F480563

General Info

Members Datasets Scaffolds Average Seq Length
781 414 1562 377

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1002327|Ga0209758_100232715
Length 398
Sequence VPVPVPRTGGPKRASGGGIFGGDDVTNQPIITFENVTKRFGKMVAVDDVSLSIQEGEFFSLLGPSGCGKTTLLRMLAGFETPTEGRILIDGQDVSTVPPNKRPVNMVFQSYAVFPHMSVADNVAYGLKVDRVSKAERDRRVEEALDLVQLHGLAQRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLRDQMRTELCTLQEKVGITFIMVTHDQDEALALASRCAVMNRGVLQQVAGPSDLYEFPNSRFVADFIGSVNLFEGVLAVDEPSHAVVKSPDLDCDIFLDHGVTGARGGTVWAALRPEKIELHKRPDGAAPPNMGDCPLGQNAVAGVIRHEAYLGGQSVYEVEIQSGRRIKVVRQNLTRWDQEDFKLGEAVWLGWHACSPAVLLS

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
283 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
355 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
356 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
359 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
364 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
365 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
366 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
367 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
379 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
380 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
381 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
382 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
383 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
384 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
385 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
386 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
387 2643221583 Caulobacter sp. Root655 Isolate Unclassified
388 2643221584 Caulobacter sp. Root656 Isolate Unclassified
389 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
390 2643221640 Caulobacter sp. Root342 Isolate Unclassified
391 2643221642 Caulobacter sp. Root343 Isolate Unclassified
392 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
393 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
394 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
395 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
396 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
397 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
398 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
399 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
400 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
401 2818991435 Caulobacter henricii 536 Isolate Unclassified
402 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
403 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
404 2849560528 Caulobacter zeae 410 Isolate Unclassified
405 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
406 2851153111 Caulobacter radicis 736 Isolate Unclassified
407 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
408 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
409 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
410 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
411 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
412 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
413 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
414 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 0
Rhizoplane 6.66
Rhizosphere 76.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1002327 3300025297 Bacteria 19634
2 rootL2_10006987 3300003322 Bacteria 5241
3 Ga0055537_1001980 3300003773 Bacteria 7305
4 Ga0055524_1017208 3300003775 Bacteria 2558
5 Ga0055536_1000787 3300003781 Bacteria 21133
6 Ga0055536_1002943 3300003781 Bacteria 9354
7 Ga0055536_1003896 3300003781 Bacteria 7833
8 Ga0055536_1005195 3300003781 Bacteria 6430
9 Ga0055536_1011827 3300003781 Bacteria 3298
10 Ga0055534_1008899 3300003784 Bacteria 2229
11 Ga0055528_1002045 3300003790 Bacteria 11275
12 Ga0055530_10000270 3300003791 Bacteria 46941
13 Ga0055530_10013210 3300003791 Bacteria 2828
14 Ga0055530_10021046 3300003791 Bacteria 1933
15 Ga0055530_10025806 3300003791 Bacteria 1634
16 Ga0055531_10000371 3300003794 Bacteria 43284
17 Ga0055531_10002055 3300003794 Bacteria 13881
18 Ga0055531_10002062 3300003794 Bacteria 13854
19 Ga0055531_10024253 3300003794 Bacteria 2245
20 Ga0055531_10024327 3300003794 Bacteria 2239
21 Ga0065165_1007528 3300005262 Bacteria 5323
22 Ga0070683_100042785 3300005329 Bacteria 4172
23 Ga0070690_100002434 3300005330 Bacteria 10014
24 Ga0070690_100004347 3300005330 Bacteria 7857
25 Ga0070670_100098031 3300005331 Bacteria 2522
26 Ga0070666_10000962 3300005335 Bacteria 17567
27 Ga0070680_100013082 3300005336 Bacteria 6459
28 Ga0068868_100004028 3300005338 Bacteria 10248
29 Ga0068868_100015991 3300005338 Bacteria 5563
30 Ga0070660_100106440 3300005339 Bacteria 2227
31 Ga0070689_100110960 3300005340 Bacteria 2181
32 Ga0070661_100037327 3300005344 Bacteria 3534
33 Ga0070692_10037764 3300005345 Bacteria 2457
34 Ga0070668_100006431 3300005347 Bacteria 8710
35 Ga0070668_100035551 3300005347 Bacteria 3799
36 Ga0070669_100015669 3300005353 Bacteria 5406
37 Ga0070669_100089659 3300005353 Bacteria 2304
38 Ga0070675_100002824 3300005354 Bacteria 13094
39 Ga0070675_100003925 3300005354 Bacteria 11267
40 Ga0070675_100189374 3300005354 Bacteria 1782
41 Ga0070671_100000657 3300005355 Bacteria 24836
42 Ga0070671_100001534 3300005355 Bacteria 17343
43 Ga0070671_100004754 3300005355 Bacteria 10789
44 Ga0070671_100103761 3300005355 Bacteria 2386
45 Ga0070673_100001288 3300005364 Bacteria 14603
46 Ga0070688_100003170 3300005365 Bacteria 8423
47 Ga0070659_100001767 3300005366 Bacteria 15523
48 Ga0070667_100041630 3300005367 Bacteria 3854
49 Ga0070667_100108820 3300005367 Bacteria 2401
50 Ga0070709_10007519 3300005434 Bacteria 5977
51 Ga0070709_10008679 3300005434 Bacteria 5590
52 Ga0070714_100006553 3300005435 Bacteria 9004
53 Ga0070714_100029604 3300005435 Bacteria 4552
54 Ga0070713_100012067 3300005436 Bacteria 6326
55 Ga0070713_100013671 3300005436 Bacteria 5999
56 Ga0070710_10003818 3300005437 Bacteria 7128
57 Ga0070701_10058066 3300005438 Bacteria 2030
58 Ga0070711_100000991 3300005439 Bacteria 15051
59 Ga0070711_100002860 3300005439 Bacteria 9931
60 Ga0070711_100007365 3300005439 Bacteria 6695
61 Ga0070705_100038144 3300005440 Bacteria 2716
62 Ga0070700_100042304 3300005441 Bacteria 2797
63 Ga0070663_100014095 3300005455 Bacteria 5122
64 Ga0070678_100001008 3300005456 Bacteria 14634
65 Ga0070678_100005204 3300005456 Bacteria 7483
66 Ga0070662_100070774 3300005457 Bacteria 2570
67 Ga0070681_10001577 3300005458 Bacteria 20233
68 Ga0070681_10001582 3300005458 Bacteria 20207
69 Ga0070681_10008934 3300005458 Bacteria 9851
70 Ga0070681_10024376 3300005458 Bacteria 6090
71 Ga0070681_10131966 3300005458 Bacteria 2430
72 Ga0070699_100023197 3300005518 Bacteria 5347
73 Ga0070679_100000469 3300005530 Bacteria 34407
74 Ga0070679_100025516 3300005530 Bacteria 5801
75 Ga0070679_100206288 3300005530 Bacteria 1930
76 Ga0070679_100245050 3300005530 Bacteria 1749
77 Ga0070684_100297982 3300005535 Bacteria 1479
78 Ga0068853_100054163 3300005539 Bacteria 3456
79 Ga0068853_100340741 3300005539 Bacteria 1393
80 Ga0070672_100018389 3300005543 Bacteria 5052
81 Ga0070686_100007351 3300005544 Bacteria 6142
82 Ga0070695_100001122 3300005545 Bacteria 14667
83 Ga0070695_100046465 3300005545 Bacteria 2770
84 Ga0070696_100003437 3300005546 Bacteria 10552
85 Ga0070696_100064546 3300005546 Bacteria 2566
86 Ga0070693_100004808 3300005547 Bacteria 6435
87 Ga0070693_100096717 3300005547 Bacteria 1790
88 Ga0070665_100002122 3300005548 Bacteria 22146
89 Ga0070704_100007227 3300005549 Bacteria 6604
90 Ga0070704_100054768 3300005549 Bacteria 2824
91 Ga0070704_100129263 3300005549 Bacteria 1955
92 Ga0068855_100001482 3300005563 Bacteria 29366
93 Ga0068855_100001944 3300005563 Bacteria 25660
94 Ga0068855_100152015 3300005563 Bacteria 2632
95 Ga0070664_100004986 3300005564 Bacteria 10641
96 Ga0068857_100066753 3300005577 Bacteria 3202
97 Ga0068857_100121702 3300005577 Bacteria 2350
98 Ga0068854_100013995 3300005578 Bacteria 5279
99 Ga0068854_100240349 3300005578 Bacteria 1442
100 Ga0068856_100008652 3300005614 Bacteria 9902
101 Ga0068856_100113281 3300005614 Bacteria 2711
102 Ga0068856_100389140 3300005614 Bacteria 1414
103 Ga0070702_100000727 3300005615 Bacteria 12496
104 Ga0068852_100108169 3300005616 Bacteria 2523
105 Ga0068859_100043197 3300005617 Bacteria 4530
106 Ga0068859_100069694 3300005617 Bacteria 3552
107 Ga0068859_100081028 3300005617 Bacteria 3288
108 Ga0068859_100109922 3300005617 Bacteria 2818
109 Ga0068859_100207818 3300005617 Bacteria 2043
110 Ga0068864_100000096 3300005618 Bacteria 88306
111 Ga0068864_100017049 3300005618 Bacteria 6054
112 Ga0068864_100035560 3300005618 Bacteria 4241
113 Ga0068866_10008386 3300005718 Bacteria 4354
114 Ga0068866_10090683 3300005718 Bacteria 1664
115 Ga0068861_100003267 3300005719 Bacteria 10724
116 Ga0068863_100000041 3300005841 Bacteria 157478
117 Ga0068863_100005625 3300005841 Bacteria 12313
118 Ga0068863_100022625 3300005841 Bacteria 6002
119 Ga0068863_100022759 3300005841 Bacteria 5986
120 Ga0068858_100000108 3300005842 Bacteria 87208
121 Ga0068858_100007229 3300005842 Bacteria 10762
122 Ga0068858_100019147 3300005842 Bacteria 6404
123 Ga0068858_100156156 3300005842 Bacteria 2147
124 Ga0068860_100007155 3300005843 Bacteria 11163
125 Ga0068860_100007202 3300005843 Bacteria 11122
126 Ga0068860_100012873 3300005843 Bacteria 8222
127 Ga0068860_100022565 3300005843 Bacteria 6085
128 Ga0068862_100000059 3300005844 Bacteria 136840
129 Ga0068862_100077587 3300005844 Bacteria 2877
130 Ga0081455_10001941 3300005937 Bacteria 24850
131 Ga0081455_10052856 3300005937 Bacteria 3474
132 Ga0070715_10001572 3300006163 Bacteria 6703
133 Ga0070715_10003057 3300006163 Bacteria 5248
134 Ga0070716_100000449 3300006173 Bacteria 17023
135 Ga0070716_100133192 3300006173 Bacteria 1574
136 Ga0070712_100052794 3300006175 Bacteria 2836
137 Ga0075369_10052968 3300006186 Bacteria 1760
138 Ga0075366_10065725 3300006195 Bacteria 2157
139 Ga0097621_100322680 3300006237 Bacteria 1368
140 Ga0068871_100026906 3300006358 Bacteria 4493
141 Ga0075428_100012185 3300006844 Bacteria 9560
142 Ga0075431_100048414 3300006847 Bacteria 4385
143 Ga0075433_10002458 3300006852 Bacteria 14092
144 Ga0075433_10008589 3300006852 Bacteria 8149
145 Ga0075434_100000766 3300006871 Bacteria 25369
146 Ga0075434_100017502 3300006871 Bacteria 6908
147 Ga0068865_100000735 3300006881 Bacteria 18419
148 Ga0068865_100252483 3300006881 Bacteria 1392
149 Ga0097620_100043196 3300006931 Bacteria 4530
150 Ga0097620_100069696 3300006931 Bacteria 3552
151 Ga0097620_100081026 3300006931 Bacteria 3288
152 Ga0097620_100109919 3300006931 Bacteria 2818
153 Ga0097620_100207827 3300006931 Bacteria 2043
154 Ga0099795_10000022 3300007788 Bacteria 52585
155 Ga0105250_10024018 3300009092 Bacteria 2457
156 Ga0105250_10035519 3300009092 Bacteria 2000
157 Ga0105240_10002705 3300009093 Bacteria 28172
158 Ga0105240_10003826 3300009093 Bacteria 23268
159 Ga0105240_10008281 3300009093 Bacteria 14883
160 Ga0105240_10024889 3300009093 Bacteria 7880
161 Ga0105240_10111111 3300009093 Bacteria 3316
162 Ga0105240_10150093 3300009093 Bacteria 2777
163 Ga0111539_10000539 3300009094 Bacteria 48163
164 Ga0111539_10005627 3300009094 Bacteria 16201
165 Ga0111539_10683492 3300009094 Bacteria 1195
166 Ga0105245_10000738 3300009098 Bacteria 29503
167 Ga0105245_10007920 3300009098 Bacteria 9291
168 Ga0105247_10002269 3300009101 Bacteria 13214
169 Ga0105247_10010243 3300009101 Bacteria 5674
170 Ga0105247_10012409 3300009101 Bacteria 5117
171 Ga0105247_10021799 3300009101 Bacteria 3854
172 Ga0114129_10010448 3300009147 Bacteria 13239
173 Ga0114129_10089316 3300009147 Bacteria 4271
174 Ga0114129_10289030 3300009147 Bacteria 2188
175 Ga0105241_10007997 3300009174 Bacteria 7778
176 Ga0105242_10005298 3300009176 Bacteria 9957
177 Ga0105242_10050505 3300009176 Bacteria 3386
178 Ga0105248_10001268 3300009177 Bacteria 28225
179 Ga0105248_10003698 3300009177 Bacteria 16951
180 Ga0105248_10005489 3300009177 Bacteria 13923
181 Ga0105248_10024418 3300009177 Bacteria 6722
182 Ga0105248_10067758 3300009177 Bacteria 4007
183 Ga0105248_10111326 3300009177 Bacteria 3088
184 Ga0105248_10199938 3300009177 Bacteria 2252
185 Ga0105237_10014418 3300009545 Bacteria 8266
186 Ga0105237_10104733 3300009545 Bacteria 2820
187 Ga0105237_10164315 3300009545 Bacteria 2219
188 Ga0105237_10204122 3300009545 Bacteria 1977
189 Ga0105238_10005376 3300009551 Bacteria 12659
190 Ga0105238_10006381 3300009551 Bacteria 11732
191 Ga0105249_10000065 3300009553 Bacteria 151159
192 Ga0105249_10008955 3300009553 Bacteria 8742
193 Ga0105030_100135 3300009987 Bacteria 5867
194 Ga0099796_10000025 3300010159 Bacteria 37858
195 Ga0099796_10001494 3300010159 Bacteria 4736
196 Ga0105239_10000694 3300010375 Bacteria 47928
197 Ga0105239_10005723 3300010375 Bacteria 14518
198 Ga0105246_10003747 3300011119 Bacteria 9213
199 Ga0157371_10097944 3300013102 Bacteria 2079
200 Ga0157370_10001472 3300013104 Bacteria 29117
201 Ga0157370_10086899 3300013104 Bacteria 2937
202 Ga0157369_10006045 3300013105 Bacteria 14052
203 Ga0157369_10065057 3300013105 Bacteria 3926
204 Ga0157369_10115433 3300013105 Bacteria 2851
205 Ga0157369_10256981 3300013105 Bacteria 1822
206 Ga0157369_10334481 3300013105 Bacteria 1573
207 Ga0157374_10007656 3300013296 Bacteria 9220
208 Ga0157374_10102377 3300013296 Bacteria 2746
209 Ga0157374_10289571 3300013296 Bacteria 1618
210 Ga0157374_10507111 3300013296 Bacteria 1211
211 Ga0157378_10004873 3300013297 Bacteria 11772
212 Ga0163162_10004801 3300013306 Bacteria 13040
213 Ga0157372_10014940 3300013307 Bacteria 8313
214 Ga0157372_10071871 3300013307 Bacteria 3898
215 Ga0157375_10004187 3300013308 Bacteria 12521
216 Ga0157375_10018198 3300013308 Bacteria 6367
217 Ga0157375_10071259 3300013308 Bacteria 3488
218 Ga0163163_10010899 3300014325 Bacteria 8211
219 Ga0163163_10029400 3300014325 Bacteria 5285
220 Ga0163163_10101260 3300014325 Bacteria 2903
221 Ga0157380_10004376 3300014326 Bacteria 9789
222 Ga0157377_10103846 3300014745 Bacteria 1698
223 Ga0157379_10006630 3300014968 Bacteria 9989
224 Ga0157379_10030721 3300014968 Bacteria 4784
225 Ga0157379_10126453 3300014968 Bacteria 2300
226 Ga0157376_10000896 3300014969 Bacteria 19480
227 Ga0157376_10013774 3300014969 Bacteria 6046
228 Ga0157376_10106809 3300014969 Bacteria 2457
229 Ga0157376_10115157 3300014969 Bacteria 2373
230 Ga0183365_10004 3300015684 Bacteria 333304
231 Ga0163161_10115144 3300017792 Bacteria 2015
232 Ga0213872_10000038 3300021361 Bacteria 123827
233 Ga0213872_10018666 3300021361 Bacteria 3196
234 Ga0213872_10036249 3300021361 Bacteria 2255
235 Ga0213872_10079967 3300021361 Bacteria 1469
236 Ga0213875_10000081 3300021388 Bacteria 114181
237 Ga0213875_10000307 3300021388 Bacteria 46789
238 Ga0224572_1008387 3300024225 Bacteria 1909
239 Ga0209565_1000065 3300025263 Bacteria 178266
240 Ga0209673_1000818 3300025273 Bacteria 41077
241 Ga0209675_1000275 3300025291 Bacteria 49474
242 Ga0209676_1000085 3300025292 Bacteria 273425
243 Ga0209676_1000171 3300025292 Bacteria 154045
244 Ga0209676_1000177 3300025292 Bacteria 151589
245 Ga0209676_1000349 3300025292 Bacteria 87517
246 Ga0209676_1000648 3300025292 Bacteria 49941
247 Ga0209564_1001008 3300025295 Bacteria 35029
248 Ga0209758_1004537 3300025297 Bacteria 11482
249 Ga0209050_1000042 3300025298 Bacteria 402842
250 Ga0209050_1000496 3300025298 Bacteria 67112
251 Ga0209050_1001766 3300025298 Bacteria 21350
252 Ga0209050_1008080 3300025298 Bacteria 5717
253 Ga0209050_1014594 3300025298 Bacteria 3369
254 Ga0209256_1000855 3300025299 Bacteria 37977
255 Ga0209051_1001860 3300025303 Bacteria 16592
256 Ga0209257_1000074 3300025304 Bacteria 325641
257 Ga0209257_1000135 3300025304 Bacteria 205668
258 Ga0209257_1000253 3300025304 Bacteria 123508
259 Ga0209257_1000482 3300025304 Bacteria 72375
260 Ga0209257_1002290 3300025304 Bacteria 19468
261 Ga0209257_1006411 3300025304 Bacteria 7594
262 Ga0207692_10058000 3300025898 Bacteria 1993
263 Ga0207710_10003083 3300025900 Bacteria 7483
264 Ga0207710_10095544 3300025900 Bacteria 1396
265 Ga0207688_10033699 3300025901 Bacteria 2833
266 Ga0207688_10111822 3300025901 Bacteria 1586
267 Ga0207680_10114148 3300025903 Bacteria 1757
268 Ga0207680_10136162 3300025903 Bacteria 1624
269 Ga0207647_10001136 3300025904 Bacteria 20506
270 Ga0207699_10009239 3300025906 Bacteria 4899
271 Ga0207699_10013238 3300025906 Bacteria 4217
272 Ga0207699_10026246 3300025906 Bacteria 3207
273 Ga0207707_10000122 3300025912 Bacteria 80159
274 Ga0207707_10036563 3300025912 Bacteria 4292
275 Ga0207707_10044816 3300025912 Bacteria 3855
276 Ga0207707_10106221 3300025912 Bacteria 2454
277 Ga0207707_10129357 3300025912 Bacteria 2208
278 Ga0207695_10002114 3300025913 Bacteria 30152
279 Ga0207695_10003540 3300025913 Bacteria 21874
280 Ga0207695_10024615 3300025913 Bacteria 6765
281 Ga0207695_10076336 3300025913 Bacteria 3406
282 Ga0207695_10332380 3300025913 Bacteria 1408
283 Ga0207671_10009799 3300025914 Bacteria 7971
284 Ga0207671_10023246 3300025914 Bacteria 4676
285 Ga0207671_10097681 3300025914 Bacteria 2221
286 Ga0207693_10000083 3300025915 Bacteria 84611
287 Ga0207693_10000551 3300025915 Bacteria 33845
288 Ga0207663_10003079 3300025916 Bacteria 8084
289 Ga0207663_10014494 3300025916 Bacteria 4317
290 Ga0207663_10048556 3300025916 Bacteria 2628
291 Ga0207660_10004896 3300025917 Bacteria 8723
292 Ga0207660_10024101 3300025917 Bacteria 4116
293 Ga0207660_10197635 3300025917 Bacteria 1569
294 Ga0207662_10001396 3300025918 Bacteria 11670
295 Ga0207657_10008555 3300025919 Bacteria 10374
296 Ga0207652_10000613 3300025921 Bacteria 35518
297 Ga0207652_10032150 3300025921 Bacteria 4408
298 Ga0207652_10099654 3300025921 Bacteria 2564
299 Ga0207694_10003403 3300025924 Bacteria 12669
300 Ga0207694_10102396 3300025924 Bacteria 2270
301 Ga0207659_10007954 3300025926 Bacteria 6557
302 Ga0207687_10017700 3300025927 Bacteria 4696
303 Ga0207687_10110472 3300025927 Bacteria 2039
304 Ga0207700_10146086 3300025928 Bacteria 1949
305 Ga0207664_10002133 3300025929 Bacteria 13018
306 Ga0207644_10156497 3300025931 Bacteria 1768
307 Ga0207706_10001303 3300025933 Bacteria 25092
308 Ga0207686_10012915 3300025934 Bacteria 4606
309 Ga0207686_10075458 3300025934 Bacteria 2183
310 Ga0207670_10052443 3300025936 Bacteria 2743
311 Ga0207704_10004318 3300025938 Bacteria 6496
312 Ga0207704_10100132 3300025938 Bacteria 1929
313 Ga0207665_10000478 3300025939 Bacteria 27104
314 Ga0207665_10000587 3300025939 Bacteria 24539
315 Ga0207665_10113687 3300025939 Bacteria 1905
316 Ga0207691_10006970 3300025940 Bacteria 10901
317 Ga0207711_10002830 3300025941 Bacteria 15244
318 Ga0207711_10005213 3300025941 Bacteria 11012
319 Ga0207711_10014144 3300025941 Bacteria 6629
320 Ga0207711_10071669 3300025941 Bacteria 3007
321 Ga0207711_10189111 3300025941 Bacteria 1875
322 Ga0207689_10246610 3300025942 Bacteria 1477
323 Ga0207661_10208532 3300025944 Bacteria 1721
324 Ga0207667_10000798 3300025949 Bacteria 40876
325 Ga0207667_10010115 3300025949 Bacteria 11052
326 Ga0207667_10045147 3300025949 Bacteria 4668
327 Ga0207667_10058371 3300025949 Bacteria 4048
328 Ga0207712_10000002 3300025961 Bacteria 706628
329 Ga0207712_10086967 3300025961 Bacteria 2291
330 Ga0207668_10004667 3300025972 Bacteria 8061
331 Ga0207668_10028281 3300025972 Bacteria 3664
332 Ga0207640_10012125 3300025981 Bacteria 4901
333 Ga0207640_10056000 3300025981 Bacteria 2586
334 Ga0207677_10057269 3300026023 Bacteria 2675
335 Ga0207703_10000035 3300026035 Bacteria 183082
336 Ga0207703_10028593 3300026035 Bacteria 4395
337 Ga0207703_10034034 3300026035 Bacteria 4041
338 Ga0207703_10065995 3300026035 Bacteria 2976
339 Ga0207703_10251779 3300026035 Bacteria 1592
340 Ga0207702_10014159 3300026078 Bacteria 6624
341 Ga0207702_10128842 3300026078 Bacteria 2275
342 Ga0207641_10000027 3300026088 Bacteria 244787
343 Ga0207641_10001424 3300026088 Bacteria 23544
344 Ga0207641_10012457 3300026088 Bacteria 6972
345 Ga0207641_10031125 3300026088 Bacteria 4424
346 Ga0207648_10031254 3300026089 Bacteria 4707
347 Ga0207676_10000418 3300026095 Bacteria 36015
348 Ga0207674_10005594 3300026116 Bacteria 14897
349 Ga0207675_100003266 3300026118 Bacteria 15871
350 Ga0207683_10004828 3300026121 Bacteria 11609
351 Ga0207683_10004897 3300026121 Bacteria 11526
352 Ga0207698_10129894 3300026142 Bacteria 2151
353 Ga0209971_1011656 3300027682 Bacteria 2083
354 Ga0209974_10005604 3300027876 Bacteria 4408
355 Ga0207428_10005547 3300027907 Bacteria 11749
356 Ga0207428_10014951 3300027907 Bacteria 6725
357 Ga0207428_10085930 3300027907 Bacteria 2449
358 Ga0268266_10086554 3300028379 Bacteria 2740
359 Ga0268265_10000114 3300028380 Bacteria 101337
360 Ga0268265_10002149 3300028380 Bacteria 15264
361 Ga0268265_10097925 3300028380 Bacteria 2361
362 Ga0268264_10000562 3300028381 Bacteria 45693
363 Ga0268264_10018337 3300028381 Bacteria 5723
364 Ga0268264_10096693 3300028381 Bacteria 2558
365 Ga0268264_10161239 3300028381 Bacteria 2020
366 Ga0268264_10185166 3300028381 Bacteria 1894
367 Ga0268264_10387470 3300028381 Bacteria 1340
368 Ga0265326_10003138 3300028558 Bacteria 5468
369 Ga0265334_10010215 3300028573 Bacteria 3960
370 Ga0265318_10001836 3300028577 Bacteria 12018
371 Ga0307515_10045057 3300028794 Bacteria 6790
372 Ga0265338_10027362 3300028800 Bacteria 5722
373 Ga0307511_10000268 3300030521 Bacteria 54105
374 Ga0265330_10004483 3300031235 Bacteria 7083
375 Ga0265332_10003174 3300031238 Bacteria 8001
376 Ga0265328_10014767 3300031239 Bacteria 3069
377 Ga0265328_10034097 3300031239 Bacteria 1885
378 Ga0265320_10010245 3300031240 Bacteria 5593
379 Ga0265320_10044698 3300031240 Bacteria 2181
380 Ga0265329_10002693 3300031242 Bacteria 7987
381 Ga0265339_10074777 3300031249 Bacteria 1799
382 Ga0265331_10009724 3300031250 Bacteria 5373
383 Ga0265327_10001660 3300031251 Bacteria 26802
384 Ga0265316_10049287 3300031344 Bacteria 3318
385 Ga0307513_10002752 3300031456 Bacteria 24185
386 Ga0307513_10020402 3300031456 Bacteria 7862
387 Ga0307509_10003194 3300031507 Bacteria 25340
388 Ga0307408_100016261 3300031548 Bacteria 4963
389 Ga0307508_10061746 3300031616 Bacteria 3310
390 Ga0265314_10022086 3300031711 Bacteria 4878
391 Ga0265342_10012843 3300031712 Bacteria 5652
392 Ga0316576_10017920 3300031727 Bacteria 4824
393 Ga0307405_10315093 3300031731 Bacteria 1193
394 Ga0307413_10031975 3300031824 Bacteria 2976
395 Ga0307410_10191260 3300031852 Bacteria 1556
396 Ga0307410_10219450 3300031852 Bacteria 1462
397 Ga0307410_10233460 3300031852 Bacteria 1421
398 Ga0307412_10100891 3300031911 Bacteria 2041
399 Ga0307409_100028297 3300031995 Bacteria 3990
400 Ga0307409_100289090 3300031995 Bacteria 1519
401 Ga0307416_100003094 3300032002 Bacteria 9732
402 Ga0307416_100042886 3300032002 Bacteria 3537
403 Ga0307414_10013586 3300032004 Bacteria 4853
404 Ga0307414_10022560 3300032004 Bacteria 3974
405 Ga0307414_10038574 3300032004 Bacteria 3210
406 Ga0307411_10048225 3300032005 Bacteria 2760
407 Ga0307415_100001180 3300032126 Bacteria 12227
408 Ga0373923_0020999 3300035111 Bacteria 2545
409 Ga0373945_0023197 3300035116 Bacteria 2143
410 Ga0373945_0068007 3300035116 Bacteria 1343
411 Ga0373943_0047771 3300035170 Bacteria 2094
412 Ga0373946_0017825 3300035171 Bacteria 2720
413 Ga0373946_0094953 3300035171 Bacteria 1328
414 Ga0373942_0010698 3300035207 Bacteria 2162
415 Ga0373961_0031387 3300035241 Bacteria 1484
416 Ga0373962_0028711 3300035242 Bacteria 1511
417 Ga0373931_0088269 3300035691 Bacteria 1723
418 Ga0373931_0155118 3300035691 Bacteria 1338
419 Ga0373935_0108787 3300035692 Bacteria 1837
420 Ga0373927_0006326 3300035695 Bacteria 8071
421 Ga0373927_0015626 3300035695 Bacteria 5013
422 Ga0373927_0148040 3300035695 Bacteria 1537
423 Ga0373933_0012987 3300035724 Bacteria 4607
424 Ga0373947_0140208 3300035725 Bacteria 1550
425 Ga0373947_0185355 3300035725 Bacteria 1356
426 Ga0373937_0031120 3300036401 Bacteria 4832
427 Ga0373937_0048457 3300036401 Bacteria 3890
428 Ga0373937_0100366 3300036401 Bacteria 2686
429 Ga0316584_0068487 3300036712 Bacteria 2660
430 Ga0373925_0093366 3300037068 Bacteria 2303
431 Ga0395900_0084547 3300037418 Bacteria 3261
432 Ga0395898_0020760 3300037466 Bacteria 6668
433 Ga0395898_0036071 3300037466 Bacteria 4913
434 Ga0395905_0000136 3300037471 Bacteria 121009
435 Ga0436364_0210071 3300037853 Bacteria 1395
436 Ga0436364_0560002 3300037853 Bacteria 93566
437 Ga0436364_0822555 3300037853 Bacteria 215682
438 Ga0436364_0856291 3300037853 Bacteria 2151
439 Ga0400489_17737 3300039093 Bacteria 2130
440 Ga0436365_0969803 3300039437 Bacteria 1238
441 Ga0436360_1031300 3300039438 Bacteria 2212
442 Ga0436361_0200397 3300039447 Bacteria 5394
443 Ga0436361_0328064 3300039447 Bacteria 5863
444 Ga0436361_1108648 3300039447 Bacteria 1542
445 Ga0436363_1410071 3300039450 Bacteria 2166
446 Ga0439454_005654 3300042011 Bacteria 1502
447 Ga0450920_007942 3300042122 Bacteria 1931
448 Ga0450890_007161 3300042127 Bacteria 1424
449 Ga0439446_0045152 3300042156 Bacteria 1305
450 Ga0439446_0054380 3300042156 Bacteria 1200
451 Ga0450908_003021 3300042184 Bacteria 3283
452 Ga0439434_0003968 3300042435 Bacteria 4318
453 Ga0439435_0001752 3300042436 Bacteria 4121
454 Ga0451577_0000194 3300042876 Bacteria 127614
455 Ga0451577_0041605 3300042876 Bacteria 4124
456 Ga0451577_0090539 3300042876 Bacteria 2731
457 Ga0451577_0106942 3300042876 Bacteria 2501
458 Ga0466969_0003345 3300044656 Bacteria 8536
459 Ga0466965_0224118 3300044683 Bacteria 1003
460 Ga0453684_0000218 3300044712 Bacteria 250267
461 Ga0466957_0130437 3300044842 Bacteria 1610
462 Ga0466959_0035356 3300045049 Bacteria 3696
463 Ga0451576_0000643 3300045051 Bacteria 72224
464 Ga0451576_0013885 3300045051 Bacteria 8996
465 Ga0451576_0049885 3300045051 Bacteria 4392
466 Ga0451576_0343852 3300045051 Bacteria 1562
467 Ga0495627_001458 3300046453 Bacteria 13865
468 Ga0495603_0006487 3300046455 Bacteria 7009
469 Ga0495603_0015445 3300046455 Bacteria 4620
470 Ga0495590_0013702 3300046457 Bacteria 2974
471 Ga0495629_0001118 3300046459 Bacteria 21234
472 Ga0495638_0000147 3300046460 Bacteria 110817
473 Ga0495638_0009919 3300046460 Bacteria 6646
474 Ga0495638_0012304 3300046460 Bacteria 5868
475 Ga0495638_0016883 3300046460 Bacteria 4881
476 Ga0495638_0063163 3300046460 Bacteria 2284
477 Ga0495650_0000045 3300046471 Bacteria 346204
478 Ga0495580_0003653 3300046472 Bacteria 13035
479 Ga0495580_0008705 3300046472 Bacteria 8047
480 Ga0495582_0000461 3300046473 Bacteria 22212
481 Ga0495639_0030378 3300046475 Bacteria 2401
482 Ga0495594_0000049 3300046499 Bacteria 52677
483 Ga0495594_0074049 3300046499 Bacteria 1897
484 Ga0495607_0140519 3300046501 Bacteria 1246
485 Ga0495583_0000005 3300046506 Bacteria 636894
486 Ga0495583_0023608 3300046506 Bacteria 3108
487 Ga0495606_0005055 3300046507 Bacteria 12840
488 Ga0495610_0000101 3300046512 Bacteria 99012
489 Ga0495610_0002849 3300046512 Bacteria 14072
490 Ga0495610_0112313 3300046512 Bacteria 1205
491 Ga0495616_0001495 3300046513 Bacteria 16156
492 Ga0495618_0149756 3300046514 Bacteria 1491
493 Ga0495620_0059358 3300046515 Bacteria 1599
494 Ga0495631_0002007 3300046518 Bacteria 11864
495 Ga0495632_0006366 3300046519 Bacteria 7611
496 Ga0495632_0067821 3300046519 Bacteria 1720
497 Ga0495648_0003254 3300046524 Bacteria 14383
498 Ga0495666_0053701 3300046526 Bacteria 1933
499 Ga0495654_0000018 3300046530 Bacteria 293124
500 Ga0495665_0014972 3300046531 Bacteria 4178
501 Ga0495597_0002750 3300046542 Bacteria 10826
502 Ga0495622_0002657 3300046557 Bacteria 8582
503 Ga0495622_0020281 3300046557 Bacteria 3095
504 Ga0495668_0000001 3300046616 Bacteria 1013420
505 Ga0495668_0000026 3300046616 Bacteria 297287
506 Ga0495668_0051407 3300046616 Bacteria 2281
507 Ga0495668_0068994 3300046616 Bacteria 1944
508 Ga0495634_0040795 3300046642 Bacteria 3154
509 Ga0495611_0034808 3300046648 Bacteria 2228
510 Ga0495625_0000099 3300046660 Bacteria 140467
511 Ga0495625_0000373 3300046660 Bacteria 68625
512 Ga0495625_0023590 3300046660 Bacteria 4697
513 Ga0495625_0043033 3300046660 Bacteria 3278
514 Ga0495625_0052636 3300046660 Bacteria 2914
515 Ga0495625_0055958 3300046660 Bacteria 2810
516 Ga0495625_0138550 3300046660 Bacteria 1643
517 Ga0495669_0000321 3300046684 Bacteria 26316
518 Ga0495613_0000244 3300046689 Bacteria 51563
519 Ga0495649_0012413 3300046694 Bacteria 4953
520 Ga0495660_0007468 3300046810 Bacteria 6417
521 Ga0495581_0092426 3300047315 Bacteria 1756
522 Ga0495604_0043627 3300047317 Bacteria 3510
523 Ga0495672_0000472 3300047320 Bacteria 47553
524 Ga0495672_0091436 3300047320 Bacteria 1670
525 Ga0495676_0034293 3300047321 Bacteria 4261
526 Ga0495680_0113860 3300047322 Bacteria 2002
527 Ga0495687_040408 3300047443 Bacteria 2055
528 Ga0495673_0000119 3300047469 Bacteria 145179
529 Ga0495673_0000967 3300047469 Bacteria 25932
530 Ga0495673_0045019 3300047469 Bacteria 1964
531 Ga0495686_0023674 3300047472 Bacteria 4047
532 Ga0495686_0049321 3300047472 Bacteria 2649
533 Ga0495593_0008379 3300047673 Bacteria 6014
534 Ga0495593_0032243 3300047673 Bacteria 2857
535 Ga0495602_0048266 3300048088 Bacteria 3828
536 Ga0495626_0029671 3300048091 Bacteria 2645
537 Ga0496100_0003273 3300048903 Bacteria 8417
538 Ga0496100_0007689 3300048903 Bacteria 5965
539 Ga0496100_0217204 3300048903 Bacteria 1401
540 Ga0496100_0264167 3300048903 Bacteria 1277
541 Ga0496101_0025222 3300048904 Bacteria 4122
542 Ga0496101_0149515 3300048904 Bacteria 1785
543 Ga0496102_0006064 3300048905 Bacteria 10305
544 Ga0496102_0040309 3300048905 Bacteria 4224
545 Ga0496102_0042344 3300048905 Bacteria 4126
546 Ga0496102_0096849 3300048905 Bacteria 2736
547 Ga0496102_0097177 3300048905 Bacteria 2731
548 Ga0496102_0171477 3300048905 Bacteria 2042
549 Ga0496102_0223101 3300048905 Bacteria 1777
550 Ga0496102_0338449 3300048905 Bacteria 1417
551 Ga0496103_0023391 3300048906 Bacteria 3725
552 Ga0496103_0063876 3300048906 Bacteria 2294
553 Ga0496103_0130479 3300048906 Bacteria 1605
554 Ga0496104_0032491 3300048907 Bacteria 4857
555 Ga0496104_0211380 3300048907 Bacteria 1851
556 Ga0496105_0001071 3300048908 Bacteria 18940
557 Ga0496105_0005319 3300048908 Bacteria 9756
558 Ga0496105_0010006 3300048908 Bacteria 7441
559 Ga0496106_0002565 3300048909 Bacteria 13516
560 Ga0496106_0013682 3300048909 Bacteria 5992
561 Ga0496106_0034515 3300048909 Bacteria 3779
562 Ga0496107_0000168 3300048910 Bacteria 33811
563 Ga0496107_0001015 3300048910 Bacteria 16758
564 Ga0496107_0034840 3300048910 Bacteria 3607
565 Ga0496107_0039577 3300048910 Bacteria 3382
566 Ga0496108_0021858 3300048911 Bacteria 5259
567 Ga0496108_0171428 3300048911 Bacteria 1877
568 Ga0496108_0544658 3300048911 Bacteria 1012
569 Ga0496109_0011744 3300048912 Bacteria 7536
570 Ga0496109_0055487 3300048912 Bacteria 3614
571 Ga0496109_0115142 3300048912 Bacteria 2501
572 Ga0496109_0196080 3300048912 Bacteria 1898
573 Ga0496109_0204093 3300048912 Bacteria 1858
574 Ga0496110_0000749 3300048913 Bacteria 22420
575 Ga0496110_0035854 3300048913 Bacteria 4306
576 Ga0496110_0104477 3300048913 Bacteria 2541
577 Ga0496111_0065590 3300048914 Bacteria 2635
578 Ga0496111_0085738 3300048914 Bacteria 2303
579 Ga0496111_0087686 3300048914 Bacteria 2278
580 Ga0496111_0168869 3300048914 Bacteria 1625
581 Ga0496112_0011995 3300048915 Bacteria 7946
582 Ga0496112_0138205 3300048915 Bacteria 2406
583 Ga0496114_0004273 3300048917 Bacteria 11058
584 Ga0496114_0004355 3300048917 Bacteria 10956
585 Ga0496115_0016363 3300048918 Bacteria 5646
586 Ga0496115_0035704 3300048918 Bacteria 3934
587 Ga0496115_0129385 3300048918 Bacteria 2080
588 Ga0496115_0283866 3300048918 Bacteria 1359
589 Ga0496116_0064059 3300048919 Bacteria 2364
590 Ga0496117_0006424 3300048920 Bacteria 11905
591 Ga0496117_0031376 3300048920 Bacteria 4058
592 Ga0496118_0001617 3300048921 Bacteria 33315
593 Ga0496118_0013816 3300048921 Bacteria 7602
594 Ga0496118_0026400 3300048921 Bacteria 4950
595 Ga0496118_0036145 3300048921 Bacteria 3999
596 Ga0496118_0049114 3300048921 Bacteria 3251
597 Ga0496119_0017203 3300048922 Bacteria 5452
598 Ga0496121_0000067 3300048924 Bacteria 261543
599 Ga0496121_0000971 3300048924 Bacteria 51396
600 Ga0496121_0004117 3300048924 Bacteria 19931
601 Ga0496121_0014418 3300048924 Bacteria 8389
602 Ga0496121_0041725 3300048924 Bacteria 4005
603 Ga0496124_0009920 3300048927 Bacteria 9735
604 Ga0496125_0030293 3300048928 Bacteria 4843
605 Ga0496126_0002263 3300048929 Bacteria 26552
606 Ga0496126_0026027 3300048929 Bacteria 5617
607 Ga0495678_006910 3300049459 Bacteria 5955
608 Ga0501031_0022942 3300049568 Bacteria 4071
609 Ga0501031_0123276 3300049568 Bacteria 1693
610 Ga0501032_0063880 3300049569 Bacteria 2464
611 Ga0501033_0140245 3300049570 Bacteria 1748
612 Ga0501033_0210888 3300049570 Bacteria 1385
613 Ga0501034_0159316 3300049571 Bacteria 2229
614 Ga0501034_0229596 3300049571 Bacteria 1805
615 Ga0501036_0069542 3300049572 Bacteria 2978
616 Ga0501036_0127718 3300049572 Bacteria 2147
617 Ga0501038_0175975 3300049574 Bacteria 1729
618 Ga0501039_0060357 3300049575 Bacteria 2937
619 Ga0501039_0065361 3300049575 Bacteria 2822
620 Ga0501039_0223194 3300049575 Bacteria 1481
621 Ga0501040_0207821 3300049576 Bacteria 1391
622 Ga0501041_0007554 3300049577 Bacteria 6382
623 Ga0501041_0020253 3300049577 Bacteria 3975
624 Ga0501041_0151457 3300049577 Bacteria 1448
625 Ga0501042_0024795 3300049578 Bacteria 4209
626 Ga0501042_0028271 3300049578 Bacteria 3949
627 Ga0501042_0041353 3300049578 Bacteria 3278
628 Ga0501043_0047123 3300049579 Bacteria 3389
629 Ga0501043_0092072 3300049579 Bacteria 2383
630 Ga0501043_0288899 3300049579 Bacteria 1255
631 Ga0501046_0093862 3300049580 Bacteria 2306
632 Ga0501046_0104003 3300049580 Bacteria 2176
633 Ga0501047_0097175 3300049581 Bacteria 2823
634 Ga0501047_0371876 3300049581 Bacteria 1264
635 Ga0501048_0049420 3300049582 Bacteria 2997
636 Ga0501048_0059167 3300049582 Bacteria 2715
637 Ga0501067_0015248 3300049583 Bacteria 4255
638 Ga0501067_0046897 3300049583 Bacteria 2398
639 Ga0501067_0066958 3300049583 Bacteria 1988
640 Ga0501068_0021133 3300049584 Bacteria 3799
641 Ga0501068_0121652 3300049584 Bacteria 1628
642 Ga0501070_0268112 3300049586 Bacteria 1395
643 Ga0501071_0023605 3300049587 Bacteria 4295
644 Ga0501071_0180334 3300049587 Bacteria 1582
645 Ga0501071_0197755 3300049587 Bacteria 1509
646 Ga0501072_0023049 3300049588 Bacteria 4835
647 Ga0501072_0026249 3300049588 Bacteria 4541
648 Ga0501072_0060245 3300049588 Bacteria 2993
649 Ga0501072_0094984 3300049588 Bacteria 2369
650 Ga0501072_0120064 3300049588 Bacteria 2094
651 Ga0501072_0123769 3300049588 Bacteria 2060
652 Ga0501072_0199328 3300049588 Bacteria 1596
653 Ga0501073_0009857 3300049589 Bacteria 7028
654 Ga0501074_0056052 3300049590 Bacteria 2840
655 Ga0501074_0064797 3300049590 Bacteria 2631
656 Ga0501074_0238004 3300049590 Bacteria 1295
657 Ga0501075_0011522 3300049591 Bacteria 6258
658 Ga0501075_0154545 3300049591 Bacteria 1749
659 Ga0501076_0016491 3300049592 Bacteria 5601
660 Ga0501076_0050875 3300049592 Bacteria 3278
661 Ga0501076_0061808 3300049592 Bacteria 2981
662 Ga0501077_0007715 3300049593 Bacteria 6642
663 Ga0501077_0114284 3300049593 Bacteria 1712
664 Ga0501079_0001187 3300049741 Bacteria 18244
665 Ga0501079_0065344 3300049741 Bacteria 2806
666 Ga0501080_0002465 3300049742 Bacteria 16197
667 Ga0501080_0013521 3300049742 Bacteria 7511
668 Ga0501080_0112812 3300049742 Bacteria 2520
669 Ga0501080_0253779 3300049742 Bacteria 1603
670 Ga0501080_0356880 3300049742 Bacteria 1319
671 Ga0501080_0363716 3300049742 Bacteria 1305
672 Ga0501081_0000552 3300049743 Bacteria 21253
673 Ga0501081_0038542 3300049743 Bacteria 3266
674 Ga0501083_0023713 3300049744 Bacteria 4255
675 Ga0501083_0044876 3300049744 Bacteria 2992
676 Ga0501083_0069092 3300049744 Bacteria 2351
677 Ga0501035_0013774 3300049822 Bacteria 7465
678 Ga0501035_0107081 3300049822 Bacteria 2450
679 Ga0501035_0264077 3300049822 Bacteria 1458
680 Ga0501044_0019395 3300049823 Bacteria 7276
681 Ga0501045_0057758 3300049824 Bacteria 2840
682 nmdc:mga0k408_49235_c1 3300050493 Bacteria 2439
683 nmdc:mga05p37_156720_c1 3300050507 Bacteria 2782
684 nmdc:mga05p37_2656_c2 3300050507 Bacteria 17190
685 nmdc:mga09592_69991_c1 3300050508 Bacteria 2976
686 nmdc:mga06r32_221935_c1 3300050510 Bacteria 1878
687 nmdc:mga06r32_96795_c1 3300050510 Bacteria 2891
688 nmdc:mga08y16_16056_c1 3300050511 Bacteria 7873
689 nmdc:mga08y16_311774_c1 3300050511 Bacteria 1620
690 nmdc:mga08y16_328713_c1 3300050511 Bacteria 1573
691 nmdc:mga08y16_33445_c1 3300050511 Bacteria 5400
692 nmdc:mga08y16_51009_c1 3300050511 Bacteria 4329
693 nmdc:mga0n895_22023_c1 3300050512 Bacteria 5971
694 nmdc:mga0n895_61570_c1 3300050512 Bacteria 3706
695 nmdc:mga0rr50_103855_c1 3300050513 Bacteria 2237
696 nmdc:mga0rr50_167360_c1 3300050513 Bacteria 1788
697 nmdc:mga08x19_28543_c1 3300050514 Bacteria 3495
698 nmdc:mga0a205_5535_c1 3300050515 Bacteria 11378
699 nmdc:mga0a205_76398_c1 3300050515 Bacteria 3237
700 Ga0500635_0000052 3300053080 Bacteria 75372
701 Ga0495619_0005673 3300053085 Bacteria 7916
702 Ga0500578_0000124 3300053086 Bacteria 92437
703 Ga0500644_0000153 3300053088 Bacteria 43050
704 Ga0500583_0111747 3300053092 Bacteria 1346
705 Ga0500651_0020066 3300053093 Bacteria 4159
706 Ga0500555_003265 3300053103 Bacteria 4616
707 Ga0500556_0070161 3300053104 Bacteria 1307
708 Ga0500562_006378 3300053108 Bacteria 2974
709 Ga0500594_0000740 3300053118 Bacteria 6939
710 Ga0500595_015695 3300053119 Bacteria 2837
711 Ga0500607_065012 3300053121 Bacteria 1897
712 Ga0500608_000784 3300053122 Bacteria 11594
713 Ga0500608_001857 3300053122 Bacteria 7532
714 Ga0500608_010380 3300053122 Bacteria 3996
715 Ga0500614_008541 3300053123 Bacteria 2172
716 Ga0500618_001535 3300053125 Bacteria 10128
717 Ga0500642_0092318 3300053130 Bacteria 1400
718 Ga0500658_0006065 3300053134 Bacteria 4493
719 Ga0500658_0051430 3300053134 Bacteria 1684
720 Ga0500559_0001246 3300053136 Bacteria 14976
721 Ga0500559_0016293 3300053136 Bacteria 3138
722 Ga0500559_0046638 3300053136 Bacteria 1901
723 Ga0500564_002766 3300053138 Bacteria 6602
724 Ga0500622_0006026 3300053156 Bacteria 7123
725 Ga0500622_0078108 3300053156 Bacteria 1661
726 Ga0500627_0000005 3300053158 Bacteria 167950
727 Ga0500636_0023183 3300053177 Bacteria 3669
728 Ga0500637_0012684 3300053178 Bacteria 4399
729 Ga0500637_0040237 3300053178 Bacteria 2639
730 Ga0500637_0054807 3300053178 Bacteria 2276
731 Ga0500645_026619 3300053730 Bacteria 1759
732 Ga0501084_0012410 3300054114 Bacteria 7060
733 Ga0501084_0013640 3300054114 Bacteria 6726
734 Ga0501084_0068400 3300054114 Bacteria 2973
735 Ga0501084_0194466 3300054114 Bacteria 1711
736 Ga0501082_0006434 3300060353 Bacteria 10192
737 Ga0501082_0013531 3300060353 Bacteria 7010
738 Ga0501082_0033299 3300060353 Bacteria 4446
739 Ga0501082_0061877 3300060353 Bacteria 3222
740 Ga0501082_0105632 3300060353 Bacteria 2436
741 Ga0530510_0009039 3300061734 Bacteria 6983
742 Ga0530510_0025731 3300061734 Bacteria 4209
743 Ga0530510_0063005 3300061734 Bacteria 2685
744 Ga0530510_0123794 3300061734 Bacteria 1900
745 Ga0530510_0178921 3300061734 Bacteria 1572
746 2511122906 2510917020 Bacteria 5657507
747 2585147874 2582581279 Bacteria 4980720
748 2585152312 2582581280 Bacteria 5994497
749 2585198983 2582581293 Bacteria 5907401
750 2587918372 2585428106 Bacteria 5179711
751 2643750041 2643221545 Bacteria 5083237
752 2643782537 2643221552 Bacteria 5708754
753 2643835892 2643221563 Bacteria 4726935
754 2643923189 2643221583 Bacteria 5218014
755 2643928748 2643221584 Bacteria 5511711
756 2644056817 2643221608 Bacteria 4724829
757 2644227736 2643221640 Bacteria 5258820
758 2644234003 2643221642 Bacteria 5357871
759 2644510803 2643221691 Bacteria 5093099
760 2738711057 2738541275 Bacteria 4830863
761 2738849482 2738541301 Bacteria 4834102
762 2738865211 2738541304 Bacteria 4833665
763 2739297729 2738543022 Bacteria 4835059
764 2739359407 2738543033 Bacteria 4833336
765 2739790377 2739367756 Bacteria 4553612
766 2753463060 2751185821 Bacteria 6189929
767 2792460183 2791355048 Bacteria 5832535
768 2819535658 2818991435 Bacteria 5433759
769 2819644933 2818991454 Bacteria 5563326
770 2843746752 2843744320 Bacteria 5659202
771 2849562832 2849560528 Bacteria 5393480
772 2849576739 2849573788 Bacteria 5421256
773 2851154033 2851153111 Bacteria 5542585
774 2852655473 2852653556 Bacteria 4050083
775 2852681393 2852680915 Bacteria 4100189
776 2857505423 2857504554 Bacteria 5369913
777 2884962312 2884960567 Bacteria 5437054
778 2898333356 2898329390 Bacteria 5168154
779 2928103669 2928100450 Bacteria 4837635
780 2928533118 2928531327 Bacteria 5101314
781 2928961318 2928959182 Bacteria 4725774
782 Ga0209758_1002327
783 rootL2_10006987
784 Ga0055537_1001980
785 Ga0055524_1017208
786 Ga0055536_1000787
787 Ga0055536_1002943
788 Ga0055536_1003896
789 Ga0055536_1005195
790 Ga0055536_1011827
791 Ga0055534_1008899
792 Ga0055528_1002045
793 Ga0055530_10000270
794 Ga0055530_10013210
795 Ga0055530_10021046
796 Ga0055530_10025806
797 Ga0055531_10000371
798 Ga0055531_10002055
799 Ga0055531_10002062
800 Ga0055531_10024253
801 Ga0055531_10024327
802 Ga0065165_1007528
803 Ga0070683_100042785
804 Ga0070690_100002434
805 Ga0070690_100004347
806 Ga0070670_100098031
807 Ga0070666_10000962
808 Ga0070680_100013082
809 Ga0068868_100004028
810 Ga0068868_100015991
811 Ga0070660_100106440
812 Ga0070689_100110960
813 Ga0070661_100037327
814 Ga0070692_10037764
815 Ga0070668_100006431
816 Ga0070668_100035551
817 Ga0070669_100015669
818 Ga0070669_100089659
819 Ga0070675_100002824
820 Ga0070675_100003925
821 Ga0070675_100189374
822 Ga0070671_100000657
823 Ga0070671_100001534
824 Ga0070671_100004754
825 Ga0070671_100103761
826 Ga0070673_100001288
827 Ga0070688_100003170
828 Ga0070659_100001767
829 Ga0070667_100041630
830 Ga0070667_100108820
831 Ga0070709_10007519
832 Ga0070709_10008679
833 Ga0070714_100006553
834 Ga0070714_100029604
835 Ga0070713_100012067
836 Ga0070713_100013671
837 Ga0070710_10003818
838 Ga0070701_10058066
839 Ga0070711_100000991
840 Ga0070711_100002860
841 Ga0070711_100007365
842 Ga0070705_100038144
843 Ga0070700_100042304
844 Ga0070663_100014095
845 Ga0070678_100001008
846 Ga0070678_100005204
847 Ga0070662_100070774
848 Ga0070681_10001577
849 Ga0070681_10001582
850 Ga0070681_10008934
851 Ga0070681_10024376
852 Ga0070681_10131966
853 Ga0070699_100023197
854 Ga0070679_100000469
855 Ga0070679_100025516
856 Ga0070679_100206288
857 Ga0070679_100245050
858 Ga0070684_100297982
859 Ga0068853_100054163
860 Ga0068853_100340741
861 Ga0070672_100018389
862 Ga0070686_100007351
863 Ga0070695_100001122
864 Ga0070695_100046465
865 Ga0070696_100003437
866 Ga0070696_100064546
867 Ga0070693_100004808
868 Ga0070693_100096717
869 Ga0070665_100002122
870 Ga0070704_100007227
871 Ga0070704_100054768
872 Ga0070704_100129263
873 Ga0068855_100001482
874 Ga0068855_100001944
875 Ga0068855_100152015
876 Ga0070664_100004986
877 Ga0068857_100066753
878 Ga0068857_100121702
879 Ga0068854_100013995
880 Ga0068854_100240349
881 Ga0068856_100008652
882 Ga0068856_100113281
883 Ga0068856_100389140
884 Ga0070702_100000727
885 Ga0068852_100108169
886 Ga0068859_100043197
887 Ga0068859_100069694
888 Ga0068859_100081028
889 Ga0068859_100109922
890 Ga0068859_100207818
891 Ga0068864_100000096
892 Ga0068864_100017049
893 Ga0068864_100035560
894 Ga0068866_10008386
895 Ga0068866_10090683
896 Ga0068861_100003267
897 Ga0068863_100000041
898 Ga0068863_100005625
899 Ga0068863_100022625
900 Ga0068863_100022759
901 Ga0068858_100000108
902 Ga0068858_100007229
903 Ga0068858_100019147
904 Ga0068858_100156156
905 Ga0068860_100007155
906 Ga0068860_100007202
907 Ga0068860_100012873
908 Ga0068860_100022565
909 Ga0068862_100000059
910 Ga0068862_100077587
911 Ga0081455_10001941
912 Ga0081455_10052856
913 Ga0070715_10001572
914 Ga0070715_10003057
915 Ga0070716_100000449
916 Ga0070716_100133192
917 Ga0070712_100052794
918 Ga0075369_10052968
919 Ga0075366_10065725
920 Ga0097621_100322680
921 Ga0068871_100026906
922 Ga0075428_100012185
923 Ga0075431_100048414
924 Ga0075433_10002458
925 Ga0075433_10008589
926 Ga0075434_100000766
927 Ga0075434_100017502
928 Ga0068865_100000735
929 Ga0068865_100252483
930 Ga0097620_100043196
931 Ga0097620_100069696
932 Ga0097620_100081026
933 Ga0097620_100109919
934 Ga0097620_100207827
935 Ga0099795_10000022
936 Ga0105250_10024018
937 Ga0105250_10035519
938 Ga0105240_10002705
939 Ga0105240_10003826
940 Ga0105240_10008281
941 Ga0105240_10024889
942 Ga0105240_10111111
943 Ga0105240_10150093
944 Ga0111539_10000539
945 Ga0111539_10005627
946 Ga0111539_10683492
947 Ga0105245_10000738
948 Ga0105245_10007920
949 Ga0105247_10002269
950 Ga0105247_10010243
951 Ga0105247_10012409
952 Ga0105247_10021799
953 Ga0114129_10010448
954 Ga0114129_10089316
955 Ga0114129_10289030
956 Ga0105241_10007997
957 Ga0105242_10005298
958 Ga0105242_10050505
959 Ga0105248_10001268
960 Ga0105248_10003698
961 Ga0105248_10005489
962 Ga0105248_10024418
963 Ga0105248_10067758
964 Ga0105248_10111326
965 Ga0105248_10199938
966 Ga0105237_10014418
967 Ga0105237_10104733
968 Ga0105237_10164315
969 Ga0105237_10204122
970 Ga0105238_10005376
971 Ga0105238_10006381
972 Ga0105249_10000065
973 Ga0105249_10008955
974 Ga0105030_100135
975 Ga0099796_10000025
976 Ga0099796_10001494
977 Ga0105239_10000694
978 Ga0105239_10005723
979 Ga0105246_10003747
980 Ga0157371_10097944
981 Ga0157370_10001472
982 Ga0157370_10086899
983 Ga0157369_10006045
984 Ga0157369_10065057
985 Ga0157369_10115433
986 Ga0157369_10256981
987 Ga0157369_10334481
988 Ga0157374_10007656
989 Ga0157374_10102377
990 Ga0157374_10289571
991 Ga0157374_10507111
992 Ga0157378_10004873
993 Ga0163162_10004801
994 Ga0157372_10014940
995 Ga0157372_10071871
996 Ga0157375_10004187
997 Ga0157375_10018198
998 Ga0157375_10071259
999 Ga0163163_10010899
1000 Ga0163163_10029400
1001 Ga0163163_10101260
1002 Ga0157380_10004376
1003 Ga0157377_10103846
1004 Ga0157379_10006630
1005 Ga0157379_10030721
1006 Ga0157379_10126453
1007 Ga0157376_10000896
1008 Ga0157376_10013774
1009 Ga0157376_10106809
1010 Ga0157376_10115157
1011 Ga0183365_10004
1012 Ga0163161_10115144
1013 Ga0213872_10000038
1014 Ga0213872_10018666
1015 Ga0213872_10036249
1016 Ga0213872_10079967
1017 Ga0213875_10000081
1018 Ga0213875_10000307
1019 Ga0224572_1008387
1020 Ga0209565_1000065
1021 Ga0209673_1000818
1022 Ga0209675_1000275
1023 Ga0209676_1000085
1024 Ga0209676_1000171
1025 Ga0209676_1000177
1026 Ga0209676_1000349
1027 Ga0209676_1000648
1028 Ga0209564_1001008
1029 Ga0209758_1004537
1030 Ga0209050_1000042
1031 Ga0209050_1000496
1032 Ga0209050_1001766
1033 Ga0209050_1008080
1034 Ga0209050_1014594
1035 Ga0209256_1000855
1036 Ga0209051_1001860
1037 Ga0209257_1000074
1038 Ga0209257_1000135
1039 Ga0209257_1000253
1040 Ga0209257_1000482
1041 Ga0209257_1002290
1042 Ga0209257_1006411
1043 Ga0207692_10058000
1044 Ga0207710_10003083
1045 Ga0207710_10095544
1046 Ga0207688_10033699
1047 Ga0207688_10111822
1048 Ga0207680_10114148
1049 Ga0207680_10136162
1050 Ga0207647_10001136
1051 Ga0207699_10009239
1052 Ga0207699_10013238
1053 Ga0207699_10026246
1054 Ga0207707_10000122
1055 Ga0207707_10036563
1056 Ga0207707_10044816
1057 Ga0207707_10106221
1058 Ga0207707_10129357
1059 Ga0207695_10002114
1060 Ga0207695_10003540
1061 Ga0207695_10024615
1062 Ga0207695_10076336
1063 Ga0207695_10332380
1064 Ga0207671_10009799
1065 Ga0207671_10023246
1066 Ga0207671_10097681
1067 Ga0207693_10000083
1068 Ga0207693_10000551
1069 Ga0207663_10003079
1070 Ga0207663_10014494
1071 Ga0207663_10048556
1072 Ga0207660_10004896
1073 Ga0207660_10024101
1074 Ga0207660_10197635
1075 Ga0207662_10001396
1076 Ga0207657_10008555
1077 Ga0207652_10000613
1078 Ga0207652_10032150
1079 Ga0207652_10099654
1080 Ga0207694_10003403
1081 Ga0207694_10102396
1082 Ga0207659_10007954
1083 Ga0207687_10017700
1084 Ga0207687_10110472
1085 Ga0207700_10146086
1086 Ga0207664_10002133
1087 Ga0207644_10156497
1088 Ga0207706_10001303
1089 Ga0207686_10012915
1090 Ga0207686_10075458
1091 Ga0207670_10052443
1092 Ga0207704_10004318
1093 Ga0207704_10100132
1094 Ga0207665_10000478
1095 Ga0207665_10000587
1096 Ga0207665_10113687
1097 Ga0207691_10006970
1098 Ga0207711_10002830
1099 Ga0207711_10005213
1100 Ga0207711_10014144
1101 Ga0207711_10071669
1102 Ga0207711_10189111
1103 Ga0207689_10246610
1104 Ga0207661_10208532
1105 Ga0207667_10000798
1106 Ga0207667_10010115
1107 Ga0207667_10045147
1108 Ga0207667_10058371
1109 Ga0207712_10000002
1110 Ga0207712_10086967
1111 Ga0207668_10004667
1112 Ga0207668_10028281
1113 Ga0207640_10012125
1114 Ga0207640_10056000
1115 Ga0207677_10057269
1116 Ga0207703_10000035
1117 Ga0207703_10028593
1118 Ga0207703_10034034
1119 Ga0207703_10065995
1120 Ga0207703_10251779
1121 Ga0207702_10014159
1122 Ga0207702_10128842
1123 Ga0207641_10000027
1124 Ga0207641_10001424
1125 Ga0207641_10012457
1126 Ga0207641_10031125
1127 Ga0207648_10031254
1128 Ga0207676_10000418
1129 Ga0207674_10005594
1130 Ga0207675_100003266
1131 Ga0207683_10004828
1132 Ga0207683_10004897
1133 Ga0207698_10129894
1134 Ga0209971_1011656
1135 Ga0209974_10005604
1136 Ga0207428_10005547
1137 Ga0207428_10014951
1138 Ga0207428_10085930
1139 Ga0268266_10086554
1140 Ga0268265_10000114
1141 Ga0268265_10002149
1142 Ga0268265_10097925
1143 Ga0268264_10000562
1144 Ga0268264_10018337
1145 Ga0268264_10096693
1146 Ga0268264_10161239
1147 Ga0268264_10185166
1148 Ga0268264_10387470
1149 Ga0265326_10003138
1150 Ga0265334_10010215
1151 Ga0265318_10001836
1152 Ga0307515_10045057
1153 Ga0265338_10027362
1154 Ga0307511_10000268
1155 Ga0265330_10004483
1156 Ga0265332_10003174
1157 Ga0265328_10014767
1158 Ga0265328_10034097
1159 Ga0265320_10010245
1160 Ga0265320_10044698
1161 Ga0265329_10002693
1162 Ga0265339_10074777
1163 Ga0265331_10009724
1164 Ga0265327_10001660
1165 Ga0265316_10049287
1166 Ga0307513_10002752
1167 Ga0307513_10020402
1168 Ga0307509_10003194
1169 Ga0307408_100016261
1170 Ga0307508_10061746
1171 Ga0265314_10022086
1172 Ga0265342_10012843
1173 Ga0316576_10017920
1174 Ga0307405_10315093
1175 Ga0307413_10031975
1176 Ga0307410_10191260
1177 Ga0307410_10219450
1178 Ga0307410_10233460
1179 Ga0307412_10100891
1180 Ga0307409_100028297
1181 Ga0307409_100289090
1182 Ga0307416_100003094
1183 Ga0307416_100042886
1184 Ga0307414_10013586
1185 Ga0307414_10022560
1186 Ga0307414_10038574
1187 Ga0307411_10048225
1188 Ga0307415_100001180
1189 Ga0373923_0020999
1190 Ga0373945_0023197
1191 Ga0373945_0068007
1192 Ga0373943_0047771
1193 Ga0373946_0017825
1194 Ga0373946_0094953
1195 Ga0373942_0010698
1196 Ga0373961_0031387
1197 Ga0373962_0028711
1198 Ga0373931_0088269
1199 Ga0373931_0155118
1200 Ga0373935_0108787
1201 Ga0373927_0006326
1202 Ga0373927_0015626
1203 Ga0373927_0148040
1204 Ga0373933_0012987
1205 Ga0373947_0140208
1206 Ga0373947_0185355
1207 Ga0373937_0031120
1208 Ga0373937_0048457
1209 Ga0373937_0100366
1210 Ga0316584_0068487
1211 Ga0373925_0093366
1212 Ga0395900_0084547
1213 Ga0395898_0020760
1214 Ga0395898_0036071
1215 Ga0395905_0000136
1216 Ga0436364_0210071
1217 Ga0436364_0560002
1218 Ga0436364_0822555
1219 Ga0436364_0856291
1220 Ga0400489_17737
1221 Ga0436365_0969803
1222 Ga0436360_1031300
1223 Ga0436361_0200397
1224 Ga0436361_0328064
1225 Ga0436361_1108648
1226 Ga0436363_1410071
1227 Ga0439454_005654
1228 Ga0450920_007942
1229 Ga0450890_007161
1230 Ga0439446_0045152
1231 Ga0439446_0054380
1232 Ga0450908_003021
1233 Ga0439434_0003968
1234 Ga0439435_0001752
1235 Ga0451577_0000194
1236 Ga0451577_0041605
1237 Ga0451577_0090539
1238 Ga0451577_0106942
1239 Ga0466969_0003345
1240 Ga0466965_0224118
1241 Ga0453684_0000218
1242 Ga0466957_0130437
1243 Ga0466959_0035356
1244 Ga0451576_0000643
1245 Ga0451576_0013885
1246 Ga0451576_0049885
1247 Ga0451576_0343852
1248 Ga0495627_001458
1249 Ga0495603_0006487
1250 Ga0495603_0015445
1251 Ga0495590_0013702
1252 Ga0495629_0001118
1253 Ga0495638_0000147
1254 Ga0495638_0009919
1255 Ga0495638_0012304
1256 Ga0495638_0016883
1257 Ga0495638_0063163
1258 Ga0495650_0000045
1259 Ga0495580_0003653
1260 Ga0495580_0008705
1261 Ga0495582_0000461
1262 Ga0495639_0030378
1263 Ga0495594_0000049
1264 Ga0495594_0074049
1265 Ga0495607_0140519
1266 Ga0495583_0000005
1267 Ga0495583_0023608
1268 Ga0495606_0005055
1269 Ga0495610_0000101
1270 Ga0495610_0002849
1271 Ga0495610_0112313
1272 Ga0495616_0001495
1273 Ga0495618_0149756
1274 Ga0495620_0059358
1275 Ga0495631_0002007
1276 Ga0495632_0006366
1277 Ga0495632_0067821
1278 Ga0495648_0003254
1279 Ga0495666_0053701
1280 Ga0495654_0000018
1281 Ga0495665_0014972
1282 Ga0495597_0002750
1283 Ga0495622_0002657
1284 Ga0495622_0020281
1285 Ga0495668_0000001
1286 Ga0495668_0000026
1287 Ga0495668_0051407
1288 Ga0495668_0068994
1289 Ga0495634_0040795
1290 Ga0495611_0034808
1291 Ga0495625_0000099
1292 Ga0495625_0000373
1293 Ga0495625_0023590
1294 Ga0495625_0043033
1295 Ga0495625_0052636
1296 Ga0495625_0055958
1297 Ga0495625_0138550
1298 Ga0495669_0000321
1299 Ga0495613_0000244
1300 Ga0495649_0012413
1301 Ga0495660_0007468
1302 Ga0495581_0092426
1303 Ga0495604_0043627
1304 Ga0495672_0000472
1305 Ga0495672_0091436
1306 Ga0495676_0034293
1307 Ga0495680_0113860
1308 Ga0495687_040408
1309 Ga0495673_0000119
1310 Ga0495673_0000967
1311 Ga0495673_0045019
1312 Ga0495686_0023674
1313 Ga0495686_0049321
1314 Ga0495593_0008379
1315 Ga0495593_0032243
1316 Ga0495602_0048266
1317 Ga0495626_0029671
1318 Ga0496100_0003273
1319 Ga0496100_0007689
1320 Ga0496100_0217204
1321 Ga0496100_0264167
1322 Ga0496101_0025222
1323 Ga0496101_0149515
1324 Ga0496102_0006064
1325 Ga0496102_0040309
1326 Ga0496102_0042344
1327 Ga0496102_0096849
1328 Ga0496102_0097177
1329 Ga0496102_0171477
1330 Ga0496102_0223101
1331 Ga0496102_0338449
1332 Ga0496103_0023391
1333 Ga0496103_0063876
1334 Ga0496103_0130479
1335 Ga0496104_0032491
1336 Ga0496104_0211380
1337 Ga0496105_0001071
1338 Ga0496105_0005319
1339 Ga0496105_0010006
1340 Ga0496106_0002565
1341 Ga0496106_0013682
1342 Ga0496106_0034515
1343 Ga0496107_0000168
1344 Ga0496107_0001015
1345 Ga0496107_0034840
1346 Ga0496107_0039577
1347 Ga0496108_0021858
1348 Ga0496108_0171428
1349 Ga0496108_0544658
1350 Ga0496109_0011744
1351 Ga0496109_0055487
1352 Ga0496109_0115142
1353 Ga0496109_0196080
1354 Ga0496109_0204093
1355 Ga0496110_0000749
1356 Ga0496110_0035854
1357 Ga0496110_0104477
1358 Ga0496111_0065590
1359 Ga0496111_0085738
1360 Ga0496111_0087686
1361 Ga0496111_0168869
1362 Ga0496112_0011995
1363 Ga0496112_0138205
1364 Ga0496114_0004273
1365 Ga0496114_0004355
1366 Ga0496115_0016363
1367 Ga0496115_0035704
1368 Ga0496115_0129385
1369 Ga0496115_0283866
1370 Ga0496116_0064059
1371 Ga0496117_0006424
1372 Ga0496117_0031376
1373 Ga0496118_0001617
1374 Ga0496118_0013816
1375 Ga0496118_0026400
1376 Ga0496118_0036145
1377 Ga0496118_0049114
1378 Ga0496119_0017203
1379 Ga0496121_0000067
1380 Ga0496121_0000971
1381 Ga0496121_0004117
1382 Ga0496121_0014418
1383 Ga0496121_0041725
1384 Ga0496124_0009920
1385 Ga0496125_0030293
1386 Ga0496126_0002263
1387 Ga0496126_0026027
1388 Ga0495678_006910
1389 Ga0501031_0022942
1390 Ga0501031_0123276
1391 Ga0501032_0063880
1392 Ga0501033_0140245
1393 Ga0501033_0210888
1394 Ga0501034_0159316
1395 Ga0501034_0229596
1396 Ga0501036_0069542
1397 Ga0501036_0127718
1398 Ga0501038_0175975
1399 Ga0501039_0060357
1400 Ga0501039_0065361
1401 Ga0501039_0223194
1402 Ga0501040_0207821
1403 Ga0501041_0007554
1404 Ga0501041_0020253
1405 Ga0501041_0151457
1406 Ga0501042_0024795
1407 Ga0501042_0028271
1408 Ga0501042_0041353
1409 Ga0501043_0047123
1410 Ga0501043_0092072
1411 Ga0501043_0288899
1412 Ga0501046_0093862
1413 Ga0501046_0104003
1414 Ga0501047_0097175
1415 Ga0501047_0371876
1416 Ga0501048_0049420
1417 Ga0501048_0059167
1418 Ga0501067_0015248
1419 Ga0501067_0046897
1420 Ga0501067_0066958
1421 Ga0501068_0021133
1422 Ga0501068_0121652
1423 Ga0501070_0268112
1424 Ga0501071_0023605
1425 Ga0501071_0180334
1426 Ga0501071_0197755
1427 Ga0501072_0023049
1428 Ga0501072_0026249
1429 Ga0501072_0060245
1430 Ga0501072_0094984
1431 Ga0501072_0120064
1432 Ga0501072_0123769
1433 Ga0501072_0199328
1434 Ga0501073_0009857
1435 Ga0501074_0056052
1436 Ga0501074_0064797
1437 Ga0501074_0238004
1438 Ga0501075_0011522
1439 Ga0501075_0154545
1440 Ga0501076_0016491
1441 Ga0501076_0050875
1442 Ga0501076_0061808
1443 Ga0501077_0007715
1444 Ga0501077_0114284
1445 Ga0501079_0001187
1446 Ga0501079_0065344
1447 Ga0501080_0002465
1448 Ga0501080_0013521
1449 Ga0501080_0112812
1450 Ga0501080_0253779
1451 Ga0501080_0356880
1452 Ga0501080_0363716
1453 Ga0501081_0000552
1454 Ga0501081_0038542
1455 Ga0501083_0023713
1456 Ga0501083_0044876
1457 Ga0501083_0069092
1458 Ga0501035_0013774
1459 Ga0501035_0107081
1460 Ga0501035_0264077
1461 Ga0501044_0019395
1462 Ga0501045_0057758
1463 nmdc:mga0k408_49235_c1
1464 nmdc:mga05p37_156720_c1
1465 nmdc:mga05p37_2656_c2
1466 nmdc:mga09592_69991_c1
1467 nmdc:mga06r32_221935_c1
1468 nmdc:mga06r32_96795_c1
1469 nmdc:mga08y16_16056_c1
1470 nmdc:mga08y16_311774_c1
1471 nmdc:mga08y16_328713_c1
1472 nmdc:mga08y16_33445_c1
1473 nmdc:mga08y16_51009_c1
1474 nmdc:mga0n895_22023_c1
1475 nmdc:mga0n895_61570_c1
1476 nmdc:mga0rr50_103855_c1
1477 nmdc:mga0rr50_167360_c1
1478 nmdc:mga08x19_28543_c1
1479 nmdc:mga0a205_5535_c1
1480 nmdc:mga0a205_76398_c1
1481 Ga0500635_0000052
1482 Ga0495619_0005673
1483 Ga0500578_0000124
1484 Ga0500644_0000153
1485 Ga0500583_0111747
1486 Ga0500651_0020066
1487 Ga0500555_003265
1488 Ga0500556_0070161
1489 Ga0500562_006378
1490 Ga0500594_0000740
1491 Ga0500595_015695
1492 Ga0500607_065012
1493 Ga0500608_000784
1494 Ga0500608_001857
1495 Ga0500608_010380
1496 Ga0500614_008541
1497 Ga0500618_001535
1498 Ga0500642_0092318
1499 Ga0500658_0006065
1500 Ga0500658_0051430
1501 Ga0500559_0001246
1502 Ga0500559_0016293
1503 Ga0500559_0046638
1504 Ga0500564_002766
1505 Ga0500622_0006026
1506 Ga0500622_0078108
1507 Ga0500627_0000005
1508 Ga0500636_0023183
1509 Ga0500637_0012684
1510 Ga0500637_0040237
1511 Ga0500637_0054807
1512 Ga0500645_026619
1513 Ga0501084_0012410
1514 Ga0501084_0013640
1515 Ga0501084_0068400
1516 Ga0501084_0194466
1517 Ga0501082_0006434
1518 Ga0501082_0013531
1519 Ga0501082_0033299
1520 Ga0501082_0061877
1521 Ga0501082_0105632
1522 Ga0530510_0009039
1523 Ga0530510_0025731
1524 Ga0530510_0063005
1525 Ga0530510_0123794
1526 Ga0530510_0178921
1527 2511122906
1528 2585147874
1529 2585152312
1530 2585198983
1531 2587918372
1532 2643750041
1533 2643782537
1534 2643835892
1535 2643923189
1536 2643928748
1537 2644056817
1538 2644227736
1539 2644234003
1540 2644510803
1541 2738711057
1542 2738849482
1543 2738865211
1544 2739297729
1545 2739359407
1546 2739790377
1547 2753463060
1548 2792460183
1549 2819535658
1550 2819644933
1551 2843746752
1552 2849562832
1553 2849576739
1554 2851154033
1555 2852655473
1556 2852681393
1557 2857505423
1558 2884962312
1559 2898333356
1560 2928103669
1561 2928533118
1562 2928961318

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

189

0.98

PF08402

TOBE_2

TOBE domain

306

396

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9431 1 193
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9381 1 176
3nix-assembly2.cif.gz_B crystal structure of flavoprotein/dehydrogenase from cytophaga hutchinsonii. northeast structural genomics consortium target chr43. 0.9372 271 299
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9339 1 176
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9317 1 193
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9834 1 177 3.40.50.300
2awnC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9614 1 195 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9602 1 196 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9569 1 195 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 1 178 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A447PH14-F1-model_v4 Putrescine transport ATP-binding protein PotG (EC 3.6.3.31) 0.9887 50 183 GO:0005524
GO:0016887
AF-A0A5J4F8B2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.9815 1 200 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A848WQ45-F1-model_v4 ABC transporter ATP-binding protein 0.9795 1 195 GO:0005524
GO:0016887
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9795 1 157 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A534HSD0-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.979 1 179 GO:0005524
GO:0016887

Map