F480620
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 782 | 384 | 782 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_1437416|Ga0373925_1437416_121_408 |
| Length | 95 |
| Sequence | VTVSILVKLDDMLYKRRMTLTELSERIGITLANLSVLKTGKARAIRFSTLDAICAALQCQPGDLLEFAPASLAASTEAASAPGHETETALCDQEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 245 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 252 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 253 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 256 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 295 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 296 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 297 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 311 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 312 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 313 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 315 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 319 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 321 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 323 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 326 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 327 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 328 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 329 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 330 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 331 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 332 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 333 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 334 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 335 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 336 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 337 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 339 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 346 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 347 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 348 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 349 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 350 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 351 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 352 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 356 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 366 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 368 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 371 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 373 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 376 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 377 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 380 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.22 |
| Nodule | 0 |
| Rhizoplane | 1.53 |
| Rhizosphere | 90.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1052156 | 3300001904 | Bacteria | 630 |
| 2 | JGI24747J21853_1012191 | 3300001978 | Bacteria | 876 |
| 3 | JGI24739J22299_10048843 | 3300001989 | Bacteria | 1374 |
| 4 | JGI24739J22299_10194073 | 3300001989 | Bacteria | 597 |
| 5 | JGI24035J26624_1005731 | 3300002126 | Bacteria | 1191 |
| 6 | JGI25406J46586_10069815 | 3300003203 | Bacteria | 1106 |
| 7 | rootH2_10160658 | 3300003320 | Bacteria | 5083 |
| 8 | rootL2_10070106 | 3300003322 | Bacteria | 1445 |
| 9 | rootL2_10073661 | 3300003322 | Bacteria | 7556 |
| 10 | rootL2_10091401 | 3300003322 | Bacteria | 5185 |
| 11 | rootL2_10184100 | 3300003322 | Bacteria | 4327 |
| 12 | rootH1_10105934 | 3300003323 | Bacteria | 15610 |
| 13 | rootH1_10383511 | 3300003323 | Bacteria | 1710 |
| 14 | Ga0006562J51391_1119555 | 3300003578 | Bacteria | 5890 |
| 15 | Ga0006562J51391_1119556 | 3300003578 | Bacteria | 1533 |
| 16 | Ga0055536_1006393 | 3300003781 | Bacteria | 5515 |
| 17 | Ga0055530_10036705 | 3300003791 | Bacteria | 1231 |
| 18 | Ga0055531_10029761 | 3300003794 | Bacteria | 1852 |
| 19 | Ga0065712_10725522 | 3300005290 | Bacteria | 537 |
| 20 | Ga0065715_10449225 | 3300005293 | Unclassified | 828 |
| 21 | Ga0065707_11145933 | 3300005295 | Bacteria | 506 |
| 22 | Ga0070658_10010053 | 3300005327 | Bacteria | 7599 |
| 23 | Ga0070658_10030908 | 3300005327 | Bacteria | 4301 |
| 24 | Ga0070658_10159387 | 3300005327 | Bacteria | 1893 |
| 25 | Ga0070658_10521310 | 3300005327 | Bacteria | 1027 |
| 26 | Ga0070658_10901181 | 3300005327 | Bacteria | 769 |
| 27 | Ga0070658_11199205 | 3300005327 | Bacteria | 660 |
| 28 | Ga0070676_10010398 | 3300005328 | Bacteria | 5048 |
| 29 | Ga0070676_10061929 | 3300005328 | Bacteria | 2225 |
| 30 | Ga0070676_10414761 | 3300005328 | Bacteria | 940 |
| 31 | Ga0070683_100146345 | 3300005329 | Bacteria | 2239 |
| 32 | Ga0070690_100143048 | 3300005330 | Unclassified | 1625 |
| 33 | Ga0070670_100007844 | 3300005331 | Bacteria | 9082 |
| 34 | Ga0070670_100014544 | 3300005331 | Bacteria | 6757 |
| 35 | Ga0070677_10002785 | 3300005333 | Bacteria | 5598 |
| 36 | Ga0070677_10151832 | 3300005333 | Unclassified | 1079 |
| 37 | Ga0068869_100182584 | 3300005334 | Bacteria | 1645 |
| 38 | Ga0068869_100250964 | 3300005334 | Bacteria | 1413 |
| 39 | Ga0068869_100384877 | 3300005334 | Bacteria | 1150 |
| 40 | Ga0068869_100710112 | 3300005334 | Bacteria | 858 |
| 41 | Ga0070666_10000388 | 3300005335 | Bacteria | 27657 |
| 42 | Ga0070666_10005249 | 3300005335 | Bacteria | 7936 |
| 43 | Ga0070666_10160576 | 3300005335 | Unclassified | 1571 |
| 44 | Ga0070680_100053130 | 3300005336 | Bacteria | 3307 |
| 45 | Ga0070682_100953854 | 3300005337 | Bacteria | 709 |
| 46 | Ga0068868_100018131 | 3300005338 | Bacteria | 5256 |
| 47 | Ga0068868_100269493 | 3300005338 | Bacteria | 1438 |
| 48 | Ga0068868_100348892 | 3300005338 | Bacteria | 1267 |
| 49 | Ga0068868_100417975 | 3300005338 | Bacteria | 1160 |
| 50 | Ga0070660_100116819 | 3300005339 | Bacteria | 2127 |
| 51 | Ga0070660_100168453 | 3300005339 | Bacteria | 1768 |
| 52 | Ga0070660_100188129 | 3300005339 | Bacteria | 1672 |
| 53 | Ga0070660_100442553 | 3300005339 | Bacteria | 1078 |
| 54 | Ga0070660_101360589 | 3300005339 | Bacteria | 603 |
| 55 | Ga0070689_100032234 | 3300005340 | Bacteria | 3985 |
| 56 | Ga0070689_100202779 | 3300005340 | Bacteria | 1620 |
| 57 | Ga0070687_100313852 | 3300005343 | Bacteria | 999 |
| 58 | Ga0070661_100002976 | 3300005344 | Bacteria | 11677 |
| 59 | Ga0070661_100005691 | 3300005344 | Bacteria | 8587 |
| 60 | Ga0070661_100108162 | 3300005344 | Bacteria | 2074 |
| 61 | Ga0070661_100275393 | 3300005344 | Bacteria | 1304 |
| 62 | Ga0070661_100601760 | 3300005344 | Bacteria | 889 |
| 63 | Ga0070661_100678884 | 3300005344 | Bacteria | 838 |
| 64 | Ga0070668_100016390 | 3300005347 | Bacteria | 5541 |
| 65 | Ga0070668_100953672 | 3300005347 | Bacteria | 769 |
| 66 | Ga0070668_101494269 | 3300005347 | Bacteria | 617 |
| 67 | Ga0070669_100007475 | 3300005353 | Bacteria | 7828 |
| 68 | Ga0070669_100077191 | 3300005353 | Bacteria | 2474 |
| 69 | Ga0070669_100706011 | 3300005353 | Bacteria | 852 |
| 70 | Ga0070669_101694824 | 3300005353 | Bacteria | 551 |
| 71 | Ga0070675_100015430 | 3300005354 | Bacteria | 6039 |
| 72 | Ga0070675_100040566 | 3300005354 | Bacteria | 3801 |
| 73 | Ga0070675_100079115 | 3300005354 | Bacteria | 2739 |
| 74 | Ga0070675_100340640 | 3300005354 | Bacteria | 1328 |
| 75 | Ga0070671_100035411 | 3300005355 | Bacteria | 4136 |
| 76 | Ga0070671_100102643 | 3300005355 | Bacteria | 2399 |
| 77 | Ga0070671_101626043 | 3300005355 | Bacteria | 573 |
| 78 | Ga0070674_100021041 | 3300005356 | Bacteria | 4181 |
| 79 | Ga0070674_100522718 | 3300005356 | Bacteria | 992 |
| 80 | Ga0070674_100531266 | 3300005356 | Bacteria | 984 |
| 81 | Ga0070673_100234382 | 3300005364 | Bacteria | 1593 |
| 82 | Ga0070673_100519402 | 3300005364 | Bacteria | 1079 |
| 83 | Ga0070673_100552015 | 3300005364 | Bacteria | 1047 |
| 84 | Ga0070673_100744826 | 3300005364 | Bacteria | 902 |
| 85 | Ga0070673_101281039 | 3300005364 | Bacteria | 688 |
| 86 | Ga0070688_100047056 | 3300005365 | Bacteria | 2674 |
| 87 | Ga0070688_100088207 | 3300005365 | Bacteria | 2022 |
| 88 | Ga0070659_100066587 | 3300005366 | Bacteria | 2854 |
| 89 | Ga0070659_100343086 | 3300005366 | Bacteria | 1252 |
| 90 | Ga0070659_100480995 | 3300005366 | Bacteria | 1057 |
| 91 | Ga0070659_101133068 | 3300005366 | Bacteria | 690 |
| 92 | Ga0070667_100034883 | 3300005367 | Bacteria | 4212 |
| 93 | Ga0070667_100397497 | 3300005367 | Bacteria | 1254 |
| 94 | Ga0070667_101946813 | 3300005367 | Bacteria | 554 |
| 95 | Ga0070714_101093563 | 3300005435 | Bacteria | 777 |
| 96 | Ga0070713_100340293 | 3300005436 | Bacteria | 1390 |
| 97 | Ga0070701_10056419 | 3300005438 | Bacteria | 2055 |
| 98 | Ga0070711_100048957 | 3300005439 | Bacteria | 2893 |
| 99 | Ga0070700_100137718 | 3300005441 | Bacteria | 1655 |
| 100 | Ga0070700_100749855 | 3300005441 | Bacteria | 781 |
| 101 | Ga0070700_101021707 | 3300005441 | Bacteria | 681 |
| 102 | Ga0070694_100542464 | 3300005444 | Bacteria | 930 |
| 103 | Ga0070708_100007994 | 3300005445 | Bacteria | 8472 |
| 104 | Ga0070708_100556570 | 3300005445 | Bacteria | 1082 |
| 105 | Ga0070663_100265701 | 3300005455 | Bacteria | 1362 |
| 106 | Ga0070663_101560047 | 3300005455 | Bacteria | 588 |
| 107 | Ga0070678_100012385 | 3300005456 | Bacteria | 5297 |
| 108 | Ga0070678_100670259 | 3300005456 | Bacteria | 932 |
| 109 | Ga0070662_100040247 | 3300005457 | Bacteria | 3327 |
| 110 | Ga0070662_101488481 | 3300005457 | Bacteria | 584 |
| 111 | Ga0070662_102000758 | 3300005457 | Bacteria | 501 |
| 112 | Ga0070681_10013929 | 3300005458 | Bacteria | 8001 |
| 113 | Ga0070681_10019453 | 3300005458 | Bacteria | 6797 |
| 114 | Ga0068867_100016610 | 3300005459 | Bacteria | 5227 |
| 115 | Ga0068867_100067192 | 3300005459 | Bacteria | 2672 |
| 116 | Ga0068867_100130323 | 3300005459 | Bacteria | 1953 |
| 117 | Ga0070685_10394697 | 3300005466 | Bacteria | 957 |
| 118 | Ga0070706_100130225 | 3300005467 | Bacteria | 2348 |
| 119 | Ga0070707_100276737 | 3300005468 | Bacteria | 1632 |
| 120 | Ga0070698_100057454 | 3300005471 | Bacteria | 3937 |
| 121 | Ga0070698_100106360 | 3300005471 | Bacteria | 2775 |
| 122 | Ga0070698_100666886 | 3300005471 | Bacteria | 981 |
| 123 | Ga0070698_100842955 | 3300005471 | Bacteria | 861 |
| 124 | Ga0070699_100808819 | 3300005518 | Bacteria | 858 |
| 125 | Ga0070679_100008268 | 3300005530 | Bacteria | 9788 |
| 126 | Ga0070679_100008928 | 3300005530 | Bacteria | 9457 |
| 127 | Ga0070679_100084368 | 3300005530 | Bacteria | 3165 |
| 128 | Ga0070679_100213471 | 3300005530 | Bacteria | 1893 |
| 129 | Ga0070679_100656327 | 3300005530 | Bacteria | 992 |
| 130 | Ga0070679_100720910 | 3300005530 | Bacteria | 940 |
| 131 | Ga0070679_102127708 | 3300005530 | Bacteria | 511 |
| 132 | Ga0070684_100095266 | 3300005535 | Unclassified | 2652 |
| 133 | Ga0070684_100178542 | 3300005535 | Bacteria | 1930 |
| 134 | Ga0070684_100543603 | 3300005535 | Bacteria | 1078 |
| 135 | Ga0070684_100771932 | 3300005535 | Bacteria | 898 |
| 136 | Ga0070697_100502780 | 3300005536 | Bacteria | 1060 |
| 137 | Ga0070697_101155573 | 3300005536 | Unclassified | 690 |
| 138 | Ga0068853_100019875 | 3300005539 | Bacteria | 5579 |
| 139 | Ga0068853_100162420 | 3300005539 | Bacteria | 2017 |
| 140 | Ga0068853_101168231 | 3300005539 | Bacteria | 743 |
| 141 | Ga0068853_101299531 | 3300005539 | Bacteria | 703 |
| 142 | Ga0070672_100017344 | 3300005543 | Bacteria | 5179 |
| 143 | Ga0070672_100043660 | 3300005543 | Bacteria | 3458 |
| 144 | Ga0070672_100240776 | 3300005543 | Bacteria | 1521 |
| 145 | Ga0070672_100513187 | 3300005543 | Bacteria | 1038 |
| 146 | Ga0070686_101877681 | 3300005544 | Bacteria | 511 |
| 147 | Ga0070695_101625235 | 3300005545 | Bacteria | 540 |
| 148 | Ga0070696_100040310 | 3300005546 | Bacteria | 3225 |
| 149 | Ga0070696_101290577 | 3300005546 | Bacteria | 619 |
| 150 | Ga0070696_101478602 | 3300005546 | Unclassified | 581 |
| 151 | Ga0070696_101773459 | 3300005546 | Bacteria | 533 |
| 152 | Ga0070693_100960539 | 3300005547 | Bacteria | 644 |
| 153 | Ga0070665_100000177 | 3300005548 | Bacteria | 113201 |
| 154 | Ga0070665_100335899 | 3300005548 | Bacteria | 1515 |
| 155 | Ga0070665_100546294 | 3300005548 | Bacteria | 1171 |
| 156 | Ga0070665_100920963 | 3300005548 | Bacteria | 887 |
| 157 | Ga0070704_102163481 | 3300005549 | Bacteria | 517 |
| 158 | Ga0068855_100014514 | 3300005563 | Bacteria | 9488 |
| 159 | Ga0068855_100043739 | 3300005563 | Bacteria | 5303 |
| 160 | Ga0068855_100724191 | 3300005563 | Bacteria | 1063 |
| 161 | Ga0070664_100010339 | 3300005564 | Bacteria | 7571 |
| 162 | Ga0070664_100036054 | 3300005564 | Bacteria | 4154 |
| 163 | Ga0070664_101376567 | 3300005564 | Bacteria | 667 |
| 164 | Ga0070664_101384068 | 3300005564 | Bacteria | 665 |
| 165 | Ga0070664_101543241 | 3300005564 | Bacteria | 629 |
| 166 | Ga0068857_100025106 | 3300005577 | Bacteria | 5249 |
| 167 | Ga0068857_100026776 | 3300005577 | Bacteria | 5084 |
| 168 | Ga0068857_100768169 | 3300005577 | Bacteria | 919 |
| 169 | Ga0068854_100194027 | 3300005578 | Bacteria | 1593 |
| 170 | Ga0068854_100250679 | 3300005578 | Bacteria | 1413 |
| 171 | Ga0068854_101181698 | 3300005578 | Bacteria | 685 |
| 172 | Ga0068856_100858403 | 3300005614 | Bacteria | 927 |
| 173 | Ga0070702_100261172 | 3300005615 | Bacteria | 1179 |
| 174 | Ga0070702_100713622 | 3300005615 | Bacteria | 766 |
| 175 | Ga0070702_100804902 | 3300005615 | Bacteria | 727 |
| 176 | Ga0068852_100032090 | 3300005616 | Bacteria | 4344 |
| 177 | Ga0068852_101351117 | 3300005616 | Bacteria | 734 |
| 178 | Ga0068852_101791592 | 3300005616 | Bacteria | 636 |
| 179 | Ga0068852_101898609 | 3300005616 | Bacteria | 618 |
| 180 | Ga0068852_102332195 | 3300005616 | Bacteria | 556 |
| 181 | Ga0068859_100021389 | 3300005617 | Bacteria | 6493 |
| 182 | Ga0068859_100090103 | 3300005617 | Bacteria | 3117 |
| 183 | Ga0068859_100128919 | 3300005617 | Bacteria | 2600 |
| 184 | Ga0068859_100447557 | 3300005617 | Bacteria | 1388 |
| 185 | Ga0068859_102018840 | 3300005617 | Bacteria | 637 |
| 186 | Ga0068859_102571272 | 3300005617 | Bacteria | 560 |
| 187 | Ga0068864_100372874 | 3300005618 | Bacteria | 1351 |
| 188 | Ga0068864_100382497 | 3300005618 | Bacteria | 1334 |
| 189 | Ga0068864_100533065 | 3300005618 | Unclassified | 1133 |
| 190 | Ga0068864_100610376 | 3300005618 | Bacteria | 1059 |
| 191 | Ga0068864_101197152 | 3300005618 | Bacteria | 758 |
| 192 | Ga0068866_10280367 | 3300005718 | Bacteria | 1032 |
| 193 | Ga0068861_100029019 | 3300005719 | Bacteria | 4042 |
| 194 | Ga0068861_100072938 | 3300005719 | Bacteria | 2665 |
| 195 | Ga0068861_100430022 | 3300005719 | Bacteria | 1178 |
| 196 | Ga0068851_10001553 | 3300005834 | Bacteria | 10061 |
| 197 | Ga0068851_10184408 | 3300005834 | Unclassified | 1157 |
| 198 | Ga0068851_10205708 | 3300005834 | Bacteria | 1100 |
| 199 | Ga0068870_10011808 | 3300005840 | Bacteria | 4063 |
| 200 | Ga0068870_10073800 | 3300005840 | Bacteria | 1867 |
| 201 | Ga0068863_100043823 | 3300005841 | Bacteria | 4248 |
| 202 | Ga0068863_100386789 | 3300005841 | Bacteria | 1366 |
| 203 | Ga0068863_100555063 | 3300005841 | Bacteria | 1134 |
| 204 | Ga0068863_100573618 | 3300005841 | Bacteria | 1115 |
| 205 | Ga0068863_101153254 | 3300005841 | Bacteria | 780 |
| 206 | Ga0068863_102707564 | 3300005841 | Bacteria | 504 |
| 207 | Ga0068858_100548365 | 3300005842 | Unclassified | 1119 |
| 208 | Ga0068858_100773715 | 3300005842 | Bacteria | 936 |
| 209 | Ga0068858_101863209 | 3300005842 | Bacteria | 594 |
| 210 | Ga0068860_100193418 | 3300005843 | Bacteria | 1969 |
| 211 | Ga0068860_100208759 | 3300005843 | Bacteria | 1894 |
| 212 | Ga0068860_100425815 | 3300005843 | Bacteria | 1316 |
| 213 | Ga0068860_100845949 | 3300005843 | Bacteria | 929 |
| 214 | Ga0068860_102153611 | 3300005843 | Bacteria | 579 |
| 215 | Ga0068862_100142400 | 3300005844 | Bacteria | 2129 |
| 216 | Ga0068862_100309311 | 3300005844 | Bacteria | 1456 |
| 217 | Ga0068862_101111238 | 3300005844 | Unclassified | 786 |
| 218 | Ga0081539_10012496 | 3300005985 | Bacteria | 6537 |
| 219 | Ga0070717_11225474 | 3300006028 | Unclassified | 683 |
| 220 | Ga0070715_10488034 | 3300006163 | Bacteria | 703 |
| 221 | Ga0070716_101145553 | 3300006173 | Bacteria | 622 |
| 222 | Ga0070712_100161126 | 3300006175 | Bacteria | 1732 |
| 223 | Ga0070712_100403729 | 3300006175 | Bacteria | 1129 |
| 224 | Ga0070712_101931974 | 3300006175 | Unclassified | 517 |
| 225 | Ga0075366_10577930 | 3300006195 | Bacteria | 696 |
| 226 | Ga0097621_100020405 | 3300006237 | Bacteria | 5105 |
| 227 | Ga0097621_101780000 | 3300006237 | Bacteria | 587 |
| 228 | Ga0068871_100194110 | 3300006358 | Bacteria | 1750 |
| 229 | Ga0068871_100311048 | 3300006358 | Bacteria | 1385 |
| 230 | Ga0068871_102390497 | 3300006358 | Bacteria | 504 |
| 231 | Ga0075428_100113448 | 3300006844 | Bacteria | 2952 |
| 232 | Ga0075430_100854207 | 3300006846 | Bacteria | 750 |
| 233 | Ga0075429_100011858 | 3300006880 | Bacteria | 7558 |
| 234 | Ga0075429_101955628 | 3300006880 | Bacteria | 508 |
| 235 | Ga0068865_100241297 | 3300006881 | Bacteria | 1422 |
| 236 | Ga0068865_100448457 | 3300006881 | Bacteria | 1066 |
| 237 | Ga0068865_101036649 | 3300006881 | Bacteria | 720 |
| 238 | Ga0097620_100021389 | 3300006931 | Bacteria | 6493 |
| 239 | Ga0097620_100090099 | 3300006931 | Bacteria | 3117 |
| 240 | Ga0097620_100128925 | 3300006931 | Bacteria | 2600 |
| 241 | Ga0097620_100447609 | 3300006931 | Bacteria | 1388 |
| 242 | Ga0097620_102572182 | 3300006931 | Bacteria | 560 |
| 243 | Ga0105240_10029957 | 3300009093 | Bacteria | 7080 |
| 244 | Ga0105240_10190937 | 3300009093 | Bacteria | 2409 |
| 245 | Ga0105240_11210355 | 3300009093 | Unclassified | 799 |
| 246 | Ga0105240_12104156 | 3300009093 | Unclassified | 586 |
| 247 | Ga0111539_10050233 | 3300009094 | Bacteria | 4968 |
| 248 | Ga0111539_10094115 | 3300009094 | Bacteria | 3520 |
| 249 | Ga0111539_10852178 | 3300009094 | Bacteria | 1060 |
| 250 | Ga0105245_10022565 | 3300009098 | Bacteria | 5525 |
| 251 | Ga0105245_10252924 | 3300009098 | Bacteria | 1712 |
| 252 | Ga0105245_11561666 | 3300009098 | Bacteria | 711 |
| 253 | Ga0105245_11594150 | 3300009098 | Unclassified | 704 |
| 254 | Ga0105245_12273977 | 3300009098 | Bacteria | 596 |
| 255 | Ga0105247_10157761 | 3300009101 | Bacteria | 1500 |
| 256 | Ga0105247_10918100 | 3300009101 | Bacteria | 677 |
| 257 | Ga0105247_11559078 | 3300009101 | Unclassified | 541 |
| 258 | Ga0105247_11801490 | 3300009101 | Bacteria | 509 |
| 259 | Ga0114129_10363833 | 3300009147 | Bacteria | 1913 |
| 260 | Ga0114129_11842004 | 3300009147 | Bacteria | 735 |
| 261 | Ga0105243_12433106 | 3300009148 | Bacteria | 562 |
| 262 | Ga0105242_10159824 | 3300009176 | Bacteria | 1971 |
| 263 | Ga0105242_10259574 | 3300009176 | Bacteria | 1569 |
| 264 | Ga0105248_10030382 | 3300009177 | Bacteria | 6032 |
| 265 | Ga0105248_10066217 | 3300009177 | Bacteria | 4057 |
| 266 | Ga0105248_10729908 | 3300009177 | Bacteria | 1118 |
| 267 | Ga0105248_11317800 | 3300009177 | Bacteria | 817 |
| 268 | Ga0105237_11490998 | 3300009545 | Bacteria | 683 |
| 269 | Ga0105237_11991015 | 3300009545 | Bacteria | 589 |
| 270 | Ga0105237_12708781 | 3300009545 | Bacteria | 507 |
| 271 | Ga0105238_10104954 | 3300009551 | Bacteria | 2807 |
| 272 | Ga0105238_10290479 | 3300009551 | Bacteria | 1617 |
| 273 | Ga0105249_10003625 | 3300009553 | Bacteria | 13351 |
| 274 | Ga0105249_10170520 | 3300009553 | Bacteria | 2110 |
| 275 | Ga0105249_11103879 | 3300009553 | Bacteria | 863 |
| 276 | Ga0105239_10037431 | 3300010375 | Bacteria | 5319 |
| 277 | Ga0105239_10435582 | 3300010375 | Bacteria | 1486 |
| 278 | Ga0105239_10496396 | 3300010375 | Bacteria | 1387 |
| 279 | Ga0105239_10568164 | 3300010375 | Bacteria | 1292 |
| 280 | Ga0105246_10445516 | 3300011119 | Unclassified | 1087 |
| 281 | Ga0105246_10567661 | 3300011119 | Bacteria | 975 |
| 282 | Ga0105246_11557809 | 3300011119 | Bacteria | 623 |
| 283 | Ga0157373_10012335 | 3300013100 | Bacteria | 6283 |
| 284 | Ga0157373_10016427 | 3300013100 | Bacteria | 5400 |
| 285 | Ga0157373_10023871 | 3300013100 | Bacteria | 4431 |
| 286 | Ga0157373_10042879 | 3300013100 | Bacteria | 3232 |
| 287 | Ga0157373_10652699 | 3300013100 | Bacteria | 768 |
| 288 | Ga0157371_10013650 | 3300013102 | Bacteria | 6164 |
| 289 | Ga0157370_10012080 | 3300013104 | Bacteria | 8987 |
| 290 | Ga0157370_10014613 | 3300013104 | Bacteria | 8022 |
| 291 | Ga0157370_10062872 | 3300013104 | Bacteria | 3519 |
| 292 | Ga0157369_10017322 | 3300013105 | Bacteria | 8099 |
| 293 | Ga0157369_11622486 | 3300013105 | Bacteria | 657 |
| 294 | Ga0157374_10138601 | 3300013296 | Bacteria | 2360 |
| 295 | Ga0157374_10201392 | 3300013296 | Bacteria | 1949 |
| 296 | Ga0157374_10628085 | 3300013296 | Bacteria | 1085 |
| 297 | Ga0157378_10377083 | 3300013297 | Bacteria | 1392 |
| 298 | Ga0157378_10477006 | 3300013297 | Bacteria | 1242 |
| 299 | Ga0157378_10664884 | 3300013297 | Bacteria | 1058 |
| 300 | Ga0157378_11529829 | 3300013297 | Bacteria | 712 |
| 301 | Ga0163162_10134062 | 3300013306 | Bacteria | 2587 |
| 302 | Ga0163162_11273815 | 3300013306 | Bacteria | 835 |
| 303 | Ga0163162_12224738 | 3300013306 | Bacteria | 630 |
| 304 | Ga0157372_10017454 | 3300013307 | Bacteria | 7705 |
| 305 | Ga0157372_10492078 | 3300013307 | Bacteria | 1430 |
| 306 | Ga0157372_11194517 | 3300013307 | Bacteria | 879 |
| 307 | Ga0157372_11200813 | 3300013307 | Bacteria | 876 |
| 308 | Ga0157375_10013745 | 3300013308 | Bacteria | 7216 |
| 309 | Ga0157375_10088173 | 3300013308 | Bacteria | 3157 |
| 310 | Ga0157375_10129028 | 3300013308 | Bacteria | 2647 |
| 311 | Ga0157375_10596135 | 3300013308 | Bacteria | 1264 |
| 312 | Ga0157375_10682173 | 3300013308 | Bacteria | 1182 |
| 313 | Ga0157375_11819765 | 3300013308 | Bacteria | 722 |
| 314 | Ga0163163_10009985 | 3300014325 | Bacteria | 8511 |
| 315 | Ga0163163_11235720 | 3300014325 | Bacteria | 810 |
| 316 | Ga0163163_12222336 | 3300014325 | Unclassified | 608 |
| 317 | Ga0157380_10034947 | 3300014326 | Bacteria | 3879 |
| 318 | Ga0157380_11169494 | 3300014326 | Bacteria | 811 |
| 319 | Ga0157380_13237887 | 3300014326 | Bacteria | 520 |
| 320 | Ga0182008_10014455 | 3300014497 | Unclassified | 4133 |
| 321 | Ga0182008_10907935 | 3300014497 | Unclassified | 519 |
| 322 | Ga0157377_10647784 | 3300014745 | Bacteria | 760 |
| 323 | Ga0157379_10583845 | 3300014968 | Unclassified | 1042 |
| 324 | Ga0157379_11079198 | 3300014968 | Bacteria | 768 |
| 325 | Ga0157379_11240199 | 3300014968 | Bacteria | 718 |
| 326 | Ga0157376_10214649 | 3300014969 | Unclassified | 1778 |
| 327 | Ga0157376_11093024 | 3300014969 | Unclassified | 823 |
| 328 | Ga0157376_12017935 | 3300014969 | Bacteria | 615 |
| 329 | Ga0157376_12847837 | 3300014969 | Bacteria | 523 |
| 330 | Ga0163161_10093594 | 3300017792 | Bacteria | 2227 |
| 331 | Ga0213874_10216528 | 3300021377 | Bacteria | 694 |
| 332 | Ga0213876_10004842 | 3300021384 | Bacteria | 7465 |
| 333 | Ga0213876_10554949 | 3300021384 | Unclassified | 611 |
| 334 | Ga0209436_100591 | 3300025208 | Bacteria | 15534 |
| 335 | Ga0209130_1005113 | 3300025284 | Bacteria | 4672 |
| 336 | Ga0209676_1000115 | 3300025292 | Bacteria | 205183 |
| 337 | Ga0209050_1004487 | 3300025298 | Bacteria | 9396 |
| 338 | Ga0207426_1000250 | 3300025302 | Bacteria | 117492 |
| 339 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 340 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 341 | Ga0209257_1069912 | 3300025304 | Bacteria | 928 |
| 342 | Ga0207697_10062671 | 3300025315 | Bacteria | 1549 |
| 343 | Ga0207697_10316523 | 3300025315 | Bacteria | 693 |
| 344 | Ga0207656_10036331 | 3300025321 | Bacteria | 2067 |
| 345 | Ga0207656_10117704 | 3300025321 | Unclassified | 1234 |
| 346 | Ga0207696_1035889 | 3300025711 | Bacteria | 1473 |
| 347 | Ga0207713_1030908 | 3300025735 | Bacteria | 2377 |
| 348 | Ga0207682_10005081 | 3300025893 | Bacteria | 5391 |
| 349 | Ga0207682_10279690 | 3300025893 | Bacteria | 780 |
| 350 | Ga0207692_10233387 | 3300025898 | Unclassified | 1096 |
| 351 | Ga0207692_10243665 | 3300025898 | Bacteria | 1074 |
| 352 | Ga0207642_10142711 | 3300025899 | Bacteria | 1265 |
| 353 | Ga0207710_10201828 | 3300025900 | Bacteria | 982 |
| 354 | Ga0207710_10685502 | 3300025900 | Unclassified | 537 |
| 355 | Ga0207688_10124271 | 3300025901 | Bacteria | 1508 |
| 356 | Ga0207680_10000227 | 3300025903 | Bacteria | 27167 |
| 357 | Ga0207680_10198240 | 3300025903 | Bacteria | 1367 |
| 358 | Ga0207680_10941264 | 3300025903 | Bacteria | 619 |
| 359 | Ga0207647_10008681 | 3300025904 | Bacteria | 7259 |
| 360 | Ga0207685_10125684 | 3300025905 | Bacteria | 1132 |
| 361 | Ga0207645_10010784 | 3300025907 | Bacteria | 6266 |
| 362 | Ga0207645_10178830 | 3300025907 | Bacteria | 1391 |
| 363 | Ga0207645_10328983 | 3300025907 | Bacteria | 1020 |
| 364 | Ga0207643_10211443 | 3300025908 | Bacteria | 1184 |
| 365 | Ga0207705_10003074 | 3300025909 | Bacteria | 12725 |
| 366 | Ga0207705_10093884 | 3300025909 | Bacteria | 2200 |
| 367 | Ga0207705_10223742 | 3300025909 | Bacteria | 1430 |
| 368 | Ga0207705_10289774 | 3300025909 | Bacteria | 1254 |
| 369 | Ga0207705_10484386 | 3300025909 | Bacteria | 960 |
| 370 | Ga0207705_11275934 | 3300025909 | Bacteria | 562 |
| 371 | Ga0207684_10039058 | 3300025910 | Bacteria | 4028 |
| 372 | Ga0207684_10239548 | 3300025910 | Bacteria | 1565 |
| 373 | Ga0207707_10013978 | 3300025912 | Bacteria | 6999 |
| 374 | Ga0207695_10241589 | 3300025913 | Bacteria | 1707 |
| 375 | Ga0207695_10552910 | 3300025913 | Bacteria | 1033 |
| 376 | Ga0207671_10545019 | 3300025914 | Bacteria | 925 |
| 377 | Ga0207693_10051226 | 3300025915 | Bacteria | 3240 |
| 378 | Ga0207663_10155575 | 3300025916 | Bacteria | 1608 |
| 379 | Ga0207663_11557363 | 3300025916 | Bacteria | 532 |
| 380 | Ga0207660_10193448 | 3300025917 | Bacteria | 1585 |
| 381 | Ga0207660_10533355 | 3300025917 | Unclassified | 954 |
| 382 | Ga0207662_10355237 | 3300025918 | Bacteria | 985 |
| 383 | Ga0207662_10553977 | 3300025918 | Unclassified | 796 |
| 384 | Ga0207662_10739076 | 3300025918 | Bacteria | 691 |
| 385 | Ga0207662_11371141 | 3300025918 | Unclassified | 502 |
| 386 | Ga0207657_10040675 | 3300025919 | Bacteria | 4117 |
| 387 | Ga0207657_10092704 | 3300025919 | Bacteria | 2517 |
| 388 | Ga0207657_10142104 | 3300025919 | Unclassified | 1961 |
| 389 | Ga0207657_10339567 | 3300025919 | Bacteria | 1185 |
| 390 | Ga0207649_10082851 | 3300025920 | Unclassified | 2081 |
| 391 | Ga0207649_10659789 | 3300025920 | Bacteria | 809 |
| 392 | Ga0207652_10613757 | 3300025921 | Bacteria | 975 |
| 393 | Ga0207652_11886901 | 3300025921 | Bacteria | 503 |
| 394 | Ga0207681_10014242 | 3300025923 | Bacteria | 4937 |
| 395 | Ga0207681_10096066 | 3300025923 | Bacteria | 2127 |
| 396 | Ga0207681_10804635 | 3300025923 | Bacteria | 785 |
| 397 | Ga0207681_11343244 | 3300025923 | Bacteria | 600 |
| 398 | Ga0207694_10383256 | 3300025924 | Bacteria | 1167 |
| 399 | Ga0207650_10020128 | 3300025925 | Bacteria | 4701 |
| 400 | Ga0207650_10035826 | 3300025925 | Bacteria | 3606 |
| 401 | Ga0207650_10110115 | 3300025925 | Unclassified | 2131 |
| 402 | Ga0207650_10563878 | 3300025925 | Bacteria | 955 |
| 403 | Ga0207659_10027515 | 3300025926 | Bacteria | 3851 |
| 404 | Ga0207659_10061946 | 3300025926 | Bacteria | 2699 |
| 405 | Ga0207659_10299967 | 3300025926 | Bacteria | 1319 |
| 406 | Ga0207687_10009501 | 3300025927 | Bacteria | 6360 |
| 407 | Ga0207687_10471931 | 3300025927 | Bacteria | 1043 |
| 408 | Ga0207687_11547132 | 3300025927 | Bacteria | 569 |
| 409 | Ga0207700_10849582 | 3300025928 | Bacteria | 817 |
| 410 | Ga0207700_10913738 | 3300025928 | Bacteria | 786 |
| 411 | Ga0207664_11128272 | 3300025929 | Bacteria | 700 |
| 412 | Ga0207644_10019062 | 3300025931 | Bacteria | 4649 |
| 413 | Ga0207644_10440092 | 3300025931 | Bacteria | 1070 |
| 414 | Ga0207644_11573722 | 3300025931 | Bacteria | 551 |
| 415 | Ga0207690_10066972 | 3300025932 | Bacteria | 2462 |
| 416 | Ga0207690_10120461 | 3300025932 | Bacteria | 1905 |
| 417 | Ga0207706_10120564 | 3300025933 | Bacteria | 2306 |
| 418 | Ga0207686_10094263 | 3300025934 | Unclassified | 1984 |
| 419 | Ga0207686_10580891 | 3300025934 | Bacteria | 879 |
| 420 | Ga0207670_10135581 | 3300025936 | Bacteria | 1809 |
| 421 | Ga0207670_10351922 | 3300025936 | Bacteria | 1167 |
| 422 | Ga0207670_10391126 | 3300025936 | Bacteria | 1110 |
| 423 | Ga0207669_10074303 | 3300025937 | Bacteria | 2149 |
| 424 | Ga0207669_11903602 | 3300025937 | Bacteria | 508 |
| 425 | Ga0207704_10235882 | 3300025938 | Bacteria | 1363 |
| 426 | Ga0207691_10005468 | 3300025940 | Bacteria | 12263 |
| 427 | Ga0207691_10025812 | 3300025940 | Bacteria | 5513 |
| 428 | Ga0207691_10408237 | 3300025940 | Bacteria | 1158 |
| 429 | Ga0207711_10228124 | 3300025941 | Bacteria | 1705 |
| 430 | Ga0207711_10512926 | 3300025941 | Bacteria | 1118 |
| 431 | Ga0207711_10950352 | 3300025941 | Bacteria | 798 |
| 432 | Ga0207689_10087967 | 3300025942 | Bacteria | 2552 |
| 433 | Ga0207689_10180912 | 3300025942 | Bacteria | 1739 |
| 434 | Ga0207689_10662438 | 3300025942 | Bacteria | 880 |
| 435 | Ga0207689_10822918 | 3300025942 | Bacteria | 784 |
| 436 | Ga0207661_10028540 | 3300025944 | Unclassified | 4274 |
| 437 | Ga0207661_10101708 | 3300025944 | Bacteria | 2415 |
| 438 | Ga0207679_10002235 | 3300025945 | Bacteria | 11964 |
| 439 | Ga0207679_10024575 | 3300025945 | Bacteria | 4132 |
| 440 | Ga0207667_10037886 | 3300025949 | Bacteria | 5152 |
| 441 | Ga0207667_10336464 | 3300025949 | Bacteria | 1541 |
| 442 | Ga0207651_10002810 | 3300025960 | Bacteria | 8372 |
| 443 | Ga0207651_10070960 | 3300025960 | Bacteria | 2467 |
| 444 | Ga0207651_10442961 | 3300025960 | Bacteria | 1113 |
| 445 | Ga0207651_10547644 | 3300025960 | Bacteria | 1006 |
| 446 | Ga0207651_10553483 | 3300025960 | Bacteria | 1001 |
| 447 | Ga0207651_10972556 | 3300025960 | Bacteria | 758 |
| 448 | Ga0207712_10175655 | 3300025961 | Bacteria | 1678 |
| 449 | Ga0207668_10421096 | 3300025972 | Bacteria | 1133 |
| 450 | Ga0207668_10898433 | 3300025972 | Bacteria | 788 |
| 451 | Ga0207668_11140859 | 3300025972 | Bacteria | 699 |
| 452 | Ga0207640_10546922 | 3300025981 | Bacteria | 972 |
| 453 | Ga0207658_10307905 | 3300025986 | Bacteria | 1367 |
| 454 | Ga0207658_10928093 | 3300025986 | Bacteria | 793 |
| 455 | Ga0207658_11504786 | 3300025986 | Bacteria | 616 |
| 456 | Ga0207658_11813046 | 3300025986 | Bacteria | 556 |
| 457 | Ga0207658_11960268 | 3300025986 | Bacteria | 533 |
| 458 | Ga0207677_10019474 | 3300026023 | Bacteria | 4098 |
| 459 | Ga0207677_12308061 | 3300026023 | Bacteria | 501 |
| 460 | Ga0207703_10091401 | 3300026035 | Bacteria | 2560 |
| 461 | Ga0207639_10316618 | 3300026041 | Bacteria | 1384 |
| 462 | Ga0207678_10085767 | 3300026067 | Bacteria | 2691 |
| 463 | Ga0207708_10213897 | 3300026075 | Bacteria | 1542 |
| 464 | Ga0207708_11001623 | 3300026075 | Bacteria | 726 |
| 465 | Ga0207702_11043188 | 3300026078 | Bacteria | 811 |
| 466 | Ga0207641_10115119 | 3300026088 | Bacteria | 2390 |
| 467 | Ga0207641_10336755 | 3300026088 | Bacteria | 1435 |
| 468 | Ga0207641_10406308 | 3300026088 | Unclassified | 1308 |
| 469 | Ga0207641_10858299 | 3300026088 | Bacteria | 900 |
| 470 | Ga0207648_10004895 | 3300026089 | Bacteria | 13651 |
| 471 | Ga0207648_10084074 | 3300026089 | Bacteria | 2776 |
| 472 | Ga0207648_10088136 | 3300026089 | Bacteria | 2710 |
| 473 | Ga0207648_10487089 | 3300026089 | Bacteria | 1127 |
| 474 | Ga0207676_10325585 | 3300026095 | Bacteria | 1412 |
| 475 | Ga0207676_10482354 | 3300026095 | Unclassified | 1174 |
| 476 | Ga0207676_11090255 | 3300026095 | Bacteria | 789 |
| 477 | Ga0207676_11479470 | 3300026095 | Bacteria | 676 |
| 478 | Ga0207676_12163251 | 3300026095 | Bacteria | 555 |
| 479 | Ga0207674_10001732 | 3300026116 | Bacteria | 27879 |
| 480 | Ga0207674_10031936 | 3300026116 | Bacteria | 5527 |
| 481 | Ga0207675_100045591 | 3300026118 | Bacteria | 4096 |
| 482 | Ga0207675_100059402 | 3300026118 | Bacteria | 3568 |
| 483 | Ga0207675_100099289 | 3300026118 | Bacteria | 2742 |
| 484 | Ga0207683_10058507 | 3300026121 | Bacteria | 3384 |
| 485 | Ga0207683_10232456 | 3300026121 | Bacteria | 1682 |
| 486 | Ga0207698_10246540 | 3300026142 | Bacteria | 1632 |
| 487 | Ga0207698_10453810 | 3300026142 | Bacteria | 1238 |
| 488 | Ga0207698_11197878 | 3300026142 | Bacteria | 773 |
| 489 | Ga0207698_12001786 | 3300026142 | Bacteria | 593 |
| 490 | Ga0209967_1052926 | 3300027364 | Bacteria | 625 |
| 491 | Ga0209995_1002705 | 3300027471 | Bacteria | 2811 |
| 492 | Ga0209999_1007476 | 3300027543 | Bacteria | 1968 |
| 493 | Ga0209971_1040406 | 3300027682 | Unclassified | 1122 |
| 494 | Ga0209998_10002536 | 3300027717 | Bacteria | 4158 |
| 495 | Ga0209974_10003157 | 3300027876 | Bacteria | 5965 |
| 496 | Ga0207428_10554248 | 3300027907 | Bacteria | 831 |
| 497 | Ga0268266_10015888 | 3300028379 | Bacteria | 6442 |
| 498 | Ga0268266_10467418 | 3300028379 | Bacteria | 1201 |
| 499 | Ga0268266_10725958 | 3300028379 | Bacteria | 958 |
| 500 | Ga0268266_10781781 | 3300028379 | Bacteria | 922 |
| 501 | Ga0268266_10860166 | 3300028379 | Bacteria | 876 |
| 502 | Ga0268265_10180581 | 3300028380 | Bacteria | 1813 |
| 503 | Ga0268265_10392743 | 3300028380 | Bacteria | 1280 |
| 504 | Ga0268265_10923291 | 3300028380 | Unclassified | 858 |
| 505 | Ga0268265_11210242 | 3300028380 | Bacteria | 753 |
| 506 | Ga0268264_10019038 | 3300028381 | Bacteria | 5613 |
| 507 | Ga0268264_10394342 | 3300028381 | Bacteria | 1329 |
| 508 | Ga0265338_10151853 | 3300028800 | Bacteria | 1799 |
| 509 | Ga0307511_10000884 | 3300030521 | Bacteria | 31692 |
| 510 | Ga0316183_1007432 | 3300030742 | Bacteria | 4241 |
| 511 | Ga0316182_1130225 | 3300030745 | Bacteria | 2711 |
| 512 | Ga0265330_10163408 | 3300031235 | Bacteria | 945 |
| 513 | Ga0265316_10337394 | 3300031344 | Bacteria | 1093 |
| 514 | Ga0307408_100026639 | 3300031548 | Bacteria | 3974 |
| 515 | Ga0307408_100399732 | 3300031548 | Bacteria | 1179 |
| 516 | Ga0307408_100447984 | 3300031548 | Unclassified | 1119 |
| 517 | Ga0307408_100478895 | 3300031548 | Bacteria | 1085 |
| 518 | Ga0307405_10008856 | 3300031731 | Bacteria | 5130 |
| 519 | Ga0307405_10027639 | 3300031731 | Bacteria | 3292 |
| 520 | Ga0307405_10062459 | 3300031731 | Bacteria | 2359 |
| 521 | Ga0307405_10146378 | 3300031731 | Bacteria | 1655 |
| 522 | Ga0307405_10615295 | 3300031731 | Bacteria | 888 |
| 523 | Ga0307405_10849367 | 3300031731 | Bacteria | 768 |
| 524 | Ga0307405_10929832 | 3300031731 | Bacteria | 737 |
| 525 | Ga0307413_10122289 | 3300031824 | Bacteria | 1765 |
| 526 | Ga0307413_10264522 | 3300031824 | Bacteria | 1284 |
| 527 | Ga0307413_10327888 | 3300031824 | Bacteria | 1172 |
| 528 | Ga0307413_10346732 | 3300031824 | Bacteria | 1144 |
| 529 | Ga0307413_10616073 | 3300031824 | Bacteria | 890 |
| 530 | Ga0307413_10831296 | 3300031824 | Bacteria | 779 |
| 531 | Ga0307410_10022387 | 3300031852 | Bacteria | 3905 |
| 532 | Ga0307410_10112313 | 3300031852 | Unclassified | 1973 |
| 533 | Ga0307410_10170829 | 3300031852 | Bacteria | 1638 |
| 534 | Ga0307410_10317415 | 3300031852 | Bacteria | 1235 |
| 535 | Ga0307410_10761245 | 3300031852 | Bacteria | 821 |
| 536 | Ga0307410_11396949 | 3300031852 | Bacteria | 614 |
| 537 | Ga0307410_11818460 | 3300031852 | Bacteria | 541 |
| 538 | Ga0307406_10007743 | 3300031901 | Bacteria | 5968 |
| 539 | Ga0307406_10034662 | 3300031901 | Bacteria | 3098 |
| 540 | Ga0307406_10092728 | 3300031901 | Bacteria | 2037 |
| 541 | Ga0307406_10232739 | 3300031901 | Bacteria | 1377 |
| 542 | Ga0307406_10289554 | 3300031901 | Bacteria | 1253 |
| 543 | Ga0307406_10430318 | 3300031901 | Bacteria | 1054 |
| 544 | Ga0307406_10745876 | 3300031901 | Bacteria | 821 |
| 545 | Ga0307407_10017774 | 3300031903 | Bacteria | 3578 |
| 546 | Ga0307407_10196823 | 3300031903 | Bacteria | 1347 |
| 547 | Ga0307407_10345067 | 3300031903 | Bacteria | 1053 |
| 548 | Ga0307412_10005721 | 3300031911 | Bacteria | 6989 |
| 549 | Ga0307412_10016709 | 3300031911 | Bacteria | 4377 |
| 550 | Ga0307412_10354522 | 3300031911 | Bacteria | 1179 |
| 551 | Ga0307409_100007252 | 3300031995 | Bacteria | 6612 |
| 552 | Ga0307409_100389195 | 3300031995 | Bacteria | 1328 |
| 553 | Ga0307409_100488427 | 3300031995 | Bacteria | 1196 |
| 554 | Ga0307416_100036010 | 3300032002 | Bacteria | 3789 |
| 555 | Ga0307416_100265469 | 3300032002 | Bacteria | 1681 |
| 556 | Ga0307416_100373631 | 3300032002 | Bacteria | 1453 |
| 557 | Ga0307416_100504941 | 3300032002 | Bacteria | 1274 |
| 558 | Ga0307416_102067088 | 3300032002 | Bacteria | 672 |
| 559 | Ga0307416_102172566 | 3300032002 | Bacteria | 656 |
| 560 | Ga0307414_10112017 | 3300032004 | Bacteria | 2079 |
| 561 | Ga0307414_10239449 | 3300032004 | Bacteria | 1501 |
| 562 | Ga0307414_10480812 | 3300032004 | Bacteria | 1095 |
| 563 | Ga0307414_10558806 | 3300032004 | Bacteria | 1021 |
| 564 | Ga0307414_10698481 | 3300032004 | Bacteria | 918 |
| 565 | Ga0307414_10746344 | 3300032004 | Bacteria | 889 |
| 566 | Ga0307414_11431496 | 3300032004 | Bacteria | 642 |
| 567 | Ga0307411_10049752 | 3300032005 | Bacteria | 2726 |
| 568 | Ga0307411_10053137 | 3300032005 | Bacteria | 2652 |
| 569 | Ga0307411_10102130 | 3300032005 | Bacteria | 2031 |
| 570 | Ga0307411_10131052 | 3300032005 | Bacteria | 1832 |
| 571 | Ga0307411_10147754 | 3300032005 | Bacteria | 1742 |
| 572 | Ga0307411_10186597 | 3300032005 | Bacteria | 1579 |
| 573 | Ga0307411_10839768 | 3300032005 | Bacteria | 812 |
| 574 | Ga0307411_12198582 | 3300032005 | Bacteria | 517 |
| 575 | Ga0307415_100087442 | 3300032126 | Bacteria | 2245 |
| 576 | Ga0307415_100273286 | 3300032126 | Bacteria | 1385 |
| 577 | Ga0307415_100514123 | 3300032126 | Bacteria | 1050 |
| 578 | Ga0307415_101091614 | 3300032126 | Bacteria | 746 |
| 579 | Ga0307415_102141735 | 3300032126 | Bacteria | 546 |
| 580 | Ga0307510_10003850 | 3300033180 | Bacteria | 17591 |
| 581 | Ga0373926_0020391 | 3300035083 | Bacteria | 2290 |
| 582 | Ga0373956_0187113 | 3300035119 | Bacteria | 980 |
| 583 | Ga0373935_1369273 | 3300035692 | Unclassified | 529 |
| 584 | Ga0373927_0004162 | 3300035695 | Bacteria | 10167 |
| 585 | Ga0373927_0016917 | 3300035695 | Bacteria | 4807 |
| 586 | Ga0373927_0389482 | 3300035695 | Bacteria | 919 |
| 587 | Ga0373933_0087586 | 3300035724 | Unclassified | 1918 |
| 588 | Ga0373933_0512951 | 3300035724 | Bacteria | 786 |
| 589 | Ga0373933_1073774 | 3300035724 | Bacteria | 530 |
| 590 | Ga0373937_0254397 | 3300036401 | Bacteria | 1656 |
| 591 | Ga0373925_0190524 | 3300037068 | Bacteria | 1627 |
| 592 | Ga0373925_0212833 | 3300037068 | Unclassified | 1540 |
| 593 | Ga0373925_0415112 | 3300037068 | Bacteria | 1099 |
| 594 | Ga0373925_1113007 | 3300037068 | Bacteria | 650 |
| 595 | Ga0373925_1437416 | 3300037068 | Bacteria | 565 |
| 596 | Ga0395899_0147933 | 3300037312 | Unclassified | 1666 |
| 597 | Ga0395899_0753232 | 3300037312 | Bacteria | 606 |
| 598 | Ga0395900_0153111 | 3300037418 | Unclassified | 2355 |
| 599 | Ga0395900_0318787 | 3300037418 | Bacteria | 1535 |
| 600 | Ga0395900_0532935 | 3300037418 | Bacteria | 1121 |
| 601 | Ga0395900_0869441 | 3300037418 | Bacteria | 826 |
| 602 | Ga0395900_0959049 | 3300037418 | Bacteria | 776 |
| 603 | Ga0395900_1629729 | 3300037418 | Bacteria | 556 |
| 604 | Ga0395898_0041822 | 3300037466 | Plasmid | 4524 |
| 605 | Ga0395898_0172669 | 3300037466 | Bacteria | 2066 |
| 606 | Ga0395898_1562404 | 3300037466 | Bacteria | 585 |
| 607 | Ga0395905_0053030 | 3300037471 | Plasmid | 3796 |
| 608 | Ga0395905_0242760 | 3300037471 | Bacteria | 1683 |
| 609 | Ga0395905_0267775 | 3300037471 | Bacteria | 1594 |
| 610 | Ga0395905_0459661 | 3300037471 | Bacteria | 1171 |
| 611 | Ga0395905_0990870 | 3300037471 | Bacteria | 743 |
| 612 | Ga0436364_1035450 | 3300037853 | Bacteria | 678 |
| 613 | Ga0395901_0019192 | 3300038443 | Bacteria | 6989 |
| 614 | Ga0395901_0363744 | 3300038443 | Bacteria | 1491 |
| 615 | Ga0237819_04260 | 3300038705 | Bacteria | 2376 |
| 616 | Ga0436365_0064527 | 3300039437 | Bacteria | 32229 |
| 617 | Ga0436365_0176077 | 3300039437 | Unclassified | 712 |
| 618 | Ga0436365_0723875 | 3300039437 | Bacteria | 733 |
| 619 | Ga0436363_0849015 | 3300039450 | Bacteria | 1116 |
| 620 | Ga0439466_0279620 | 3300041411 | Bacteria | 506 |
| 621 | Ga0451789_0891629 | 3300041443 | Bacteria | 1054 |
| 622 | Ga0451791_0779858 | 3300041451 | Bacteria | 510 |
| 623 | Ga0451804_0479665 | 3300041463 | Bacteria | 909 |
| 624 | Ga0451807_0589435 | 3300041486 | Unclassified | 1588 |
| 625 | Ga0451837_1865023 | 3300041494 | Unclassified | 546 |
| 626 | Ga0451853_0008946 | 3300041512 | Bacteria | 1510 |
| 627 | Ga0439448_0053507 | 3300042005 | Bacteria | 1325 |
| 628 | Ga0439455_0052303 | 3300042012 | Bacteria | 1069 |
| 629 | Ga0450890_088189 | 3300042127 | Bacteria | 512 |
| 630 | Ga0439446_0021586 | 3300042156 | Bacteria | 1821 |
| 631 | Ga0439458_0094916 | 3300042157 | Bacteria | 770 |
| 632 | Ga0451577_0009474 | 3300042876 | Bacteria | 9374 |
| 633 | Ga0451577_0725838 | 3300042876 | Bacteria | 899 |
| 634 | Ga0453683_0165836 | 3300044673 | Bacteria | 1398 |
| 635 | Ga0453683_0186899 | 3300044673 | Bacteria | 1314 |
| 636 | Ga0453684_0000167 | 3300044712 | Bacteria | 290200 |
| 637 | Ga0453684_0000284 | 3300044712 | Bacteria | 218640 |
| 638 | Ga0451576_0950625 | 3300045051 | Bacteria | 901 |
| 639 | Ga0466967_0312984 | 3300045976 | Bacteria | 1513 |
| 640 | Ga0495629_0606387 | 3300046459 | Bacteria | 732 |
| 641 | Ga0495580_0029698 | 3300046472 | Bacteria | 3966 |
| 642 | Ga0495594_0025607 | 3300046499 | Bacteria | 3171 |
| 643 | Ga0495643_0000307 | 3300046522 | Bacteria | 67608 |
| 644 | Ga0495644_0387208 | 3300046523 | Bacteria | 553 |
| 645 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 646 | Ga0495663_0000501 | 3300046525 | Bacteria | 14104 |
| 647 | Ga0495663_0002001 | 3300046525 | Bacteria | 6266 |
| 648 | Ga0495665_0076666 | 3300046531 | Bacteria | 1760 |
| 649 | Ga0495640_0298038 | 3300046533 | Bacteria | 1002 |
| 650 | Ga0495586_0343417 | 3300046535 | Bacteria | 857 |
| 651 | Ga0495597_0301781 | 3300046542 | Bacteria | 621 |
| 652 | Ga0495668_0017551 | 3300046616 | Bacteria | 4148 |
| 653 | Ga0495634_0207852 | 3300046642 | Bacteria | 1213 |
| 654 | Ga0495625_0025028 | 3300046660 | Bacteria | 4532 |
| 655 | Ga0495625_0124009 | 3300046660 | Bacteria | 1755 |
| 656 | Ga0495669_0287095 | 3300046684 | Bacteria | 792 |
| 657 | Ga0495613_0260187 | 3300046689 | Bacteria | 1209 |
| 658 | Ga0495671_0148001 | 3300046692 | Bacteria | 1143 |
| 659 | Ga0495671_0584912 | 3300046692 | Bacteria | 531 |
| 660 | Ga0495581_0322362 | 3300047315 | Bacteria | 903 |
| 661 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 662 | Ga0495683_0133256 | 3300047323 | Bacteria | 1170 |
| 663 | Ga0495673_0000148 | 3300047469 | Bacteria | 124135 |
| 664 | Ga0495602_0571599 | 3300048088 | Bacteria | 781 |
| 665 | Ga0496100_0246866 | 3300048903 | Bacteria | 1319 |
| 666 | Ga0496104_0041190 | 3300048907 | Bacteria | 4330 |
| 667 | Ga0496106_0110493 | 3300048909 | Bacteria | 2140 |
| 668 | Ga0496109_1150370 | 3300048912 | Bacteria | 713 |
| 669 | Ga0496113_1288444 | 3300048916 | Bacteria | 569 |
| 670 | Ga0496114_0031627 | 3300048917 | Bacteria | 4353 |
| 671 | Ga0496114_0869569 | 3300048917 | Bacteria | 782 |
| 672 | Ga0496115_0182934 | 3300048918 | Bacteria | 1732 |
| 673 | Ga0496122_0006171 | 3300048925 | Bacteria | 13933 |
| 674 | Ga0496123_0001218 | 3300048926 | Bacteria | 37586 |
| 675 | Ga0496124_0298596 | 3300048927 | Bacteria | 1165 |
| 676 | Ga0496124_0650463 | 3300048927 | Bacteria | 677 |
| 677 | Ga0496126_0900073 | 3300048929 | Bacteria | 671 |
| 678 | Ga0501292_111648 | 3300049515 | Unclassified | 551 |
| 679 | Ga0501294_049719 | 3300049517 | Unclassified | 535 |
| 680 | Ga0501298_012219 | 3300049521 | Bacteria | 1503 |
| 681 | Ga0501300_068771 | 3300049523 | Unclassified | 570 |
| 682 | Ga0501032_0126934 | 3300049569 | Bacteria | 1685 |
| 683 | Ga0501033_0153770 | 3300049570 | Bacteria | 1658 |
| 684 | Ga0501034_0514414 | 3300049571 | Bacteria | 1109 |
| 685 | Ga0501038_0130853 | 3300049574 | Bacteria | 2061 |
| 686 | Ga0501039_0541071 | 3300049575 | Bacteria | 914 |
| 687 | Ga0501041_0953380 | 3300049577 | Bacteria | 552 |
| 688 | Ga0501042_0654553 | 3300049578 | Bacteria | 764 |
| 689 | Ga0501043_0254836 | 3300049579 | Bacteria | 1351 |
| 690 | Ga0501043_0406205 | 3300049579 | Bacteria | 1028 |
| 691 | Ga0501046_0024430 | 3300049580 | Bacteria | 4958 |
| 692 | Ga0501047_0046092 | 3300049581 | Bacteria | 4214 |
| 693 | Ga0501047_0320744 | 3300049581 | Bacteria | 1389 |
| 694 | Ga0501070_1551826 | 3300049586 | Bacteria | 500 |
| 695 | Ga0501073_0354632 | 3300049589 | Bacteria | 1013 |
| 696 | Ga0501073_0496053 | 3300049589 | Bacteria | 844 |
| 697 | Ga0501198_012182 | 3300049649 | Unclassified | 1290 |
| 698 | Ga0501202_000394 | 3300049652 | Bacteria | 6087 |
| 699 | Ga0501206_022968 | 3300049653 | Unclassified | 897 |
| 700 | Ga0501208_006031 | 3300049655 | Unclassified | 1523 |
| 701 | Ga0501216_000093 | 3300049660 | Bacteria | 8536 |
| 702 | Ga0501223_023705 | 3300049663 | Unclassified | 1196 |
| 703 | Ga0501224_000292 | 3300049664 | Bacteria | 5787 |
| 704 | Ga0501227_009937 | 3300049665 | Bacteria | 2058 |
| 705 | Ga0501228_003485 | 3300049666 | Unclassified | 1299 |
| 706 | Ga0501233_000355 | 3300049668 | Bacteria | 7160 |
| 707 | Ga0501235_002165 | 3300049669 | Bacteria | 4215 |
| 708 | Ga0501236_004539 | 3300049670 | Unclassified | 1650 |
| 709 | Ga0501239_085233 | 3300049672 | Unclassified | 513 |
| 710 | Ga0501240_003855 | 3300049673 | Bacteria | 1704 |
| 711 | Ga0501242_001847 | 3300049674 | Bacteria | 2177 |
| 712 | Ga0501243_000433 | 3300049675 | Bacteria | 5555 |
| 713 | Ga0501247_002240 | 3300049677 | Bacteria | 1992 |
| 714 | Ga0501249_000835 | 3300049679 | Bacteria | 6807 |
| 715 | Ga0501251_021274 | 3300049681 | Unclassified | 863 |
| 716 | Ga0501252_001093 | 3300049682 | Bacteria | 2400 |
| 717 | Ga0501256_001858 | 3300049685 | Unclassified | 1618 |
| 718 | Ga0501257_007726 | 3300049686 | Bacteria | 2405 |
| 719 | Ga0501259_001036 | 3300049688 | Bacteria | 4628 |
| 720 | Ga0501260_001647 | 3300049689 | Bacteria | 1857 |
| 721 | Ga0501261_000819 | 3300049690 | Bacteria | 3885 |
| 722 | Ga0501219_008694 | 3300049703 | Unclassified | 745 |
| 723 | Ga0501221_000083 | 3300049704 | Bacteria | 10820 |
| 724 | Ga0501225_0002327 | 3300049705 | Bacteria | 5861 |
| 725 | Ga0501229_004951 | 3300049706 | Bacteria | 1626 |
| 726 | Ga0501234_000699 | 3300049707 | Bacteria | 5178 |
| 727 | Ga0501079_0813125 | 3300049741 | Bacteria | 736 |
| 728 | Ga0501080_0007302 | 3300049742 | Bacteria | 9967 |
| 729 | Ga0501080_0099106 | 3300049742 | Bacteria | 2704 |
| 730 | Ga0501081_0266617 | 3300049743 | Bacteria | 1252 |
| 731 | Ga0501083_0008004 | 3300049744 | Bacteria | 7486 |
| 732 | Ga0501083_0493963 | 3300049744 | Bacteria | 797 |
| 733 | Ga0501262_001325 | 3300049759 | Bacteria | 2769 |
| 734 | Ga0501263_000868 | 3300049760 | Bacteria | 2591 |
| 735 | Ga0501266_000368 | 3300049763 | Bacteria | 6009 |
| 736 | Ga0501268_000039 | 3300049765 | Bacteria | 10915 |
| 737 | Ga0501268_159978 | 3300049765 | Bacteria | 525 |
| 738 | Ga0501270_000589 | 3300049767 | Bacteria | 3148 |
| 739 | Ga0501270_108704 | 3300049767 | Bacteria | 589 |
| 740 | Ga0501271_014589 | 3300049768 | Unclassified | 871 |
| 741 | Ga0501274_001615 | 3300049771 | Bacteria | 1728 |
| 742 | Ga0501275_003412 | 3300049772 | Bacteria | 1463 |
| 743 | Ga0501279_000426 | 3300049775 | Bacteria | 5569 |
| 744 | Ga0501035_0575139 | 3300049822 | Bacteria | 920 |
| 745 | Ga0501044_0095748 | 3300049823 | Bacteria | 2991 |
| 746 | Ga0501044_0290252 | 3300049823 | Bacteria | 1567 |
| 747 | Ga0501204_016960 | 3300049850 | Unclassified | 919 |
| 748 | Ga0501212_001054 | 3300049851 | Bacteria | 2994 |
| 749 | nmdc:mga0k408_18214_c1 | 3300050493 | Bacteria | 3918 |
| 750 | nmdc:mga07m45_169690_c1 | 3300050496 | Bacteria | 1268 |
| 751 | nmdc:mga09592_7127_c1 | 3300050508 | Bacteria | 9089 |
| 752 | nmdc:mga0qj67_1240879_c1 | 3300050509 | Bacteria | 579 |
| 753 | nmdc:mga0qj67_2521_c1 | 3300050509 | Bacteria | 13087 |
| 754 | nmdc:mga0qj67_560003_c1 | 3300050509 | Bacteria | 916 |
| 755 | nmdc:mga06r32_1943755_c1 | 3300050510 | Bacteria | 522 |
| 756 | nmdc:mga06r32_233401_c1 | 3300050510 | Bacteria | 1828 |
| 757 | nmdc:mga08y16_1232046_c1 | 3300050511 | Bacteria | 718 |
| 758 | nmdc:mga08y16_1348903_c1 | 3300050511 | Bacteria | 678 |
| 759 | nmdc:mga08x19_523597_c1 | 3300050514 | Bacteria | 838 |
| 760 | Ga0495619_0198291 | 3300053085 | Bacteria | 1390 |
| 761 | Ga0500643_049529 | 3300053087 | Bacteria | 1204 |
| 762 | Ga0500644_0000368 | 3300053088 | Bacteria | 22094 |
| 763 | Ga0500651_0006283 | 3300053093 | Bacteria | 6833 |
| 764 | Ga0500650_0025842 | 3300053098 | Bacteria | 2629 |
| 765 | Ga0500556_0000222 | 3300053104 | Bacteria | 45971 |
| 766 | Ga0500562_017365 | 3300053108 | Bacteria | 1855 |
| 767 | Ga0500597_337681 | 3300053120 | Bacteria | 590 |
| 768 | Ga0500642_0000011 | 3300053130 | Bacteria | 215963 |
| 769 | Ga0500658_0394216 | 3300053134 | Bacteria | 634 |
| 770 | Ga0500564_000200 | 3300053138 | Bacteria | 16311 |
| 771 | Ga0500568_0032237 | 3300053139 | Bacteria | 2156 |
| 772 | Ga0500577_0100378 | 3300053142 | Bacteria | 1182 |
| 773 | Ga0500588_0192502 | 3300053146 | Bacteria | 753 |
| 774 | Ga0500616_0001825 | 3300053153 | Bacteria | 19303 |
| 775 | Ga0500620_024372 | 3300053155 | Bacteria | 1847 |
| 776 | Ga0500627_0428287 | 3300053158 | Bacteria | 560 |
| 777 | Ga0500645_003390 | 3300053730 | Bacteria | 6508 |
| 778 | Ga0500645_221190 | 3300053730 | Bacteria | 507 |
| 779 | Ga0500609_057780 | 3300053731 | Bacteria | 541 |
| 780 | Ga0501084_0627408 | 3300054114 | Bacteria | 908 |
| 781 | Ga0501082_0002676 | 3300060353 | Bacteria | 15565 |
| 782 | Ga0501082_1636570 | 3300060353 | Bacteria | 562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025910 | Ga0207684_10039058 | Ga0207684_100390582 | 67 |
| 2 | 3300025735 | Ga0207713_1030908 | Ga0207713_10309083 | 68 |
| 3 | 3300038705 | Ga0237819_04260 | Ga0237819_04260_2086_2316 | 68 |
| 4 | 3300046522 | Ga0495643_0000307 | Ga0495643_0000307_10092_10322 | 68 |
| 5 | 3300047320 | Ga0495672_0000006 | Ga0495672_0000006_39793_40023 | 68 |
| 6 | 3300005338 | Ga0068868_100348892 | Ga0068868_1003488922 | 69 |
| 7 | 3300005339 | Ga0070660_100168453 | Ga0070660_1001684532 | 69 |
| 8 | 3300005367 | Ga0070667_101946813 | Ga0070667_1019468131 | 69 |
| 9 | 3300005455 | Ga0070663_101560047 | Ga0070663_1015600471 | 69 |
| 10 | 3300005539 | Ga0068853_100162420 | Ga0068853_1001624203 | 69 |
| 11 | 3300005547 | Ga0070693_100960539 | Ga0070693_1009605391 | 69 |
| 12 | 3300005577 | Ga0068857_100768169 | Ga0068857_1007681691 | 69 |
| 13 | 3300006358 | Ga0068871_102390497 | Ga0068871_1023904972 | 69 |
| 14 | 3300009093 | Ga0105240_11210355 | Ga0105240_112103551 | 69 |
| 15 | 3300010375 | Ga0105239_10568164 | Ga0105239_105681642 | 69 |
| 16 | 3300013100 | Ga0157373_10652699 | Ga0157373_106526992 | 69 |
| 17 | 3300013307 | Ga0157372_11194517 | Ga0157372_111945172 | 69 |
| 18 | 3300005290 | Ga0065712_10725522 | Ga0065712_107255222 | 70 |
| 19 | 3300005335 | Ga0070666_10160576 | Ga0070666_101605763 | 70 |
| 20 | 3300005338 | Ga0068868_100269493 | Ga0068868_1002694933 | 70 |
| 21 | 3300005343 | Ga0070687_100313852 | Ga0070687_1003138523 | 70 |
| 22 | 3300005353 | Ga0070669_100007475 | Ga0070669_1000074753 | 70 |
| 23 | 3300005355 | Ga0070671_101626043 | Ga0070671_1016260431 | 70 |
| 24 | 3300005364 | Ga0070673_100519402 | Ga0070673_1005194022 | 70 |
| 25 | 3300005365 | Ga0070688_100047056 | Ga0070688_1000470563 | 70 |
| 26 | 3300005367 | Ga0070667_100397497 | Ga0070667_1003974972 | 70 |
| 27 | 3300005438 | Ga0070701_10056419 | Ga0070701_100564192 | 70 |
| 28 | 3300005441 | Ga0070700_100137718 | Ga0070700_1001377183 | 70 |
| 29 | 3300005468 | Ga0070707_100276737 | Ga0070707_1002767373 | 70 |
| 30 | 3300005471 | Ga0070698_100842955 | Ga0070698_1008429551 | 70 |
| 31 | 3300005543 | Ga0070672_100513187 | Ga0070672_1005131872 | 70 |
| 32 | 3300005548 | Ga0070665_100920963 | Ga0070665_1009209631 | 70 |
| 33 | 3300005549 | Ga0070704_102163481 | Ga0070704_1021634811 | 70 |
| 34 | 3300005617 | Ga0068859_100090103 | Ga0068859_1000901033 | 70 |
| 35 | 3300005617 | Ga0068859_102571272 | Ga0068859_1025712722 | 70 |
| 36 | 3300005618 | Ga0068864_100382497 | Ga0068864_1003824972 | 70 |
| 37 | 3300005719 | Ga0068861_100029019 | Ga0068861_1000290196 | 70 |
| 38 | 3300005841 | Ga0068863_100573618 | Ga0068863_1005736182 | 70 |
| 39 | 3300005842 | Ga0068858_100773715 | Ga0068858_1007737152 | 70 |
| 40 | 3300005843 | Ga0068860_100845949 | Ga0068860_1008459492 | 70 |
| 41 | 3300006163 | Ga0070715_10488034 | Ga0070715_104880342 | 70 |
| 42 | 3300006881 | Ga0068865_100241297 | Ga0068865_1002412972 | 70 |
| 43 | 3300006931 | Ga0097620_100090099 | Ga0097620_1000900993 | 70 |
| 44 | 3300006931 | Ga0097620_102572182 | Ga0097620_1025721822 | 70 |
| 45 | 3300009098 | Ga0105245_11561666 | Ga0105245_115616662 | 70 |
| 46 | 3300009101 | Ga0105247_11559078 | Ga0105247_115590781 | 70 |
| 47 | 3300009101 | Ga0105247_11801490 | Ga0105247_118014902 | 70 |
| 48 | 3300009176 | Ga0105242_10259574 | Ga0105242_102595742 | 70 |
| 49 | 3300009553 | Ga0105249_10170520 | Ga0105249_101705203 | 70 |
| 50 | 3300013306 | Ga0163162_11273815 | Ga0163162_112738152 | 70 |
| 51 | 3300013308 | Ga0157375_10088173 | Ga0157375_100881733 | 70 |
| 52 | 3300013308 | Ga0157375_10596135 | Ga0157375_105961352 | 70 |
| 53 | 3300014325 | Ga0163163_10009985 | Ga0163163_100099856 | 70 |
| 54 | 3300014968 | Ga0157379_10583845 | Ga0157379_105838452 | 70 |
| 55 | 3300014969 | Ga0157376_12847837 | Ga0157376_128478372 | 70 |
| 56 | 3300025900 | Ga0207710_10685502 | Ga0207710_106855022 | 70 |
| 57 | 3300025918 | Ga0207662_10355237 | Ga0207662_103552372 | 70 |
| 58 | 3300025923 | Ga0207681_10096066 | Ga0207681_100960662 | 70 |
| 59 | 3300025931 | Ga0207644_11573722 | Ga0207644_115737222 | 70 |
| 60 | 3300025936 | Ga0207670_10135581 | Ga0207670_101355813 | 70 |
| 61 | 3300025940 | Ga0207691_10408237 | Ga0207691_104082372 | 70 |
| 62 | 3300025942 | Ga0207689_10087967 | Ga0207689_100879673 | 70 |
| 63 | 3300025944 | Ga0207661_10028540 | Ga0207661_100285405 | 70 |
| 64 | 3300025960 | Ga0207651_10442961 | Ga0207651_104429612 | 70 |
| 65 | 3300025961 | Ga0207712_10175655 | Ga0207712_101756552 | 70 |
| 66 | 3300025986 | Ga0207658_10928093 | Ga0207658_109280932 | 70 |
| 67 | 3300026023 | Ga0207677_12308061 | Ga0207677_123080612 | 70 |
| 68 | 3300026075 | Ga0207708_10213897 | Ga0207708_102138972 | 70 |
| 69 | 3300026118 | Ga0207675_100045591 | Ga0207675_1000455915 | 70 |
| 70 | 3300028379 | Ga0268266_10725958 | Ga0268266_107259582 | 70 |
| 71 | 3300028381 | Ga0268264_10394342 | Ga0268264_103943423 | 70 |
| 72 | 3300031731 | Ga0307405_10615295 | Ga0307405_106152952 | 70 |
| 73 | 3300031901 | Ga0307406_10430318 | Ga0307406_104303182 | 70 |
| 74 | 3300032004 | Ga0307414_10558806 | Ga0307414_105588062 | 70 |
| 75 | 3300046533 | Ga0495640_0298038 | Ga0495640_0298038_198_428 | 70 |
| 76 | 3300046535 | Ga0495586_0343417 | Ga0495586_0343417_412_642 | 70 |
| 77 | 3300046642 | Ga0495634_0207852 | Ga0495634_0207852_399_629 | 70 |
| 78 | 3300046689 | Ga0495613_0260187 | Ga0495613_0260187_594_824 | 70 |
| 79 | 3300048903 | Ga0496100_0246866 | Ga0496100_0246866_429_659 | 70 |
| 80 | 3300048907 | Ga0496104_0041190 | Ga0496104_0041190_511_741 | 70 |
| 81 | 3300048909 | Ga0496106_0110493 | Ga0496106_0110493_1495_1725 | 70 |
| 82 | 3300048917 | Ga0496114_0031627 | Ga0496114_0031627_841_1071 | 70 |
| 83 | 3300048918 | Ga0496115_0182934 | Ga0496115_0182934_1063_1293 | 70 |
| 84 | 3300048927 | Ga0496124_0650463 | Ga0496124_0650463_350_634 | 70 |
| 85 | 3300003578 | Ga0006562J51391_1119555 | Ga0006562J51391_11195552 | 71 |
| 86 | 3300003578 | Ga0006562J51391_1119556 | Ga0006562J51391_11195562 | 71 |
| 87 | 3300005445 | Ga0070708_100007994 | Ga0070708_1000079942 | 71 |
| 88 | 3300005466 | Ga0070685_10394697 | Ga0070685_103946972 | 71 |
| 89 | 3300005467 | Ga0070706_100130225 | Ga0070706_1001302254 | 71 |
| 90 | 3300005471 | Ga0070698_100106360 | Ga0070698_1001063604 | 71 |
| 91 | 3300005536 | Ga0070697_100502780 | Ga0070697_1005027802 | 71 |
| 92 | 3300005545 | Ga0070695_101625235 | Ga0070695_1016252351 | 71 |
| 93 | 3300005842 | Ga0068858_101863209 | Ga0068858_1018632092 | 71 |
| 94 | 3300006173 | Ga0070716_101145553 | Ga0070716_1011455532 | 71 |
| 95 | 3300006175 | Ga0070712_100161126 | Ga0070712_1001611264 | 71 |
| 96 | 3300013102 | Ga0157371_10013650 | Ga0157371_100136506 | 71 |
| 97 | 3300013104 | Ga0157370_10012080 | Ga0157370_100120805 | 71 |
| 98 | 3300013105 | Ga0157369_10017322 | Ga0157369_1001732210 | 71 |
| 99 | 3300025910 | Ga0207684_10239548 | Ga0207684_102395483 | 71 |
| 100 | 3300031731 | Ga0307405_10929832 | Ga0307405_109298322 | 71 |
| 101 | 3300031824 | Ga0307413_10264522 | Ga0307413_102645222 | 71 |
| 102 | 3300031824 | Ga0307413_10831296 | Ga0307413_108312962 | 71 |
| 103 | 3300032004 | Ga0307414_10480812 | Ga0307414_104808122 | 71 |
| 104 | 3300032004 | Ga0307414_11431496 | Ga0307414_114314962 | 71 |
| 105 | 3300032005 | Ga0307411_10839768 | Ga0307411_108397682 | 71 |
| 106 | 3300041451 | Ga0451791_0779858 | Ga0451791_0779858_73_312 | 71 |
| 107 | 3300041494 | Ga0451837_1865023 | Ga0451837_1865023_268_498 | 71 |
| 108 | 3300044673 | Ga0453683_0186899 | Ga0453683_0186899_359_589 | 71 |
| 109 | 3300046499 | Ga0495594_0025607 | Ga0495594_0025607_714_947 | 71 |
| 110 | 3300046524 | Ga0495648_0000039 | Ga0495648_0000039_137723_137962 | 71 |
| 111 | 3300046692 | Ga0495671_0584912 | Ga0495671_0584912_48_287 | 71 |
| 112 | 3300047469 | Ga0495673_0000148 | Ga0495673_0000148_91798_92037 | 71 |
| 113 | 3300048916 | Ga0496113_1288444 | Ga0496113_1288444_294_527 | 71 |
| 114 | 3300048925 | Ga0496122_0006171 | Ga0496122_0006171_3936_4175 | 71 |
| 115 | 3300048926 | Ga0496123_0001218 | Ga0496123_0001218_36432_36671 | 71 |
| 116 | 3300048927 | Ga0496124_0298596 | Ga0496124_0298596_53_292 | 71 |
| 117 | 3300053087 | Ga0500643_049529 | Ga0500643_049529_309_548 | 71 |
| 118 | 3300053088 | Ga0500644_0000368 | Ga0500644_0000368_1538_1777 | 71 |
| 119 | 3300053138 | Ga0500564_000200 | Ga0500564_000200_15331_15570 | 71 |
| 120 | 3300003781 | Ga0055536_1006393 | Ga0055536_10063935 | 72 |
| 121 | 3300003794 | Ga0055531_10029761 | Ga0055531_100297611 | 72 |
| 122 | 3300005546 | Ga0070696_101290577 | Ga0070696_1012905772 | 72 |
| 123 | 3300005841 | Ga0068863_100043823 | Ga0068863_1000438232 | 72 |
| 124 | 3300014968 | Ga0157379_11079198 | Ga0157379_110791982 | 72 |
| 125 | 3300025292 | Ga0209676_1000115 | Ga0209676_100011549 | 72 |
| 126 | 3300025298 | Ga0209050_1004487 | Ga0209050_10044874 | 72 |
| 127 | 3300025304 | Ga0209257_1000090 | Ga0209257_100009031 | 72 |
| 128 | 3300026088 | Ga0207641_10406308 | Ga0207641_104063082 | 72 |
| 129 | 3300028800 | Ga0265338_10151853 | Ga0265338_101518534 | 72 |
| 130 | 3300031901 | Ga0307406_10007743 | Ga0307406_100077436 | 72 |
| 131 | 3300042127 | Ga0450890_088189 | Ga0450890_088189_29_262 | 72 |
| 132 | 3300046523 | Ga0495644_0387208 | Ga0495644_0387208_238_483 | 72 |
| 133 | 3300049742 | Ga0501080_0007302 | Ga0501080_0007302_436_687 | 72 |
| 134 | 3300049744 | Ga0501083_0008004 | Ga0501083_0008004_3419_3670 | 72 |
| 135 | 3300053139 | Ga0500568_0032237 | Ga0500568_0032237_479_721 | 72 |
| 136 | 3300060353 | Ga0501082_0002676 | Ga0501082_0002676_1092_1343 | 72 |
| 137 | 3300005295 | Ga0065707_11145933 | Ga0065707_111459332 | 73 |
| 138 | 3300005445 | Ga0070708_100556570 | Ga0070708_1005565701 | 73 |
| 139 | 3300005471 | Ga0070698_100057454 | Ga0070698_1000574544 | 73 |
| 140 | 3300005471 | Ga0070698_100666886 | Ga0070698_1006668862 | 73 |
| 141 | 3300005518 | Ga0070699_100808819 | Ga0070699_1008088192 | 73 |
| 142 | 3300005546 | Ga0070696_101478602 | Ga0070696_1014786022 | 73 |
| 143 | 3300005563 | Ga0068855_100724191 | Ga0068855_1007241912 | 73 |
| 144 | 3300005577 | Ga0068857_100025106 | Ga0068857_1000251066 | 73 |
| 145 | 3300009093 | Ga0105240_10190937 | Ga0105240_101909372 | 73 |
| 146 | 3300013105 | Ga0157369_11622486 | Ga0157369_116224862 | 73 |
| 147 | 3300013307 | Ga0157372_11200813 | Ga0157372_112008132 | 73 |
| 148 | 3300014325 | Ga0163163_12222336 | Ga0163163_122223362 | 73 |
| 149 | 3300014497 | Ga0182008_10907935 | Ga0182008_109079352 | 73 |
| 150 | 3300021377 | Ga0213874_10216528 | Ga0213874_102165282 | 73 |
| 151 | 3300021384 | Ga0213876_10004842 | Ga0213876_100048427 | 73 |
| 152 | 3300025304 | Ga0209257_1069912 | Ga0209257_10699122 | 73 |
| 153 | 3300025913 | Ga0207695_10241589 | Ga0207695_102415893 | 73 |
| 154 | 3300025949 | Ga0207667_10336464 | Ga0207667_103364642 | 73 |
| 155 | 3300026116 | Ga0207674_10031936 | Ga0207674_100319364 | 73 |
| 156 | 3300027471 | Ga0209995_1002705 | Ga0209995_10027055 | 73 |
| 157 | 3300027543 | Ga0209999_1007476 | Ga0209999_10074764 | 73 |
| 158 | 3300027682 | Ga0209971_1040406 | Ga0209971_10404062 | 73 |
| 159 | 3300027717 | Ga0209998_10002536 | Ga0209998_100025366 | 73 |
| 160 | 3300031548 | Ga0307408_100447984 | Ga0307408_1004479842 | 73 |
| 161 | 3300031731 | Ga0307405_10062459 | Ga0307405_100624594 | 73 |
| 162 | 3300031852 | Ga0307410_10112313 | Ga0307410_101123134 | 73 |
| 163 | 3300031901 | Ga0307406_10092728 | Ga0307406_100927282 | 73 |
| 164 | 3300031903 | Ga0307407_10017774 | Ga0307407_100177744 | 73 |
| 165 | 3300031995 | Ga0307409_100007252 | Ga0307409_1000072527 | 73 |
| 166 | 3300032002 | Ga0307416_100265469 | Ga0307416_1002654692 | 73 |
| 167 | 3300032005 | Ga0307411_10102130 | Ga0307411_101021302 | 73 |
| 168 | 3300032126 | Ga0307415_100273286 | Ga0307415_1002732862 | 73 |
| 169 | 3300037418 | Ga0395900_0318787 | Ga0395900_0318787_795_1025 | 73 |
| 170 | 3300037466 | Ga0395898_0172669 | Ga0395898_0172669_1373_1603 | 73 |
| 171 | 3300037853 | Ga0436364_1035450 | Ga0436364_1035450_285_530 | 73 |
| 172 | 3300038443 | Ga0395901_0363744 | Ga0395901_0363744_568_798 | 73 |
| 173 | 3300039437 | Ga0436365_0064527 | Ga0436365_0064527_2200_2445 | 73 |
| 174 | 3300039450 | Ga0436363_0849015 | Ga0436363_0849015_592_837 | 73 |
| 175 | 3300042156 | Ga0439446_0021586 | Ga0439446_0021586_94_339 | 73 |
| 176 | 3300046542 | Ga0495597_0301781 | Ga0495597_0301781_145_384 | 73 |
| 177 | 3300046616 | Ga0495668_0017551 | Ga0495668_0017551_276_515 | 73 |
| 178 | 3300046660 | Ga0495625_0025028 | Ga0495625_0025028_4183_4422 | 73 |
| 179 | 3300046660 | Ga0495625_0124009 | Ga0495625_0124009_1378_1617 | 73 |
| 180 | 3300048929 | Ga0496126_0900073 | Ga0496126_0900073_406_645 | 73 |
| 181 | 3300049515 | Ga0501292_111648 | Ga0501292_111648_138_383 | 73 |
| 182 | 3300049517 | Ga0501294_049719 | Ga0501294_049719_251_496 | 73 |
| 183 | 3300049521 | Ga0501298_012219 | Ga0501298_012219_227_472 | 73 |
| 184 | 3300049523 | Ga0501300_068771 | Ga0501300_068771_146_391 | 73 |
| 185 | 3300049589 | Ga0501073_0496053 | Ga0501073_0496053_588_818 | 73 |
| 186 | 3300049649 | Ga0501198_012182 | Ga0501198_012182_397_642 | 73 |
| 187 | 3300049652 | Ga0501202_000394 | Ga0501202_000394_380_625 | 73 |
| 188 | 3300049653 | Ga0501206_022968 | Ga0501206_022968_73_318 | 73 |
| 189 | 3300049655 | Ga0501208_006031 | Ga0501208_006031_332_577 | 73 |
| 190 | 3300049660 | Ga0501216_000093 | Ga0501216_000093_4192_4437 | 73 |
| 191 | 3300049663 | Ga0501223_023705 | Ga0501223_023705_127_372 | 73 |
| 192 | 3300049664 | Ga0501224_000292 | Ga0501224_000292_1785_2030 | 73 |
| 193 | 3300049665 | Ga0501227_009937 | Ga0501227_009937_1193_1438 | 73 |
| 194 | 3300049666 | Ga0501228_003485 | Ga0501228_003485_397_642 | 73 |
| 195 | 3300049668 | Ga0501233_000355 | Ga0501233_000355_1084_1329 | 73 |
| 196 | 3300049669 | Ga0501235_002165 | Ga0501235_002165_1259_1504 | 73 |
| 197 | 3300049670 | Ga0501236_004539 | Ga0501236_004539_318_563 | 73 |
| 198 | 3300049672 | Ga0501239_085233 | Ga0501239_085233_247_492 | 73 |
| 199 | 3300049673 | Ga0501240_003855 | Ga0501240_003855_551_796 | 73 |
| 200 | 3300049674 | Ga0501242_001847 | Ga0501242_001847_392_637 | 73 |
| 201 | 3300049675 | Ga0501243_000433 | Ga0501243_000433_3372_3617 | 73 |
| 202 | 3300049677 | Ga0501247_002240 | Ga0501247_002240_1041_1286 | 73 |
| 203 | 3300049679 | Ga0501249_000835 | Ga0501249_000835_4223_4468 | 73 |
| 204 | 3300049681 | Ga0501251_021274 | Ga0501251_021274_397_642 | 73 |
| 205 | 3300049682 | Ga0501252_001093 | Ga0501252_001093_944_1189 | 73 |
| 206 | 3300049685 | Ga0501256_001858 | Ga0501256_001858_1247_1492 | 73 |
| 207 | 3300049686 | Ga0501257_007726 | Ga0501257_007726_129_374 | 73 |
| 208 | 3300049688 | Ga0501259_001036 | Ga0501259_001036_1841_2086 | 73 |
| 209 | 3300049689 | Ga0501260_001647 | Ga0501260_001647_854_1099 | 73 |
| 210 | 3300049690 | Ga0501261_000819 | Ga0501261_000819_939_1184 | 73 |
| 211 | 3300049703 | Ga0501219_008694 | Ga0501219_008694_177_422 | 73 |
| 212 | 3300049704 | Ga0501221_000083 | Ga0501221_000083_5908_6153 | 73 |
| 213 | 3300049705 | Ga0501225_0002327 | Ga0501225_0002327_5007_5252 | 73 |
| 214 | 3300049706 | Ga0501229_004951 | Ga0501229_004951_880_1125 | 73 |
| 215 | 3300049707 | Ga0501234_000699 | Ga0501234_000699_4081_4326 | 73 |
| 216 | 3300049741 | Ga0501079_0813125 | Ga0501079_0813125_451_681 | 73 |
| 217 | 3300049759 | Ga0501262_001325 | Ga0501262_001325_632_877 | 73 |
| 218 | 3300049760 | Ga0501263_000868 | Ga0501263_000868_621_866 | 73 |
| 219 | 3300049763 | Ga0501266_000368 | Ga0501266_000368_3888_4133 | 73 |
| 220 | 3300049765 | Ga0501268_000039 | Ga0501268_000039_6532_6777 | 73 |
| 221 | 3300049767 | Ga0501270_000589 | Ga0501270_000589_521_766 | 73 |
| 222 | 3300049768 | Ga0501271_014589 | Ga0501271_014589_582_827 | 73 |
| 223 | 3300049771 | Ga0501274_001615 | Ga0501274_001615_1398_1643 | 73 |
| 224 | 3300049772 | Ga0501275_003412 | Ga0501275_003412_669_914 | 73 |
| 225 | 3300049775 | Ga0501279_000426 | Ga0501279_000426_3486_3731 | 73 |
| 226 | 3300049850 | Ga0501204_016960 | Ga0501204_016960_172_417 | 73 |
| 227 | 3300049851 | Ga0501212_001054 | Ga0501212_001054_664_909 | 73 |
| 228 | 3300050496 | nmdc:mga07m45_169690_c1 | nmdc:mga07m45_169690_c1_854_1093 | 73 |
| 229 | 3300050510 | nmdc:mga06r32_1943755_c1 | nmdc:mga06r32_1943755_c1_267_503 | 73 |
| 230 | 3300053098 | Ga0500650_0025842 | Ga0500650_0025842_2249_2488 | 73 |
| 231 | 3300053104 | Ga0500556_0000222 | Ga0500556_0000222_35220_35459 | 73 |
| 232 | 3300053108 | Ga0500562_017365 | Ga0500562_017365_1510_1749 | 73 |
| 233 | 3300053120 | Ga0500597_337681 | Ga0500597_337681_234_473 | 73 |
| 234 | 3300053130 | Ga0500642_0000011 | Ga0500642_0000011_116314_116553 | 73 |
| 235 | 3300053158 | Ga0500627_0428287 | Ga0500627_0428287_14_253 | 73 |
| 236 | 3300053730 | Ga0500645_003390 | Ga0500645_003390_5349_5588 | 73 |
| 237 | 3300053730 | Ga0500645_221190 | Ga0500645_221190_139_378 | 73 |
| 238 | 3300003320 | rootH2_10160658 | rootH2_101606582 | 74 |
| 239 | 3300003322 | rootL2_10070106 | rootL2_100701061 | 74 |
| 240 | 3300003322 | rootL2_10073661 | rootL2_100736613 | 74 |
| 241 | 3300003322 | rootL2_10091401 | rootL2_100914014 | 74 |
| 242 | 3300003322 | rootL2_10184100 | rootL2_101841004 | 74 |
| 243 | 3300003323 | rootH1_10105934 | rootH1_101059345 | 74 |
| 244 | 3300003323 | rootH1_10383511 | rootH1_103835112 | 74 |
| 245 | 3300003791 | Ga0055530_10036705 | Ga0055530_100367051 | 74 |
| 246 | 3300005327 | Ga0070658_10521310 | Ga0070658_105213101 | 74 |
| 247 | 3300005334 | Ga0068869_100384877 | Ga0068869_1003848771 | 74 |
| 248 | 3300005339 | Ga0070660_100188129 | Ga0070660_1001881293 | 74 |
| 249 | 3300005339 | Ga0070660_101360589 | Ga0070660_1013605891 | 74 |
| 250 | 3300005340 | Ga0070689_100032234 | Ga0070689_1000322342 | 74 |
| 251 | 3300005344 | Ga0070661_100002976 | Ga0070661_10000297613 | 74 |
| 252 | 3300005347 | Ga0070668_100953672 | Ga0070668_1009536722 | 74 |
| 253 | 3300005365 | Ga0070688_100088207 | Ga0070688_1000882072 | 74 |
| 254 | 3300005436 | Ga0070713_100340293 | Ga0070713_1003402933 | 74 |
| 255 | 3300005441 | Ga0070700_100749855 | Ga0070700_1007498552 | 74 |
| 256 | 3300005444 | Ga0070694_100542464 | Ga0070694_1005424642 | 74 |
| 257 | 3300005457 | Ga0070662_101488481 | Ga0070662_1014884812 | 74 |
| 258 | 3300005457 | Ga0070662_102000758 | Ga0070662_1020007581 | 74 |
| 259 | 3300005458 | Ga0070681_10013929 | Ga0070681_1001392911 | 74 |
| 260 | 3300005530 | Ga0070679_100008928 | Ga0070679_1000089289 | 74 |
| 261 | 3300005530 | Ga0070679_100720910 | Ga0070679_1007209103 | 74 |
| 262 | 3300005536 | Ga0070697_101155573 | Ga0070697_1011555732 | 74 |
| 263 | 3300005544 | Ga0070686_101877681 | Ga0070686_1018776811 | 74 |
| 264 | 3300005564 | Ga0070664_101376567 | Ga0070664_1013765672 | 74 |
| 265 | 3300005564 | Ga0070664_101543241 | Ga0070664_1015432411 | 74 |
| 266 | 3300005578 | Ga0068854_100194027 | Ga0068854_1001940272 | 74 |
| 267 | 3300005614 | Ga0068856_100858403 | Ga0068856_1008584031 | 74 |
| 268 | 3300005615 | Ga0070702_100804902 | Ga0070702_1008049021 | 74 |
| 269 | 3300005616 | Ga0068852_102332195 | Ga0068852_1023321952 | 74 |
| 270 | 3300005618 | Ga0068864_100610376 | Ga0068864_1006103762 | 74 |
| 271 | 3300005719 | Ga0068861_100430022 | Ga0068861_1004300222 | 74 |
| 272 | 3300005841 | Ga0068863_100555063 | Ga0068863_1005550632 | 74 |
| 273 | 3300005843 | Ga0068860_100425815 | Ga0068860_1004258152 | 74 |
| 274 | 3300005844 | Ga0068862_100142400 | Ga0068862_1001424004 | 74 |
| 275 | 3300006195 | Ga0075366_10577930 | Ga0075366_105779302 | 74 |
| 276 | 3300006844 | Ga0075428_100113448 | Ga0075428_1001134484 | 74 |
| 277 | 3300006846 | Ga0075430_100854207 | Ga0075430_1008542071 | 74 |
| 278 | 3300006880 | Ga0075429_101955628 | Ga0075429_1019556282 | 74 |
| 279 | 3300006881 | Ga0068865_101036649 | Ga0068865_1010366492 | 74 |
| 280 | 3300009094 | Ga0111539_10050233 | Ga0111539_100502335 | 74 |
| 281 | 3300009094 | Ga0111539_10094115 | Ga0111539_100941153 | 74 |
| 282 | 3300009094 | Ga0111539_10852178 | Ga0111539_108521782 | 74 |
| 283 | 3300009147 | Ga0114129_10363833 | Ga0114129_103638334 | 74 |
| 284 | 3300009147 | Ga0114129_11842004 | Ga0114129_118420042 | 74 |
| 285 | 3300009148 | Ga0105243_12433106 | Ga0105243_124331062 | 74 |
| 286 | 3300009545 | Ga0105237_11490998 | Ga0105237_114909982 | 74 |
| 287 | 3300009545 | Ga0105237_11991015 | Ga0105237_119910151 | 74 |
| 288 | 3300009553 | Ga0105249_10003625 | Ga0105249_100036254 | 74 |
| 289 | 3300009553 | Ga0105249_11103879 | Ga0105249_111038792 | 74 |
| 290 | 3300010375 | Ga0105239_10037431 | Ga0105239_100374314 | 74 |
| 291 | 3300010375 | Ga0105239_10496396 | Ga0105239_104963962 | 74 |
| 292 | 3300011119 | Ga0105246_10567661 | Ga0105246_105676612 | 74 |
| 293 | 3300013100 | Ga0157373_10012335 | Ga0157373_100123356 | 74 |
| 294 | 3300013100 | Ga0157373_10016427 | Ga0157373_100164276 | 74 |
| 295 | 3300013104 | Ga0157370_10062872 | Ga0157370_100628724 | 74 |
| 296 | 3300013296 | Ga0157374_10201392 | Ga0157374_102013922 | 74 |
| 297 | 3300013297 | Ga0157378_10664884 | Ga0157378_106648842 | 74 |
| 298 | 3300013306 | Ga0163162_12224738 | Ga0163162_122247382 | 74 |
| 299 | 3300013307 | Ga0157372_10017454 | Ga0157372_1001745412 | 74 |
| 300 | 3300013307 | Ga0157372_10492078 | Ga0157372_104920782 | 74 |
| 301 | 3300013308 | Ga0157375_10129028 | Ga0157375_101290284 | 74 |
| 302 | 3300013308 | Ga0157375_11819765 | Ga0157375_118197651 | 74 |
| 303 | 3300014969 | Ga0157376_11093024 | Ga0157376_110930241 | 74 |
| 304 | 3300025208 | Ga0209436_100591 | Ga0209436_1005913 | 74 |
| 305 | 3300025284 | Ga0209130_1005113 | Ga0209130_10051132 | 74 |
| 306 | 3300025302 | Ga0207426_1000250 | Ga0207426_100025010 | 74 |
| 307 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005636 | 74 |
| 308 | 3300025711 | Ga0207696_1035889 | Ga0207696_10358893 | 74 |
| 309 | 3300025909 | Ga0207705_10093884 | Ga0207705_100938844 | 74 |
| 310 | 3300025918 | Ga0207662_11371141 | Ga0207662_113711412 | 74 |
| 311 | 3300025936 | Ga0207670_10351922 | Ga0207670_103519222 | 74 |
| 312 | 3300025942 | Ga0207689_10662438 | Ga0207689_106624382 | 74 |
| 313 | 3300025960 | Ga0207651_10547644 | Ga0207651_105476442 | 74 |
| 314 | 3300025972 | Ga0207668_11140859 | Ga0207668_111408592 | 74 |
| 315 | 3300025986 | Ga0207658_11504786 | Ga0207658_115047862 | 74 |
| 316 | 3300026075 | Ga0207708_11001623 | Ga0207708_110016232 | 74 |
| 317 | 3300026088 | Ga0207641_10336755 | Ga0207641_103367553 | 74 |
| 318 | 3300026095 | Ga0207676_11090255 | Ga0207676_110902552 | 74 |
| 319 | 3300026142 | Ga0207698_12001786 | Ga0207698_120017862 | 74 |
| 320 | 3300027907 | Ga0207428_10554248 | Ga0207428_105542481 | 74 |
| 321 | 3300028380 | Ga0268265_10180581 | Ga0268265_101805813 | 74 |
| 322 | 3300030521 | Ga0307511_10000884 | Ga0307511_100008849 | 74 |
| 323 | 3300033180 | Ga0307510_10003850 | Ga0307510_100038508 | 74 |
| 324 | 3300035692 | Ga0373935_1369273 | Ga0373935_1369273_180_434 | 74 |
| 325 | 3300041463 | Ga0451804_0479665 | Ga0451804_0479665_625_864 | 74 |
| 326 | 3300042876 | Ga0451577_0725838 | Ga0451577_0725838_524_754 | 74 |
| 327 | 3300044712 | Ga0453684_0000167 | Ga0453684_0000167_73621_73851 | 74 |
| 328 | 3300046525 | Ga0495663_0000501 | Ga0495663_0000501_4632_4871 | 74 |
| 329 | 3300046525 | Ga0495663_0002001 | Ga0495663_0002001_5905_6144 | 74 |
| 330 | 3300046692 | Ga0495671_0148001 | Ga0495671_0148001_872_1111 | 74 |
| 331 | 3300047323 | Ga0495683_0133256 | Ga0495683_0133256_562_795 | 74 |
| 332 | 3300049765 | Ga0501268_159978 | Ga0501268_159978_274_507 | 74 |
| 333 | 3300050493 | nmdc:mga0k408_18214_c1 | nmdc:mga0k408_18214_c1_1679_1909 | 74 |
| 334 | 3300050511 | nmdc:mga08y16_1232046_c1 | nmdc:mga08y16_1232046_c1_150_398 | 74 |
| 335 | 3300050511 | nmdc:mga08y16_1348903_c1 | nmdc:mga08y16_1348903_c1_74_304 | 74 |
| 336 | 3300053093 | Ga0500651_0006283 | Ga0500651_0006283_3382_3636 | 74 |
| 337 | 3300053134 | Ga0500658_0394216 | Ga0500658_0394216_128_358 | 74 |
| 338 | 3300053142 | Ga0500577_0100378 | Ga0500577_0100378_879_1118 | 74 |
| 339 | 3300053146 | Ga0500588_0192502 | Ga0500588_0192502_263_517 | 74 |
| 340 | 3300053153 | Ga0500616_0001825 | Ga0500616_0001825_12508_12744 | 74 |
| 341 | 3300053155 | Ga0500620_024372 | Ga0500620_024372_1539_1793 | 74 |
| 342 | 3300053731 | Ga0500609_057780 | Ga0500609_057780_182_421 | 74 |
| 343 | 3300054114 | Ga0501084_0627408 | Ga0501084_0627408_162_392 | 74 |
| 344 | 3300001978 | JGI24747J21853_1012191 | JGI24747J21853_10121912 | 75 |
| 345 | 3300005327 | Ga0070658_10159387 | Ga0070658_101593873 | 75 |
| 346 | 3300005328 | Ga0070676_10010398 | Ga0070676_100103987 | 75 |
| 347 | 3300005333 | Ga0070677_10002785 | Ga0070677_100027853 | 75 |
| 348 | 3300005334 | Ga0068869_100182584 | Ga0068869_1001825842 | 75 |
| 349 | 3300005335 | Ga0070666_10005249 | Ga0070666_1000524910 | 75 |
| 350 | 3300005338 | Ga0068868_100018131 | Ga0068868_1000181317 | 75 |
| 351 | 3300005344 | Ga0070661_100601760 | Ga0070661_1006017602 | 75 |
| 352 | 3300005347 | Ga0070668_100016390 | Ga0070668_1000163903 | 75 |
| 353 | 3300005354 | Ga0070675_100015430 | Ga0070675_1000154309 | 75 |
| 354 | 3300005355 | Ga0070671_100035411 | Ga0070671_1000354115 | 75 |
| 355 | 3300005356 | Ga0070674_100021041 | Ga0070674_1000210415 | 75 |
| 356 | 3300005364 | Ga0070673_100234382 | Ga0070673_1002343822 | 75 |
| 357 | 3300005367 | Ga0070667_100034883 | Ga0070667_1000348833 | 75 |
| 358 | 3300005455 | Ga0070663_100265701 | Ga0070663_1002657012 | 75 |
| 359 | 3300005456 | Ga0070678_100012385 | Ga0070678_1000123857 | 75 |
| 360 | 3300005459 | Ga0068867_100016610 | Ga0068867_1000166108 | 75 |
| 361 | 3300005539 | Ga0068853_100019875 | Ga0068853_1000198753 | 75 |
| 362 | 3300005539 | Ga0068853_101168231 | Ga0068853_1011682311 | 75 |
| 363 | 3300005543 | Ga0070672_100017344 | Ga0070672_1000173442 | 75 |
| 364 | 3300005546 | Ga0070696_100040310 | Ga0070696_1000403104 | 75 |
| 365 | 3300005548 | Ga0070665_100335899 | Ga0070665_1003358993 | 75 |
| 366 | 3300005578 | Ga0068854_100250679 | Ga0068854_1002506792 | 75 |
| 367 | 3300005578 | Ga0068854_101181698 | Ga0068854_1011816981 | 75 |
| 368 | 3300005615 | Ga0070702_100261172 | Ga0070702_1002611722 | 75 |
| 369 | 3300005616 | Ga0068852_100032090 | Ga0068852_1000320905 | 75 |
| 370 | 3300005718 | Ga0068866_10280367 | Ga0068866_102803672 | 75 |
| 371 | 3300005719 | Ga0068861_100072938 | Ga0068861_1000729382 | 75 |
| 372 | 3300005834 | Ga0068851_10001553 | Ga0068851_1000155314 | 75 |
| 373 | 3300005840 | Ga0068870_10011808 | Ga0068870_100118082 | 75 |
| 374 | 3300005841 | Ga0068863_100386789 | Ga0068863_1003867892 | 75 |
| 375 | 3300005843 | Ga0068860_100208759 | Ga0068860_1002087592 | 75 |
| 376 | 3300006237 | Ga0097621_100020405 | Ga0097621_1000204053 | 75 |
| 377 | 3300006358 | Ga0068871_100194110 | Ga0068871_1001941102 | 75 |
| 378 | 3300006881 | Ga0068865_100448457 | Ga0068865_1004484572 | 75 |
| 379 | 3300009177 | Ga0105248_10066217 | Ga0105248_100662175 | 75 |
| 380 | 3300011119 | Ga0105246_11557809 | Ga0105246_115578091 | 75 |
| 381 | 3300013296 | Ga0157374_10138601 | Ga0157374_101386014 | 75 |
| 382 | 3300013297 | Ga0157378_10377083 | Ga0157378_103770832 | 75 |
| 383 | 3300013306 | Ga0163162_10134062 | Ga0163162_101340625 | 75 |
| 384 | 3300013308 | Ga0157375_10013745 | Ga0157375_100137452 | 75 |
| 385 | 3300014325 | Ga0163163_11235720 | Ga0163163_112357202 | 75 |
| 386 | 3300014745 | Ga0157377_10647784 | Ga0157377_106477842 | 75 |
| 387 | 3300017792 | Ga0163161_10093594 | Ga0163161_100935944 | 75 |
| 388 | 3300025315 | Ga0207697_10062671 | Ga0207697_100626713 | 75 |
| 389 | 3300025321 | Ga0207656_10036331 | Ga0207656_100363314 | 75 |
| 390 | 3300025893 | Ga0207682_10005081 | Ga0207682_100050818 | 75 |
| 391 | 3300025899 | Ga0207642_10142711 | Ga0207642_101427112 | 75 |
| 392 | 3300025903 | Ga0207680_10198240 | Ga0207680_101982402 | 75 |
| 393 | 3300025907 | Ga0207645_10010784 | Ga0207645_100107842 | 75 |
| 394 | 3300025909 | Ga0207705_10223742 | Ga0207705_102237422 | 75 |
| 395 | 3300025916 | Ga0207663_10155575 | Ga0207663_101555752 | 75 |
| 396 | 3300025919 | Ga0207657_10142104 | Ga0207657_101421041 | 75 |
| 397 | 3300025925 | Ga0207650_10563878 | Ga0207650_105638782 | 75 |
| 398 | 3300025926 | Ga0207659_10299967 | Ga0207659_102999672 | 75 |
| 399 | 3300025928 | Ga0207700_10849582 | Ga0207700_108495822 | 75 |
| 400 | 3300025931 | Ga0207644_10019062 | Ga0207644_100190627 | 75 |
| 401 | 3300025938 | Ga0207704_10235882 | Ga0207704_102358822 | 75 |
| 402 | 3300025940 | Ga0207691_10025812 | Ga0207691_100258127 | 75 |
| 403 | 3300025941 | Ga0207711_10950352 | Ga0207711_109503521 | 75 |
| 404 | 3300025942 | Ga0207689_10180912 | Ga0207689_101809122 | 75 |
| 405 | 3300025960 | Ga0207651_10002810 | Ga0207651_100028102 | 75 |
| 406 | 3300025972 | Ga0207668_10421096 | Ga0207668_104210962 | 75 |
| 407 | 3300025972 | Ga0207668_10898433 | Ga0207668_108984332 | 75 |
| 408 | 3300025981 | Ga0207640_10546922 | Ga0207640_105469222 | 75 |
| 409 | 3300025986 | Ga0207658_11813046 | Ga0207658_118130462 | 75 |
| 410 | 3300026023 | Ga0207677_10019474 | Ga0207677_100194743 | 75 |
| 411 | 3300026035 | Ga0207703_10091401 | Ga0207703_100914013 | 75 |
| 412 | 3300026041 | Ga0207639_10316618 | Ga0207639_103166182 | 75 |
| 413 | 3300026067 | Ga0207678_10085767 | Ga0207678_100857672 | 75 |
| 414 | 3300026088 | Ga0207641_10115119 | Ga0207641_101151192 | 75 |
| 415 | 3300026089 | Ga0207648_10004895 | Ga0207648_1000489518 | 75 |
| 416 | 3300026118 | Ga0207675_100059402 | Ga0207675_1000594022 | 75 |
| 417 | 3300026118 | Ga0207675_100099289 | Ga0207675_1000992895 | 75 |
| 418 | 3300026121 | Ga0207683_10058507 | Ga0207683_100585073 | 75 |
| 419 | 3300026142 | Ga0207698_10246540 | Ga0207698_102465403 | 75 |
| 420 | 3300028379 | Ga0268266_10781781 | Ga0268266_107817812 | 75 |
| 421 | 3300028379 | Ga0268266_10860166 | Ga0268266_108601662 | 75 |
| 422 | 3300028381 | Ga0268264_10019038 | Ga0268264_100190388 | 75 |
| 423 | 3300031824 | Ga0307413_10327888 | Ga0307413_103278882 | 75 |
| 424 | 3300031852 | Ga0307410_10170829 | Ga0307410_101708293 | 75 |
| 425 | 3300031903 | Ga0307407_10345067 | Ga0307407_103450672 | 75 |
| 426 | 3300032002 | Ga0307416_102172566 | Ga0307416_1021725662 | 75 |
| 427 | 3300032005 | Ga0307411_10186597 | Ga0307411_101865972 | 75 |
| 428 | 3300032126 | Ga0307415_102141735 | Ga0307415_1021417352 | 75 |
| 429 | 3300049577 | Ga0501041_0953380 | Ga0501041_0953380_200_436 | 75 |
| 430 | 3300005327 | Ga0070658_10010053 | Ga0070658_100100537 | 76 |
| 431 | 3300005327 | Ga0070658_10030908 | Ga0070658_100309084 | 76 |
| 432 | 3300005336 | Ga0070680_100053130 | Ga0070680_1000531303 | 76 |
| 433 | 3300005339 | Ga0070660_100116819 | Ga0070660_1001168192 | 76 |
| 434 | 3300005344 | Ga0070661_100108162 | Ga0070661_1001081624 | 76 |
| 435 | 3300005347 | Ga0070668_101494269 | Ga0070668_1014942692 | 76 |
| 436 | 3300005354 | Ga0070675_100079115 | Ga0070675_1000791154 | 76 |
| 437 | 3300005456 | Ga0070678_100670259 | Ga0070678_1006702592 | 76 |
| 438 | 3300005530 | Ga0070679_100084368 | Ga0070679_1000843684 | 76 |
| 439 | 3300005535 | Ga0070684_100771932 | Ga0070684_1007719322 | 76 |
| 440 | 3300005548 | Ga0070665_100000177 | Ga0070665_10000017762 | 76 |
| 441 | 3300005548 | Ga0070665_100546294 | Ga0070665_1005462942 | 76 |
| 442 | 3300005563 | Ga0068855_100043739 | Ga0068855_1000437396 | 76 |
| 443 | 3300005616 | Ga0068852_101898609 | Ga0068852_1018986091 | 76 |
| 444 | 3300006175 | Ga0070712_101931974 | Ga0070712_1019319742 | 76 |
| 445 | 3300006237 | Ga0097621_101780000 | Ga0097621_1017800001 | 76 |
| 446 | 3300009093 | Ga0105240_10029957 | Ga0105240_100299577 | 76 |
| 447 | 3300009098 | Ga0105245_10022565 | Ga0105245_100225652 | 76 |
| 448 | 3300009177 | Ga0105248_10030382 | Ga0105248_100303827 | 76 |
| 449 | 3300009551 | Ga0105238_10104954 | Ga0105238_101049542 | 76 |
| 450 | 3300010375 | Ga0105239_10435582 | Ga0105239_104355823 | 76 |
| 451 | 3300014326 | Ga0157380_11169494 | Ga0157380_111694942 | 76 |
| 452 | 3300014969 | Ga0157376_10214649 | Ga0157376_102146494 | 76 |
| 453 | 3300014969 | Ga0157376_12017935 | Ga0157376_120179352 | 76 |
| 454 | 3300025909 | Ga0207705_10003074 | Ga0207705_100030748 | 76 |
| 455 | 3300025909 | Ga0207705_10484386 | Ga0207705_104843862 | 76 |
| 456 | 3300025913 | Ga0207695_10552910 | Ga0207695_105529102 | 76 |
| 457 | 3300025917 | Ga0207660_10193448 | Ga0207660_101934482 | 76 |
| 458 | 3300025919 | Ga0207657_10040675 | Ga0207657_100406753 | 76 |
| 459 | 3300025924 | Ga0207694_10383256 | Ga0207694_103832562 | 76 |
| 460 | 3300025926 | Ga0207659_10061946 | Ga0207659_100619464 | 76 |
| 461 | 3300025927 | Ga0207687_10009501 | Ga0207687_100095017 | 76 |
| 462 | 3300025941 | Ga0207711_10228124 | Ga0207711_102281243 | 76 |
| 463 | 3300025960 | Ga0207651_10553483 | Ga0207651_105534831 | 76 |
| 464 | 3300025986 | Ga0207658_10307905 | Ga0207658_103079053 | 76 |
| 465 | 3300028379 | Ga0268266_10015888 | Ga0268266_100158887 | 76 |
| 466 | 3300028379 | Ga0268266_10467418 | Ga0268266_104674182 | 76 |
| 467 | 3300031235 | Ga0265330_10163408 | Ga0265330_101634082 | 76 |
| 468 | 3300031344 | Ga0265316_10337394 | Ga0265316_103373942 | 76 |
| 469 | 3300031824 | Ga0307413_10346732 | Ga0307413_103467322 | 76 |
| 470 | 3300031901 | Ga0307406_10232739 | Ga0307406_102327393 | 76 |
| 471 | 3300032004 | Ga0307414_10112017 | Ga0307414_101120174 | 76 |
| 472 | 3300032005 | Ga0307411_10147754 | Ga0307411_101477542 | 76 |
| 473 | 3300035083 | Ga0373926_0020391 | Ga0373926_0020391_1849_2115 | 76 |
| 474 | 3300035695 | Ga0373927_0004162 | Ga0373927_0004162_3623_3889 | 76 |
| 475 | 3300035695 | Ga0373927_0389482 | Ga0373927_0389482_534_806 | 76 |
| 476 | 3300037068 | Ga0373925_0212833 | Ga0373925_0212833_849_1115 | 76 |
| 477 | 3300037068 | Ga0373925_1113007 | Ga0373925_1113007_297_569 | 76 |
| 478 | 3300046472 | Ga0495580_0029698 | Ga0495580_0029698_575_847 | 76 |
| 479 | 3300046531 | Ga0495665_0076666 | Ga0495665_0076666_63_335 | 76 |
| 480 | 3300047315 | Ga0495581_0322362 | Ga0495581_0322362_50_322 | 76 |
| 481 | 3300048088 | Ga0495602_0571599 | Ga0495602_0571599_142_414 | 76 |
| 482 | 3300048917 | Ga0496114_0869569 | Ga0496114_0869569_445_717 | 76 |
| 483 | 3300049569 | Ga0501032_0126934 | Ga0501032_0126934_239_472 | 76 |
| 484 | 3300049570 | Ga0501033_0153770 | Ga0501033_0153770_242_475 | 76 |
| 485 | 3300049578 | Ga0501042_0654553 | Ga0501042_0654553_445_702 | 76 |
| 486 | 3300049579 | Ga0501043_0254836 | Ga0501043_0254836_20_253 | 76 |
| 487 | 3300049581 | Ga0501047_0320744 | Ga0501047_0320744_981_1214 | 76 |
| 488 | 3300049586 | Ga0501070_1551826 | Ga0501070_1551826_170_427 | 76 |
| 489 | 3300049743 | Ga0501081_0266617 | Ga0501081_0266617_87_344 | 76 |
| 490 | 3300049823 | Ga0501044_0290252 | Ga0501044_0290252_186_419 | 76 |
| 491 | 3300050514 | nmdc:mga08x19_523597_c1 | nmdc:mga08x19_523597_c1_193_459 | 76 |
| 492 | 3300005293 | Ga0065715_10449225 | Ga0065715_104492252 | 77 |
| 493 | 3300005327 | Ga0070658_10901181 | Ga0070658_109011811 | 77 |
| 494 | 3300005327 | Ga0070658_11199205 | Ga0070658_111992051 | 77 |
| 495 | 3300005328 | Ga0070676_10061929 | Ga0070676_100619292 | 77 |
| 496 | 3300005329 | Ga0070683_100146345 | Ga0070683_1001463452 | 77 |
| 497 | 3300005331 | Ga0070670_100007844 | Ga0070670_1000078449 | 77 |
| 498 | 3300005333 | Ga0070677_10151832 | Ga0070677_101518322 | 77 |
| 499 | 3300005334 | Ga0068869_100250964 | Ga0068869_1002509642 | 77 |
| 500 | 3300005334 | Ga0068869_100710112 | Ga0068869_1007101122 | 77 |
| 501 | 3300005335 | Ga0070666_10000388 | Ga0070666_1000038829 | 77 |
| 502 | 3300005344 | Ga0070661_100005691 | Ga0070661_1000056916 | 77 |
| 503 | 3300005344 | Ga0070661_100678884 | Ga0070661_1006788842 | 77 |
| 504 | 3300005353 | Ga0070669_100077191 | Ga0070669_1000771913 | 77 |
| 505 | 3300005354 | Ga0070675_100040566 | Ga0070675_1000405663 | 77 |
| 506 | 3300005355 | Ga0070671_100102643 | Ga0070671_1001026433 | 77 |
| 507 | 3300005356 | Ga0070674_100522718 | Ga0070674_1005227182 | 77 |
| 508 | 3300005356 | Ga0070674_100531266 | Ga0070674_1005312662 | 77 |
| 509 | 3300005364 | Ga0070673_100552015 | Ga0070673_1005520152 | 77 |
| 510 | 3300005366 | Ga0070659_100343086 | Ga0070659_1003430862 | 77 |
| 511 | 3300005439 | Ga0070711_100048957 | Ga0070711_1000489573 | 77 |
| 512 | 3300005457 | Ga0070662_100040247 | Ga0070662_1000402473 | 77 |
| 513 | 3300005458 | Ga0070681_10019453 | Ga0070681_100194536 | 77 |
| 514 | 3300005459 | Ga0068867_100067192 | Ga0068867_1000671923 | 77 |
| 515 | 3300005459 | Ga0068867_100130323 | Ga0068867_1001303232 | 77 |
| 516 | 3300005530 | Ga0070679_100008268 | Ga0070679_1000082684 | 77 |
| 517 | 3300005530 | Ga0070679_100213471 | Ga0070679_1002134713 | 77 |
| 518 | 3300005530 | Ga0070679_102127708 | Ga0070679_1021277081 | 77 |
| 519 | 3300005535 | Ga0070684_100095266 | Ga0070684_1000952663 | 77 |
| 520 | 3300005535 | Ga0070684_100178542 | Ga0070684_1001785422 | 77 |
| 521 | 3300005535 | Ga0070684_100543603 | Ga0070684_1005436032 | 77 |
| 522 | 3300005539 | Ga0068853_101299531 | Ga0068853_1012995312 | 77 |
| 523 | 3300005543 | Ga0070672_100043660 | Ga0070672_1000436603 | 77 |
| 524 | 3300005563 | Ga0068855_100014514 | Ga0068855_1000145145 | 77 |
| 525 | 3300005564 | Ga0070664_100010339 | Ga0070664_1000103397 | 77 |
| 526 | 3300005564 | Ga0070664_100036054 | Ga0070664_1000360544 | 77 |
| 527 | 3300005577 | Ga0068857_100026776 | Ga0068857_1000267764 | 77 |
| 528 | 3300005615 | Ga0070702_100713622 | Ga0070702_1007136222 | 77 |
| 529 | 3300005618 | Ga0068864_100372874 | Ga0068864_1003728741 | 77 |
| 530 | 3300005618 | Ga0068864_100533065 | Ga0068864_1005330652 | 77 |
| 531 | 3300005834 | Ga0068851_10184408 | Ga0068851_101844082 | 77 |
| 532 | 3300005840 | Ga0068870_10073800 | Ga0068870_100738002 | 77 |
| 533 | 3300005841 | Ga0068863_101153254 | Ga0068863_1011532541 | 77 |
| 534 | 3300005844 | Ga0068862_100309311 | Ga0068862_1003093112 | 77 |
| 535 | 3300005844 | Ga0068862_101111238 | Ga0068862_1011112382 | 77 |
| 536 | 3300006028 | Ga0070717_11225474 | Ga0070717_112254742 | 77 |
| 537 | 3300006175 | Ga0070712_100403729 | Ga0070712_1004037292 | 77 |
| 538 | 3300006358 | Ga0068871_100311048 | Ga0068871_1003110483 | 77 |
| 539 | 3300009093 | Ga0105240_12104156 | Ga0105240_121041561 | 77 |
| 540 | 3300009098 | Ga0105245_10252924 | Ga0105245_102529243 | 77 |
| 541 | 3300009098 | Ga0105245_11594150 | Ga0105245_115941502 | 77 |
| 542 | 3300009176 | Ga0105242_10159824 | Ga0105242_101598243 | 77 |
| 543 | 3300009177 | Ga0105248_11317800 | Ga0105248_113178002 | 77 |
| 544 | 3300009545 | Ga0105237_12708781 | Ga0105237_127087812 | 77 |
| 545 | 3300009551 | Ga0105238_10290479 | Ga0105238_102904793 | 77 |
| 546 | 3300011119 | Ga0105246_10445516 | Ga0105246_104455161 | 77 |
| 547 | 3300013104 | Ga0157370_10014613 | Ga0157370_100146132 | 77 |
| 548 | 3300013296 | Ga0157374_10628085 | Ga0157374_106280852 | 77 |
| 549 | 3300013297 | Ga0157378_10477006 | Ga0157378_104770063 | 77 |
| 550 | 3300013297 | Ga0157378_11529829 | Ga0157378_115298292 | 77 |
| 551 | 3300013308 | Ga0157375_10682173 | Ga0157375_106821732 | 77 |
| 552 | 3300014326 | Ga0157380_13237887 | Ga0157380_132378872 | 77 |
| 553 | 3300025315 | Ga0207697_10316523 | Ga0207697_103165232 | 77 |
| 554 | 3300025321 | Ga0207656_10117704 | Ga0207656_101177043 | 77 |
| 555 | 3300025893 | Ga0207682_10279690 | Ga0207682_102796902 | 77 |
| 556 | 3300025898 | Ga0207692_10233387 | Ga0207692_102333871 | 77 |
| 557 | 3300025901 | Ga0207688_10124271 | Ga0207688_101242713 | 77 |
| 558 | 3300025903 | Ga0207680_10000227 | Ga0207680_1000022711 | 77 |
| 559 | 3300025905 | Ga0207685_10125684 | Ga0207685_101256842 | 77 |
| 560 | 3300025907 | Ga0207645_10178830 | Ga0207645_101788302 | 77 |
| 561 | 3300025908 | Ga0207643_10211443 | Ga0207643_102114432 | 77 |
| 562 | 3300025909 | Ga0207705_11275934 | Ga0207705_112759342 | 77 |
| 563 | 3300025912 | Ga0207707_10013978 | Ga0207707_100139782 | 77 |
| 564 | 3300025914 | Ga0207671_10545019 | Ga0207671_105450192 | 77 |
| 565 | 3300025915 | Ga0207693_10051226 | Ga0207693_100512263 | 77 |
| 566 | 3300025917 | Ga0207660_10533355 | Ga0207660_105333552 | 77 |
| 567 | 3300025918 | Ga0207662_10553977 | Ga0207662_105539772 | 77 |
| 568 | 3300025920 | Ga0207649_10082851 | Ga0207649_100828512 | 77 |
| 569 | 3300025920 | Ga0207649_10659789 | Ga0207649_106597892 | 77 |
| 570 | 3300025921 | Ga0207652_10613757 | Ga0207652_106137572 | 77 |
| 571 | 3300025921 | Ga0207652_11886901 | Ga0207652_118869012 | 77 |
| 572 | 3300025923 | Ga0207681_10014242 | Ga0207681_100142423 | 77 |
| 573 | 3300025925 | Ga0207650_10020128 | Ga0207650_100201283 | 77 |
| 574 | 3300025925 | Ga0207650_10110115 | Ga0207650_101101152 | 77 |
| 575 | 3300025926 | Ga0207659_10027515 | Ga0207659_100275153 | 77 |
| 576 | 3300025927 | Ga0207687_10471931 | Ga0207687_104719312 | 77 |
| 577 | 3300025928 | Ga0207700_10913738 | Ga0207700_109137382 | 77 |
| 578 | 3300025933 | Ga0207706_10120564 | Ga0207706_101205643 | 77 |
| 579 | 3300025934 | Ga0207686_10580891 | Ga0207686_105808911 | 77 |
| 580 | 3300025937 | Ga0207669_10074303 | Ga0207669_100743032 | 77 |
| 581 | 3300025940 | Ga0207691_10005468 | Ga0207691_100054683 | 77 |
| 582 | 3300025942 | Ga0207689_10822918 | Ga0207689_108229182 | 77 |
| 583 | 3300025944 | Ga0207661_10101708 | Ga0207661_101017082 | 77 |
| 584 | 3300025945 | Ga0207679_10002235 | Ga0207679_100022356 | 77 |
| 585 | 3300025945 | Ga0207679_10024575 | Ga0207679_100245753 | 77 |
| 586 | 3300025949 | Ga0207667_10037886 | Ga0207667_100378862 | 77 |
| 587 | 3300025960 | Ga0207651_10070960 | Ga0207651_100709603 | 77 |
| 588 | 3300026078 | Ga0207702_11043188 | Ga0207702_110431882 | 77 |
| 589 | 3300026088 | Ga0207641_10858299 | Ga0207641_108582992 | 77 |
| 590 | 3300026089 | Ga0207648_10084074 | Ga0207648_100840743 | 77 |
| 591 | 3300026089 | Ga0207648_10088136 | Ga0207648_100881363 | 77 |
| 592 | 3300026095 | Ga0207676_10325585 | Ga0207676_103255853 | 77 |
| 593 | 3300026095 | Ga0207676_10482354 | Ga0207676_104823543 | 77 |
| 594 | 3300026116 | Ga0207674_10001732 | Ga0207674_100017323 | 77 |
| 595 | 3300026121 | Ga0207683_10232456 | Ga0207683_102324562 | 77 |
| 596 | 3300028380 | Ga0268265_10392743 | Ga0268265_103927432 | 77 |
| 597 | 3300028380 | Ga0268265_10923291 | Ga0268265_109232912 | 77 |
| 598 | 3300031548 | Ga0307408_100399732 | Ga0307408_1003997324 | 77 |
| 599 | 3300035724 | Ga0373933_0087586 | Ga0373933_0087586_1531_1812 | 77 |
| 600 | 3300037068 | Ga0373925_1437416 | Ga0373925_1437416_121_408 | 77 |
| 601 | 3300037418 | Ga0395900_1629729 | Ga0395900_1629729_156_389 | 77 |
| 602 | 3300037471 | Ga0395905_0990870 | Ga0395905_0990870_218_451 | 77 |
| 603 | 3300041443 | Ga0451789_0891629 | Ga0451789_0891629_611_868 | 77 |
| 604 | 3300041486 | Ga0451807_0589435 | Ga0451807_0589435_878_1135 | 77 |
| 605 | 3300042876 | Ga0451577_0009474 | Ga0451577_0009474_5937_6188 | 77 |
| 606 | 3300044673 | Ga0453683_0165836 | Ga0453683_0165836_599_850 | 77 |
| 607 | 3300044712 | Ga0453684_0000284 | Ga0453684_0000284_141818_142069 | 77 |
| 608 | 3300045051 | Ga0451576_0950625 | Ga0451576_0950625_189_440 | 77 |
| 609 | 3300001904 | JGI24736J21556_1052156 | JGI24736J21556_10521562 | 78 |
| 610 | 3300001989 | JGI24739J22299_10048843 | JGI24739J22299_100488432 | 78 |
| 611 | 3300001989 | JGI24739J22299_10194073 | JGI24739J22299_101940732 | 78 |
| 612 | 3300002126 | JGI24035J26624_1005731 | JGI24035J26624_10057312 | 78 |
| 613 | 3300003203 | JGI25406J46586_10069815 | JGI25406J46586_100698152 | 78 |
| 614 | 3300005328 | Ga0070676_10414761 | Ga0070676_104147612 | 78 |
| 615 | 3300005330 | Ga0070690_100143048 | Ga0070690_1001430481 | 78 |
| 616 | 3300005331 | Ga0070670_100014544 | Ga0070670_1000145446 | 78 |
| 617 | 3300005337 | Ga0070682_100953854 | Ga0070682_1009538541 | 78 |
| 618 | 3300005338 | Ga0068868_100417975 | Ga0068868_1004179752 | 78 |
| 619 | 3300005339 | Ga0070660_100442553 | Ga0070660_1004425531 | 78 |
| 620 | 3300005340 | Ga0070689_100202779 | Ga0070689_1002027793 | 78 |
| 621 | 3300005344 | Ga0070661_100275393 | Ga0070661_1002753932 | 78 |
| 622 | 3300005353 | Ga0070669_100706011 | Ga0070669_1007060112 | 78 |
| 623 | 3300005353 | Ga0070669_101694824 | Ga0070669_1016948242 | 78 |
| 624 | 3300005354 | Ga0070675_100340640 | Ga0070675_1003406402 | 78 |
| 625 | 3300005364 | Ga0070673_100744826 | Ga0070673_1007448261 | 78 |
| 626 | 3300005364 | Ga0070673_101281039 | Ga0070673_1012810392 | 78 |
| 627 | 3300005366 | Ga0070659_100066587 | Ga0070659_1000665874 | 78 |
| 628 | 3300005366 | Ga0070659_100480995 | Ga0070659_1004809953 | 78 |
| 629 | 3300005366 | Ga0070659_101133068 | Ga0070659_1011330681 | 78 |
| 630 | 3300005435 | Ga0070714_101093563 | Ga0070714_1010935632 | 78 |
| 631 | 3300005441 | Ga0070700_101021707 | Ga0070700_1010217072 | 78 |
| 632 | 3300005530 | Ga0070679_100656327 | Ga0070679_1006563272 | 78 |
| 633 | 3300005543 | Ga0070672_100240776 | Ga0070672_1002407763 | 78 |
| 634 | 3300005546 | Ga0070696_101773459 | Ga0070696_1017734591 | 78 |
| 635 | 3300005564 | Ga0070664_101384068 | Ga0070664_1013840682 | 78 |
| 636 | 3300005616 | Ga0068852_101351117 | Ga0068852_1013511172 | 78 |
| 637 | 3300005616 | Ga0068852_101791592 | Ga0068852_1017915922 | 78 |
| 638 | 3300005617 | Ga0068859_100021389 | Ga0068859_1000213894 | 78 |
| 639 | 3300005617 | Ga0068859_100128919 | Ga0068859_1001289192 | 78 |
| 640 | 3300005617 | Ga0068859_100447557 | Ga0068859_1004475573 | 78 |
| 641 | 3300005617 | Ga0068859_102018840 | Ga0068859_1020188402 | 78 |
| 642 | 3300005618 | Ga0068864_101197152 | Ga0068864_1011971522 | 78 |
| 643 | 3300005834 | Ga0068851_10205708 | Ga0068851_102057082 | 78 |
| 644 | 3300005841 | Ga0068863_102707564 | Ga0068863_1027075642 | 78 |
| 645 | 3300005842 | Ga0068858_100548365 | Ga0068858_1005483652 | 78 |
| 646 | 3300005843 | Ga0068860_100193418 | Ga0068860_1001934184 | 78 |
| 647 | 3300005843 | Ga0068860_102153611 | Ga0068860_1021536112 | 78 |
| 648 | 3300005985 | Ga0081539_10012496 | Ga0081539_100124966 | 78 |
| 649 | 3300006880 | Ga0075429_100011858 | Ga0075429_1000118585 | 78 |
| 650 | 3300006931 | Ga0097620_100021389 | Ga0097620_1000213894 | 78 |
| 651 | 3300006931 | Ga0097620_100128925 | Ga0097620_1001289252 | 78 |
| 652 | 3300006931 | Ga0097620_100447609 | Ga0097620_1004476093 | 78 |
| 653 | 3300009098 | Ga0105245_12273977 | Ga0105245_122739771 | 78 |
| 654 | 3300009101 | Ga0105247_10157761 | Ga0105247_101577613 | 78 |
| 655 | 3300009101 | Ga0105247_10918100 | Ga0105247_109181002 | 78 |
| 656 | 3300009177 | Ga0105248_10729908 | Ga0105248_107299083 | 78 |
| 657 | 3300013100 | Ga0157373_10023871 | Ga0157373_100238715 | 78 |
| 658 | 3300013100 | Ga0157373_10042879 | Ga0157373_100428793 | 78 |
| 659 | 3300014326 | Ga0157380_10034947 | Ga0157380_100349473 | 78 |
| 660 | 3300014497 | Ga0182008_10014455 | Ga0182008_100144556 | 78 |
| 661 | 3300014968 | Ga0157379_11240199 | Ga0157379_112401991 | 78 |
| 662 | 3300021384 | Ga0213876_10554949 | Ga0213876_105549492 | 78 |
| 663 | 3300025898 | Ga0207692_10243665 | Ga0207692_102436653 | 78 |
| 664 | 3300025900 | Ga0207710_10201828 | Ga0207710_102018282 | 78 |
| 665 | 3300025903 | Ga0207680_10941264 | Ga0207680_109412642 | 78 |
| 666 | 3300025904 | Ga0207647_10008681 | Ga0207647_1000868110 | 78 |
| 667 | 3300025907 | Ga0207645_10328983 | Ga0207645_103289832 | 78 |
| 668 | 3300025909 | Ga0207705_10289774 | Ga0207705_102897743 | 78 |
| 669 | 3300025916 | Ga0207663_11557363 | Ga0207663_115573632 | 78 |
| 670 | 3300025918 | Ga0207662_10739076 | Ga0207662_107390762 | 78 |
| 671 | 3300025919 | Ga0207657_10092704 | Ga0207657_100927044 | 78 |
| 672 | 3300025919 | Ga0207657_10339567 | Ga0207657_103395672 | 78 |
| 673 | 3300025923 | Ga0207681_10804635 | Ga0207681_108046351 | 78 |
| 674 | 3300025923 | Ga0207681_11343244 | Ga0207681_113432441 | 78 |
| 675 | 3300025925 | Ga0207650_10035826 | Ga0207650_100358265 | 78 |
| 676 | 3300025927 | Ga0207687_11547132 | Ga0207687_115471322 | 78 |
| 677 | 3300025929 | Ga0207664_11128272 | Ga0207664_111282722 | 78 |
| 678 | 3300025931 | Ga0207644_10440092 | Ga0207644_104400922 | 78 |
| 679 | 3300025932 | Ga0207690_10066972 | Ga0207690_100669722 | 78 |
| 680 | 3300025932 | Ga0207690_10120461 | Ga0207690_101204611 | 78 |
| 681 | 3300025934 | Ga0207686_10094263 | Ga0207686_100942633 | 78 |
| 682 | 3300025936 | Ga0207670_10391126 | Ga0207670_103911263 | 78 |
| 683 | 3300025937 | Ga0207669_11903602 | Ga0207669_119036022 | 78 |
| 684 | 3300025941 | Ga0207711_10512926 | Ga0207711_105129263 | 78 |
| 685 | 3300025960 | Ga0207651_10972556 | Ga0207651_109725562 | 78 |
| 686 | 3300025986 | Ga0207658_11960268 | Ga0207658_119602682 | 78 |
| 687 | 3300026089 | Ga0207648_10487089 | Ga0207648_104870893 | 78 |
| 688 | 3300026095 | Ga0207676_11479470 | Ga0207676_114794702 | 78 |
| 689 | 3300026095 | Ga0207676_12163251 | Ga0207676_121632512 | 78 |
| 690 | 3300026142 | Ga0207698_10453810 | Ga0207698_104538102 | 78 |
| 691 | 3300026142 | Ga0207698_11197878 | Ga0207698_111978782 | 78 |
| 692 | 3300027364 | Ga0209967_1052926 | Ga0209967_10529262 | 78 |
| 693 | 3300027876 | Ga0209974_10003157 | Ga0209974_100031573 | 78 |
| 694 | 3300028380 | Ga0268265_11210242 | Ga0268265_112102421 | 78 |
| 695 | 3300030742 | Ga0316183_1007432 | Ga0316183_10074325 | 78 |
| 696 | 3300030745 | Ga0316182_1130225 | Ga0316182_11302254 | 78 |
| 697 | 3300031548 | Ga0307408_100026639 | Ga0307408_1000266393 | 78 |
| 698 | 3300031548 | Ga0307408_100478895 | Ga0307408_1004788952 | 78 |
| 699 | 3300031731 | Ga0307405_10008856 | Ga0307405_100088563 | 78 |
| 700 | 3300031731 | Ga0307405_10027639 | Ga0307405_100276394 | 78 |
| 701 | 3300031731 | Ga0307405_10146378 | Ga0307405_101463782 | 78 |
| 702 | 3300031731 | Ga0307405_10849367 | Ga0307405_108493672 | 78 |
| 703 | 3300031824 | Ga0307413_10122289 | Ga0307413_101222891 | 78 |
| 704 | 3300031824 | Ga0307413_10616073 | Ga0307413_106160732 | 78 |
| 705 | 3300031852 | Ga0307410_10022387 | Ga0307410_100223872 | 78 |
| 706 | 3300031852 | Ga0307410_10317415 | Ga0307410_103174152 | 78 |
| 707 | 3300031852 | Ga0307410_10761245 | Ga0307410_107612451 | 78 |
| 708 | 3300031852 | Ga0307410_11396949 | Ga0307410_113969491 | 78 |
| 709 | 3300031852 | Ga0307410_11818460 | Ga0307410_118184602 | 78 |
| 710 | 3300031901 | Ga0307406_10034662 | Ga0307406_100346624 | 78 |
| 711 | 3300031901 | Ga0307406_10289554 | Ga0307406_102895542 | 78 |
| 712 | 3300031901 | Ga0307406_10745876 | Ga0307406_107458762 | 78 |
| 713 | 3300031903 | Ga0307407_10196823 | Ga0307407_101968232 | 78 |
| 714 | 3300031911 | Ga0307412_10005721 | Ga0307412_100057217 | 78 |
| 715 | 3300031911 | Ga0307412_10016709 | Ga0307412_100167094 | 78 |
| 716 | 3300031911 | Ga0307412_10354522 | Ga0307412_103545222 | 78 |
| 717 | 3300031995 | Ga0307409_100389195 | Ga0307409_1003891952 | 78 |
| 718 | 3300031995 | Ga0307409_100488427 | Ga0307409_1004884271 | 78 |
| 719 | 3300032002 | Ga0307416_100036010 | Ga0307416_1000360103 | 78 |
| 720 | 3300032002 | Ga0307416_100373631 | Ga0307416_1003736311 | 78 |
| 721 | 3300032002 | Ga0307416_100504941 | Ga0307416_1005049413 | 78 |
| 722 | 3300032002 | Ga0307416_102067088 | Ga0307416_1020670882 | 78 |
| 723 | 3300032004 | Ga0307414_10239449 | Ga0307414_102394493 | 78 |
| 724 | 3300032004 | Ga0307414_10698481 | Ga0307414_106984811 | 78 |
| 725 | 3300032004 | Ga0307414_10746344 | Ga0307414_107463442 | 78 |
| 726 | 3300032005 | Ga0307411_10049752 | Ga0307411_100497524 | 78 |
| 727 | 3300032005 | Ga0307411_10053137 | Ga0307411_100531372 | 78 |
| 728 | 3300032005 | Ga0307411_10131052 | Ga0307411_101310524 | 78 |
| 729 | 3300032005 | Ga0307411_12198582 | Ga0307411_121985822 | 78 |
| 730 | 3300032126 | Ga0307415_100087442 | Ga0307415_1000874423 | 78 |
| 731 | 3300032126 | Ga0307415_100514123 | Ga0307415_1005141232 | 78 |
| 732 | 3300032126 | Ga0307415_101091614 | Ga0307415_1010916142 | 78 |
| 733 | 3300035119 | Ga0373956_0187113 | Ga0373956_0187113_525_773 | 78 |
| 734 | 3300035695 | Ga0373927_0016917 | Ga0373927_0016917_2209_2445 | 78 |
| 735 | 3300035724 | Ga0373933_0512951 | Ga0373933_0512951_316_564 | 78 |
| 736 | 3300035724 | Ga0373933_1073774 | Ga0373933_1073774_229_477 | 78 |
| 737 | 3300036401 | Ga0373937_0254397 | Ga0373937_0254397_973_1221 | 78 |
| 738 | 3300037068 | Ga0373925_0190524 | Ga0373925_0190524_113_349 | 78 |
| 739 | 3300037068 | Ga0373925_0415112 | Ga0373925_0415112_45_305 | 78 |
| 740 | 3300037312 | Ga0395899_0147933 | Ga0395899_0147933_243_479 | 78 |
| 741 | 3300037312 | Ga0395899_0753232 | Ga0395899_0753232_159_398 | 78 |
| 742 | 3300037418 | Ga0395900_0153111 | Ga0395900_0153111_2066_2302 | 78 |
| 743 | 3300037418 | Ga0395900_0532935 | Ga0395900_0532935_483_722 | 78 |
| 744 | 3300037418 | Ga0395900_0869441 | Ga0395900_0869441_448_684 | 78 |
| 745 | 3300037418 | Ga0395900_0959049 | Ga0395900_0959049_96_332 | 78 |
| 746 | 3300037466 | Ga0395898_0041822 | Ga0395898_0041822_1654_1890 | 78 |
| 747 | 3300037466 | Ga0395898_1562404 | Ga0395898_1562404_118_357 | 78 |
| 748 | 3300037471 | Ga0395905_0053030 | Ga0395905_0053030_1962_2198 | 78 |
| 749 | 3300037471 | Ga0395905_0242760 | Ga0395905_0242760_692_931 | 78 |
| 750 | 3300037471 | Ga0395905_0267775 | Ga0395905_0267775_750_986 | 78 |
| 751 | 3300037471 | Ga0395905_0459661 | Ga0395905_0459661_377_613 | 78 |
| 752 | 3300038443 | Ga0395901_0019192 | Ga0395901_0019192_5098_5334 | 78 |
| 753 | 3300039437 | Ga0436365_0176077 | Ga0436365_0176077_268_504 | 78 |
| 754 | 3300039437 | Ga0436365_0723875 | Ga0436365_0723875_398_646 | 78 |
| 755 | 3300041411 | Ga0439466_0279620 | Ga0439466_0279620_216_452 | 78 |
| 756 | 3300041512 | Ga0451853_0008946 | Ga0451853_0008946_493_729 | 78 |
| 757 | 3300042005 | Ga0439448_0053507 | Ga0439448_0053507_481_729 | 78 |
| 758 | 3300042012 | Ga0439455_0052303 | Ga0439455_0052303_751_999 | 78 |
| 759 | 3300042157 | Ga0439458_0094916 | Ga0439458_0094916_487_735 | 78 |
| 760 | 3300045976 | Ga0466967_0312984 | Ga0466967_0312984_206_442 | 78 |
| 761 | 3300046459 | Ga0495629_0606387 | Ga0495629_0606387_267_515 | 78 |
| 762 | 3300046684 | Ga0495669_0287095 | Ga0495669_0287095_494_730 | 78 |
| 763 | 3300048912 | Ga0496109_1150370 | Ga0496109_1150370_375_629 | 78 |
| 764 | 3300049571 | Ga0501034_0514414 | Ga0501034_0514414_449_685 | 78 |
| 765 | 3300049574 | Ga0501038_0130853 | Ga0501038_0130853_524_760 | 78 |
| 766 | 3300049575 | Ga0501039_0541071 | Ga0501039_0541071_412_648 | 78 |
| 767 | 3300049579 | Ga0501043_0406205 | Ga0501043_0406205_657_893 | 78 |
| 768 | 3300049580 | Ga0501046_0024430 | Ga0501046_0024430_2515_2751 | 78 |
| 769 | 3300049581 | Ga0501047_0046092 | Ga0501047_0046092_213_449 | 78 |
| 770 | 3300049589 | Ga0501073_0354632 | Ga0501073_0354632_563_799 | 78 |
| 771 | 3300049742 | Ga0501080_0099106 | Ga0501080_0099106_2034_2270 | 78 |
| 772 | 3300049744 | Ga0501083_0493963 | Ga0501083_0493963_251_511 | 78 |
| 773 | 3300049767 | Ga0501270_108704 | Ga0501270_108704_174_431 | 78 |
| 774 | 3300049822 | Ga0501035_0575139 | Ga0501035_0575139_506_742 | 78 |
| 775 | 3300049823 | Ga0501044_0095748 | Ga0501044_0095748_243_479 | 78 |
| 776 | 3300050508 | nmdc:mga09592_7127_c1 | nmdc:mga09592_7127_c1_3295_3552 | 78 |
| 777 | 3300050509 | nmdc:mga0qj67_1240879_c1 | nmdc:mga0qj67_1240879_c1_264_524 | 78 |
| 778 | 3300050509 | nmdc:mga0qj67_2521_c1 | nmdc:mga0qj67_2521_c1_1896_2153 | 78 |
| 779 | 3300050509 | nmdc:mga0qj67_560003_c1 | nmdc:mga0qj67_560003_c1_600_857 | 78 |
| 780 | 3300050510 | nmdc:mga06r32_233401_c1 | nmdc:mga06r32_233401_c1_996_1253 | 78 |
| 781 | 3300053085 | Ga0495619_0198291 | Ga0495619_0198291_206_454 | 78 |
| 782 | 3300060353 | Ga0501082_1636570 | Ga0501082_1636570_211_447 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f51-assembly1.cif.gz_A | crystal structure of the clp gene regulator clgr from corynebacterium glutamicum | 0.9381 | 7 | 62 |
| 3zkc-assembly1.cif.gz_B | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9347 | 6 | 62 |
| 3zkc-assembly1.cif.gz_A | crystal structure of the master regulator for biofilm formation sinr in complex with dna. | 0.9342 | 6 | 62 |
| 3f52-assembly1.cif.gz_E | crystal structure of the clp gene regulator clgr from c. glutamicum | 0.9305 | 7 | 62 |
| 1b0n-assembly1.cif.gz_A | sinr protein/sini protein complex | 0.9276 | 6 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3f51A00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9381 | 7 | 62 | 1.10.260.40 |
| 3zkcB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9347 | 6 | 62 | 1.10.260.40 |
| 3zkcA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9342 | 6 | 62 | 1.10.260.40 |
| 3f51C00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9311 | 7 | 62 | 1.10.260.40 |
| 3f52E00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9305 | 7 | 62 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4V562-F1-model_v4 | Helix-turn-helix domain-containing protein | 0.9814 | 2 | 66 |
GO:0003677
|
| AF-S3X7D6-F1-model_v4 | HTH cro/C1-type domain-containing protein | 0.9796 | 2 | 66 |
GO:0003677
|
| AF-A0A7Z0BWH4-F1-model_v4 | Putative transcriptional regulator | 0.9793 | 2 | 66 |
GO:0003677
|
| AF-I9WD21-F1-model_v4 | Putative transcriptional regulator | 0.979 | 2 | 67 |
GO:0003677
|
| AF-A0A1M6KAK0-F1-model_v4 | Putative transcriptional regulator | 0.9784 | 2 | 67 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar