102571272 3300005617 Bacteria 560
187 Ga0068864_100372874 3300005618 Bacteria 1351
188 Ga0068864_100382497 3300005618 Bacteria 1334
189 Ga0068864_100533065 3300005618 Unclassified 1133
190 Ga0068864_100610376 3300005618 Bacteria 1059
191 Ga0068864_101197152 3300005618 Bacteria 758
192 Ga0068866_10280367 3300005718 Bacteria 1032
193 Ga0068861_100029019 3300005719 Bacteria 4042
194 Ga0068861_100072938 3300005719 Bacteria 2665
195 Ga0068861_100430022 3300005719 Bacteria 1178
196 Ga0068851_10001553 3300005834 Bacteria 10061
197 Ga0068851_10184408 3300005834 Unclassified 1157
198 Ga0068851_10205708 3300005834 Bacteria 1100
199 Ga0068870_10011808 3300005840 Bacteria 4063
200 Ga0068870_10073800 3300005840 Bacteria 1867
201 Ga0068863_100043823 3300005841 Bacteria 4248
202 Ga0068863_100386789 3300005841 Bacteria 1366
203 Ga0068863_100555063 3300005841 Bacteria 1134
204 Ga0068863_100573618 3300005841 Bacteria 1115
205 Ga0068863_101153254 3300005841 Bacteria 780
206 Ga0068863_102707564 3300005841 Bacteria 504
207 Ga0068858_100548365 3300005842 Unclassified 1119
208 Ga0068858_100773715 3300005842 Bacteria 936
209 Ga0068858_101863209 3300005842 Bacteria 594
210 Ga0068860_100193418 3300005843 Bacteria 1969
211 Ga0068860_100208759 3300005843 Bacteria 1894
212 Ga0068860_100425815 3300005843 Bacteria 1316
213 Ga0068860_100845949 3300005843 Bacteria 929
214 Ga0068860_102153611 3300005843 Bacteria 579
215 Ga0068862_100142400 3300005844 Bacteria 2129
216 Ga0068862_100309311 3300005844 Bacteria 1456
217 Ga0068862_101111238 3300005844 Unclassified 786
218 Ga0081539_10012496 3300005985 Bacteria 6537
219 Ga0070717_11225474 3300006028 Unclassified 683
220 Ga0070715_10488034 3300006163 Bacteria 703
221 Ga0070716_101145553 3300006173 Bacteria 622
222 Ga0070712_100161126 3300006175 Bacteria 1732
223 Ga0070712_100403729 3300006175 Bacteria 1129
224 Ga0070712_101931974 3300006175 Unclassified 517
225 Ga0075366_10577930 3300006195 Bacteria 696
226 Ga0097621_100020405 3300006237 Bacteria 5105
227 Ga0097621_101780000 3300006237 Bacteria 587
228 Ga0068871_100194110 3300006358 Bacteria 1750
229 Ga0068871_100311048 3300006358 Bacteria 1385
230 Ga0068871_102390497 3300006358 Bacteria 504
231 Ga0075428_100113448 3300006844 Bacteria 2952
232 Ga0075430_100854207 3300006846 Bacteria 750
233 Ga0075429_100011858 3300006880 Bacteria 7558
234 Ga0075429_101955628 3300006880 Bacteria 508
235 Ga0068865_100241297 3300006881 Bacteria 1422
236 Ga0068865_100448457 3300006881 Bacteria 1066
237 Ga0068865_101036649 3300006881 Bacteria 720
238 Ga0097620_100021389 3300006931 Bacteria 6493
239 Ga0097620_100090099 3300006931 Bacteria 3117
240 Ga0097620_100128925 3300006931 Bacteria 2600
241 Ga0097620_100447609 3300006931 Bacteria 1388
242 Ga0097620_102572182 3300006931 Bacteria 560
243 Ga0105240_10029957 3300009093 Bacteria 7080
244 Ga0105240_10190937 3300009093 Bacteria 2409
245 Ga0105240_11210355 3300009093 Unclassified 799
246 Ga0105240_12104156 3300009093 Unclassified 586
247 Ga0111539_10050233 3300009094 Bacteria 4968
248 Ga0111539_10094115 3300009094 Bacteria 3520
249 Ga0111539_10852178 3300009094 Bacteria 1060
250 Ga0105245_10022565 3300009098 Bacteria 5525
251 Ga0105245_10252924 3300009098 Bacteria 1712
252 Ga0105245_11561666 3300009098 Bacteria 711
253 Ga0105245_11594150 3300009098 Unclassified 704
254 Ga0105245_12273977 3300009098 Bacteria 596
255 Ga0105247_10157761 3300009101 Bacteria 1500
256 Ga0105247_10918100 3300009101 Bacteria 677
257 Ga0105247_11559078 3300009101 Unclassified 541
258 Ga0105247_11801490 3300009101 Bacteria 509
259 Ga0114129_10363833 3300009147 Bacteria 1913
260 Ga0114129_11842004 3300009147 Bacteria 735
261 Ga0105243_12433106 3300009148 Bacteria 562
262 Ga0105242_10159824 3300009176 Bacteria 1971
263 Ga0105242_10259574 3300009176 Bacteria 1569
264 Ga0105248_10030382 3300009177 Bacteria 6032
265 Ga0105248_10066217 3300009177 Bacteria 4057
266 Ga0105248_10729908 3300009177 Bacteria 1118
267 Ga0105248_11317800 3300009177 Bacteria 817
268 Ga0105237_11490998 3300009545 Bacteria 683
269 Ga0105237_11991015 3300009545 Bacteria 589
270 Ga0105237_12708781 3300009545 Bacteria 507
271 Ga0105238_10104954 3300009551 Bacteria 2807
272 Ga0105238_10290479 3300009551 Bacteria 1617
273 Ga0105249_10003625 3300009553 Bacteria 13351
274 Ga0105249_10170520 3300009553 Bacteria 2110
275 Ga0105249_11103879 3300009553 Bacteria 863
276 Ga0105239_10037431 3300010375 Bacteria 5319
277 Ga0105239_10435582 3300010375 Bacteria 1486
278 Ga0105239_10496396 3300010375 Bacteria 1387
279 Ga0105239_10568164 3300010375 Bacteria 1292
280 Ga0105246_10445516 3300011119 Unclassified 1087
281 Ga0105246_10567661 3300011119 Bacteria 975
282 Ga0105246_11557809 3300011119 Bacteria 623
283 Ga0157373_10012335 3300013100 Bacteria 6283
284 Ga0157373_10016427 3300013100 Bacteria 5400
285 Ga0157373_10023871 3300013100 Bacteria 4431
286 Ga0157373_10042879 3300013100 Bacteria 3232
287 Ga0157373_10652699 3300013100 Bacteria 768
288 Ga0157371_10013650 3300013102 Bacteria 6164
289 Ga0157370_10012080 3300013104 Bacteria 8987
290 Ga0157370_10014613 3300013104 Bacteria 8022
291 Ga0157370_10062872 3300013104 Bacteria 3519
292 Ga0157369_10017322 3300013105 Bacteria 8099
293 Ga0157369_11622486 3300013105 Bacteria 657
294 Ga0157374_10138601 3300013296 Bacteria 2360
295 Ga0157374_10201392 3300013296 Bacteria 1949
296 Ga0157374_10628085 3300013296 Bacteria 1085
297 Ga0157378_10377083 3300013297 Bacteria 1392
298 Ga0157378_10477006 3300013297 Bacteria 1242
299 Ga0157378_10664884 3300013297 Bacteria 1058
300 Ga0157378_11529829 3300013297 Bacteria 712
301 Ga0163162_10134062 3300013306 Bacteria 2587
302 Ga0163162_11273815 3300013306 Bacteria 835
303 Ga0163162_12224738 3300013306 Bacteria 630
304 Ga0157372_10017454 3300013307 Bacteria 7705
305 Ga0157372_10492078 3300013307 Bacteria 1430
306 Ga0157372_11194517 3300013307 Bacteria 879
307 Ga0157372_11200813 3300013307 Bacteria 876
308 Ga0157375_10013745 3300013308 Bacteria 7216
309 Ga0157375_10088173 3300013308 Bacteria 3157
310 Ga0157375_10129028 3300013308 Bacteria 2647
311 Ga0157375_10596135 3300013308 Bacteria 1264
312 Ga0157375_10682173 3300013308 Bacteria 1182
313 Ga0157375_11819765 3300013308 Bacteria 722
314 Ga0163163_10009985 3300014325 Bacteria 8511
315 Ga0163163_11235720 3300014325 Bacteria 810
316 Ga0163163_12222336 3300014325 Unclassified 608
317 Ga0157380_10034947 3300014326 Bacteria 3879
318 Ga0157380_11169494 3300014326 Bacteria 811
319 Ga0157380_13237887 3300014326 Bacteria 520
320 Ga0182008_10014455 3300014497 Unclassified 4133
321 Ga0182008_10907935 3300014497 Unclassified 519
322 Ga0157377_10647784 3300014745 Bacteria 760
323 Ga0157379_10583845 3300014968 Unclassified 1042
324 Ga0157379_11079198 3300014968 Bacteria 768
325 Ga0157379_11240199 3300014968 Bacteria 718
326 Ga0157376_10214649 3300014969 Unclassified 1778
327 Ga0157376_11093024 3300014969 Unclassified 823
328 Ga0157376_12017935 3300014969 Bacteria 615
329 Ga0157376_12847837 3300014969 Bacteria 523
330 Ga0163161_10093594 3300017792 Bacteria 2227
331 Ga0213874_10216528 3300021377 Bacteria 694
332 Ga0213876_10004842 3300021384 Bacteria 7465
333 Ga0213876_10554949 3300021384 Unclassified 611
334 Ga0209436_100591 3300025208 Bacteria 15534
335 Ga0209130_1005113 3300025284 Bacteria 4672
336 Ga0209676_1000115 3300025292 Bacteria 205183
337 Ga0209050_1004487 3300025298 Bacteria 9396
338 Ga0207426_1000250 3300025302 Bacteria 117492
339 Ga0209257_1000005 3300025304 Bacteria 1592528
340 Ga0209257_1000090 3300025304 Bacteria 274746
341 Ga0209257_1069912 3300025304 Bacteria 928
342 Ga0207697_10062671 3300025315 Bacteria 1549
343 Ga0207697_10316523 3300025315 Bacteria 693
344 Ga0207656_10036331 3300025321 Bacteria 2067
345 Ga0207656_10117704 3300025321 Unclassified 1234
346 Ga0207696_1035889 3300025711 Bacteria 1473
347 Ga0207713_1030908 3300025735 Bacteria 2377
348 Ga0207682_10005081 3300025893 Bacteria 5391
349 Ga0207682_10279690 3300025893 Bacteria 780
350 Ga0207692_10233387 3300025898 Unclassified 1096
351 Ga0207692_10243665 3300025898 Bacteria 1074
352 Ga0207642_10142711 3300025899 Bacteria 1265
353 Ga0207710_10201828 3300025900 Bacteria 982
354 Ga0207710_10685502 3300025900 Unclassified 537
355 Ga0207688_10124271 3300025901 Bacteria 1508
356 Ga0207680_10000227 3300025903 Bacteria 27167
357 Ga0207680_10198240 3300025903 Bacteria 1367
358 Ga0207680_10941264 3300025903 Bacteria 619
359 Ga0207647_10008681 3300025904 Bacteria 7259
360 Ga0207685_10125684 3300025905 Bacteria 1132
361 Ga0207645_10010784 3300025907 Bacteria 6266
362 Ga0207645_10178830 3300025907 Bacteria 1391
363 Ga0207645_10328983 3300025907 Bacteria 1020
364 Ga0207643_10211443 3300025908 Bacteria 1184
365 Ga0207705_10003074 3300025909 Bacteria 12725
366 Ga0207705_10093884 3300025909 Bacteria 2200
367 Ga0207705_10223742 3300025909 Bacteria 1430
368 Ga0207705_10289774 3300025909 Bacteria 1254
369 Ga0207705_10484386 3300025909 Bacteria 960
370 Ga0207705_11275934 3300025909 Bacteria 562
371 Ga0207684_10039058 3300025910 Bacteria 4028
372 Ga0207684_10239548 3300025910 Bacteria 1565
373 Ga0207707_10013978 3300025912 Bacteria 6999
374 Ga0207695_10241589 3300025913 Bacteria 1707
375 Ga0207695_10552910 3300025913 Bacteria 1033
376 Ga0207671_10545019 3300025914 Bacteria 925
377 Ga0207693_10051226 3300025915 Bacteria 3240
378 Ga0207663_10155575 3300025916 Bacteria 1608
379 Ga0207663_11557363 3300025916 Bacteria 532
380 Ga0207660_10193448 3300025917 Bacteria 1585
381 Ga0207660_10533355 3300025917 Unclassified 954
382 Ga0207662_10355237 3300025918 Bacteria 985
383 Ga0207662_10553977 3300025918 Unclassified 796
384 Ga0207662_10739076 3300025918 Bacteria 691
385 Ga0207662_11371141 3300025918 Unclassified 502
386 Ga0207657_10040675 3300025919 Bacteria 4117
387 Ga0207657_10092704 3300025919 Bacteria 2517
388 Ga0207657_10142104 3300025919 Unclassified 1961
389 Ga0207657_10339567 3300025919 Bacteria 1185
390 Ga0207649_10082851 3300025920 Unclassified 2081
391 Ga0207649_10659789 3300025920 Bacteria 809
392 Ga0207652_10613757 3300025921 Bacteria 975
393 Ga0207652_11886901 3300025921 Bacteria 503
394 Ga0207681_10014242 3300025923 Bacteria 4937
395 Ga0207681_10096066 3300025923 Bacteria 2127
396 Ga0207681_10804635 3300025923 Bacteria 785
397 Ga0207681_11343244 3300025923 Bacteria 600
398 Ga0207694_10383256 3300025924 Bacteria 1167
399 Ga0207650_10020128 3300025925 Bacteria 4701
400 Ga0207650_10035826 3300025925 Bacteria 3606
401 Ga0207650_10110115 3300025925 Unclassified 2131
402 Ga0207650_10563878 3300025925 Bacteria 955
403 Ga0207659_10027515 3300025926 Bacteria 3851
404 Ga0207659_10061946 3300025926 Bacteria 2699
405 Ga0207659_10299967 3300025926 Bacteria 1319
406 Ga0207687_10009501 3300025927 Bacteria 6360
407 Ga0207687_10471931 3300025927 Bacteria 1043
408 Ga0207687_11547132 3300025927 Bacteria 569
409 Ga0207700_10849582 3300025928 Bacteria 817
410 Ga0207700_10913738 3300025928 Bacteria 786
411 Ga0207664_11128272 3300025929 Bacteria 700
412 Ga0207644_10019062 3300025931 Bacteria 4649
413 Ga0207644_10440092 3300025931 Bacteria 1070
414 Ga0207644_11573722 3300025931 Bacteria 551
415 Ga0207690_10066972 3300025932 Bacteria 2462
416 Ga0207690_10120461 3300025932 Bacteria 1905
417 Ga0207706_10120564 3300025933 Bacteria 2306
418 Ga0207686_10094263 3300025934 Unclassified 1984
419 Ga0207686_10580891 3300025934 Bacteria 879
420 Ga0207670_10135581 3300025936 Bacteria 1809
421 Ga0207670_10351922 3300025936 Bacteria 1167
422 Ga0207670_10391126 3300025936 Bacteria 1110
423 Ga0207669_10074303 3300025937 Bacteria 2149
424 Ga0207669_11903602 3300025937 Bacteria 508
425 Ga0207704_10235882 3300025938 Bacteria 1363
426 Ga0207691_10005468 3300025940 Bacteria 12263
427 Ga0207691_10025812 3300025940 Bacteria 5513
428 Ga0207691_10408237 3300025940 Bacteria 1158
429 Ga0207711_10228124 3300025941 Bacteria 1705
430 Ga0207711_10512926 3300025941 Bacteria 1118
431 Ga0207711_10950352 3300025941 Bacteria 798
432 Ga0207689_10087967 3300025942 Bacteria 2552
433 Ga0207689_10180912 3300025942 Bacteria 1739
434 Ga0207689_10662438 3300025942 Bacteria 880
435 Ga0207689_10822918 3300025942 Bacteria 784
436 Ga0207661_10028540 3300025944 Unclassified 4274
437 Ga0207661_10101708 3300025944 Bacteria 2415
438 Ga0207679_10002235 3300025945 Bacteria 11964
439 Ga0207679_10024575 3300025945 Bacteria 4132
440 Ga0207667_10037886 3300025949 Bacteria 5152
441 Ga0207667_10336464 3300025949 Bacteria 1541
442 Ga0207651_10002810 3300025960 Bacteria 8372
443 Ga0207651_10070960 3300025960 Bacteria 2467
444 Ga0207651_10442961 3300025960 Bacteria 1113
445 Ga0207651_10547644 3300025960 Bacteria 1006
446 Ga0207651_10553483 3300025960 Bacteria 1001
447 Ga0207651_10972556 3300025960 Bacteria 758
448 Ga0207712_10175655 3300025961 Bacteria 1678
449 Ga0207668_10421096 3300025972 Bacteria 1133
450 Ga0207668_10898433 3300025972 Bacteria 788
451 Ga0207668_11140859 3300025972 Bacteria 699
452 Ga0207640_10546922 3300025981 Bacteria 972
453 Ga0207658_10307905 3300025986 Bacteria 1367
454 Ga0207658_10928093 3300025986 Bacteria 793
455 Ga0207658_11504786 3300025986 Bacteria 616
456 Ga0207658_11813046 3300025986 Bacteria 556
457 Ga0207658_11960268 3300025986 Bacteria 533
458 Ga0207677_10019474 3300026023 Bacteria 4098
459 Ga0207677_12308061 3300026023 Bacteria 501
460 Ga0207703_10091401 3300026035 Bacteria 2560
461 Ga0207639_10316618 3300026041 Bacteria 1384
462 Ga0207678_10085767 3300026067 Bacteria 2691
463 Ga0207708_10213897 3300026075 Bacteria 1542
464 Ga0207708_11001623 3300026075 Bacteria 726
465 Ga0207702_11043188 3300026078 Bacteria 811
466 Ga0207641_10115119 3300026088 Bacteria 2390
467 Ga0207641_10336755 3300026088 Bacteria 1435
468 Ga0207641_10406308 3300026088 Unclassified 1308
469 Ga0207641_10858299 3300026088 Bacteria 900
470 Ga0207648_10004895 3300026089 Bacteria 13651
471 Ga0207648_10084074 3300026089 Bacteria 2776
472 Ga0207648_10088136 3300026089 Bacteria 2710
473 Ga0207648_10487089 3300026089 Bacteria 1127
474 Ga0207676_10325585 3300026095 Bacteria 1412
475 Ga0207676_10482354 3300026095 Unclassified 1174
476 Ga0207676_11090255 3300026095 Bacteria 789
477 Ga0207676_11479470 3300026095 Bacteria 676
478 Ga0207676_12163251 3300026095 Bacteria 555
479 Ga0207674_10001732 3300026116 Bacteria 27879
480 Ga0207674_10031936 3300026116 Bacteria 5527
481 Ga0207675_100045591 3300026118 Bacteria 4096
482 Ga0207675_100059402 3300026118 Bacteria 3568
483 Ga0207675_100099289 3300026118 Bacteria 2742
484 Ga0207683_10058507 3300026121 Bacteria 3384
485 Ga0207683_10232456 3300026121 Bacteria 1682
486 Ga0207698_10246540 3300026142 Bacteria 1632
487 Ga0207698_10453810 3300026142 Bacteria 1238
488 Ga0207698_11197878 3300026142 Bacteria 773
489 Ga0207698_12001786 3300026142 Bacteria 593
490 Ga0209967_1052926 3300027364 Bacteria 625
491 Ga0209995_1002705 3300027471 Bacteria 2811
492 Ga0209999_1007476 3300027543 Bacteria 1968
493 Ga0209971_1040406 3300027682 Unclassified 1122
494 Ga0209998_10002536 3300027717 Bacteria 4158
495 Ga0209974_10003157 3300027876 Bacteria 5965
496 Ga0207428_10554248 3300027907 Bacteria 831
497 Ga0268266_10015888 3300028379 Bacteria 6442
498 Ga0268266_10467418 3300028379 Bacteria 1201
499 Ga0268266_10725958 3300028379 Bacteria 958
500 Ga0268266_10781781 3300028379 Bacteria 922
501 Ga0268266_10860166 3300028379 Bacteria 876
502 Ga0268265_10180581 3300028380 Bacteria 1813
503 Ga0268265_10392743 3300028380 Bacteria 1280
504 Ga0268265_10923291 3300028380 Unclassified 858
505 Ga0268265_11210242 3300028380 Bacteria 753
506 Ga0268264_10019038 3300028381 Bacteria 5613
507 Ga0268264_10394342 3300028381 Bacteria 1329
508 Ga0265338_10151853 3300028800 Bacteria 1799
509 Ga0307511_10000884 3300030521 Bacteria 31692
510 Ga0316183_1007432 3300030742 Bacteria 4241
511 Ga0316182_1130225 3300030745 Bacteria 2711
512 Ga0265330_10163408 3300031235 Bacteria 945
513 Ga0265316_10337394 3300031344 Bacteria 1093
514 Ga0307408_100026639 3300031548 Bacteria 3974
515 Ga0307408_100399732 3300031548 Bacteria 1179
516 Ga0307408_100447984 3300031548 Unclassified 1119
517 Ga0307408_100478895 3300031548 Bacteria 1085
518 Ga0307405_10008856 3300031731 Bacteria 5130
519 Ga0307405_10027639 3300031731 Bacteria 3292
520 Ga0307405_10062459 3300031731 Bacteria 2359
521 Ga0307405_10146378 3300031731 Bacteria 1655
522 Ga0307405_10615295 3300031731 Bacteria 888
523 Ga0307405_10849367 3300031731 Bacteria 768
524 Ga0307405_10929832 3300031731 Bacteria 737
525 Ga0307413_10122289 3300031824 Bacteria 1765
526 Ga0307413_10264522 3300031824 Bacteria 1284
527 Ga0307413_10327888 3300031824 Bacteria 1172
528 Ga0307413_10346732 3300031824 Bacteria 1144
529 Ga0307413_10616073 3300031824 Bacteria 890
530 Ga0307413_10831296 3300031824 Bacteria 779
531 Ga0307410_10022387 3300031852 Bacteria 3905
532 Ga0307410_10112313 3300031852 Unclassified 1973
533 Ga0307410_10170829 3300031852 Bacteria 1638
534 Ga0307410_10317415 3300031852 Bacteria 1235
535 Ga0307410_10761245 3300031852 Bacteria 821
536 Ga0307410_11396949 3300031852 Bacteria 614
537 Ga0307410_11818460 3300031852 Bacteria 541
538 Ga0307406_10007743 3300031901 Bacteria 5968
539 Ga0307406_10034662 3300031901 Bacteria 3098
540 Ga0307406_10092728 3300031901 Bacteria 2037
541 Ga0307406_10232739 3300031901 Bacteria 1377
542 Ga0307406_10289554 3300031901 Bacteria 1253
543 Ga0307406_10430318 3300031901 Bacteria 1054
544 Ga0307406_10745876 3300031901 Bacteria 821
545 Ga0307407_10017774 3300031903 Bacteria 3578
546 Ga0307407_10196823 3300031903 Bacteria 1347
547 Ga0307407_10345067 3300031903 Bacteria 1053
548 Ga0307412_10005721 3300031911 Bacteria 6989
549 Ga0307412_10016709 3300031911 Bacteria 4377
550 Ga0307412_10354522 3300031911 Bacteria 1179
551 Ga0307409_100007252 3300031995 Bacteria 6612
552 Ga0307409_100389195 3300031995 Bacteria 1328
553 Ga0307409_100488427 3300031995 Bacteria 1196
554 Ga0307416_100036010 3300032002 Bacteria 3789
555 Ga0307416_100265469 3300032002 Bacteria 1681
556 Ga0307416_100373631 3300032002 Bacteria 1453
557 Ga0307416_100504941 3300032002 Bacteria 1274
558 Ga0307416_102067088 3300032002 Bacteria 672
559 Ga0307416_102172566 3300032002 Bacteria 656
560 Ga0307414_10112017 3300032004 Bacteria 2079
561 Ga0307414_10239449 3300032004 Bacteria 1501
562 Ga0307414_10480812 3300032004 Bacteria 1095
563 Ga0307414_10558806 3300032004 Bacteria 1021
564 Ga0307414_10698481 3300032004 Bacteria 918
565 Ga0307414_10746344 3300032004 Bacteria 889
566 Ga0307414_11431496 3300032004 Bacteria 642
567 Ga0307411_10049752 3300032005 Bacteria 2726
568 Ga0307411_10053137 3300032005 Bacteria 2652
569 Ga0307411_10102130 3300032005 Bacteria 2031
570 Ga0307411_10131052 3300032005 Bacteria 1832
571 Ga0307411_10147754 3300032005 Bacteria 1742
572 Ga0307411_10186597 3300032005 Bacteria 1579
573 Ga0307411_10839768 3300032005 Bacteria 812
574 Ga0307411_12198582 3300032005 Bacteria 517
575 Ga0307415_100087442 3300032126 Bacteria 2245
576 Ga0307415_100273286 3300032126 Bacteria 1385
577 Ga0307415_100514123 3300032126 Bacteria 1050
578 Ga0307415_101091614 3300032126 Bacteria 746
579 Ga0307415_102141735 3300032126 Bacteria 546
580 Ga0307510_10003850 3300033180 Bacteria 17591
581 Ga0373926_0020391 3300035083 Bacteria 2290
582 Ga0373956_0187113 3300035119 Bacteria 980
583 Ga0373935_1369273 3300035692 Unclassified 529
584 Ga0373927_0004162 3300035695 Bacteria 10167
585 Ga0373927_0016917 3300035695 Bacteria 4807
586 Ga0373927_0389482 3300035695 Bacteria 919
587 Ga0373933_0087586 3300035724 Unclassified 1918
588 Ga0373933_0512951 3300035724 Bacteria 786
589 Ga0373933_1073774 3300035724 Bacteria 530
590 Ga0373937_0254397 3300036401 Bacteria 1656
591 Ga0373925_0190524 3300037068 Bacteria 1627
592 Ga0373925_0212833 3300037068 Unclassified 1540
593 Ga0373925_0415112 3300037068 Bacteria 1099
594 Ga0373925_1113007 3300037068 Bacteria 650
595 Ga0373925_1437416 3300037068 Bacteria 565
596 Ga0395899_0147933 3300037312 Unclassified 1666
597 Ga0395899_0753232 3300037312 Bacteria 606
598 Ga0395900_0153111 3300037418 Unclassified 2355
599 Ga0395900_0318787 3300037418 Bacteria 1535
600 Ga0395900_0532935 3300037418 Bacteria 1121
601 Ga0395900_0869441 3300037418 Bacteria 826
602 Ga0395900_0959049 3300037418 Bacteria 776
603 Ga0395900_1629729 3300037418 Bacteria 556
604 Ga0395898_0041822 3300037466 Plasmid 4524
605 Ga0395898_0172669 3300037466 Bacteria 2066
606 Ga0395898_1562404 3300037466 Bacteria 585
607 Ga0395905_0053030 3300037471 Plasmid 3796
608 Ga0395905_0242760 3300037471 Bacteria 1683
609 Ga0395905_0267775 3300037471 Bacteria 1594
610 Ga0395905_0459661 3300037471 Bacteria 1171
611 Ga0395905_0990870 3300037471 Bacteria 743
612 Ga0436364_1035450 3300037853 Bacteria 678
613 Ga0395901_0019192 3300038443 Bacteria 6989
614 Ga0395901_0363744 3300038443 Bacteria 1491
615 Ga0237819_04260 3300038705 Bacteria 2376
616 Ga0436365_0064527 3300039437 Bacteria 32229
617 Ga0436365_0176077 3300039437 Unclassified 712
618 Ga0436365_0723875 3300039437 Bacteria 733
619 Ga0436363_0849015 3300039450 Bacteria 1116
620 Ga0439466_0279620 3300041411 Bacteria 506
621 Ga0451789_0891629 3300041443 Bacteria 1054
622 Ga0451791_0779858 3300041451 Bacteria 510
623 Ga0451804_0479665 3300041463 Bacteria 909
624 Ga0451807_0589435 3300041486 Unclassified 1588
625 Ga0451837_1865023 3300041494 Unclassified 546
626 Ga0451853_0008946 3300041512 Bacteria 1510
627 Ga0439448_0053507 3300042005 Bacteria 1325
628 Ga0439455_0052303 3300042012 Bacteria 1069
629 Ga0450890_088189 3300042127 Bacteria 512
630 Ga0439446_0021586 3300042156 Bacteria 1821
631 Ga0439458_0094916 3300042157 Bacteria 770
632 Ga0451577_0009474 3300042876 Bacteria 9374
633 Ga0451577_0725838 3300042876 Bacteria 899
634 Ga0453683_0165836 3300044673 Bacteria 1398
635 Ga0453683_0186899 3300044673 Bacteria 1314
636 Ga0453684_0000167 3300044712 Bacteria 290200
637 Ga0453684_0000284 3300044712 Bacteria 218640
638 Ga0451576_0950625 3300045051 Bacteria 901
639 Ga0466967_0312984 3300045976 Bacteria 1513
640 Ga0495629_0606387 3300046459 Bacteria 732
641 Ga0495580_0029698 3300046472 Bacteria 3966
642 Ga0495594_0025607 3300046499 Bacteria 3171
643 Ga0495643_0000307 3300046522 Bacteria 67608
644 Ga0495644_0387208 3300046523 Bacteria 553
645 Ga0495648_0000039 3300046524 Bacteria 185430
646 Ga0495663_0000501 3300046525 Bacteria 14104
647 Ga0495663_0002001 3300046525 Bacteria 6266
648 Ga0495665_0076666 3300046531 Bacteria 1760
649 Ga0495640_0298038 3300046533 Bacteria 1002
650 Ga0495586_0343417 3300046535 Bacteria 857
651 Ga0495597_0301781 3300046542 Bacteria 621
652 Ga0495668_0017551 3300046616 Bacteria 4148
653 Ga0495634_0207852 3300046642 Bacteria 1213
654 Ga0495625_0025028 3300046660 Bacteria 4532
655 Ga0495625_0124009 3300046660 Bacteria 1755
656 Ga0495669_0287095 3300046684 Bacteria 792
657 Ga0495613_0260187 3300046689 Bacteria 1209
658 Ga0495671_0148001 3300046692 Bacteria 1143
659 Ga0495671_0584912 3300046692 Bacteria 531
660 Ga0495581_0322362 3300047315 Bacteria 903
661 Ga0495672_0000006 3300047320 Bacteria 589807
662 Ga0495683_0133256 3300047323 Bacteria 1170
663 Ga0495673_0000148 3300047469 Bacteria 124135
664 Ga0495602_0571599 3300048088 Bacteria 781
665 Ga0496100_0246866 3300048903 Bacteria 1319
666 Ga0496104_0041190 3300048907 Bacteria 4330
667 Ga0496106_0110493 3300048909 Bacteria 2140
668 Ga0496109_1150370 3300048912 Bacteria 713
669 Ga0496113_1288444 3300048916 Bacteria 569
670 Ga0496114_0031627 3300048917 Bacteria 4353
671 Ga0496114_0869569 3300048917 Bacteria 782
672 Ga0496115_0182934 3300048918 Bacteria 1732
673 Ga0496122_0006171 3300048925 Bacteria 13933
674 Ga0496123_0001218 3300048926 Bacteria 37586
675 Ga0496124_0298596 3300048927 Bacteria 1165
676 Ga0496124_0650463 3300048927 Bacteria 677
677 Ga0496126_0900073 3300048929 Bacteria 671
678 Ga0501292_111648 3300049515 Unclassified 551
679 Ga0501294_049719 3300049517 Unclassified 535
680 Ga0501298_012219 3300049521 Bacteria 1503
681 Ga0501300_068771 3300049523 Unclassified 570
682 Ga0501032_0126934 3300049569 Bacteria 1685
683 Ga0501033_0153770 3300049570 Bacteria 1658
684 Ga0501034_0514414 3300049571 Bacteria 1109
685 Ga0501038_0130853 3300049574 Bacteria 2061
686 Ga0501039_0541071 3300049575 Bacteria 914
687 Ga0501041_0953380 3300049577 Bacteria 552
688 Ga0501042_0654553 3300049578 Bacteria 764
689 Ga0501043_0254836 3300049579 Bacteria 1351
690 Ga0501043_0406205 3300049579 Bacteria 1028
691 Ga0501046_0024430 3300049580 Bacteria 4958
692 Ga0501047_0046092 3300049581 Bacteria 4214
693 Ga0501047_0320744 3300049581 Bacteria 1389
694 Ga0501070_1551826 3300049586 Bacteria 500
695 Ga0501073_0354632 3300049589 Bacteria 1013
696 Ga0501073_0496053 3300049589 Bacteria 844
697 Ga0501198_012182 3300049649 Unclassified 1290
698 Ga0501202_000394 3300049652 Bacteria 6087
699 Ga0501206_022968 3300049653 Unclassified 897
700 Ga0501208_006031 3300049655 Unclassified 1523
701 Ga0501216_000093 3300049660 Bacteria 8536
702 Ga0501223_023705 3300049663 Unclassified 1196
703 Ga0501224_000292 3300049664 Bacteria 5787
704 Ga0501227_009937 3300049665 Bacteria 2058
705 Ga0501228_003485 3300049666 Unclassified 1299
706 Ga0501233_000355 3300049668 Bacteria 7160
707 Ga0501235_002165 3300049669 Bacteria 4215
708 Ga0501236_004539 3300049670 Unclassified 1650
709 Ga0501239_085233 3300049672 Unclassified 513
710 Ga0501240_003855 3300049673 Bacteria 1704
711 Ga0501242_001847 3300049674 Bacteria 2177
712 Ga0501243_000433 3300049675 Bacteria 5555
713 Ga0501247_002240 3300049677 Bacteria 1992
714 Ga0501249_000835 3300049679 Bacteria 6807
715 Ga0501251_021274 3300049681 Unclassified 863
716 Ga0501252_001093 3300049682 Bacteria 2400
717 Ga0501256_001858 3300049685 Unclassified 1618
718 Ga0501257_007726 3300049686 Bacteria 2405
719 Ga0501259_001036 3300049688 Bacteria 4628
720 Ga0501260_001647 3300049689 Bacteria 1857
721 Ga0501261_000819 3300049690 Bacteria 3885
722 Ga0501219_008694 3300049703 Unclassified 745
723 Ga0501221_000083 3300049704 Bacteria 10820
724 Ga0501225_0002327 3300049705 Bacteria 5861
725 Ga0501229_004951 3300049706 Bacteria 1626
726 Ga0501234_000699 3300049707 Bacteria 5178
727 Ga0501079_0813125 3300049741 Bacteria 736
728 Ga0501080_0007302 3300049742 Bacteria 9967
729 Ga0501080_0099106 3300049742 Bacteria 2704
730 Ga0501081_0266617 3300049743 Bacteria 1252
731 Ga0501083_0008004 3300049744 Bacteria 7486
732 Ga0501083_0493963 3300049744 Bacteria 797
733 Ga0501262_001325 3300049759 Bacteria 2769
734 Ga0501263_000868 3300049760 Bacteria 2591
735 Ga0501266_000368 3300049763 Bacteria 6009
736 Ga0501268_000039 3300049765 Bacteria 10915
737 Ga0501268_159978 3300049765 Bacteria 525
738 Ga0501270_000589 3300049767 Bacteria 3148
739 Ga0501270_108704 3300049767 Bacteria 589
740 Ga0501271_014589 3300049768 Unclassified 871
741 Ga0501274_001615 3300049771 Bacteria 1728
742 Ga0501275_003412 3300049772 Bacteria 1463
743 Ga0501279_000426 3300049775 Bacteria 5569
744 Ga0501035_0575139 3300049822 Bacteria 920
745 Ga0501044_0095748 3300049823 Bacteria 2991
746 Ga0501044_0290252 3300049823 Bacteria 1567
747 Ga0501204_016960 3300049850 Unclassified 919
748 Ga0501212_001054 3300049851 Bacteria 2994
749 nmdc:mga0k408_18214_c1 3300050493 Bacteria 3918
750 nmdc:mga07m45_169690_c1 3300050496 Bacteria 1268
751 nmdc:mga09592_7127_c1 3300050508 Bacteria 9089
752 nmdc:mga0qj67_1240879_c1 3300050509 Bacteria 579
753 nmdc:mga0qj67_2521_c1 3300050509 Bacteria 13087
754 nmdc:mga0qj67_560003_c1 3300050509 Bacteria 916
755 nmdc:mga06r32_1943755_c1 3300050510 Bacteria 522
756 nmdc:mga06r32_233401_c1 3300050510 Bacteria 1828
757 nmdc:mga08y16_1232046_c1 3300050511 Bacteria 718
758 nmdc:mga08y16_1348903_c1 3300050511 Bacteria 678
759 nmdc:mga08x19_523597_c1 3300050514 Bacteria 838
760 Ga0495619_0198291 3300053085 Bacteria 1390
761 Ga0500643_049529 3300053087 Bacteria 1204
762 Ga0500644_0000368 3300053088 Bacteria 22094
763 Ga0500651_0006283 3300053093 Bacteria 6833
764 Ga0500650_0025842 3300053098 Bacteria 2629
765 Ga0500556_0000222 3300053104 Bacteria 45971
766 Ga0500562_017365 3300053108 Bacteria 1855
767 Ga0500597_337681 3300053120 Bacteria 590
768 Ga0500642_0000011 3300053130 Bacteria 215963
769 Ga0500658_0394216 3300053134 Bacteria 634
770 Ga0500564_000200 3300053138 Bacteria 16311
771 Ga0500568_0032237 3300053139 Bacteria 2156
772 Ga0500577_0100378 3300053142 Bacteria 1182
773 Ga0500588_0192502 3300053146 Bacteria 753
774 Ga0500616_0001825 3300053153 Bacteria 19303
775 Ga0500620_024372 3300053155 Bacteria 1847
776 Ga0500627_0428287 3300053158 Bacteria 560
777 Ga0500645_003390 3300053730 Bacteria 6508
778 Ga0500645_221190 3300053730 Bacteria 507
779 Ga0500609_057780 3300053731 Bacteria 541
780 Ga0501084_0627408 3300054114 Bacteria 908
781 Ga0501082_0002676 3300060353 Bacteria 15565
782 Ga0501082_1636570 3300060353 Bacteria 562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10039058 Ga0207684_100390582 67
2 3300025735 Ga0207713_1030908 Ga0207713_10309083 68
3 3300038705 Ga0237819_04260 Ga0237819_04260_2086_2316 68
4 3300046522 Ga0495643_0000307 Ga0495643_0000307_10092_10322 68
5 3300047320 Ga0495672_0000006 Ga0495672_0000006_39793_40023 68
6 3300005338 Ga0068868_100348892 Ga0068868_1003488922 69
7 3300005339 Ga0070660_100168453 Ga0070660_1001684532 69
8 3300005367 Ga0070667_101946813 Ga0070667_1019468131 69
9 3300005455 Ga0070663_101560047 Ga0070663_1015600471 69
10 3300005539 Ga0068853_100162420 Ga0068853_1001624203 69
11 3300005547 Ga0070693_100960539 Ga0070693_1009605391 69
12 3300005577 Ga0068857_100768169 Ga0068857_1007681691 69
13 3300006358 Ga0068871_102390497 Ga0068871_1023904972 69
14 3300009093 Ga0105240_11210355 Ga0105240_112103551 69
15 3300010375 Ga0105239_10568164 Ga0105239_105681642 69
16 3300013100 Ga0157373_10652699 Ga0157373_106526992 69
17 3300013307 Ga0157372_11194517 Ga0157372_111945172 69
18 3300005290 Ga0065712_10725522 Ga0065712_107255222 70
19 3300005335 Ga0070666_10160576 Ga0070666_101605763 70
20 3300005338 Ga0068868_100269493 Ga0068868_1002694933 70
21 3300005343 Ga0070687_100313852 Ga0070687_1003138523 70
22 3300005353 Ga0070669_100007475 Ga0070669_1000074753 70
23 3300005355 Ga0070671_101626043 Ga0070671_1016260431 70
24 3300005364 Ga0070673_100519402 Ga0070673_1005194022 70
25 3300005365 Ga0070688_100047056 Ga0070688_1000470563 70
26 3300005367 Ga0070667_100397497 Ga0070667_1003974972 70
27 3300005438 Ga0070701_10056419 Ga0070701_100564192 70
28 3300005441 Ga0070700_100137718 Ga0070700_1001377183 70
29 3300005468 Ga0070707_100276737 Ga0070707_1002767373 70
30 3300005471 Ga0070698_100842955 Ga0070698_1008429551 70
31 3300005543 Ga0070672_100513187 Ga0070672_1005131872 70
32 3300005548 Ga0070665_100920963 Ga0070665_1009209631 70
33 3300005549 Ga0070704_102163481 Ga0070704_1021634811 70
34 3300005617 Ga0068859_100090103 Ga0068859_1000901033 70
35 3300005617 Ga0068859_102571272 Ga0068859_1025712722 70
36 3300005618 Ga0068864_100382497 Ga0068864_1003824972 70
37 3300005719 Ga0068861_100029019 Ga0068861_1000290196 70
38 3300005841 Ga0068863_100573618 Ga0068863_1005736182 70
39 3300005842 Ga0068858_100773715 Ga0068858_1007737152 70
40 3300005843 Ga0068860_100845949 Ga0068860_1008459492 70
41 3300006163 Ga0070715_10488034 Ga0070715_104880342 70
42 3300006881 Ga0068865_100241297 Ga0068865_1002412972 70
43 3300006931 Ga0097620_100090099 Ga0097620_1000900993 70
44 3300006931 Ga0097620_102572182 Ga0097620_1025721822 70
45 3300009098 Ga0105245_11561666 Ga0105245_115616662 70
46 3300009101 Ga0105247_11559078 Ga0105247_115590781 70
47 3300009101 Ga0105247_11801490 Ga0105247_118014902 70
48 3300009176 Ga0105242_10259574 Ga0105242_102595742 70
49 3300009553 Ga0105249_10170520 Ga0105249_101705203 70
50 3300013306 Ga0163162_11273815 Ga0163162_112738152 70
51 3300013308 Ga0157375_10088173 Ga0157375_100881733 70
52 3300013308 Ga0157375_10596135 Ga0157375_105961352 70
53 3300014325 Ga0163163_10009985 Ga0163163_100099856 70
54 3300014968 Ga0157379_10583845 Ga0157379_105838452 70
55 3300014969 Ga0157376_12847837 Ga0157376_128478372 70
56 3300025900 Ga0207710_10685502 Ga0207710_106855022 70
57 3300025918 Ga0207662_10355237 Ga0207662_103552372 70
58 3300025923 Ga0207681_10096066 Ga0207681_100960662 70
59 3300025931 Ga0207644_11573722 Ga0207644_115737222 70
60 3300025936 Ga0207670_10135581 Ga0207670_101355813 70
61 3300025940 Ga0207691_10408237 Ga0207691_104082372 70
62 3300025942 Ga0207689_10087967 Ga0207689_100879673 70
63 3300025944 Ga0207661_10028540 Ga0207661_100285405 70
64 3300025960 Ga0207651_10442961 Ga0207651_104429612 70
65 3300025961 Ga0207712_10175655 Ga0207712_101756552 70
66 3300025986 Ga0207658_10928093 Ga0207658_109280932 70
67 3300026023 Ga0207677_12308061 Ga0207677_123080612 70
68 3300026075 Ga0207708_10213897 Ga0207708_102138972 70
69 3300026118 Ga0207675_100045591 Ga0207675_1000455915 70
70 3300028379 Ga0268266_10725958 Ga0268266_107259582 70
71 3300028381 Ga0268264_10394342 Ga0268264_103943423 70
72 3300031731 Ga0307405_10615295 Ga0307405_106152952 70
73 3300031901 Ga0307406_10430318 Ga0307406_104303182 70
74 3300032004 Ga0307414_10558806 Ga0307414_105588062 70
75 3300046533 Ga0495640_0298038 Ga0495640_0298038_198_428 70
76 3300046535 Ga0495586_0343417 Ga0495586_0343417_412_642 70
77 3300046642 Ga0495634_0207852 Ga0495634_0207852_399_629 70
78 3300046689 Ga0495613_0260187 Ga0495613_0260187_594_824 70
79 3300048903 Ga0496100_0246866 Ga0496100_0246866_429_659 70
80 3300048907 Ga0496104_0041190 Ga0496104_0041190_511_741 70
81 3300048909 Ga0496106_0110493 Ga0496106_0110493_1495_1725 70
82 3300048917 Ga0496114_0031627 Ga0496114_0031627_841_1071 70
83 3300048918 Ga0496115_0182934 Ga0496115_0182934_1063_1293 70
84 3300048927 Ga0496124_0650463 Ga0496124_0650463_350_634 70
85 3300003578 Ga0006562J51391_1119555 Ga0006562J51391_11195552 71
86 3300003578 Ga0006562J51391_1119556 Ga0006562J51391_11195562 71
87 3300005445 Ga0070708_100007994 Ga0070708_1000079942 71
88 3300005466 Ga0070685_10394697 Ga0070685_103946972 71
89 3300005467 Ga0070706_100130225 Ga0070706_1001302254 71
90 3300005471 Ga0070698_100106360 Ga0070698_1001063604 71
91 3300005536 Ga0070697_100502780 Ga0070697_1005027802 71
92 3300005545 Ga0070695_101625235 Ga0070695_1016252351 71
93 3300005842 Ga0068858_101863209 Ga0068858_1018632092 71
94 3300006173 Ga0070716_101145553 Ga0070716_1011455532 71
95 3300006175 Ga0070712_100161126 Ga0070712_1001611264 71
96 3300013102 Ga0157371_10013650 Ga0157371_100136506 71
97 3300013104 Ga0157370_10012080 Ga0157370_100120805 71
98 3300013105 Ga0157369_10017322 Ga0157369_1001732210 71
99 3300025910 Ga0207684_10239548 Ga0207684_102395483 71
100 3300031731 Ga0307405_10929832 Ga0307405_109298322 71
101 3300031824 Ga0307413_10264522 Ga0307413_102645222 71
102 3300031824 Ga0307413_10831296 Ga0307413_108312962 71
103 3300032004 Ga0307414_10480812 Ga0307414_104808122 71
104 3300032004 Ga0307414_11431496 Ga0307414_114314962 71
105 3300032005 Ga0307411_10839768 Ga0307411_108397682 71
106 3300041451 Ga0451791_0779858 Ga0451791_0779858_73_312 71
107 3300041494 Ga0451837_1865023 Ga0451837_1865023_268_498 71
108 3300044673 Ga0453683_0186899 Ga0453683_0186899_359_589 71
109 3300046499 Ga0495594_0025607 Ga0495594_0025607_714_947 71
110 3300046524 Ga0495648_0000039 Ga0495648_0000039_137723_137962 71
111 3300046692 Ga0495671_0584912 Ga0495671_0584912_48_287 71
112 3300047469 Ga0495673_0000148 Ga0495673_0000148_91798_92037 71
113 3300048916 Ga0496113_1288444 Ga0496113_1288444_294_527 71
114 3300048925 Ga0496122_0006171 Ga0496122_0006171_3936_4175 71
115 3300048926 Ga0496123_0001218 Ga0496123_0001218_36432_36671 71
116 3300048927 Ga0496124_0298596 Ga0496124_0298596_53_292 71
117 3300053087 Ga0500643_049529 Ga0500643_049529_309_548 71
118 3300053088 Ga0500644_0000368 Ga0500644_0000368_1538_1777 71
119 3300053138 Ga0500564_000200 Ga0500564_000200_15331_15570 71
120 3300003781 Ga0055536_1006393 Ga0055536_10063935 72
121 3300003794 Ga0055531_10029761 Ga0055531_100297611 72
122 3300005546 Ga0070696_101290577 Ga0070696_1012905772 72
123 3300005841 Ga0068863_100043823 Ga0068863_1000438232 72
124 3300014968 Ga0157379_11079198 Ga0157379_110791982 72
125 3300025292 Ga0209676_1000115 Ga0209676_100011549 72
126 3300025298 Ga0209050_1004487 Ga0209050_10044874 72
127 3300025304 Ga0209257_1000090 Ga0209257_100009031 72
128 3300026088 Ga0207641_10406308 Ga0207641_104063082 72
129 3300028800 Ga0265338_10151853 Ga0265338_101518534 72
130 3300031901 Ga0307406_10007743 Ga0307406_100077436 72
131 3300042127 Ga0450890_088189 Ga0450890_088189_29_262 72
132 3300046523 Ga0495644_0387208 Ga0495644_0387208_238_483 72
133 3300049742 Ga0501080_0007302 Ga0501080_0007302_436_687 72
134 3300049744 Ga0501083_0008004 Ga0501083_0008004_3419_3670 72
135 3300053139 Ga0500568_0032237 Ga0500568_0032237_479_721 72
136 3300060353 Ga0501082_0002676 Ga0501082_0002676_1092_1343 72
137 3300005295 Ga0065707_11145933 Ga0065707_111459332 73
138 3300005445 Ga0070708_100556570 Ga0070708_1005565701 73
139 3300005471 Ga0070698_100057454 Ga0070698_1000574544 73
140 3300005471 Ga0070698_100666886 Ga0070698_1006668862 73
141 3300005518 Ga0070699_100808819 Ga0070699_1008088192 73
142 3300005546 Ga0070696_101478602 Ga0070696_1014786022 73
143 3300005563 Ga0068855_100724191 Ga0068855_1007241912 73
144 3300005577 Ga0068857_100025106 Ga0068857_1000251066 73
145 3300009093 Ga0105240_10190937 Ga0105240_101909372 73
146 3300013105 Ga0157369_11622486 Ga0157369_116224862 73
147 3300013307 Ga0157372_11200813 Ga0157372_112008132 73
148 3300014325 Ga0163163_12222336 Ga0163163_122223362 73
149 3300014497 Ga0182008_10907935 Ga0182008_109079352 73
150 3300021377 Ga0213874_10216528 Ga0213874_102165282 73
151 3300021384 Ga0213876_10004842 Ga0213876_100048427 73
152 3300025304 Ga0209257_1069912 Ga0209257_10699122 73
153 3300025913 Ga0207695_10241589 Ga0207695_102415893 73
154 3300025949 Ga0207667_10336464 Ga0207667_103364642 73
155 3300026116 Ga0207674_10031936 Ga0207674_100319364 73
156 3300027471 Ga0209995_1002705 Ga0209995_10027055 73
157 3300027543 Ga0209999_1007476 Ga0209999_10074764 73
158 3300027682 Ga0209971_1040406 Ga0209971_10404062 73
159 3300027717 Ga0209998_10002536 Ga0209998_100025366 73
160 3300031548 Ga0307408_100447984 Ga0307408_1004479842 73
161 3300031731 Ga0307405_10062459 Ga0307405_100624594 73
162 3300031852 Ga0307410_10112313 Ga0307410_101123134 73
163 3300031901 Ga0307406_10092728 Ga0307406_100927282 73
164 3300031903 Ga0307407_10017774 Ga0307407_100177744 73
165 3300031995 Ga0307409_100007252 Ga0307409_1000072527 73
166 3300032002 Ga0307416_100265469 Ga0307416_1002654692 73
167 3300032005 Ga0307411_10102130 Ga0307411_101021302 73
168 3300032126 Ga0307415_100273286 Ga0307415_1002732862 73
169 3300037418 Ga0395900_0318787 Ga0395900_0318787_795_1025 73
170 3300037466 Ga0395898_0172669 Ga0395898_0172669_1373_1603 73
171 3300037853 Ga0436364_1035450 Ga0436364_1035450_285_530 73
172 3300038443 Ga0395901_0363744 Ga0395901_0363744_568_798 73
173 3300039437 Ga0436365_0064527 Ga0436365_0064527_2200_2445 73
174 3300039450 Ga0436363_0849015 Ga0436363_0849015_592_837 73
175 3300042156 Ga0439446_0021586 Ga0439446_0021586_94_339 73
176 3300046542 Ga0495597_0301781 Ga0495597_0301781_145_384 73
177 3300046616 Ga0495668_0017551 Ga0495668_0017551_276_515 73
178 3300046660 Ga0495625_0025028 Ga0495625_0025028_4183_4422 73
179 3300046660 Ga0495625_0124009 Ga0495625_0124009_1378_1617 73
180 3300048929 Ga0496126_0900073 Ga0496126_0900073_406_645 73
181 3300049515 Ga0501292_111648 Ga0501292_111648_138_383 73
182 3300049517 Ga0501294_049719 Ga0501294_049719_251_496 73
183 3300049521 Ga0501298_012219 Ga0501298_012219_227_472 73
184 3300049523 Ga0501300_068771 Ga0501300_068771_146_391 73
185 3300049589 Ga0501073_0496053 Ga0501073_0496053_588_818 73
186 3300049649 Ga0501198_012182 Ga0501198_012182_397_642 73
187 3300049652 Ga0501202_000394 Ga0501202_000394_380_625 73
188 3300049653 Ga0501206_022968 Ga0501206_022968_73_318 73
189 3300049655 Ga0501208_006031 Ga0501208_006031_332_577 73
190 3300049660 Ga0501216_000093 Ga0501216_000093_4192_4437 73
191 3300049663 Ga0501223_023705 Ga0501223_023705_127_372 73
192 3300049664 Ga0501224_000292 Ga0501224_000292_1785_2030 73
193 3300049665 Ga0501227_009937 Ga0501227_009937_1193_1438 73
194 3300049666 Ga0501228_003485 Ga0501228_003485_397_642 73
195 3300049668 Ga0501233_000355 Ga0501233_000355_1084_1329 73
196 3300049669 Ga0501235_002165 Ga0501235_002165_1259_1504 73
197 3300049670 Ga0501236_004539 Ga0501236_004539_318_563 73
198 3300049672 Ga0501239_085233 Ga0501239_085233_247_492 73
199 3300049673 Ga0501240_003855 Ga0501240_003855_551_796 73
200 3300049674 Ga0501242_001847 Ga0501242_001847_392_637 73
201 3300049675 Ga0501243_000433 Ga0501243_000433_3372_3617 73
202 3300049677 Ga0501247_002240 Ga0501247_002240_1041_1286 73
203 3300049679 Ga0501249_000835 Ga0501249_000835_4223_4468 73
204 3300049681 Ga0501251_021274 Ga0501251_021274_397_642 73
205 3300049682 Ga0501252_001093 Ga0501252_001093_944_1189 73
206 3300049685 Ga0501256_001858 Ga0501256_001858_1247_1492 73
207 3300049686 Ga0501257_007726 Ga0501257_007726_129_374 73
208 3300049688 Ga0501259_001036 Ga0501259_001036_1841_2086 73
209 3300049689 Ga0501260_001647 Ga0501260_001647_854_1099 73
210 3300049690 Ga0501261_000819 Ga0501261_000819_939_1184 73
211 3300049703 Ga0501219_008694 Ga0501219_008694_177_422 73
212 3300049704 Ga0501221_000083 Ga0501221_000083_5908_6153 73
213 3300049705 Ga0501225_0002327 Ga0501225_0002327_5007_5252 73
214 3300049706 Ga0501229_004951 Ga0501229_004951_880_1125 73
215 3300049707 Ga0501234_000699 Ga0501234_000699_4081_4326 73
216 3300049741 Ga0501079_0813125 Ga0501079_0813125_451_681 73
217 3300049759 Ga0501262_001325 Ga0501262_001325_632_877 73
218 3300049760 Ga0501263_000868 Ga0501263_000868_621_866 73
219 3300049763 Ga0501266_000368 Ga0501266_000368_3888_4133 73
220 3300049765 Ga0501268_000039 Ga0501268_000039_6532_6777 73
221 3300049767 Ga0501270_000589 Ga0501270_000589_521_766 73
222 3300049768 Ga0501271_014589 Ga0501271_014589_582_827 73
223 3300049771 Ga0501274_001615 Ga0501274_001615_1398_1643 73
224 3300049772 Ga0501275_003412 Ga0501275_003412_669_914 73
225 3300049775 Ga0501279_000426 Ga0501279_000426_3486_3731 73
226 3300049850 Ga0501204_016960 Ga0501204_016960_172_417 73
227 3300049851 Ga0501212_001054 Ga0501212_001054_664_909 73
228 3300050496 nmdc:mga07m45_169690_c1 nmdc:mga07m45_169690_c1_854_1093 73
229 3300050510 nmdc:mga06r32_1943755_c1 nmdc:mga06r32_1943755_c1_267_503 73
230 3300053098 Ga0500650_0025842 Ga0500650_0025842_2249_2488 73
231 3300053104 Ga0500556_0000222 Ga0500556_0000222_35220_35459 73
232 3300053108 Ga0500562_017365 Ga0500562_017365_1510_1749 73
233 3300053120 Ga0500597_337681 Ga0500597_337681_234_473 73
234 3300053130 Ga0500642_0000011 Ga0500642_0000011_116314_116553 73
235 3300053158 Ga0500627_0428287 Ga0500627_0428287_14_253 73
236 3300053730 Ga0500645_003390 Ga0500645_003390_5349_5588 73
237 3300053730 Ga0500645_221190 Ga0500645_221190_139_378 73
238 3300003320 rootH2_10160658 rootH2_101606582 74
239 3300003322 rootL2_10070106 rootL2_100701061 74
240 3300003322 rootL2_10073661 rootL2_100736613 74
241 3300003322 rootL2_10091401 rootL2_100914014 74
242 3300003322 rootL2_10184100 rootL2_101841004 74
243 3300003323 rootH1_10105934 rootH1_101059345 74
244 3300003323 rootH1_10383511 rootH1_103835112 74
245 3300003791 Ga0055530_10036705 Ga0055530_100367051 74
246 3300005327 Ga0070658_10521310 Ga0070658_105213101 74
247 3300005334 Ga0068869_100384877 Ga0068869_1003848771 74
248 3300005339 Ga0070660_100188129 Ga0070660_1001881293 74
249 3300005339 Ga0070660_101360589 Ga0070660_1013605891 74
250 3300005340 Ga0070689_100032234 Ga0070689_1000322342 74
251 3300005344 Ga0070661_100002976 Ga0070661_10000297613 74
252 3300005347 Ga0070668_100953672 Ga0070668_1009536722 74
253 3300005365 Ga0070688_100088207 Ga0070688_1000882072 74
254 3300005436 Ga0070713_100340293 Ga0070713_1003402933 74
255 3300005441 Ga0070700_100749855 Ga0070700_1007498552 74
256 3300005444 Ga0070694_100542464 Ga0070694_1005424642 74
257 3300005457 Ga0070662_101488481 Ga0070662_1014884812 74
258 3300005457 Ga0070662_102000758 Ga0070662_1020007581 74
259 3300005458 Ga0070681_10013929 Ga0070681_1001392911 74
260 3300005530 Ga0070679_100008928 Ga0070679_1000089289 74
261 3300005530 Ga0070679_100720910 Ga0070679_1007209103 74
262 3300005536 Ga0070697_101155573 Ga0070697_1011555732 74
263 3300005544 Ga0070686_101877681 Ga0070686_1018776811 74
264 3300005564 Ga0070664_101376567 Ga0070664_1013765672 74
265 3300005564 Ga0070664_101543241 Ga0070664_1015432411 74
266 3300005578 Ga0068854_100194027 Ga0068854_1001940272 74
267 3300005614 Ga0068856_100858403 Ga0068856_1008584031 74
268 3300005615 Ga0070702_100804902 Ga0070702_1008049021 74
269 3300005616 Ga0068852_102332195 Ga0068852_1023321952 74
270 3300005618 Ga0068864_100610376 Ga0068864_1006103762 74
271 3300005719 Ga0068861_100430022 Ga0068861_1004300222 74
272 3300005841 Ga0068863_100555063 Ga0068863_1005550632 74
273 3300005843 Ga0068860_100425815 Ga0068860_1004258152 74
274 3300005844 Ga0068862_100142400 Ga0068862_1001424004 74
275 3300006195 Ga0075366_10577930 Ga0075366_105779302 74
276 3300006844 Ga0075428_100113448 Ga0075428_1001134484 74
277 3300006846 Ga0075430_100854207 Ga0075430_1008542071 74
278 3300006880 Ga0075429_101955628 Ga0075429_1019556282 74
279 3300006881 Ga0068865_101036649 Ga0068865_1010366492 74
280 3300009094 Ga0111539_10050233 Ga0111539_100502335 74
281 3300009094 Ga0111539_10094115 Ga0111539_100941153 74
282 3300009094 Ga0111539_10852178 Ga0111539_108521782 74
283 3300009147 Ga0114129_10363833 Ga0114129_103638334 74
284 3300009147 Ga0114129_11842004 Ga0114129_118420042 74
285 3300009148 Ga0105243_12433106 Ga0105243_124331062 74
286 3300009545 Ga0105237_11490998 Ga0105237_114909982 74
287 3300009545 Ga0105237_11991015 Ga0105237_119910151 74
288 3300009553 Ga0105249_10003625 Ga0105249_100036254 74
289 3300009553 Ga0105249_11103879 Ga0105249_111038792 74
290 3300010375 Ga0105239_10037431 Ga0105239_100374314 74
291 3300010375 Ga0105239_10496396 Ga0105239_104963962 74
292 3300011119 Ga0105246_10567661 Ga0105246_105676612 74
293 3300013100 Ga0157373_10012335 Ga0157373_100123356 74
294 3300013100 Ga0157373_10016427 Ga0157373_100164276 74
295 3300013104 Ga0157370_10062872 Ga0157370_100628724 74
296 3300013296 Ga0157374_10201392 Ga0157374_102013922 74
297 3300013297 Ga0157378_10664884 Ga0157378_106648842 74
298 3300013306 Ga0163162_12224738 Ga0163162_122247382 74
299 3300013307 Ga0157372_10017454 Ga0157372_1001745412 74
300 3300013307 Ga0157372_10492078 Ga0157372_104920782 74
301 3300013308 Ga0157375_10129028 Ga0157375_101290284 74
302 3300013308 Ga0157375_11819765 Ga0157375_118197651 74
303 3300014969 Ga0157376_11093024 Ga0157376_110930241 74
304 3300025208 Ga0209436_100591 Ga0209436_1005913 74
305 3300025284 Ga0209130_1005113 Ga0209130_10051132 74
306 3300025302 Ga0207426_1000250 Ga0207426_100025010 74
307 3300025304 Ga0209257_1000005 Ga0209257_1000005636 74
308 3300025711 Ga0207696_1035889 Ga0207696_10358893 74
309 3300025909 Ga0207705_10093884 Ga0207705_100938844 74
310 3300025918 Ga0207662_11371141 Ga0207662_113711412 74
311 3300025936 Ga0207670_10351922 Ga0207670_103519222 74
312 3300025942 Ga0207689_10662438 Ga0207689_106624382 74
313 3300025960 Ga0207651_10547644 Ga0207651_105476442 74
314 3300025972 Ga0207668_11140859 Ga0207668_111408592 74
315 3300025986 Ga0207658_11504786 Ga0207658_115047862 74
316 3300026075 Ga0207708_11001623 Ga0207708_110016232 74
317 3300026088 Ga0207641_10336755 Ga0207641_103367553 74
318 3300026095 Ga0207676_11090255 Ga0207676_110902552 74
319 3300026142 Ga0207698_12001786 Ga0207698_120017862 74
320 3300027907 Ga0207428_10554248 Ga0207428_105542481 74
321 3300028380 Ga0268265_10180581 Ga0268265_101805813 74
322 3300030521 Ga0307511_10000884 Ga0307511_100008849 74
323 3300033180 Ga0307510_10003850 Ga0307510_100038508 74
324 3300035692 Ga0373935_1369273 Ga0373935_1369273_180_434 74
325 3300041463 Ga0451804_0479665 Ga0451804_0479665_625_864 74
326 3300042876 Ga0451577_0725838 Ga0451577_0725838_524_754 74
327 3300044712 Ga0453684_0000167 Ga0453684_0000167_73621_73851 74
328 3300046525 Ga0495663_0000501 Ga0495663_0000501_4632_4871 74
329 3300046525 Ga0495663_0002001 Ga0495663_0002001_5905_6144 74
330 3300046692 Ga0495671_0148001 Ga0495671_0148001_872_1111 74
331 3300047323 Ga0495683_0133256 Ga0495683_0133256_562_795 74
332 3300049765 Ga0501268_159978 Ga0501268_159978_274_507 74
333 3300050493 nmdc:mga0k408_18214_c1 nmdc:mga0k408_18214_c1_1679_1909 74
334 3300050511 nmdc:mga08y16_1232046_c1 nmdc:mga08y16_1232046_c1_150_398 74
335 3300050511 nmdc:mga08y16_1348903_c1 nmdc:mga08y16_1348903_c1_74_304 74
336 3300053093 Ga0500651_0006283 Ga0500651_0006283_3382_3636 74
337 3300053134 Ga0500658_0394216 Ga0500658_0394216_128_358 74
338 3300053142 Ga0500577_0100378 Ga0500577_0100378_879_1118 74
339 3300053146 Ga0500588_0192502 Ga0500588_0192502_263_517 74
340 3300053153 Ga0500616_0001825 Ga0500616_0001825_12508_12744 74
341 3300053155 Ga0500620_024372 Ga0500620_024372_1539_1793 74
342 3300053731 Ga0500609_057780 Ga0500609_057780_182_421 74
343 3300054114 Ga0501084_0627408 Ga0501084_0627408_162_392 74
344 3300001978 JGI24747J21853_1012191 JGI24747J21853_10121912 75
345 3300005327 Ga0070658_10159387 Ga0070658_101593873 75
346 3300005328 Ga0070676_10010398 Ga0070676_100103987 75
347 3300005333 Ga0070677_10002785 Ga0070677_100027853 75
348 3300005334 Ga0068869_100182584 Ga0068869_1001825842 75
349 3300005335 Ga0070666_10005249 Ga0070666_1000524910 75
350 3300005338 Ga0068868_100018131 Ga0068868_1000181317 75
351 3300005344 Ga0070661_100601760 Ga0070661_1006017602 75
352 3300005347 Ga0070668_100016390 Ga0070668_1000163903 75
353 3300005354 Ga0070675_100015430 Ga0070675_1000154309 75
354 3300005355 Ga0070671_100035411 Ga0070671_1000354115 75
355 3300005356 Ga0070674_100021041 Ga0070674_1000210415 75
356 3300005364 Ga0070673_100234382 Ga0070673_1002343822 75
357 3300005367 Ga0070667_100034883 Ga0070667_1000348833 75
358 3300005455 Ga0070663_100265701 Ga0070663_1002657012 75
359 3300005456 Ga0070678_100012385 Ga0070678_1000123857 75
360 3300005459 Ga0068867_100016610 Ga0068867_1000166108 75
361 3300005539 Ga0068853_100019875 Ga0068853_1000198753 75
362 3300005539 Ga0068853_101168231 Ga0068853_1011682311 75
363 3300005543 Ga0070672_100017344 Ga0070672_1000173442 75
364 3300005546 Ga0070696_100040310 Ga0070696_1000403104 75
365 3300005548 Ga0070665_100335899 Ga0070665_1003358993 75
366 3300005578 Ga0068854_100250679 Ga0068854_1002506792 75
367 3300005578 Ga0068854_101181698 Ga0068854_1011816981 75
368 3300005615 Ga0070702_100261172 Ga0070702_1002611722 75
369 3300005616 Ga0068852_100032090 Ga0068852_1000320905 75
370 3300005718 Ga0068866_10280367 Ga0068866_102803672 75
371 3300005719 Ga0068861_100072938 Ga0068861_1000729382 75
372 3300005834 Ga0068851_10001553 Ga0068851_1000155314 75
373 3300005840 Ga0068870_10011808 Ga0068870_100118082 75
374 3300005841 Ga0068863_100386789 Ga0068863_1003867892 75
375 3300005843 Ga0068860_100208759 Ga0068860_1002087592 75
376 3300006237 Ga0097621_100020405 Ga0097621_1000204053 75
377 3300006358 Ga0068871_100194110 Ga0068871_1001941102 75
378 3300006881 Ga0068865_100448457 Ga0068865_1004484572 75
379 3300009177 Ga0105248_10066217 Ga0105248_100662175 75
380 3300011119 Ga0105246_11557809 Ga0105246_115578091 75
381 3300013296 Ga0157374_10138601 Ga0157374_101386014 75
382 3300013297 Ga0157378_10377083 Ga0157378_103770832 75
383 3300013306 Ga0163162_10134062 Ga0163162_101340625 75
384 3300013308 Ga0157375_10013745 Ga0157375_100137452 75
385 3300014325 Ga0163163_11235720 Ga0163163_112357202 75
386 3300014745 Ga0157377_10647784 Ga0157377_106477842 75
387 3300017792 Ga0163161_10093594 Ga0163161_100935944 75
388 3300025315 Ga0207697_10062671 Ga0207697_100626713 75
389 3300025321 Ga0207656_10036331 Ga0207656_100363314 75
390 3300025893 Ga0207682_10005081 Ga0207682_100050818 75
391 3300025899 Ga0207642_10142711 Ga0207642_101427112 75
392 3300025903 Ga0207680_10198240 Ga0207680_101982402 75
393 3300025907 Ga0207645_10010784 Ga0207645_100107842 75
394 3300025909 Ga0207705_10223742 Ga0207705_102237422 75
395 3300025916 Ga0207663_10155575 Ga0207663_101555752 75
396 3300025919 Ga0207657_10142104 Ga0207657_101421041 75
397 3300025925 Ga0207650_10563878 Ga0207650_105638782 75
398 3300025926 Ga0207659_10299967 Ga0207659_102999672 75
399 3300025928 Ga0207700_10849582 Ga0207700_108495822 75
400 3300025931 Ga0207644_10019062 Ga0207644_100190627 75
401 3300025938 Ga0207704_10235882 Ga0207704_102358822 75
402 3300025940 Ga0207691_10025812 Ga0207691_100258127 75
403 3300025941 Ga0207711_10950352 Ga0207711_109503521 75
404 3300025942 Ga0207689_10180912 Ga0207689_101809122 75
405 3300025960 Ga0207651_10002810 Ga0207651_100028102 75
406 3300025972 Ga0207668_10421096 Ga0207668_104210962 75
407 3300025972 Ga0207668_10898433 Ga0207668_108984332 75
408 3300025981 Ga0207640_10546922 Ga0207640_105469222 75
409 3300025986 Ga0207658_11813046 Ga0207658_118130462 75
410 3300026023 Ga0207677_10019474 Ga0207677_100194743 75
411 3300026035 Ga0207703_10091401 Ga0207703_100914013 75
412 3300026041 Ga0207639_10316618 Ga0207639_103166182 75
413 3300026067 Ga0207678_10085767 Ga0207678_100857672 75
414 3300026088 Ga0207641_10115119 Ga0207641_101151192 75
415 3300026089 Ga0207648_10004895 Ga0207648_1000489518 75
416 3300026118 Ga0207675_100059402 Ga0207675_1000594022 75
417 3300026118 Ga0207675_100099289 Ga0207675_1000992895 75
418 3300026121 Ga0207683_10058507 Ga0207683_100585073 75
419 3300026142 Ga0207698_10246540 Ga0207698_102465403 75
420 3300028379 Ga0268266_10781781 Ga0268266_107817812 75
421 3300028379 Ga0268266_10860166 Ga0268266_108601662 75
422 3300028381 Ga0268264_10019038 Ga0268264_100190388 75
423 3300031824 Ga0307413_10327888 Ga0307413_103278882 75
424 3300031852 Ga0307410_10170829 Ga0307410_101708293 75
425 3300031903 Ga0307407_10345067 Ga0307407_103450672 75
426 3300032002 Ga0307416_102172566 Ga0307416_1021725662 75
427 3300032005 Ga0307411_10186597 Ga0307411_101865972 75
428 3300032126 Ga0307415_102141735 Ga0307415_1021417352 75
429 3300049577 Ga0501041_0953380 Ga0501041_0953380_200_436 75
430 3300005327 Ga0070658_10010053 Ga0070658_100100537 76
431 3300005327 Ga0070658_10030908 Ga0070658_100309084 76
432 3300005336 Ga0070680_100053130 Ga0070680_1000531303 76
433 3300005339 Ga0070660_100116819 Ga0070660_1001168192 76
434 3300005344 Ga0070661_100108162 Ga0070661_1001081624 76
435 3300005347 Ga0070668_101494269 Ga0070668_1014942692 76
436 3300005354 Ga0070675_100079115 Ga0070675_1000791154 76
437 3300005456 Ga0070678_100670259 Ga0070678_1006702592 76
438 3300005530 Ga0070679_100084368 Ga0070679_1000843684 76
439 3300005535 Ga0070684_100771932 Ga0070684_1007719322 76
440 3300005548 Ga0070665_100000177 Ga0070665_10000017762 76
441 3300005548 Ga0070665_100546294 Ga0070665_1005462942 76
442 3300005563 Ga0068855_100043739 Ga0068855_1000437396 76
443 3300005616 Ga0068852_101898609 Ga0068852_1018986091 76
444 3300006175 Ga0070712_101931974 Ga0070712_1019319742 76
445 3300006237 Ga0097621_101780000 Ga0097621_1017800001 76
446 3300009093 Ga0105240_10029957 Ga0105240_100299577 76
447 3300009098 Ga0105245_10022565 Ga0105245_100225652 76
448 3300009177 Ga0105248_10030382 Ga0105248_100303827 76
449 3300009551 Ga0105238_10104954 Ga0105238_101049542 76
450 3300010375 Ga0105239_10435582 Ga0105239_104355823 76
451 3300014326 Ga0157380_11169494 Ga0157380_111694942 76
452 3300014969 Ga0157376_10214649 Ga0157376_102146494 76
453 3300014969 Ga0157376_12017935 Ga0157376_120179352 76
454 3300025909 Ga0207705_10003074 Ga0207705_100030748 76
455 3300025909 Ga0207705_10484386 Ga0207705_104843862 76
456 3300025913 Ga0207695_10552910 Ga0207695_105529102 76
457 3300025917 Ga0207660_10193448 Ga0207660_101934482 76
458 3300025919 Ga0207657_10040675 Ga0207657_100406753 76
459 3300025924 Ga0207694_10383256 Ga0207694_103832562 76
460 3300025926 Ga0207659_10061946 Ga0207659_100619464 76
461 3300025927 Ga0207687_10009501 Ga0207687_100095017 76
462 3300025941 Ga0207711_10228124 Ga0207711_102281243 76
463 3300025960 Ga0207651_10553483 Ga0207651_105534831 76
464 3300025986 Ga0207658_10307905 Ga0207658_103079053 76
465 3300028379 Ga0268266_10015888 Ga0268266_100158887 76
466 3300028379 Ga0268266_10467418 Ga0268266_104674182 76
467 3300031235 Ga0265330_10163408 Ga0265330_101634082 76
468 3300031344 Ga0265316_10337394 Ga0265316_103373942 76
469 3300031824 Ga0307413_10346732 Ga0307413_103467322 76
470 3300031901 Ga0307406_10232739 Ga0307406_102327393 76
471 3300032004 Ga0307414_10112017 Ga0307414_101120174 76
472 3300032005 Ga0307411_10147754 Ga0307411_101477542 76
473 3300035083 Ga0373926_0020391 Ga0373926_0020391_1849_2115 76
474 3300035695 Ga0373927_0004162 Ga0373927_0004162_3623_3889 76
475 3300035695 Ga0373927_0389482 Ga0373927_0389482_534_806 76
476 3300037068 Ga0373925_0212833 Ga0373925_0212833_849_1115 76
477 3300037068 Ga0373925_1113007 Ga0373925_1113007_297_569 76
478 3300046472 Ga0495580_0029698 Ga0495580_0029698_575_847 76
479 3300046531 Ga0495665_0076666 Ga0495665_0076666_63_335 76
480 3300047315 Ga0495581_0322362 Ga0495581_0322362_50_322 76
481 3300048088 Ga0495602_0571599 Ga0495602_0571599_142_414 76
482 3300048917 Ga0496114_0869569 Ga0496114_0869569_445_717 76
483 3300049569 Ga0501032_0126934 Ga0501032_0126934_239_472 76
484 3300049570 Ga0501033_0153770 Ga0501033_0153770_242_475 76
485 3300049578 Ga0501042_0654553 Ga0501042_0654553_445_702 76
486 3300049579 Ga0501043_0254836 Ga0501043_0254836_20_253 76
487 3300049581 Ga0501047_0320744 Ga0501047_0320744_981_1214 76
488 3300049586 Ga0501070_1551826 Ga0501070_1551826_170_427 76
489 3300049743 Ga0501081_0266617 Ga0501081_0266617_87_344 76
490 3300049823 Ga0501044_0290252 Ga0501044_0290252_186_419 76
491 3300050514 nmdc:mga08x19_523597_c1 nmdc:mga08x19_523597_c1_193_459 76
492 3300005293 Ga0065715_10449225 Ga0065715_104492252 77
493 3300005327 Ga0070658_10901181 Ga0070658_109011811 77
494 3300005327 Ga0070658_11199205 Ga0070658_111992051 77
495 3300005328 Ga0070676_10061929 Ga0070676_100619292 77
496 3300005329 Ga0070683_100146345 Ga0070683_1001463452 77
497 3300005331 Ga0070670_100007844 Ga0070670_1000078449 77
498 3300005333 Ga0070677_10151832 Ga0070677_101518322 77
499 3300005334 Ga0068869_100250964 Ga0068869_1002509642 77
500 3300005334 Ga0068869_100710112 Ga0068869_1007101122 77
501 3300005335 Ga0070666_10000388 Ga0070666_1000038829 77
502 3300005344 Ga0070661_100005691 Ga0070661_1000056916 77
503 3300005344 Ga0070661_100678884 Ga0070661_1006788842 77
504 3300005353 Ga0070669_100077191 Ga0070669_1000771913 77
505 3300005354 Ga0070675_100040566 Ga0070675_1000405663 77
506 3300005355 Ga0070671_100102643 Ga0070671_1001026433 77
507 3300005356 Ga0070674_100522718 Ga0070674_1005227182 77
508 3300005356 Ga0070674_100531266 Ga0070674_1005312662 77
509 3300005364 Ga0070673_100552015 Ga0070673_1005520152 77
510 3300005366 Ga0070659_100343086 Ga0070659_1003430862 77
511 3300005439 Ga0070711_100048957 Ga0070711_1000489573 77
512 3300005457 Ga0070662_100040247 Ga0070662_1000402473 77
513 3300005458 Ga0070681_10019453 Ga0070681_100194536 77
514 3300005459 Ga0068867_100067192 Ga0068867_1000671923 77
515 3300005459 Ga0068867_100130323 Ga0068867_1001303232 77
516 3300005530 Ga0070679_100008268 Ga0070679_1000082684 77
517 3300005530 Ga0070679_100213471 Ga0070679_1002134713 77
518 3300005530 Ga0070679_102127708 Ga0070679_1021277081 77
519 3300005535 Ga0070684_100095266 Ga0070684_1000952663 77
520 3300005535 Ga0070684_100178542 Ga0070684_1001785422 77
521 3300005535 Ga0070684_100543603 Ga0070684_1005436032 77
522 3300005539 Ga0068853_101299531 Ga0068853_1012995312 77
523 3300005543 Ga0070672_100043660 Ga0070672_1000436603 77
524 3300005563 Ga0068855_100014514 Ga0068855_1000145145 77
525 3300005564 Ga0070664_100010339 Ga0070664_1000103397 77
526 3300005564 Ga0070664_100036054 Ga0070664_1000360544 77
527 3300005577 Ga0068857_100026776 Ga0068857_1000267764 77
528 3300005615 Ga0070702_100713622 Ga0070702_1007136222 77
529 3300005618 Ga0068864_100372874 Ga0068864_1003728741 77
530 3300005618 Ga0068864_100533065 Ga0068864_1005330652 77
531 3300005834 Ga0068851_10184408 Ga0068851_101844082 77
532 3300005840 Ga0068870_10073800 Ga0068870_100738002 77
533 3300005841 Ga0068863_101153254 Ga0068863_1011532541 77
534 3300005844 Ga0068862_100309311 Ga0068862_1003093112 77
535 3300005844 Ga0068862_101111238 Ga0068862_1011112382 77
536 3300006028 Ga0070717_11225474 Ga0070717_112254742 77
537 3300006175 Ga0070712_100403729 Ga0070712_1004037292 77
538 3300006358 Ga0068871_100311048 Ga0068871_1003110483 77
539 3300009093 Ga0105240_12104156 Ga0105240_121041561 77
540 3300009098 Ga0105245_10252924 Ga0105245_102529243 77
541 3300009098 Ga0105245_11594150 Ga0105245_115941502 77
542 3300009176 Ga0105242_10159824 Ga0105242_101598243 77
543 3300009177 Ga0105248_11317800 Ga0105248_113178002 77
544 3300009545 Ga0105237_12708781 Ga0105237_127087812 77
545 3300009551 Ga0105238_10290479 Ga0105238_102904793 77
546 3300011119 Ga0105246_10445516 Ga0105246_104455161 77
547 3300013104 Ga0157370_10014613 Ga0157370_100146132 77
548 3300013296 Ga0157374_10628085 Ga0157374_106280852 77
549 3300013297 Ga0157378_10477006 Ga0157378_104770063 77
550 3300013297 Ga0157378_11529829 Ga0157378_115298292 77
551 3300013308 Ga0157375_10682173 Ga0157375_106821732 77
552 3300014326 Ga0157380_13237887 Ga0157380_132378872 77
553 3300025315 Ga0207697_10316523 Ga0207697_103165232 77
554 3300025321 Ga0207656_10117704 Ga0207656_101177043 77
555 3300025893 Ga0207682_10279690 Ga0207682_102796902 77
556 3300025898 Ga0207692_10233387 Ga0207692_102333871 77
557 3300025901 Ga0207688_10124271 Ga0207688_101242713 77
558 3300025903 Ga0207680_10000227 Ga0207680_1000022711 77
559 3300025905 Ga0207685_10125684 Ga0207685_101256842 77
560 3300025907 Ga0207645_10178830 Ga0207645_101788302 77
561 3300025908 Ga0207643_10211443 Ga0207643_102114432 77
562 3300025909 Ga0207705_11275934 Ga0207705_112759342 77
563 3300025912 Ga0207707_10013978 Ga0207707_100139782 77
564 3300025914 Ga0207671_10545019 Ga0207671_105450192 77
565 3300025915 Ga0207693_10051226 Ga0207693_100512263 77
566 3300025917 Ga0207660_10533355 Ga0207660_105333552 77
567 3300025918 Ga0207662_10553977 Ga0207662_105539772 77
568 3300025920 Ga0207649_10082851 Ga0207649_100828512 77
569 3300025920 Ga0207649_10659789 Ga0207649_106597892 77
570 3300025921 Ga0207652_10613757 Ga0207652_106137572 77
571 3300025921 Ga0207652_11886901 Ga0207652_118869012 77
572 3300025923 Ga0207681_10014242 Ga0207681_100142423 77
573 3300025925 Ga0207650_10020128 Ga0207650_100201283 77
574 3300025925 Ga0207650_10110115 Ga0207650_101101152 77
575 3300025926 Ga0207659_10027515 Ga0207659_100275153 77
576 3300025927 Ga0207687_10471931 Ga0207687_104719312 77
577 3300025928 Ga0207700_10913738 Ga0207700_109137382 77
578 3300025933 Ga0207706_10120564 Ga0207706_101205643 77
579 3300025934 Ga0207686_10580891 Ga0207686_105808911 77
580 3300025937 Ga0207669_10074303 Ga0207669_100743032 77
581 3300025940 Ga0207691_10005468 Ga0207691_100054683 77
582 3300025942 Ga0207689_10822918 Ga0207689_108229182 77
583 3300025944 Ga0207661_10101708 Ga0207661_101017082 77
584 3300025945 Ga0207679_10002235 Ga0207679_100022356 77
585 3300025945 Ga0207679_10024575 Ga0207679_100245753 77
586 3300025949 Ga0207667_10037886 Ga0207667_100378862 77
587 3300025960 Ga0207651_10070960 Ga0207651_100709603 77
588 3300026078 Ga0207702_11043188 Ga0207702_110431882 77
589 3300026088 Ga0207641_10858299 Ga0207641_108582992 77
590 3300026089 Ga0207648_10084074 Ga0207648_100840743 77
591 3300026089 Ga0207648_10088136 Ga0207648_100881363 77
592 3300026095 Ga0207676_10325585 Ga0207676_103255853 77
593 3300026095 Ga0207676_10482354 Ga0207676_104823543 77
594 3300026116 Ga0207674_10001732 Ga0207674_100017323 77
595 3300026121 Ga0207683_10232456 Ga0207683_102324562 77
596 3300028380 Ga0268265_10392743 Ga0268265_103927432 77
597 3300028380 Ga0268265_10923291 Ga0268265_109232912 77
598 3300031548 Ga0307408_100399732 Ga0307408_1003997324 77
599 3300035724 Ga0373933_0087586 Ga0373933_0087586_1531_1812 77
600 3300037068 Ga0373925_1437416 Ga0373925_1437416_121_408 77
601 3300037418 Ga0395900_1629729 Ga0395900_1629729_156_389 77
602 3300037471 Ga0395905_0990870 Ga0395905_0990870_218_451 77
603 3300041443 Ga0451789_0891629 Ga0451789_0891629_611_868 77
604 3300041486 Ga0451807_0589435 Ga0451807_0589435_878_1135 77
605 3300042876 Ga0451577_0009474 Ga0451577_0009474_5937_6188 77
606 3300044673 Ga0453683_0165836 Ga0453683_0165836_599_850 77
607 3300044712 Ga0453684_0000284 Ga0453684_0000284_141818_142069 77
608 3300045051 Ga0451576_0950625 Ga0451576_0950625_189_440 77
609 3300001904 JGI24736J21556_1052156 JGI24736J21556_10521562 78
610 3300001989 JGI24739J22299_10048843 JGI24739J22299_100488432 78
611 3300001989 JGI24739J22299_10194073 JGI24739J22299_101940732 78
612 3300002126 JGI24035J26624_1005731 JGI24035J26624_10057312 78
613 3300003203 JGI25406J46586_10069815 JGI25406J46586_100698152 78
614 3300005328 Ga0070676_10414761 Ga0070676_104147612 78
615 3300005330 Ga0070690_100143048 Ga0070690_1001430481 78
616 3300005331 Ga0070670_100014544 Ga0070670_1000145446 78
617 3300005337 Ga0070682_100953854 Ga0070682_1009538541 78
618 3300005338 Ga0068868_100417975 Ga0068868_1004179752 78
619 3300005339 Ga0070660_100442553 Ga0070660_1004425531 78
620 3300005340 Ga0070689_100202779 Ga0070689_1002027793 78
621 3300005344 Ga0070661_100275393 Ga0070661_1002753932 78
622 3300005353 Ga0070669_100706011 Ga0070669_1007060112 78
623 3300005353 Ga0070669_101694824 Ga0070669_1016948242 78
624 3300005354 Ga0070675_100340640 Ga0070675_1003406402 78
625 3300005364 Ga0070673_100744826 Ga0070673_1007448261 78
626 3300005364 Ga0070673_101281039 Ga0070673_1012810392 78
627 3300005366 Ga0070659_100066587 Ga0070659_1000665874 78
628 3300005366 Ga0070659_100480995 Ga0070659_1004809953 78
629 3300005366 Ga0070659_101133068 Ga0070659_1011330681 78
630 3300005435 Ga0070714_101093563 Ga0070714_1010935632 78
631 3300005441 Ga0070700_101021707 Ga0070700_1010217072 78
632 3300005530 Ga0070679_100656327 Ga0070679_1006563272 78
633 3300005543 Ga0070672_100240776 Ga0070672_1002407763 78
634 3300005546 Ga0070696_101773459 Ga0070696_1017734591 78
635 3300005564 Ga0070664_101384068 Ga0070664_1013840682 78
636 3300005616 Ga0068852_101351117 Ga0068852_1013511172 78
637 3300005616 Ga0068852_101791592 Ga0068852_1017915922 78
638 3300005617 Ga0068859_100021389 Ga0068859_1000213894 78
639 3300005617 Ga0068859_100128919 Ga0068859_1001289192 78
640 3300005617 Ga0068859_100447557 Ga0068859_1004475573 78
641 3300005617 Ga0068859_102018840 Ga0068859_1020188402 78
642 3300005618 Ga0068864_101197152 Ga0068864_1011971522 78
643 3300005834 Ga0068851_10205708 Ga0068851_102057082 78
644 3300005841 Ga0068863_102707564 Ga0068863_1027075642 78
645 3300005842 Ga0068858_100548365 Ga0068858_1005483652 78
646 3300005843 Ga0068860_100193418 Ga0068860_1001934184 78
647 3300005843 Ga0068860_102153611 Ga0068860_1021536112 78
648 3300005985 Ga0081539_10012496 Ga0081539_100124966 78
649 3300006880 Ga0075429_100011858 Ga0075429_1000118585 78
650 3300006931 Ga0097620_100021389 Ga0097620_1000213894 78
651 3300006931 Ga0097620_100128925 Ga0097620_1001289252 78
652 3300006931 Ga0097620_100447609 Ga0097620_1004476093 78
653 3300009098 Ga0105245_12273977 Ga0105245_122739771 78
654 3300009101 Ga0105247_10157761 Ga0105247_101577613 78
655 3300009101 Ga0105247_10918100 Ga0105247_109181002 78
656 3300009177 Ga0105248_10729908 Ga0105248_107299083 78
657 3300013100 Ga0157373_10023871 Ga0157373_100238715 78
658 3300013100 Ga0157373_10042879 Ga0157373_100428793 78
659 3300014326 Ga0157380_10034947 Ga0157380_100349473 78
660 3300014497 Ga0182008_10014455 Ga0182008_100144556 78
661 3300014968 Ga0157379_11240199 Ga0157379_112401991 78
662 3300021384 Ga0213876_10554949 Ga0213876_105549492 78
663 3300025898 Ga0207692_10243665 Ga0207692_102436653 78
664 3300025900 Ga0207710_10201828 Ga0207710_102018282 78
665 3300025903 Ga0207680_10941264 Ga0207680_109412642 78
666 3300025904 Ga0207647_10008681 Ga0207647_1000868110 78
667 3300025907 Ga0207645_10328983 Ga0207645_103289832 78
668 3300025909 Ga0207705_10289774 Ga0207705_102897743 78
669 3300025916 Ga0207663_11557363 Ga0207663_115573632 78
670 3300025918 Ga0207662_10739076 Ga0207662_107390762 78
671 3300025919 Ga0207657_10092704 Ga0207657_100927044 78
672 3300025919 Ga0207657_10339567 Ga0207657_103395672 78
673 3300025923 Ga0207681_10804635 Ga0207681_108046351 78
674 3300025923 Ga0207681_11343244 Ga0207681_113432441 78
675 3300025925 Ga0207650_10035826 Ga0207650_100358265 78
676 3300025927 Ga0207687_11547132 Ga0207687_115471322 78
677 3300025929 Ga0207664_11128272 Ga0207664_111282722 78
678 3300025931 Ga0207644_10440092 Ga0207644_104400922 78
679 3300025932 Ga0207690_10066972 Ga0207690_100669722 78
680 3300025932 Ga0207690_10120461 Ga0207690_101204611 78
681 3300025934 Ga0207686_10094263 Ga0207686_100942633 78
682 3300025936 Ga0207670_10391126 Ga0207670_103911263 78
683 3300025937 Ga0207669_11903602 Ga0207669_119036022 78
684 3300025941 Ga0207711_10512926 Ga0207711_105129263 78
685 3300025960 Ga0207651_10972556 Ga0207651_109725562 78
686 3300025986 Ga0207658_11960268 Ga0207658_119602682 78
687 3300026089 Ga0207648_10487089 Ga0207648_104870893 78
688 3300026095 Ga0207676_11479470 Ga0207676_114794702 78
689 3300026095 Ga0207676_12163251 Ga0207676_121632512 78
690 3300026142 Ga0207698_10453810 Ga0207698_104538102 78
691 3300026142 Ga0207698_11197878 Ga0207698_111978782 78
692 3300027364 Ga0209967_1052926 Ga0209967_10529262 78
693 3300027876 Ga0209974_10003157 Ga0209974_100031573 78
694 3300028380 Ga0268265_11210242 Ga0268265_112102421 78
695 3300030742 Ga0316183_1007432 Ga0316183_10074325 78
696 3300030745 Ga0316182_1130225 Ga0316182_11302254 78
697 3300031548 Ga0307408_100026639 Ga0307408_1000266393 78
698 3300031548 Ga0307408_100478895 Ga0307408_1004788952 78
699 3300031731 Ga0307405_10008856 Ga0307405_100088563 78
700 3300031731 Ga0307405_10027639 Ga0307405_100276394 78
701 3300031731 Ga0307405_10146378 Ga0307405_101463782 78
702 3300031731 Ga0307405_10849367 Ga0307405_108493672 78
703 3300031824 Ga0307413_10122289 Ga0307413_101222891 78
704 3300031824 Ga0307413_10616073 Ga0307413_106160732 78
705 3300031852 Ga0307410_10022387 Ga0307410_100223872 78
706 3300031852 Ga0307410_10317415 Ga0307410_103174152 78
707 3300031852 Ga0307410_10761245 Ga0307410_107612451 78
708 3300031852 Ga0307410_11396949 Ga0307410_113969491 78
709 3300031852 Ga0307410_11818460 Ga0307410_118184602 78
710 3300031901 Ga0307406_10034662 Ga0307406_100346624 78
711 3300031901 Ga0307406_10289554 Ga0307406_102895542 78
712 3300031901 Ga0307406_10745876 Ga0307406_107458762 78
713 3300031903 Ga0307407_10196823 Ga0307407_101968232 78
714 3300031911 Ga0307412_10005721 Ga0307412_100057217 78
715 3300031911 Ga0307412_10016709 Ga0307412_100167094 78
716 3300031911 Ga0307412_10354522 Ga0307412_103545222 78
717 3300031995 Ga0307409_100389195 Ga0307409_1003891952 78
718 3300031995 Ga0307409_100488427 Ga0307409_1004884271 78
719 3300032002 Ga0307416_100036010 Ga0307416_1000360103 78
720 3300032002 Ga0307416_100373631 Ga0307416_1003736311 78
721 3300032002 Ga0307416_100504941 Ga0307416_1005049413 78
722 3300032002 Ga0307416_102067088 Ga0307416_1020670882 78
723 3300032004 Ga0307414_10239449 Ga0307414_102394493 78
724 3300032004 Ga0307414_10698481 Ga0307414_106984811 78
725 3300032004 Ga0307414_10746344 Ga0307414_107463442 78
726 3300032005 Ga0307411_10049752 Ga0307411_100497524 78
727 3300032005 Ga0307411_10053137 Ga0307411_100531372 78
728 3300032005 Ga0307411_10131052 Ga0307411_101310524 78
729 3300032005 Ga0307411_12198582 Ga0307411_121985822 78
730 3300032126 Ga0307415_100087442 Ga0307415_1000874423 78
731 3300032126 Ga0307415_100514123 Ga0307415_1005141232 78
732 3300032126 Ga0307415_101091614 Ga0307415_1010916142 78
733 3300035119 Ga0373956_0187113 Ga0373956_0187113_525_773 78
734 3300035695 Ga0373927_0016917 Ga0373927_0016917_2209_2445 78
735 3300035724 Ga0373933_0512951 Ga0373933_0512951_316_564 78
736 3300035724 Ga0373933_1073774 Ga0373933_1073774_229_477 78
737 3300036401 Ga0373937_0254397 Ga0373937_0254397_973_1221 78
738 3300037068 Ga0373925_0190524 Ga0373925_0190524_113_349 78
739 3300037068 Ga0373925_0415112 Ga0373925_0415112_45_305 78
740 3300037312 Ga0395899_0147933 Ga0395899_0147933_243_479 78
741 3300037312 Ga0395899_0753232 Ga0395899_0753232_159_398 78
742 3300037418 Ga0395900_0153111 Ga0395900_0153111_2066_2302 78
743 3300037418 Ga0395900_0532935 Ga0395900_0532935_483_722 78
744 3300037418 Ga0395900_0869441 Ga0395900_0869441_448_684 78
745 3300037418 Ga0395900_0959049 Ga0395900_0959049_96_332 78
746 3300037466 Ga0395898_0041822 Ga0395898_0041822_1654_1890 78
747 3300037466 Ga0395898_1562404 Ga0395898_1562404_118_357 78
748 3300037471 Ga0395905_0053030 Ga0395905_0053030_1962_2198 78
749 3300037471 Ga0395905_0242760 Ga0395905_0242760_692_931 78
750 3300037471 Ga0395905_0267775 Ga0395905_0267775_750_986 78
751 3300037471 Ga0395905_0459661 Ga0395905_0459661_377_613 78
752 3300038443 Ga0395901_0019192 Ga0395901_0019192_5098_5334 78
753 3300039437 Ga0436365_0176077 Ga0436365_0176077_268_504 78
754 3300039437 Ga0436365_0723875 Ga0436365_0723875_398_646 78
755 3300041411 Ga0439466_0279620 Ga0439466_0279620_216_452 78
756 3300041512 Ga0451853_0008946 Ga0451853_0008946_493_729 78
757 3300042005 Ga0439448_0053507 Ga0439448_0053507_481_729 78
758 3300042012 Ga0439455_0052303 Ga0439455_0052303_751_999 78
759 3300042157 Ga0439458_0094916 Ga0439458_0094916_487_735 78
760 3300045976 Ga0466967_0312984 Ga0466967_0312984_206_442 78
761 3300046459 Ga0495629_0606387 Ga0495629_0606387_267_515 78
762 3300046684 Ga0495669_0287095 Ga0495669_0287095_494_730 78
763 3300048912 Ga0496109_1150370 Ga0496109_1150370_375_629 78
764 3300049571 Ga0501034_0514414 Ga0501034_0514414_449_685 78
765 3300049574 Ga0501038_0130853 Ga0501038_0130853_524_760 78
766 3300049575 Ga0501039_0541071 Ga0501039_0541071_412_648 78
767 3300049579 Ga0501043_0406205 Ga0501043_0406205_657_893 78
768 3300049580 Ga0501046_0024430 Ga0501046_0024430_2515_2751 78
769 3300049581 Ga0501047_0046092 Ga0501047_0046092_213_449 78
770 3300049589 Ga0501073_0354632 Ga0501073_0354632_563_799 78
771 3300049742 Ga0501080_0099106 Ga0501080_0099106_2034_2270 78
772 3300049744 Ga0501083_0493963 Ga0501083_0493963_251_511 78
773 3300049767 Ga0501270_108704 Ga0501270_108704_174_431 78
774 3300049822 Ga0501035_0575139 Ga0501035_0575139_506_742 78
775 3300049823 Ga0501044_0095748 Ga0501044_0095748_243_479 78
776 3300050508 nmdc:mga09592_7127_c1 nmdc:mga09592_7127_c1_3295_3552 78
777 3300050509 nmdc:mga0qj67_1240879_c1 nmdc:mga0qj67_1240879_c1_264_524 78
778 3300050509 nmdc:mga0qj67_2521_c1 nmdc:mga0qj67_2521_c1_1896_2153 78
779 3300050509 nmdc:mga0qj67_560003_c1 nmdc:mga0qj67_560003_c1_600_857 78
780 3300050510 nmdc:mga06r32_233401_c1 nmdc:mga06r32_233401_c1_996_1253 78
781 3300053085 Ga0495619_0198291 Ga0495619_0198291_206_454 78
782 3300060353 Ga0501082_1636570 Ga0501082_1636570_211_447 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

8

70

0.97

PF01381

HTH_3

Helix-turn-helix

12

64

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9381 7 62
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9347 6 62
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9342 6 62
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9305 7 62
1b0n-assembly1.cif.gz_A sinr protein/sini protein complex 0.9276 6 62
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9381 7 62 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9347 6 62 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9342 6 62 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9311 7 62 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9305 7 62 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A6I4V562-F1-model_v4 Helix-turn-helix domain-containing protein 0.9814 2 66 GO:0003677
AF-S3X7D6-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9796 2 66 GO:0003677
AF-A0A7Z0BWH4-F1-model_v4 Putative transcriptional regulator 0.9793 2 66 GO:0003677
AF-I9WD21-F1-model_v4 Putative transcriptional regulator 0.979 2 67 GO:0003677
AF-A0A1M6KAK0-F1-model_v4 Putative transcriptional regulator 0.9784 2 67 GO:0003677

Feature Viewer

pLDDT pTM Quality
84.7 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map