F480563
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 781 | 414 | 1562 | 377 |
Family's Representative Sequence
| Representative Sequence | 3300025297|Ga0209758_1002327|Ga0209758_100232715 |
| Length | 398 |
| Sequence | VPVPVPRTGGPKRASGGGIFGGDDVTNQPIITFENVTKRFGKMVAVDDVSLSIQEGEFFSLLGPSGCGKTTLLRMLAGFETPTEGRILIDGQDVSTVPPNKRPVNMVFQSYAVFPHMSVADNVAYGLKVDRVSKAERDRRVEEALDLVQLHGLAQRKPDQLSGGQRQRVALARALVKRPRVLLLDEPLSALDAKLRDQMRTELCTLQEKVGITFIMVTHDQDEALALASRCAVMNRGVLQQVAGPSDLYEFPNSRFVADFIGSVNLFEGVLAVDEPSHAVVKSPDLDCDIFLDHGVTGARGGTVWAALRPEKIELHKRPDGAAPPNMGDCPLGQNAVAGVIRHEAYLGGQSVYEVEIQSGRRIKVVRQNLTRWDQEDFKLGEAVWLGWHACSPAVLLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 181 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 191 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 230 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 231 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 232 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 235 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 236 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 304 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 305 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 306 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 307 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 357 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 358 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 364 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 365 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 366 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 368 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 370 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 372 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 375 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 379 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 380 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 381 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 382 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 383 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 384 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 385 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 386 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 387 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 388 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 389 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 390 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 391 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 392 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 393 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 394 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 395 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 396 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 397 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 398 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 399 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 400 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 401 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 402 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 403 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 404 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 405 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 406 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 407 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 408 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 409 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 410 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 411 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 412 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 413 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 414 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.39 |
| Metatranscriptomes | 0 |
| Isolates | 4.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.86 |
| Nodule | 0 |
| Rhizoplane | 6.66 |
| Rhizosphere | 76.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209758_1002327 | 3300025297 | Bacteria | 19634 |
| 2 | rootL2_10006987 | 3300003322 | Bacteria | 5241 |
| 3 | Ga0055537_1001980 | 3300003773 | Bacteria | 7305 |
| 4 | Ga0055524_1017208 | 3300003775 | Bacteria | 2558 |
| 5 | Ga0055536_1000787 | 3300003781 | Bacteria | 21133 |
| 6 | Ga0055536_1002943 | 3300003781 | Bacteria | 9354 |
| 7 | Ga0055536_1003896 | 3300003781 | Bacteria | 7833 |
| 8 | Ga0055536_1005195 | 3300003781 | Bacteria | 6430 |
| 9 | Ga0055536_1011827 | 3300003781 | Bacteria | 3298 |
| 10 | Ga0055534_1008899 | 3300003784 | Bacteria | 2229 |
| 11 | Ga0055528_1002045 | 3300003790 | Bacteria | 11275 |
| 12 | Ga0055530_10000270 | 3300003791 | Bacteria | 46941 |
| 13 | Ga0055530_10013210 | 3300003791 | Bacteria | 2828 |
| 14 | Ga0055530_10021046 | 3300003791 | Bacteria | 1933 |
| 15 | Ga0055530_10025806 | 3300003791 | Bacteria | 1634 |
| 16 | Ga0055531_10000371 | 3300003794 | Bacteria | 43284 |
| 17 | Ga0055531_10002055 | 3300003794 | Bacteria | 13881 |
| 18 | Ga0055531_10002062 | 3300003794 | Bacteria | 13854 |
| 19 | Ga0055531_10024253 | 3300003794 | Bacteria | 2245 |
| 20 | Ga0055531_10024327 | 3300003794 | Bacteria | 2239 |
| 21 | Ga0065165_1007528 | 3300005262 | Bacteria | 5323 |
| 22 | Ga0070683_100042785 | 3300005329 | Bacteria | 4172 |
| 23 | Ga0070690_100002434 | 3300005330 | Bacteria | 10014 |
| 24 | Ga0070690_100004347 | 3300005330 | Bacteria | 7857 |
| 25 | Ga0070670_100098031 | 3300005331 | Bacteria | 2522 |
| 26 | Ga0070666_10000962 | 3300005335 | Bacteria | 17567 |
| 27 | Ga0070680_100013082 | 3300005336 | Bacteria | 6459 |
| 28 | Ga0068868_100004028 | 3300005338 | Bacteria | 10248 |
| 29 | Ga0068868_100015991 | 3300005338 | Bacteria | 5563 |
| 30 | Ga0070660_100106440 | 3300005339 | Bacteria | 2227 |
| 31 | Ga0070689_100110960 | 3300005340 | Bacteria | 2181 |
| 32 | Ga0070661_100037327 | 3300005344 | Bacteria | 3534 |
| 33 | Ga0070692_10037764 | 3300005345 | Bacteria | 2457 |
| 34 | Ga0070668_100006431 | 3300005347 | Bacteria | 8710 |
| 35 | Ga0070668_100035551 | 3300005347 | Bacteria | 3799 |
| 36 | Ga0070669_100015669 | 3300005353 | Bacteria | 5406 |
| 37 | Ga0070669_100089659 | 3300005353 | Bacteria | 2304 |
| 38 | Ga0070675_100002824 | 3300005354 | Bacteria | 13094 |
| 39 | Ga0070675_100003925 | 3300005354 | Bacteria | 11267 |
| 40 | Ga0070675_100189374 | 3300005354 | Bacteria | 1782 |
| 41 | Ga0070671_100000657 | 3300005355 | Bacteria | 24836 |
| 42 | Ga0070671_100001534 | 3300005355 | Bacteria | 17343 |
| 43 | Ga0070671_100004754 | 3300005355 | Bacteria | 10789 |
| 44 | Ga0070671_100103761 | 3300005355 | Bacteria | 2386 |
| 45 | Ga0070673_100001288 | 3300005364 | Bacteria | 14603 |
| 46 | Ga0070688_100003170 | 3300005365 | Bacteria | 8423 |
| 47 | Ga0070659_100001767 | 3300005366 | Bacteria | 15523 |
| 48 | Ga0070667_100041630 | 3300005367 | Bacteria | 3854 |
| 49 | Ga0070667_100108820 | 3300005367 | Bacteria | 2401 |
| 50 | Ga0070709_10007519 | 3300005434 | Bacteria | 5977 |
| 51 | Ga0070709_10008679 | 3300005434 | Bacteria | 5590 |
| 52 | Ga0070714_100006553 | 3300005435 | Bacteria | 9004 |
| 53 | Ga0070714_100029604 | 3300005435 | Bacteria | 4552 |
| 54 | Ga0070713_100012067 | 3300005436 | Bacteria | 6326 |
| 55 | Ga0070713_100013671 | 3300005436 | Bacteria | 5999 |
| 56 | Ga0070710_10003818 | 3300005437 | Bacteria | 7128 |
| 57 | Ga0070701_10058066 | 3300005438 | Bacteria | 2030 |
| 58 | Ga0070711_100000991 | 3300005439 | Bacteria | 15051 |
| 59 | Ga0070711_100002860 | 3300005439 | Bacteria | 9931 |
| 60 | Ga0070711_100007365 | 3300005439 | Bacteria | 6695 |
| 61 | Ga0070705_100038144 | 3300005440 | Bacteria | 2716 |
| 62 | Ga0070700_100042304 | 3300005441 | Bacteria | 2797 |
| 63 | Ga0070663_100014095 | 3300005455 | Bacteria | 5122 |
| 64 | Ga0070678_100001008 | 3300005456 | Bacteria | 14634 |
| 65 | Ga0070678_100005204 | 3300005456 | Bacteria | 7483 |
| 66 | Ga0070662_100070774 | 3300005457 | Bacteria | 2570 |
| 67 | Ga0070681_10001577 | 3300005458 | Bacteria | 20233 |
| 68 | Ga0070681_10001582 | 3300005458 | Bacteria | 20207 |
| 69 | Ga0070681_10008934 | 3300005458 | Bacteria | 9851 |
| 70 | Ga0070681_10024376 | 3300005458 | Bacteria | 6090 |
| 71 | Ga0070681_10131966 | 3300005458 | Bacteria | 2430 |
| 72 | Ga0070699_100023197 | 3300005518 | Bacteria | 5347 |
| 73 | Ga0070679_100000469 | 3300005530 | Bacteria | 34407 |
| 74 | Ga0070679_100025516 | 3300005530 | Bacteria | 5801 |
| 75 | Ga0070679_100206288 | 3300005530 | Bacteria | 1930 |
| 76 | Ga0070679_100245050 | 3300005530 | Bacteria | 1749 |
| 77 | Ga0070684_100297982 | 3300005535 | Bacteria | 1479 |
| 78 | Ga0068853_100054163 | 3300005539 | Bacteria | 3456 |
| 79 | Ga0068853_100340741 | 3300005539 | Bacteria | 1393 |
| 80 | Ga0070672_100018389 | 3300005543 | Bacteria | 5052 |
| 81 | Ga0070686_100007351 | 3300005544 | Bacteria | 6142 |
| 82 | Ga0070695_100001122 | 3300005545 | Bacteria | 14667 |
| 83 | Ga0070695_100046465 | 3300005545 | Bacteria | 2770 |
| 84 | Ga0070696_100003437 | 3300005546 | Bacteria | 10552 |
| 85 | Ga0070696_100064546 | 3300005546 | Bacteria | 2566 |
| 86 | Ga0070693_100004808 | 3300005547 | Bacteria | 6435 |
| 87 | Ga0070693_100096717 | 3300005547 | Bacteria | 1790 |
| 88 | Ga0070665_100002122 | 3300005548 | Bacteria | 22146 |
| 89 | Ga0070704_100007227 | 3300005549 | Bacteria | 6604 |
| 90 | Ga0070704_100054768 | 3300005549 | Bacteria | 2824 |
| 91 | Ga0070704_100129263 | 3300005549 | Bacteria | 1955 |
| 92 | Ga0068855_100001482 | 3300005563 | Bacteria | 29366 |
| 93 | Ga0068855_100001944 | 3300005563 | Bacteria | 25660 |
| 94 | Ga0068855_100152015 | 3300005563 | Bacteria | 2632 |
| 95 | Ga0070664_100004986 | 3300005564 | Bacteria | 10641 |
| 96 | Ga0068857_100066753 | 3300005577 | Bacteria | 3202 |
| 97 | Ga0068857_100121702 | 3300005577 | Bacteria | 2350 |
| 98 | Ga0068854_100013995 | 3300005578 | Bacteria | 5279 |
| 99 | Ga0068854_100240349 | 3300005578 | Bacteria | 1442 |
| 100 | Ga0068856_100008652 | 3300005614 | Bacteria | 9902 |
| 101 | Ga0068856_100113281 | 3300005614 | Bacteria | 2711 |
| 102 | Ga0068856_100389140 | 3300005614 | Bacteria | 1414 |
| 103 | Ga0070702_100000727 | 3300005615 | Bacteria | 12496 |
| 104 | Ga0068852_100108169 | 3300005616 | Bacteria | 2523 |
| 105 | Ga0068859_100043197 | 3300005617 | Bacteria | 4530 |
| 106 | Ga0068859_100069694 | 3300005617 | Bacteria | 3552 |
| 107 | Ga0068859_100081028 | 3300005617 | Bacteria | 3288 |
| 108 | Ga0068859_100109922 | 3300005617 | Bacteria | 2818 |
| 109 | Ga0068859_100207818 | 3300005617 | Bacteria | 2043 |
| 110 | Ga0068864_100000096 | 3300005618 | Bacteria | 88306 |
| 111 | Ga0068864_100017049 | 3300005618 | Bacteria | 6054 |
| 112 | Ga0068864_100035560 | 3300005618 | Bacteria | 4241 |
| 113 | Ga0068866_10008386 | 3300005718 | Bacteria | 4354 |
| 114 | Ga0068866_10090683 | 3300005718 | Bacteria | 1664 |
| 115 | Ga0068861_100003267 | 3300005719 | Bacteria | 10724 |
| 116 | Ga0068863_100000041 | 3300005841 | Bacteria | 157478 |
| 117 | Ga0068863_100005625 | 3300005841 | Bacteria | 12313 |
| 118 | Ga0068863_100022625 | 3300005841 | Bacteria | 6002 |
| 119 | Ga0068863_100022759 | 3300005841 | Bacteria | 5986 |
| 120 | Ga0068858_100000108 | 3300005842 | Bacteria | 87208 |
| 121 | Ga0068858_100007229 | 3300005842 | Bacteria | 10762 |
| 122 | Ga0068858_100019147 | 3300005842 | Bacteria | 6404 |
| 123 | Ga0068858_100156156 | 3300005842 | Bacteria | 2147 |
| 124 | Ga0068860_100007155 | 3300005843 | Bacteria | 11163 |
| 125 | Ga0068860_100007202 | 3300005843 | Bacteria | 11122 |
| 126 | Ga0068860_100012873 | 3300005843 | Bacteria | 8222 |
| 127 | Ga0068860_100022565 | 3300005843 | Bacteria | 6085 |
| 128 | Ga0068862_100000059 | 3300005844 | Bacteria | 136840 |
| 129 | Ga0068862_100077587 | 3300005844 | Bacteria | 2877 |
| 130 | Ga0081455_10001941 | 3300005937 | Bacteria | 24850 |
| 131 | Ga0081455_10052856 | 3300005937 | Bacteria | 3474 |
| 132 | Ga0070715_10001572 | 3300006163 | Bacteria | 6703 |
| 133 | Ga0070715_10003057 | 3300006163 | Bacteria | 5248 |
| 134 | Ga0070716_100000449 | 3300006173 | Bacteria | 17023 |
| 135 | Ga0070716_100133192 | 3300006173 | Bacteria | 1574 |
| 136 | Ga0070712_100052794 | 3300006175 | Bacteria | 2836 |
| 137 | Ga0075369_10052968 | 3300006186 | Bacteria | 1760 |
| 138 | Ga0075366_10065725 | 3300006195 | Bacteria | 2157 |
| 139 | Ga0097621_100322680 | 3300006237 | Bacteria | 1368 |
| 140 | Ga0068871_100026906 | 3300006358 | Bacteria | 4493 |
| 141 | Ga0075428_100012185 | 3300006844 | Bacteria | 9560 |
| 142 | Ga0075431_100048414 | 3300006847 | Bacteria | 4385 |
| 143 | Ga0075433_10002458 | 3300006852 | Bacteria | 14092 |
| 144 | Ga0075433_10008589 | 3300006852 | Bacteria | 8149 |
| 145 | Ga0075434_100000766 | 3300006871 | Bacteria | 25369 |
| 146 | Ga0075434_100017502 | 3300006871 | Bacteria | 6908 |
| 147 | Ga0068865_100000735 | 3300006881 | Bacteria | 18419 |
| 148 | Ga0068865_100252483 | 3300006881 | Bacteria | 1392 |
| 149 | Ga0097620_100043196 | 3300006931 | Bacteria | 4530 |
| 150 | Ga0097620_100069696 | 3300006931 | Bacteria | 3552 |
| 151 | Ga0097620_100081026 | 3300006931 | Bacteria | 3288 |
| 152 | Ga0097620_100109919 | 3300006931 | Bacteria | 2818 |
| 153 | Ga0097620_100207827 | 3300006931 | Bacteria | 2043 |
| 154 | Ga0099795_10000022 | 3300007788 | Bacteria | 52585 |
| 155 | Ga0105250_10024018 | 3300009092 | Bacteria | 2457 |
| 156 | Ga0105250_10035519 | 3300009092 | Bacteria | 2000 |
| 157 | Ga0105240_10002705 | 3300009093 | Bacteria | 28172 |
| 158 | Ga0105240_10003826 | 3300009093 | Bacteria | 23268 |
| 159 | Ga0105240_10008281 | 3300009093 | Bacteria | 14883 |
| 160 | Ga0105240_10024889 | 3300009093 | Bacteria | 7880 |
| 161 | Ga0105240_10111111 | 3300009093 | Bacteria | 3316 |
| 162 | Ga0105240_10150093 | 3300009093 | Bacteria | 2777 |
| 163 | Ga0111539_10000539 | 3300009094 | Bacteria | 48163 |
| 164 | Ga0111539_10005627 | 3300009094 | Bacteria | 16201 |
| 165 | Ga0111539_10683492 | 3300009094 | Bacteria | 1195 |
| 166 | Ga0105245_10000738 | 3300009098 | Bacteria | 29503 |
| 167 | Ga0105245_10007920 | 3300009098 | Bacteria | 9291 |
| 168 | Ga0105247_10002269 | 3300009101 | Bacteria | 13214 |
| 169 | Ga0105247_10010243 | 3300009101 | Bacteria | 5674 |
| 170 | Ga0105247_10012409 | 3300009101 | Bacteria | 5117 |
| 171 | Ga0105247_10021799 | 3300009101 | Bacteria | 3854 |
| 172 | Ga0114129_10010448 | 3300009147 | Bacteria | 13239 |
| 173 | Ga0114129_10089316 | 3300009147 | Bacteria | 4271 |
| 174 | Ga0114129_10289030 | 3300009147 | Bacteria | 2188 |
| 175 | Ga0105241_10007997 | 3300009174 | Bacteria | 7778 |
| 176 | Ga0105242_10005298 | 3300009176 | Bacteria | 9957 |
| 177 | Ga0105242_10050505 | 3300009176 | Bacteria | 3386 |
| 178 | Ga0105248_10001268 | 3300009177 | Bacteria | 28225 |
| 179 | Ga0105248_10003698 | 3300009177 | Bacteria | 16951 |
| 180 | Ga0105248_10005489 | 3300009177 | Bacteria | 13923 |
| 181 | Ga0105248_10024418 | 3300009177 | Bacteria | 6722 |
| 182 | Ga0105248_10067758 | 3300009177 | Bacteria | 4007 |
| 183 | Ga0105248_10111326 | 3300009177 | Bacteria | 3088 |
| 184 | Ga0105248_10199938 | 3300009177 | Bacteria | 2252 |
| 185 | Ga0105237_10014418 | 3300009545 | Bacteria | 8266 |
| 186 | Ga0105237_10104733 | 3300009545 | Bacteria | 2820 |
| 187 | Ga0105237_10164315 | 3300009545 | Bacteria | 2219 |
| 188 | Ga0105237_10204122 | 3300009545 | Bacteria | 1977 |
| 189 | Ga0105238_10005376 | 3300009551 | Bacteria | 12659 |
| 190 | Ga0105238_10006381 | 3300009551 | Bacteria | 11732 |
| 191 | Ga0105249_10000065 | 3300009553 | Bacteria | 151159 |
| 192 | Ga0105249_10008955 | 3300009553 | Bacteria | 8742 |
| 193 | Ga0105030_100135 | 3300009987 | Bacteria | 5867 |
| 194 | Ga0099796_10000025 | 3300010159 | Bacteria | 37858 |
| 195 | Ga0099796_10001494 | 3300010159 | Bacteria | 4736 |
| 196 | Ga0105239_10000694 | 3300010375 | Bacteria | 47928 |
| 197 | Ga0105239_10005723 | 3300010375 | Bacteria | 14518 |
| 198 | Ga0105246_10003747 | 3300011119 | Bacteria | 9213 |
| 199 | Ga0157371_10097944 | 3300013102 | Bacteria | 2079 |
| 200 | Ga0157370_10001472 | 3300013104 | Bacteria | 29117 |
| 201 | Ga0157370_10086899 | 3300013104 | Bacteria | 2937 |
| 202 | Ga0157369_10006045 | 3300013105 | Bacteria | 14052 |
| 203 | Ga0157369_10065057 | 3300013105 | Bacteria | 3926 |
| 204 | Ga0157369_10115433 | 3300013105 | Bacteria | 2851 |
| 205 | Ga0157369_10256981 | 3300013105 | Bacteria | 1822 |
| 206 | Ga0157369_10334481 | 3300013105 | Bacteria | 1573 |
| 207 | Ga0157374_10007656 | 3300013296 | Bacteria | 9220 |
| 208 | Ga0157374_10102377 | 3300013296 | Bacteria | 2746 |
| 209 | Ga0157374_10289571 | 3300013296 | Bacteria | 1618 |
| 210 | Ga0157374_10507111 | 3300013296 | Bacteria | 1211 |
| 211 | Ga0157378_10004873 | 3300013297 | Bacteria | 11772 |
| 212 | Ga0163162_10004801 | 3300013306 | Bacteria | 13040 |
| 213 | Ga0157372_10014940 | 3300013307 | Bacteria | 8313 |
| 214 | Ga0157372_10071871 | 3300013307 | Bacteria | 3898 |
| 215 | Ga0157375_10004187 | 3300013308 | Bacteria | 12521 |
| 216 | Ga0157375_10018198 | 3300013308 | Bacteria | 6367 |
| 217 | Ga0157375_10071259 | 3300013308 | Bacteria | 3488 |
| 218 | Ga0163163_10010899 | 3300014325 | Bacteria | 8211 |
| 219 | Ga0163163_10029400 | 3300014325 | Bacteria | 5285 |
| 220 | Ga0163163_10101260 | 3300014325 | Bacteria | 2903 |
| 221 | Ga0157380_10004376 | 3300014326 | Bacteria | 9789 |
| 222 | Ga0157377_10103846 | 3300014745 | Bacteria | 1698 |
| 223 | Ga0157379_10006630 | 3300014968 | Bacteria | 9989 |
| 224 | Ga0157379_10030721 | 3300014968 | Bacteria | 4784 |
| 225 | Ga0157379_10126453 | 3300014968 | Bacteria | 2300 |
| 226 | Ga0157376_10000896 | 3300014969 | Bacteria | 19480 |
| 227 | Ga0157376_10013774 | 3300014969 | Bacteria | 6046 |
| 228 | Ga0157376_10106809 | 3300014969 | Bacteria | 2457 |
| 229 | Ga0157376_10115157 | 3300014969 | Bacteria | 2373 |
| 230 | Ga0183365_10004 | 3300015684 | Bacteria | 333304 |
| 231 | Ga0163161_10115144 | 3300017792 | Bacteria | 2015 |
| 232 | Ga0213872_10000038 | 3300021361 | Bacteria | 123827 |
| 233 | Ga0213872_10018666 | 3300021361 | Bacteria | 3196 |
| 234 | Ga0213872_10036249 | 3300021361 | Bacteria | 2255 |
| 235 | Ga0213872_10079967 | 3300021361 | Bacteria | 1469 |
| 236 | Ga0213875_10000081 | 3300021388 | Bacteria | 114181 |
| 237 | Ga0213875_10000307 | 3300021388 | Bacteria | 46789 |
| 238 | Ga0224572_1008387 | 3300024225 | Bacteria | 1909 |
| 239 | Ga0209565_1000065 | 3300025263 | Bacteria | 178266 |
| 240 | Ga0209673_1000818 | 3300025273 | Bacteria | 41077 |
| 241 | Ga0209675_1000275 | 3300025291 | Bacteria | 49474 |
| 242 | Ga0209676_1000085 | 3300025292 | Bacteria | 273425 |
| 243 | Ga0209676_1000171 | 3300025292 | Bacteria | 154045 |
| 244 | Ga0209676_1000177 | 3300025292 | Bacteria | 151589 |
| 245 | Ga0209676_1000349 | 3300025292 | Bacteria | 87517 |
| 246 | Ga0209676_1000648 | 3300025292 | Bacteria | 49941 |
| 247 | Ga0209564_1001008 | 3300025295 | Bacteria | 35029 |
| 248 | Ga0209758_1004537 | 3300025297 | Bacteria | 11482 |
| 249 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 250 | Ga0209050_1000496 | 3300025298 | Bacteria | 67112 |
| 251 | Ga0209050_1001766 | 3300025298 | Bacteria | 21350 |
| 252 | Ga0209050_1008080 | 3300025298 | Bacteria | 5717 |
| 253 | Ga0209050_1014594 | 3300025298 | Bacteria | 3369 |
| 254 | Ga0209256_1000855 | 3300025299 | Bacteria | 37977 |
| 255 | Ga0209051_1001860 | 3300025303 | Bacteria | 16592 |
| 256 | Ga0209257_1000074 | 3300025304 | Bacteria | 325641 |
| 257 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 258 | Ga0209257_1000253 | 3300025304 | Bacteria | 123508 |
| 259 | Ga0209257_1000482 | 3300025304 | Bacteria | 72375 |
| 260 | Ga0209257_1002290 | 3300025304 | Bacteria | 19468 |
| 261 | Ga0209257_1006411 | 3300025304 | Bacteria | 7594 |
| 262 | Ga0207692_10058000 | 3300025898 | Bacteria | 1993 |
| 263 | Ga0207710_10003083 | 3300025900 | Bacteria | 7483 |
| 264 | Ga0207710_10095544 | 3300025900 | Bacteria | 1396 |
| 265 | Ga0207688_10033699 | 3300025901 | Bacteria | 2833 |
| 266 | Ga0207688_10111822 | 3300025901 | Bacteria | 1586 |
| 267 | Ga0207680_10114148 | 3300025903 | Bacteria | 1757 |
| 268 | Ga0207680_10136162 | 3300025903 | Bacteria | 1624 |
| 269 | Ga0207647_10001136 | 3300025904 | Bacteria | 20506 |
| 270 | Ga0207699_10009239 | 3300025906 | Bacteria | 4899 |
| 271 | Ga0207699_10013238 | 3300025906 | Bacteria | 4217 |
| 272 | Ga0207699_10026246 | 3300025906 | Bacteria | 3207 |
| 273 | Ga0207707_10000122 | 3300025912 | Bacteria | 80159 |
| 274 | Ga0207707_10036563 | 3300025912 | Bacteria | 4292 |
| 275 | Ga0207707_10044816 | 3300025912 | Bacteria | 3855 |
| 276 | Ga0207707_10106221 | 3300025912 | Bacteria | 2454 |
| 277 | Ga0207707_10129357 | 3300025912 | Bacteria | 2208 |
| 278 | Ga0207695_10002114 | 3300025913 | Bacteria | 30152 |
| 279 | Ga0207695_10003540 | 3300025913 | Bacteria | 21874 |
| 280 | Ga0207695_10024615 | 3300025913 | Bacteria | 6765 |
| 281 | Ga0207695_10076336 | 3300025913 | Bacteria | 3406 |
| 282 | Ga0207695_10332380 | 3300025913 | Bacteria | 1408 |
| 283 | Ga0207671_10009799 | 3300025914 | Bacteria | 7971 |
| 284 | Ga0207671_10023246 | 3300025914 | Bacteria | 4676 |
| 285 | Ga0207671_10097681 | 3300025914 | Bacteria | 2221 |
| 286 | Ga0207693_10000083 | 3300025915 | Bacteria | 84611 |
| 287 | Ga0207693_10000551 | 3300025915 | Bacteria | 33845 |
| 288 | Ga0207663_10003079 | 3300025916 | Bacteria | 8084 |
| 289 | Ga0207663_10014494 | 3300025916 | Bacteria | 4317 |
| 290 | Ga0207663_10048556 | 3300025916 | Bacteria | 2628 |
| 291 | Ga0207660_10004896 | 3300025917 | Bacteria | 8723 |
| 292 | Ga0207660_10024101 | 3300025917 | Bacteria | 4116 |
| 293 | Ga0207660_10197635 | 3300025917 | Bacteria | 1569 |
| 294 | Ga0207662_10001396 | 3300025918 | Bacteria | 11670 |
| 295 | Ga0207657_10008555 | 3300025919 | Bacteria | 10374 |
| 296 | Ga0207652_10000613 | 3300025921 | Bacteria | 35518 |
| 297 | Ga0207652_10032150 | 3300025921 | Bacteria | 4408 |
| 298 | Ga0207652_10099654 | 3300025921 | Bacteria | 2564 |
| 299 | Ga0207694_10003403 | 3300025924 | Bacteria | 12669 |
| 300 | Ga0207694_10102396 | 3300025924 | Bacteria | 2270 |
| 301 | Ga0207659_10007954 | 3300025926 | Bacteria | 6557 |
| 302 | Ga0207687_10017700 | 3300025927 | Bacteria | 4696 |
| 303 | Ga0207687_10110472 | 3300025927 | Bacteria | 2039 |
| 304 | Ga0207700_10146086 | 3300025928 | Bacteria | 1949 |
| 305 | Ga0207664_10002133 | 3300025929 | Bacteria | 13018 |
| 306 | Ga0207644_10156497 | 3300025931 | Bacteria | 1768 |
| 307 | Ga0207706_10001303 | 3300025933 | Bacteria | 25092 |
| 308 | Ga0207686_10012915 | 3300025934 | Bacteria | 4606 |
| 309 | Ga0207686_10075458 | 3300025934 | Bacteria | 2183 |
| 310 | Ga0207670_10052443 | 3300025936 | Bacteria | 2743 |
| 311 | Ga0207704_10004318 | 3300025938 | Bacteria | 6496 |
| 312 | Ga0207704_10100132 | 3300025938 | Bacteria | 1929 |
| 313 | Ga0207665_10000478 | 3300025939 | Bacteria | 27104 |
| 314 | Ga0207665_10000587 | 3300025939 | Bacteria | 24539 |
| 315 | Ga0207665_10113687 | 3300025939 | Bacteria | 1905 |
| 316 | Ga0207691_10006970 | 3300025940 | Bacteria | 10901 |
| 317 | Ga0207711_10002830 | 3300025941 | Bacteria | 15244 |
| 318 | Ga0207711_10005213 | 3300025941 | Bacteria | 11012 |
| 319 | Ga0207711_10014144 | 3300025941 | Bacteria | 6629 |
| 320 | Ga0207711_10071669 | 3300025941 | Bacteria | 3007 |
| 321 | Ga0207711_10189111 | 3300025941 | Bacteria | 1875 |
| 322 | Ga0207689_10246610 | 3300025942 | Bacteria | 1477 |
| 323 | Ga0207661_10208532 | 3300025944 | Bacteria | 1721 |
| 324 | Ga0207667_10000798 | 3300025949 | Bacteria | 40876 |
| 325 | Ga0207667_10010115 | 3300025949 | Bacteria | 11052 |
| 326 | Ga0207667_10045147 | 3300025949 | Bacteria | 4668 |
| 327 | Ga0207667_10058371 | 3300025949 | Bacteria | 4048 |
| 328 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 329 | Ga0207712_10086967 | 3300025961 | Bacteria | 2291 |
| 330 | Ga0207668_10004667 | 3300025972 | Bacteria | 8061 |
| 331 | Ga0207668_10028281 | 3300025972 | Bacteria | 3664 |
| 332 | Ga0207640_10012125 | 3300025981 | Bacteria | 4901 |
| 333 | Ga0207640_10056000 | 3300025981 | Bacteria | 2586 |
| 334 | Ga0207677_10057269 | 3300026023 | Bacteria | 2675 |
| 335 | Ga0207703_10000035 | 3300026035 | Bacteria | 183082 |
| 336 | Ga0207703_10028593 | 3300026035 | Bacteria | 4395 |
| 337 | Ga0207703_10034034 | 3300026035 | Bacteria | 4041 |
| 338 | Ga0207703_10065995 | 3300026035 | Bacteria | 2976 |
| 339 | Ga0207703_10251779 | 3300026035 | Bacteria | 1592 |
| 340 | Ga0207702_10014159 | 3300026078 | Bacteria | 6624 |
| 341 | Ga0207702_10128842 | 3300026078 | Bacteria | 2275 |
| 342 | Ga0207641_10000027 | 3300026088 | Bacteria | 244787 |
| 343 | Ga0207641_10001424 | 3300026088 | Bacteria | 23544 |
| 344 | Ga0207641_10012457 | 3300026088 | Bacteria | 6972 |
| 345 | Ga0207641_10031125 | 3300026088 | Bacteria | 4424 |
| 346 | Ga0207648_10031254 | 3300026089 | Bacteria | 4707 |
| 347 | Ga0207676_10000418 | 3300026095 | Bacteria | 36015 |
| 348 | Ga0207674_10005594 | 3300026116 | Bacteria | 14897 |
| 349 | Ga0207675_100003266 | 3300026118 | Bacteria | 15871 |
| 350 | Ga0207683_10004828 | 3300026121 | Bacteria | 11609 |
| 351 | Ga0207683_10004897 | 3300026121 | Bacteria | 11526 |
| 352 | Ga0207698_10129894 | 3300026142 | Bacteria | 2151 |
| 353 | Ga0209971_1011656 | 3300027682 | Bacteria | 2083 |
| 354 | Ga0209974_10005604 | 3300027876 | Bacteria | 4408 |
| 355 | Ga0207428_10005547 | 3300027907 | Bacteria | 11749 |
| 356 | Ga0207428_10014951 | 3300027907 | Bacteria | 6725 |
| 357 | Ga0207428_10085930 | 3300027907 | Bacteria | 2449 |
| 358 | Ga0268266_10086554 | 3300028379 | Bacteria | 2740 |
| 359 | Ga0268265_10000114 | 3300028380 | Bacteria | 101337 |
| 360 | Ga0268265_10002149 | 3300028380 | Bacteria | 15264 |
| 361 | Ga0268265_10097925 | 3300028380 | Bacteria | 2361 |
| 362 | Ga0268264_10000562 | 3300028381 | Bacteria | 45693 |
| 363 | Ga0268264_10018337 | 3300028381 | Bacteria | 5723 |
| 364 | Ga0268264_10096693 | 3300028381 | Bacteria | 2558 |
| 365 | Ga0268264_10161239 | 3300028381 | Bacteria | 2020 |
| 366 | Ga0268264_10185166 | 3300028381 | Bacteria | 1894 |
| 367 | Ga0268264_10387470 | 3300028381 | Bacteria | 1340 |
| 368 | Ga0265326_10003138 | 3300028558 | Bacteria | 5468 |
| 369 | Ga0265334_10010215 | 3300028573 | Bacteria | 3960 |
| 370 | Ga0265318_10001836 | 3300028577 | Bacteria | 12018 |
| 371 | Ga0307515_10045057 | 3300028794 | Bacteria | 6790 |
| 372 | Ga0265338_10027362 | 3300028800 | Bacteria | 5722 |
| 373 | Ga0307511_10000268 | 3300030521 | Bacteria | 54105 |
| 374 | Ga0265330_10004483 | 3300031235 | Bacteria | 7083 |
| 375 | Ga0265332_10003174 | 3300031238 | Bacteria | 8001 |
| 376 | Ga0265328_10014767 | 3300031239 | Bacteria | 3069 |
| 377 | Ga0265328_10034097 | 3300031239 | Bacteria | 1885 |
| 378 | Ga0265320_10010245 | 3300031240 | Bacteria | 5593 |
| 379 | Ga0265320_10044698 | 3300031240 | Bacteria | 2181 |
| 380 | Ga0265329_10002693 | 3300031242 | Bacteria | 7987 |
| 381 | Ga0265339_10074777 | 3300031249 | Bacteria | 1799 |
| 382 | Ga0265331_10009724 | 3300031250 | Bacteria | 5373 |
| 383 | Ga0265327_10001660 | 3300031251 | Bacteria | 26802 |
| 384 | Ga0265316_10049287 | 3300031344 | Bacteria | 3318 |
| 385 | Ga0307513_10002752 | 3300031456 | Bacteria | 24185 |
| 386 | Ga0307513_10020402 | 3300031456 | Bacteria | 7862 |
| 387 | Ga0307509_10003194 | 3300031507 | Bacteria | 25340 |
| 388 | Ga0307408_100016261 | 3300031548 | Bacteria | 4963 |
| 389 | Ga0307508_10061746 | 3300031616 | Bacteria | 3310 |
| 390 | Ga0265314_10022086 | 3300031711 | Bacteria | 4878 |
| 391 | Ga0265342_10012843 | 3300031712 | Bacteria | 5652 |
| 392 | Ga0316576_10017920 | 3300031727 | Bacteria | 4824 |
| 393 | Ga0307405_10315093 | 3300031731 | Bacteria | 1193 |
| 394 | Ga0307413_10031975 | 3300031824 | Bacteria | 2976 |
| 395 | Ga0307410_10191260 | 3300031852 | Bacteria | 1556 |
| 396 | Ga0307410_10219450 | 3300031852 | Bacteria | 1462 |
| 397 | Ga0307410_10233460 | 3300031852 | Bacteria | 1421 |
| 398 | Ga0307412_10100891 | 3300031911 | Bacteria | 2041 |
| 399 | Ga0307409_100028297 | 3300031995 | Bacteria | 3990 |
| 400 | Ga0307409_100289090 | 3300031995 | Bacteria | 1519 |
| 401 | Ga0307416_100003094 | 3300032002 | Bacteria | 9732 |
| 402 | Ga0307416_100042886 | 3300032002 | Bacteria | 3537 |
| 403 | Ga0307414_10013586 | 3300032004 | Bacteria | 4853 |
| 404 | Ga0307414_10022560 | 3300032004 | Bacteria | 3974 |
| 405 | Ga0307414_10038574 | 3300032004 | Bacteria | 3210 |
| 406 | Ga0307411_10048225 | 3300032005 | Bacteria | 2760 |
| 407 | Ga0307415_100001180 | 3300032126 | Bacteria | 12227 |
| 408 | Ga0373923_0020999 | 3300035111 | Bacteria | 2545 |
| 409 | Ga0373945_0023197 | 3300035116 | Bacteria | 2143 |
| 410 | Ga0373945_0068007 | 3300035116 | Bacteria | 1343 |
| 411 | Ga0373943_0047771 | 3300035170 | Bacteria | 2094 |
| 412 | Ga0373946_0017825 | 3300035171 | Bacteria | 2720 |
| 413 | Ga0373946_0094953 | 3300035171 | Bacteria | 1328 |
| 414 | Ga0373942_0010698 | 3300035207 | Bacteria | 2162 |
| 415 | Ga0373961_0031387 | 3300035241 | Bacteria | 1484 |
| 416 | Ga0373962_0028711 | 3300035242 | Bacteria | 1511 |
| 417 | Ga0373931_0088269 | 3300035691 | Bacteria | 1723 |
| 418 | Ga0373931_0155118 | 3300035691 | Bacteria | 1338 |
| 419 | Ga0373935_0108787 | 3300035692 | Bacteria | 1837 |
| 420 | Ga0373927_0006326 | 3300035695 | Bacteria | 8071 |
| 421 | Ga0373927_0015626 | 3300035695 | Bacteria | 5013 |
| 422 | Ga0373927_0148040 | 3300035695 | Bacteria | 1537 |
| 423 | Ga0373933_0012987 | 3300035724 | Bacteria | 4607 |
| 424 | Ga0373947_0140208 | 3300035725 | Bacteria | 1550 |
| 425 | Ga0373947_0185355 | 3300035725 | Bacteria | 1356 |
| 426 | Ga0373937_0031120 | 3300036401 | Bacteria | 4832 |
| 427 | Ga0373937_0048457 | 3300036401 | Bacteria | 3890 |
| 428 | Ga0373937_0100366 | 3300036401 | Bacteria | 2686 |
| 429 | Ga0316584_0068487 | 3300036712 | Bacteria | 2660 |
| 430 | Ga0373925_0093366 | 3300037068 | Bacteria | 2303 |
| 431 | Ga0395900_0084547 | 3300037418 | Bacteria | 3261 |
| 432 | Ga0395898_0020760 | 3300037466 | Bacteria | 6668 |
| 433 | Ga0395898_0036071 | 3300037466 | Bacteria | 4913 |
| 434 | Ga0395905_0000136 | 3300037471 | Bacteria | 121009 |
| 435 | Ga0436364_0210071 | 3300037853 | Bacteria | 1395 |
| 436 | Ga0436364_0560002 | 3300037853 | Bacteria | 93566 |
| 437 | Ga0436364_0822555 | 3300037853 | Bacteria | 215682 |
| 438 | Ga0436364_0856291 | 3300037853 | Bacteria | 2151 |
| 439 | Ga0400489_17737 | 3300039093 | Bacteria | 2130 |
| 440 | Ga0436365_0969803 | 3300039437 | Bacteria | 1238 |
| 441 | Ga0436360_1031300 | 3300039438 | Bacteria | 2212 |
| 442 | Ga0436361_0200397 | 3300039447 | Bacteria | 5394 |
| 443 | Ga0436361_0328064 | 3300039447 | Bacteria | 5863 |
| 444 | Ga0436361_1108648 | 3300039447 | Bacteria | 1542 |
| 445 | Ga0436363_1410071 | 3300039450 | Bacteria | 2166 |
| 446 | Ga0439454_005654 | 3300042011 | Bacteria | 1502 |
| 447 | Ga0450920_007942 | 3300042122 | Bacteria | 1931 |
| 448 | Ga0450890_007161 | 3300042127 | Bacteria | 1424 |
| 449 | Ga0439446_0045152 | 3300042156 | Bacteria | 1305 |
| 450 | Ga0439446_0054380 | 3300042156 | Bacteria | 1200 |
| 451 | Ga0450908_003021 | 3300042184 | Bacteria | 3283 |
| 452 | Ga0439434_0003968 | 3300042435 | Bacteria | 4318 |
| 453 | Ga0439435_0001752 | 3300042436 | Bacteria | 4121 |
| 454 | Ga0451577_0000194 | 3300042876 | Bacteria | 127614 |
| 455 | Ga0451577_0041605 | 3300042876 | Bacteria | 4124 |
| 456 | Ga0451577_0090539 | 3300042876 | Bacteria | 2731 |
| 457 | Ga0451577_0106942 | 3300042876 | Bacteria | 2501 |
| 458 | Ga0466969_0003345 | 3300044656 | Bacteria | 8536 |
| 459 | Ga0466965_0224118 | 3300044683 | Bacteria | 1003 |
| 460 | Ga0453684_0000218 | 3300044712 | Bacteria | 250267 |
| 461 | Ga0466957_0130437 | 3300044842 | Bacteria | 1610 |
| 462 | Ga0466959_0035356 | 3300045049 | Bacteria | 3696 |
| 463 | Ga0451576_0000643 | 3300045051 | Bacteria | 72224 |
| 464 | Ga0451576_0013885 | 3300045051 | Bacteria | 8996 |
| 465 | Ga0451576_0049885 | 3300045051 | Bacteria | 4392 |
| 466 | Ga0451576_0343852 | 3300045051 | Bacteria | 1562 |
| 467 | Ga0495627_001458 | 3300046453 | Bacteria | 13865 |
| 468 | Ga0495603_0006487 | 3300046455 | Bacteria | 7009 |
| 469 | Ga0495603_0015445 | 3300046455 | Bacteria | 4620 |
| 470 | Ga0495590_0013702 | 3300046457 | Bacteria | 2974 |
| 471 | Ga0495629_0001118 | 3300046459 | Bacteria | 21234 |
| 472 | Ga0495638_0000147 | 3300046460 | Bacteria | 110817 |
| 473 | Ga0495638_0009919 | 3300046460 | Bacteria | 6646 |
| 474 | Ga0495638_0012304 | 3300046460 | Bacteria | 5868 |
| 475 | Ga0495638_0016883 | 3300046460 | Bacteria | 4881 |
| 476 | Ga0495638_0063163 | 3300046460 | Bacteria | 2284 |
| 477 | Ga0495650_0000045 | 3300046471 | Bacteria | 346204 |
| 478 | Ga0495580_0003653 | 3300046472 | Bacteria | 13035 |
| 479 | Ga0495580_0008705 | 3300046472 | Bacteria | 8047 |
| 480 | Ga0495582_0000461 | 3300046473 | Bacteria | 22212 |
| 481 | Ga0495639_0030378 | 3300046475 | Bacteria | 2401 |
| 482 | Ga0495594_0000049 | 3300046499 | Bacteria | 52677 |
| 483 | Ga0495594_0074049 | 3300046499 | Bacteria | 1897 |
| 484 | Ga0495607_0140519 | 3300046501 | Bacteria | 1246 |
| 485 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 486 | Ga0495583_0023608 | 3300046506 | Bacteria | 3108 |
| 487 | Ga0495606_0005055 | 3300046507 | Bacteria | 12840 |
| 488 | Ga0495610_0000101 | 3300046512 | Bacteria | 99012 |
| 489 | Ga0495610_0002849 | 3300046512 | Bacteria | 14072 |
| 490 | Ga0495610_0112313 | 3300046512 | Bacteria | 1205 |
| 491 | Ga0495616_0001495 | 3300046513 | Bacteria | 16156 |
| 492 | Ga0495618_0149756 | 3300046514 | Bacteria | 1491 |
| 493 | Ga0495620_0059358 | 3300046515 | Bacteria | 1599 |
| 494 | Ga0495631_0002007 | 3300046518 | Bacteria | 11864 |
| 495 | Ga0495632_0006366 | 3300046519 | Bacteria | 7611 |
| 496 | Ga0495632_0067821 | 3300046519 | Bacteria | 1720 |
| 497 | Ga0495648_0003254 | 3300046524 | Bacteria | 14383 |
| 498 | Ga0495666_0053701 | 3300046526 | Bacteria | 1933 |
| 499 | Ga0495654_0000018 | 3300046530 | Bacteria | 293124 |
| 500 | Ga0495665_0014972 | 3300046531 | Bacteria | 4178 |
| 501 | Ga0495597_0002750 | 3300046542 | Bacteria | 10826 |
| 502 | Ga0495622_0002657 | 3300046557 | Bacteria | 8582 |
| 503 | Ga0495622_0020281 | 3300046557 | Bacteria | 3095 |
| 504 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 505 | Ga0495668_0000026 | 3300046616 | Bacteria | 297287 |
| 506 | Ga0495668_0051407 | 3300046616 | Bacteria | 2281 |
| 507 | Ga0495668_0068994 | 3300046616 | Bacteria | 1944 |
| 508 | Ga0495634_0040795 | 3300046642 | Bacteria | 3154 |
| 509 | Ga0495611_0034808 | 3300046648 | Bacteria | 2228 |
| 510 | Ga0495625_0000099 | 3300046660 | Bacteria | 140467 |
| 511 | Ga0495625_0000373 | 3300046660 | Bacteria | 68625 |
| 512 | Ga0495625_0023590 | 3300046660 | Bacteria | 4697 |
| 513 | Ga0495625_0043033 | 3300046660 | Bacteria | 3278 |
| 514 | Ga0495625_0052636 | 3300046660 | Bacteria | 2914 |
| 515 | Ga0495625_0055958 | 3300046660 | Bacteria | 2810 |
| 516 | Ga0495625_0138550 | 3300046660 | Bacteria | 1643 |
| 517 | Ga0495669_0000321 | 3300046684 | Bacteria | 26316 |
| 518 | Ga0495613_0000244 | 3300046689 | Bacteria | 51563 |
| 519 | Ga0495649_0012413 | 3300046694 | Bacteria | 4953 |
| 520 | Ga0495660_0007468 | 3300046810 | Bacteria | 6417 |
| 521 | Ga0495581_0092426 | 3300047315 | Bacteria | 1756 |
| 522 | Ga0495604_0043627 | 3300047317 | Bacteria | 3510 |
| 523 | Ga0495672_0000472 | 3300047320 | Bacteria | 47553 |
| 524 | Ga0495672_0091436 | 3300047320 | Bacteria | 1670 |
| 525 | Ga0495676_0034293 | 3300047321 | Bacteria | 4261 |
| 526 | Ga0495680_0113860 | 3300047322 | Bacteria | 2002 |
| 527 | Ga0495687_040408 | 3300047443 | Bacteria | 2055 |
| 528 | Ga0495673_0000119 | 3300047469 | Bacteria | 145179 |
| 529 | Ga0495673_0000967 | 3300047469 | Bacteria | 25932 |
| 530 | Ga0495673_0045019 | 3300047469 | Bacteria | 1964 |
| 531 | Ga0495686_0023674 | 3300047472 | Bacteria | 4047 |
| 532 | Ga0495686_0049321 | 3300047472 | Bacteria | 2649 |
| 533 | Ga0495593_0008379 | 3300047673 | Bacteria | 6014 |
| 534 | Ga0495593_0032243 | 3300047673 | Bacteria | 2857 |
| 535 | Ga0495602_0048266 | 3300048088 | Bacteria | 3828 |
| 536 | Ga0495626_0029671 | 3300048091 | Bacteria | 2645 |
| 537 | Ga0496100_0003273 | 3300048903 | Bacteria | 8417 |
| 538 | Ga0496100_0007689 | 3300048903 | Bacteria | 5965 |
| 539 | Ga0496100_0217204 | 3300048903 | Bacteria | 1401 |
| 540 | Ga0496100_0264167 | 3300048903 | Bacteria | 1277 |
| 541 | Ga0496101_0025222 | 3300048904 | Bacteria | 4122 |
| 542 | Ga0496101_0149515 | 3300048904 | Bacteria | 1785 |
| 543 | Ga0496102_0006064 | 3300048905 | Bacteria | 10305 |
| 544 | Ga0496102_0040309 | 3300048905 | Bacteria | 4224 |
| 545 | Ga0496102_0042344 | 3300048905 | Bacteria | 4126 |
| 546 | Ga0496102_0096849 | 3300048905 | Bacteria | 2736 |
| 547 | Ga0496102_0097177 | 3300048905 | Bacteria | 2731 |
| 548 | Ga0496102_0171477 | 3300048905 | Bacteria | 2042 |
| 549 | Ga0496102_0223101 | 3300048905 | Bacteria | 1777 |
| 550 | Ga0496102_0338449 | 3300048905 | Bacteria | 1417 |
| 551 | Ga0496103_0023391 | 3300048906 | Bacteria | 3725 |
| 552 | Ga0496103_0063876 | 3300048906 | Bacteria | 2294 |
| 553 | Ga0496103_0130479 | 3300048906 | Bacteria | 1605 |
| 554 | Ga0496104_0032491 | 3300048907 | Bacteria | 4857 |
| 555 | Ga0496104_0211380 | 3300048907 | Bacteria | 1851 |
| 556 | Ga0496105_0001071 | 3300048908 | Bacteria | 18940 |
| 557 | Ga0496105_0005319 | 3300048908 | Bacteria | 9756 |
| 558 | Ga0496105_0010006 | 3300048908 | Bacteria | 7441 |
| 559 | Ga0496106_0002565 | 3300048909 | Bacteria | 13516 |
| 560 | Ga0496106_0013682 | 3300048909 | Bacteria | 5992 |
| 561 | Ga0496106_0034515 | 3300048909 | Bacteria | 3779 |
| 562 | Ga0496107_0000168 | 3300048910 | Bacteria | 33811 |
| 563 | Ga0496107_0001015 | 3300048910 | Bacteria | 16758 |
| 564 | Ga0496107_0034840 | 3300048910 | Bacteria | 3607 |
| 565 | Ga0496107_0039577 | 3300048910 | Bacteria | 3382 |
| 566 | Ga0496108_0021858 | 3300048911 | Bacteria | 5259 |
| 567 | Ga0496108_0171428 | 3300048911 | Bacteria | 1877 |
| 568 | Ga0496108_0544658 | 3300048911 | Bacteria | 1012 |
| 569 | Ga0496109_0011744 | 3300048912 | Bacteria | 7536 |
| 570 | Ga0496109_0055487 | 3300048912 | Bacteria | 3614 |
| 571 | Ga0496109_0115142 | 3300048912 | Bacteria | 2501 |
| 572 | Ga0496109_0196080 | 3300048912 | Bacteria | 1898 |
| 573 | Ga0496109_0204093 | 3300048912 | Bacteria | 1858 |
| 574 | Ga0496110_0000749 | 3300048913 | Bacteria | 22420 |
| 575 | Ga0496110_0035854 | 3300048913 | Bacteria | 4306 |
| 576 | Ga0496110_0104477 | 3300048913 | Bacteria | 2541 |
| 577 | Ga0496111_0065590 | 3300048914 | Bacteria | 2635 |
| 578 | Ga0496111_0085738 | 3300048914 | Bacteria | 2303 |
| 579 | Ga0496111_0087686 | 3300048914 | Bacteria | 2278 |
| 580 | Ga0496111_0168869 | 3300048914 | Bacteria | 1625 |
| 581 | Ga0496112_0011995 | 3300048915 | Bacteria | 7946 |
| 582 | Ga0496112_0138205 | 3300048915 | Bacteria | 2406 |
| 583 | Ga0496114_0004273 | 3300048917 | Bacteria | 11058 |
| 584 | Ga0496114_0004355 | 3300048917 | Bacteria | 10956 |
| 585 | Ga0496115_0016363 | 3300048918 | Bacteria | 5646 |
| 586 | Ga0496115_0035704 | 3300048918 | Bacteria | 3934 |
| 587 | Ga0496115_0129385 | 3300048918 | Bacteria | 2080 |
| 588 | Ga0496115_0283866 | 3300048918 | Bacteria | 1359 |
| 589 | Ga0496116_0064059 | 3300048919 | Bacteria | 2364 |
| 590 | Ga0496117_0006424 | 3300048920 | Bacteria | 11905 |
| 591 | Ga0496117_0031376 | 3300048920 | Bacteria | 4058 |
| 592 | Ga0496118_0001617 | 3300048921 | Bacteria | 33315 |
| 593 | Ga0496118_0013816 | 3300048921 | Bacteria | 7602 |
| 594 | Ga0496118_0026400 | 3300048921 | Bacteria | 4950 |
| 595 | Ga0496118_0036145 | 3300048921 | Bacteria | 3999 |
| 596 | Ga0496118_0049114 | 3300048921 | Bacteria | 3251 |
| 597 | Ga0496119_0017203 | 3300048922 | Bacteria | 5452 |
| 598 | Ga0496121_0000067 | 3300048924 | Bacteria | 261543 |
| 599 | Ga0496121_0000971 | 3300048924 | Bacteria | 51396 |
| 600 | Ga0496121_0004117 | 3300048924 | Bacteria | 19931 |
| 601 | Ga0496121_0014418 | 3300048924 | Bacteria | 8389 |
| 602 | Ga0496121_0041725 | 3300048924 | Bacteria | 4005 |
| 603 | Ga0496124_0009920 | 3300048927 | Bacteria | 9735 |
| 604 | Ga0496125_0030293 | 3300048928 | Bacteria | 4843 |
| 605 | Ga0496126_0002263 | 3300048929 | Bacteria | 26552 |
| 606 | Ga0496126_0026027 | 3300048929 | Bacteria | 5617 |
| 607 | Ga0495678_006910 | 3300049459 | Bacteria | 5955 |
| 608 | Ga0501031_0022942 | 3300049568 | Bacteria | 4071 |
| 609 | Ga0501031_0123276 | 3300049568 | Bacteria | 1693 |
| 610 | Ga0501032_0063880 | 3300049569 | Bacteria | 2464 |
| 611 | Ga0501033_0140245 | 3300049570 | Bacteria | 1748 |
| 612 | Ga0501033_0210888 | 3300049570 | Bacteria | 1385 |
| 613 | Ga0501034_0159316 | 3300049571 | Bacteria | 2229 |
| 614 | Ga0501034_0229596 | 3300049571 | Bacteria | 1805 |
| 615 | Ga0501036_0069542 | 3300049572 | Bacteria | 2978 |
| 616 | Ga0501036_0127718 | 3300049572 | Bacteria | 2147 |
| 617 | Ga0501038_0175975 | 3300049574 | Bacteria | 1729 |
| 618 | Ga0501039_0060357 | 3300049575 | Bacteria | 2937 |
| 619 | Ga0501039_0065361 | 3300049575 | Bacteria | 2822 |
| 620 | Ga0501039_0223194 | 3300049575 | Bacteria | 1481 |
| 621 | Ga0501040_0207821 | 3300049576 | Bacteria | 1391 |
| 622 | Ga0501041_0007554 | 3300049577 | Bacteria | 6382 |
| 623 | Ga0501041_0020253 | 3300049577 | Bacteria | 3975 |
| 624 | Ga0501041_0151457 | 3300049577 | Bacteria | 1448 |
| 625 | Ga0501042_0024795 | 3300049578 | Bacteria | 4209 |
| 626 | Ga0501042_0028271 | 3300049578 | Bacteria | 3949 |
| 627 | Ga0501042_0041353 | 3300049578 | Bacteria | 3278 |
| 628 | Ga0501043_0047123 | 3300049579 | Bacteria | 3389 |
| 629 | Ga0501043_0092072 | 3300049579 | Bacteria | 2383 |
| 630 | Ga0501043_0288899 | 3300049579 | Bacteria | 1255 |
| 631 | Ga0501046_0093862 | 3300049580 | Bacteria | 2306 |
| 632 | Ga0501046_0104003 | 3300049580 | Bacteria | 2176 |
| 633 | Ga0501047_0097175 | 3300049581 | Bacteria | 2823 |
| 634 | Ga0501047_0371876 | 3300049581 | Bacteria | 1264 |
| 635 | Ga0501048_0049420 | 3300049582 | Bacteria | 2997 |
| 636 | Ga0501048_0059167 | 3300049582 | Bacteria | 2715 |
| 637 | Ga0501067_0015248 | 3300049583 | Bacteria | 4255 |
| 638 | Ga0501067_0046897 | 3300049583 | Bacteria | 2398 |
| 639 | Ga0501067_0066958 | 3300049583 | Bacteria | 1988 |
| 640 | Ga0501068_0021133 | 3300049584 | Bacteria | 3799 |
| 641 | Ga0501068_0121652 | 3300049584 | Bacteria | 1628 |
| 642 | Ga0501070_0268112 | 3300049586 | Bacteria | 1395 |
| 643 | Ga0501071_0023605 | 3300049587 | Bacteria | 4295 |
| 644 | Ga0501071_0180334 | 3300049587 | Bacteria | 1582 |
| 645 | Ga0501071_0197755 | 3300049587 | Bacteria | 1509 |
| 646 | Ga0501072_0023049 | 3300049588 | Bacteria | 4835 |
| 647 | Ga0501072_0026249 | 3300049588 | Bacteria | 4541 |
| 648 | Ga0501072_0060245 | 3300049588 | Bacteria | 2993 |
| 649 | Ga0501072_0094984 | 3300049588 | Bacteria | 2369 |
| 650 | Ga0501072_0120064 | 3300049588 | Bacteria | 2094 |
| 651 | Ga0501072_0123769 | 3300049588 | Bacteria | 2060 |
| 652 | Ga0501072_0199328 | 3300049588 | Bacteria | 1596 |
| 653 | Ga0501073_0009857 | 3300049589 | Bacteria | 7028 |
| 654 | Ga0501074_0056052 | 3300049590 | Bacteria | 2840 |
| 655 | Ga0501074_0064797 | 3300049590 | Bacteria | 2631 |
| 656 | Ga0501074_0238004 | 3300049590 | Bacteria | 1295 |
| 657 | Ga0501075_0011522 | 3300049591 | Bacteria | 6258 |
| 658 | Ga0501075_0154545 | 3300049591 | Bacteria | 1749 |
| 659 | Ga0501076_0016491 | 3300049592 | Bacteria | 5601 |
| 660 | Ga0501076_0050875 | 3300049592 | Bacteria | 3278 |
| 661 | Ga0501076_0061808 | 3300049592 | Bacteria | 2981 |
| 662 | Ga0501077_0007715 | 3300049593 | Bacteria | 6642 |
| 663 | Ga0501077_0114284 | 3300049593 | Bacteria | 1712 |
| 664 | Ga0501079_0001187 | 3300049741 | Bacteria | 18244 |
| 665 | Ga0501079_0065344 | 3300049741 | Bacteria | 2806 |
| 666 | Ga0501080_0002465 | 3300049742 | Bacteria | 16197 |
| 667 | Ga0501080_0013521 | 3300049742 | Bacteria | 7511 |
| 668 | Ga0501080_0112812 | 3300049742 | Bacteria | 2520 |
| 669 | Ga0501080_0253779 | 3300049742 | Bacteria | 1603 |
| 670 | Ga0501080_0356880 | 3300049742 | Bacteria | 1319 |
| 671 | Ga0501080_0363716 | 3300049742 | Bacteria | 1305 |
| 672 | Ga0501081_0000552 | 3300049743 | Bacteria | 21253 |
| 673 | Ga0501081_0038542 | 3300049743 | Bacteria | 3266 |
| 674 | Ga0501083_0023713 | 3300049744 | Bacteria | 4255 |
| 675 | Ga0501083_0044876 | 3300049744 | Bacteria | 2992 |
| 676 | Ga0501083_0069092 | 3300049744 | Bacteria | 2351 |
| 677 | Ga0501035_0013774 | 3300049822 | Bacteria | 7465 |
| 678 | Ga0501035_0107081 | 3300049822 | Bacteria | 2450 |
| 679 | Ga0501035_0264077 | 3300049822 | Bacteria | 1458 |
| 680 | Ga0501044_0019395 | 3300049823 | Bacteria | 7276 |
| 681 | Ga0501045_0057758 | 3300049824 | Bacteria | 2840 |
| 682 | nmdc:mga0k408_49235_c1 | 3300050493 | Bacteria | 2439 |
| 683 | nmdc:mga05p37_156720_c1 | 3300050507 | Bacteria | 2782 |
| 684 | nmdc:mga05p37_2656_c2 | 3300050507 | Bacteria | 17190 |
| 685 | nmdc:mga09592_69991_c1 | 3300050508 | Bacteria | 2976 |
| 686 | nmdc:mga06r32_221935_c1 | 3300050510 | Bacteria | 1878 |
| 687 | nmdc:mga06r32_96795_c1 | 3300050510 | Bacteria | 2891 |
| 688 | nmdc:mga08y16_16056_c1 | 3300050511 | Bacteria | 7873 |
| 689 | nmdc:mga08y16_311774_c1 | 3300050511 | Bacteria | 1620 |
| 690 | nmdc:mga08y16_328713_c1 | 3300050511 | Bacteria | 1573 |
| 691 | nmdc:mga08y16_33445_c1 | 3300050511 | Bacteria | 5400 |
| 692 | nmdc:mga08y16_51009_c1 | 3300050511 | Bacteria | 4329 |
| 693 | nmdc:mga0n895_22023_c1 | 3300050512 | Bacteria | 5971 |
| 694 | nmdc:mga0n895_61570_c1 | 3300050512 | Bacteria | 3706 |
| 695 | nmdc:mga0rr50_103855_c1 | 3300050513 | Bacteria | 2237 |
| 696 | nmdc:mga0rr50_167360_c1 | 3300050513 | Bacteria | 1788 |
| 697 | nmdc:mga08x19_28543_c1 | 3300050514 | Bacteria | 3495 |
| 698 | nmdc:mga0a205_5535_c1 | 3300050515 | Bacteria | 11378 |
| 699 | nmdc:mga0a205_76398_c1 | 3300050515 | Bacteria | 3237 |
| 700 | Ga0500635_0000052 | 3300053080 | Bacteria | 75372 |
| 701 | Ga0495619_0005673 | 3300053085 | Bacteria | 7916 |
| 702 | Ga0500578_0000124 | 3300053086 | Bacteria | 92437 |
| 703 | Ga0500644_0000153 | 3300053088 | Bacteria | 43050 |
| 704 | Ga0500583_0111747 | 3300053092 | Bacteria | 1346 |
| 705 | Ga0500651_0020066 | 3300053093 | Bacteria | 4159 |
| 706 | Ga0500555_003265 | 3300053103 | Bacteria | 4616 |
| 707 | Ga0500556_0070161 | 3300053104 | Bacteria | 1307 |
| 708 | Ga0500562_006378 | 3300053108 | Bacteria | 2974 |
| 709 | Ga0500594_0000740 | 3300053118 | Bacteria | 6939 |
| 710 | Ga0500595_015695 | 3300053119 | Bacteria | 2837 |
| 711 | Ga0500607_065012 | 3300053121 | Bacteria | 1897 |
| 712 | Ga0500608_000784 | 3300053122 | Bacteria | 11594 |
| 713 | Ga0500608_001857 | 3300053122 | Bacteria | 7532 |
| 714 | Ga0500608_010380 | 3300053122 | Bacteria | 3996 |
| 715 | Ga0500614_008541 | 3300053123 | Bacteria | 2172 |
| 716 | Ga0500618_001535 | 3300053125 | Bacteria | 10128 |
| 717 | Ga0500642_0092318 | 3300053130 | Bacteria | 1400 |
| 718 | Ga0500658_0006065 | 3300053134 | Bacteria | 4493 |
| 719 | Ga0500658_0051430 | 3300053134 | Bacteria | 1684 |
| 720 | Ga0500559_0001246 | 3300053136 | Bacteria | 14976 |
| 721 | Ga0500559_0016293 | 3300053136 | Bacteria | 3138 |
| 722 | Ga0500559_0046638 | 3300053136 | Bacteria | 1901 |
| 723 | Ga0500564_002766 | 3300053138 | Bacteria | 6602 |
| 724 | Ga0500622_0006026 | 3300053156 | Bacteria | 7123 |
| 725 | Ga0500622_0078108 | 3300053156 | Bacteria | 1661 |
| 726 | Ga0500627_0000005 | 3300053158 | Bacteria | 167950 |
| 727 | Ga0500636_0023183 | 3300053177 | Bacteria | 3669 |
| 728 | Ga0500637_0012684 | 3300053178 | Bacteria | 4399 |
| 729 | Ga0500637_0040237 | 3300053178 | Bacteria | 2639 |
| 730 | Ga0500637_0054807 | 3300053178 | Bacteria | 2276 |
| 731 | Ga0500645_026619 | 3300053730 | Bacteria | 1759 |
| 732 | Ga0501084_0012410 | 3300054114 | Bacteria | 7060 |
| 733 | Ga0501084_0013640 | 3300054114 | Bacteria | 6726 |
| 734 | Ga0501084_0068400 | 3300054114 | Bacteria | 2973 |
| 735 | Ga0501084_0194466 | 3300054114 | Bacteria | 1711 |
| 736 | Ga0501082_0006434 | 3300060353 | Bacteria | 10192 |
| 737 | Ga0501082_0013531 | 3300060353 | Bacteria | 7010 |
| 738 | Ga0501082_0033299 | 3300060353 | Bacteria | 4446 |
| 739 | Ga0501082_0061877 | 3300060353 | Bacteria | 3222 |
| 740 | Ga0501082_0105632 | 3300060353 | Bacteria | 2436 |
| 741 | Ga0530510_0009039 | 3300061734 | Bacteria | 6983 |
| 742 | Ga0530510_0025731 | 3300061734 | Bacteria | 4209 |
| 743 | Ga0530510_0063005 | 3300061734 | Bacteria | 2685 |
| 744 | Ga0530510_0123794 | 3300061734 | Bacteria | 1900 |
| 745 | Ga0530510_0178921 | 3300061734 | Bacteria | 1572 |
| 746 | 2511122906 | 2510917020 | Bacteria | 5657507 |
| 747 | 2585147874 | 2582581279 | Bacteria | 4980720 |
| 748 | 2585152312 | 2582581280 | Bacteria | 5994497 |
| 749 | 2585198983 | 2582581293 | Bacteria | 5907401 |
| 750 | 2587918372 | 2585428106 | Bacteria | 5179711 |
| 751 | 2643750041 | 2643221545 | Bacteria | 5083237 |
| 752 | 2643782537 | 2643221552 | Bacteria | 5708754 |
| 753 | 2643835892 | 2643221563 | Bacteria | 4726935 |
| 754 | 2643923189 | 2643221583 | Bacteria | 5218014 |
| 755 | 2643928748 | 2643221584 | Bacteria | 5511711 |
| 756 | 2644056817 | 2643221608 | Bacteria | 4724829 |
| 757 | 2644227736 | 2643221640 | Bacteria | 5258820 |
| 758 | 2644234003 | 2643221642 | Bacteria | 5357871 |
| 759 | 2644510803 | 2643221691 | Bacteria | 5093099 |
| 760 | 2738711057 | 2738541275 | Bacteria | 4830863 |
| 761 | 2738849482 | 2738541301 | Bacteria | 4834102 |
| 762 | 2738865211 | 2738541304 | Bacteria | 4833665 |
| 763 | 2739297729 | 2738543022 | Bacteria | 4835059 |
| 764 | 2739359407 | 2738543033 | Bacteria | 4833336 |
| 765 | 2739790377 | 2739367756 | Bacteria | 4553612 |
| 766 | 2753463060 | 2751185821 | Bacteria | 6189929 |
| 767 | 2792460183 | 2791355048 | Bacteria | 5832535 |
| 768 | 2819535658 | 2818991435 | Bacteria | 5433759 |
| 769 | 2819644933 | 2818991454 | Bacteria | 5563326 |
| 770 | 2843746752 | 2843744320 | Bacteria | 5659202 |
| 771 | 2849562832 | 2849560528 | Bacteria | 5393480 |
| 772 | 2849576739 | 2849573788 | Bacteria | 5421256 |
| 773 | 2851154033 | 2851153111 | Bacteria | 5542585 |
| 774 | 2852655473 | 2852653556 | Bacteria | 4050083 |
| 775 | 2852681393 | 2852680915 | Bacteria | 4100189 |
| 776 | 2857505423 | 2857504554 | Bacteria | 5369913 |
| 777 | 2884962312 | 2884960567 | Bacteria | 5437054 |
| 778 | 2898333356 | 2898329390 | Bacteria | 5168154 |
| 779 | 2928103669 | 2928100450 | Bacteria | 4837635 |
| 780 | 2928533118 | 2928531327 | Bacteria | 5101314 |
| 781 | 2928961318 | 2928959182 | Bacteria | 4725774 |
| 782 | Ga0209758_1002327 | |||
| 783 | rootL2_10006987 | |||
| 784 | Ga0055537_1001980 | |||
| 785 | Ga0055524_1017208 | |||
| 786 | Ga0055536_1000787 | |||
| 787 | Ga0055536_1002943 | |||
| 788 | Ga0055536_1003896 | |||
| 789 | Ga0055536_1005195 | |||
| 790 | Ga0055536_1011827 | |||
| 791 | Ga0055534_1008899 | |||
| 792 | Ga0055528_1002045 | |||
| 793 | Ga0055530_10000270 | |||
| 794 | Ga0055530_10013210 | |||
| 795 | Ga0055530_10021046 | |||
| 796 | Ga0055530_10025806 | |||
| 797 | Ga0055531_10000371 | |||
| 798 | Ga0055531_10002055 | |||
| 799 | Ga0055531_10002062 | |||
| 800 | Ga0055531_10024253 | |||
| 801 | Ga0055531_10024327 | |||
| 802 | Ga0065165_1007528 | |||
| 803 | Ga0070683_100042785 | |||
| 804 | Ga0070690_100002434 | |||
| 805 | Ga0070690_100004347 | |||
| 806 | Ga0070670_100098031 | |||
| 807 | Ga0070666_10000962 | |||
| 808 | Ga0070680_100013082 | |||
| 809 | Ga0068868_100004028 | |||
| 810 | Ga0068868_100015991 | |||
| 811 | Ga0070660_100106440 | |||
| 812 | Ga0070689_100110960 | |||
| 813 | Ga0070661_100037327 | |||
| 814 | Ga0070692_10037764 | |||
| 815 | Ga0070668_100006431 | |||
| 816 | Ga0070668_100035551 | |||
| 817 | Ga0070669_100015669 | |||
| 818 | Ga0070669_100089659 | |||
| 819 | Ga0070675_100002824 | |||
| 820 | Ga0070675_100003925 | |||
| 821 | Ga0070675_100189374 | |||
| 822 | Ga0070671_100000657 | |||
| 823 | Ga0070671_100001534 | |||
| 824 | Ga0070671_100004754 | |||
| 825 | Ga0070671_100103761 | |||
| 826 | Ga0070673_100001288 | |||
| 827 | Ga0070688_100003170 | |||
| 828 | Ga0070659_100001767 | |||
| 829 | Ga0070667_100041630 | |||
| 830 | Ga0070667_100108820 | |||
| 831 | Ga0070709_10007519 | |||
| 832 | Ga0070709_10008679 | |||
| 833 | Ga0070714_100006553 | |||
| 834 | Ga0070714_100029604 | |||
| 835 | Ga0070713_100012067 | |||
| 836 | Ga0070713_100013671 | |||
| 837 | Ga0070710_10003818 | |||
| 838 | Ga0070701_10058066 | |||
| 839 | Ga0070711_100000991 | |||
| 840 | Ga0070711_100002860 | |||
| 841 | Ga0070711_100007365 | |||
| 842 | Ga0070705_100038144 | |||
| 843 | Ga0070700_100042304 | |||
| 844 | Ga0070663_100014095 | |||
| 845 | Ga0070678_100001008 | |||
| 846 | Ga0070678_100005204 | |||
| 847 | Ga0070662_100070774 | |||
| 848 | Ga0070681_10001577 | |||
| 849 | Ga0070681_10001582 | |||
| 850 | Ga0070681_10008934 | |||
| 851 | Ga0070681_10024376 | |||
| 852 | Ga0070681_10131966 | |||
| 853 | Ga0070699_100023197 | |||
| 854 | Ga0070679_100000469 | |||
| 855 | Ga0070679_100025516 | |||
| 856 | Ga0070679_100206288 | |||
| 857 | Ga0070679_100245050 | |||
| 858 | Ga0070684_100297982 | |||
| 859 | Ga0068853_100054163 | |||
| 860 | Ga0068853_100340741 | |||
| 861 | Ga0070672_100018389 | |||
| 862 | Ga0070686_100007351 | |||
| 863 | Ga0070695_100001122 | |||
| 864 | Ga0070695_100046465 | |||
| 865 | Ga0070696_100003437 | |||
| 866 | Ga0070696_100064546 | |||
| 867 | Ga0070693_100004808 | |||
| 868 | Ga0070693_100096717 | |||
| 869 | Ga0070665_100002122 | |||
| 870 | Ga0070704_100007227 | |||
| 871 | Ga0070704_100054768 | |||
| 872 | Ga0070704_100129263 | |||
| 873 | Ga0068855_100001482 | |||
| 874 | Ga0068855_100001944 | |||
| 875 | Ga0068855_100152015 | |||
| 876 | Ga0070664_100004986 | |||
| 877 | Ga0068857_100066753 | |||
| 878 | Ga0068857_100121702 | |||
| 879 | Ga0068854_100013995 | |||
| 880 | Ga0068854_100240349 | |||
| 881 | Ga0068856_100008652 | |||
| 882 | Ga0068856_100113281 | |||
| 883 | Ga0068856_100389140 | |||
| 884 | Ga0070702_100000727 | |||
| 885 | Ga0068852_100108169 | |||
| 886 | Ga0068859_100043197 | |||
| 887 | Ga0068859_100069694 | |||
| 888 | Ga0068859_100081028 | |||
| 889 | Ga0068859_100109922 | |||
| 890 | Ga0068859_100207818 | |||
| 891 | Ga0068864_100000096 | |||
| 892 | Ga0068864_100017049 | |||
| 893 | Ga0068864_100035560 | |||
| 894 | Ga0068866_10008386 | |||
| 895 | Ga0068866_10090683 | |||
| 896 | Ga0068861_100003267 | |||
| 897 | Ga0068863_100000041 | |||
| 898 | Ga0068863_100005625 | |||
| 899 | Ga0068863_100022625 | |||
| 900 | Ga0068863_100022759 | |||
| 901 | Ga0068858_100000108 | |||
| 902 | Ga0068858_100007229 | |||
| 903 | Ga0068858_100019147 | |||
| 904 | Ga0068858_100156156 | |||
| 905 | Ga0068860_100007155 | |||
| 906 | Ga0068860_100007202 | |||
| 907 | Ga0068860_100012873 | |||
| 908 | Ga0068860_100022565 | |||
| 909 | Ga0068862_100000059 | |||
| 910 | Ga0068862_100077587 | |||
| 911 | Ga0081455_10001941 | |||
| 912 | Ga0081455_10052856 | |||
| 913 | Ga0070715_10001572 | |||
| 914 | Ga0070715_10003057 | |||
| 915 | Ga0070716_100000449 | |||
| 916 | Ga0070716_100133192 | |||
| 917 | Ga0070712_100052794 | |||
| 918 | Ga0075369_10052968 | |||
| 919 | Ga0075366_10065725 | |||
| 920 | Ga0097621_100322680 | |||
| 921 | Ga0068871_100026906 | |||
| 922 | Ga0075428_100012185 | |||
| 923 | Ga0075431_100048414 | |||
| 924 | Ga0075433_10002458 | |||
| 925 | Ga0075433_10008589 | |||
| 926 | Ga0075434_100000766 | |||
| 927 | Ga0075434_100017502 | |||
| 928 | Ga0068865_100000735 | |||
| 929 | Ga0068865_100252483 | |||
| 930 | Ga0097620_100043196 | |||
| 931 | Ga0097620_100069696 | |||
| 932 | Ga0097620_100081026 | |||
| 933 | Ga0097620_100109919 | |||
| 934 | Ga0097620_100207827 | |||
| 935 | Ga0099795_10000022 | |||
| 936 | Ga0105250_10024018 | |||
| 937 | Ga0105250_10035519 | |||
| 938 | Ga0105240_10002705 | |||
| 939 | Ga0105240_10003826 | |||
| 940 | Ga0105240_10008281 | |||
| 941 | Ga0105240_10024889 | |||
| 942 | Ga0105240_10111111 | |||
| 943 | Ga0105240_10150093 | |||
| 944 | Ga0111539_10000539 | |||
| 945 | Ga0111539_10005627 | |||
| 946 | Ga0111539_10683492 | |||
| 947 | Ga0105245_10000738 | |||
| 948 | Ga0105245_10007920 | |||
| 949 | Ga0105247_10002269 | |||
| 950 | Ga0105247_10010243 | |||
| 951 | Ga0105247_10012409 | |||
| 952 | Ga0105247_10021799 | |||
| 953 | Ga0114129_10010448 | |||
| 954 | Ga0114129_10089316 | |||
| 955 | Ga0114129_10289030 | |||
| 956 | Ga0105241_10007997 | |||
| 957 | Ga0105242_10005298 | |||
| 958 | Ga0105242_10050505 | |||
| 959 | Ga0105248_10001268 | |||
| 960 | Ga0105248_10003698 | |||
| 961 | Ga0105248_10005489 | |||
| 962 | Ga0105248_10024418 | |||
| 963 | Ga0105248_10067758 | |||
| 964 | Ga0105248_10111326 | |||
| 965 | Ga0105248_10199938 | |||
| 966 | Ga0105237_10014418 | |||
| 967 | Ga0105237_10104733 | |||
| 968 | Ga0105237_10164315 | |||
| 969 | Ga0105237_10204122 | |||
| 970 | Ga0105238_10005376 | |||
| 971 | Ga0105238_10006381 | |||
| 972 | Ga0105249_10000065 | |||
| 973 | Ga0105249_10008955 | |||
| 974 | Ga0105030_100135 | |||
| 975 | Ga0099796_10000025 | |||
| 976 | Ga0099796_10001494 | |||
| 977 | Ga0105239_10000694 | |||
| 978 | Ga0105239_10005723 | |||
| 979 | Ga0105246_10003747 | |||
| 980 | Ga0157371_10097944 | |||
| 981 | Ga0157370_10001472 | |||
| 982 | Ga0157370_10086899 | |||
| 983 | Ga0157369_10006045 | |||
| 984 | Ga0157369_10065057 | |||
| 985 | Ga0157369_10115433 | |||
| 986 | Ga0157369_10256981 | |||
| 987 | Ga0157369_10334481 | |||
| 988 | Ga0157374_10007656 | |||
| 989 | Ga0157374_10102377 | |||
| 990 | Ga0157374_10289571 | |||
| 991 | Ga0157374_10507111 | |||
| 992 | Ga0157378_10004873 | |||
| 993 | Ga0163162_10004801 | |||
| 994 | Ga0157372_10014940 | |||
| 995 | Ga0157372_10071871 | |||
| 996 | Ga0157375_10004187 | |||
| 997 | Ga0157375_10018198 | |||
| 998 | Ga0157375_10071259 | |||
| 999 | Ga0163163_10010899 | |||
| 1000 | Ga0163163_10029400 | |||
| 1001 | Ga0163163_10101260 | |||
| 1002 | Ga0157380_10004376 | |||
| 1003 | Ga0157377_10103846 | |||
| 1004 | Ga0157379_10006630 | |||
| 1005 | Ga0157379_10030721 | |||
| 1006 | Ga0157379_10126453 | |||
| 1007 | Ga0157376_10000896 | |||
| 1008 | Ga0157376_10013774 | |||
| 1009 | Ga0157376_10106809 | |||
| 1010 | Ga0157376_10115157 | |||
| 1011 | Ga0183365_10004 | |||
| 1012 | Ga0163161_10115144 | |||
| 1013 | Ga0213872_10000038 | |||
| 1014 | Ga0213872_10018666 | |||
| 1015 | Ga0213872_10036249 | |||
| 1016 | Ga0213872_10079967 | |||
| 1017 | Ga0213875_10000081 | |||
| 1018 | Ga0213875_10000307 | |||
| 1019 | Ga0224572_1008387 | |||
| 1020 | Ga0209565_1000065 | |||
| 1021 | Ga0209673_1000818 | |||
| 1022 | Ga0209675_1000275 | |||
| 1023 | Ga0209676_1000085 | |||
| 1024 | Ga0209676_1000171 | |||
| 1025 | Ga0209676_1000177 | |||
| 1026 | Ga0209676_1000349 | |||
| 1027 | Ga0209676_1000648 | |||
| 1028 | Ga0209564_1001008 | |||
| 1029 | Ga0209758_1004537 | |||
| 1030 | Ga0209050_1000042 | |||
| 1031 | Ga0209050_1000496 | |||
| 1032 | Ga0209050_1001766 | |||
| 1033 | Ga0209050_1008080 | |||
| 1034 | Ga0209050_1014594 | |||
| 1035 | Ga0209256_1000855 | |||
| 1036 | Ga0209051_1001860 | |||
| 1037 | Ga0209257_1000074 | |||
| 1038 | Ga0209257_1000135 | |||
| 1039 | Ga0209257_1000253 | |||
| 1040 | Ga0209257_1000482 | |||
| 1041 | Ga0209257_1002290 | |||
| 1042 | Ga0209257_1006411 | |||
| 1043 | Ga0207692_10058000 | |||
| 1044 | Ga0207710_10003083 | |||
| 1045 | Ga0207710_10095544 | |||
| 1046 | Ga0207688_10033699 | |||
| 1047 | Ga0207688_10111822 | |||
| 1048 | Ga0207680_10114148 | |||
| 1049 | Ga0207680_10136162 | |||
| 1050 | Ga0207647_10001136 | |||
| 1051 | Ga0207699_10009239 | |||
| 1052 | Ga0207699_10013238 | |||
| 1053 | Ga0207699_10026246 | |||
| 1054 | Ga0207707_10000122 | |||
| 1055 | Ga0207707_10036563 | |||
| 1056 | Ga0207707_10044816 | |||
| 1057 | Ga0207707_10106221 | |||
| 1058 | Ga0207707_10129357 | |||
| 1059 | Ga0207695_10002114 | |||
| 1060 | Ga0207695_10003540 | |||
| 1061 | Ga0207695_10024615 | |||
| 1062 | Ga0207695_10076336 | |||
| 1063 | Ga0207695_10332380 | |||
| 1064 | Ga0207671_10009799 | |||
| 1065 | Ga0207671_10023246 | |||
| 1066 | Ga0207671_10097681 | |||
| 1067 | Ga0207693_10000083 | |||
| 1068 | Ga0207693_10000551 | |||
| 1069 | Ga0207663_10003079 | |||
| 1070 | Ga0207663_10014494 | |||
| 1071 | Ga0207663_10048556 | |||
| 1072 | Ga0207660_10004896 | |||
| 1073 | Ga0207660_10024101 | |||
| 1074 | Ga0207660_10197635 | |||
| 1075 | Ga0207662_10001396 | |||
| 1076 | Ga0207657_10008555 | |||
| 1077 | Ga0207652_10000613 | |||
| 1078 | Ga0207652_10032150 | |||
| 1079 | Ga0207652_10099654 | |||
| 1080 | Ga0207694_10003403 | |||
| 1081 | Ga0207694_10102396 | |||
| 1082 | Ga0207659_10007954 | |||
| 1083 | Ga0207687_10017700 | |||
| 1084 | Ga0207687_10110472 | |||
| 1085 | Ga0207700_10146086 | |||
| 1086 | Ga0207664_10002133 | |||
| 1087 | Ga0207644_10156497 | |||
| 1088 | Ga0207706_10001303 | |||
| 1089 | Ga0207686_10012915 | |||
| 1090 | Ga0207686_10075458 | |||
| 1091 | Ga0207670_10052443 | |||
| 1092 | Ga0207704_10004318 | |||
| 1093 | Ga0207704_10100132 | |||
| 1094 | Ga0207665_10000478 | |||
| 1095 | Ga0207665_10000587 | |||
| 1096 | Ga0207665_10113687 | |||
| 1097 | Ga0207691_10006970 | |||
| 1098 | Ga0207711_10002830 | |||
| 1099 | Ga0207711_10005213 | |||
| 1100 | Ga0207711_10014144 | |||
| 1101 | Ga0207711_10071669 | |||
| 1102 | Ga0207711_10189111 | |||
| 1103 | Ga0207689_10246610 | |||
| 1104 | Ga0207661_10208532 | |||
| 1105 | Ga0207667_10000798 | |||
| 1106 | Ga0207667_10010115 | |||
| 1107 | Ga0207667_10045147 | |||
| 1108 | Ga0207667_10058371 | |||
| 1109 | Ga0207712_10000002 | |||
| 1110 | Ga0207712_10086967 | |||
| 1111 | Ga0207668_10004667 | |||
| 1112 | Ga0207668_10028281 | |||
| 1113 | Ga0207640_10012125 | |||
| 1114 | Ga0207640_10056000 | |||
| 1115 | Ga0207677_10057269 | |||
| 1116 | Ga0207703_10000035 | |||
| 1117 | Ga0207703_10028593 | |||
| 1118 | Ga0207703_10034034 | |||
| 1119 | Ga0207703_10065995 | |||
| 1120 | Ga0207703_10251779 | |||
| 1121 | Ga0207702_10014159 | |||
| 1122 | Ga0207702_10128842 | |||
| 1123 | Ga0207641_10000027 | |||
| 1124 | Ga0207641_10001424 | |||
| 1125 | Ga0207641_10012457 | |||
| 1126 | Ga0207641_10031125 | |||
| 1127 | Ga0207648_10031254 | |||
| 1128 | Ga0207676_10000418 | |||
| 1129 | Ga0207674_10005594 | |||
| 1130 | Ga0207675_100003266 | |||
| 1131 | Ga0207683_10004828 | |||
| 1132 | Ga0207683_10004897 | |||
| 1133 | Ga0207698_10129894 | |||
| 1134 | Ga0209971_1011656 | |||
| 1135 | Ga0209974_10005604 | |||
| 1136 | Ga0207428_10005547 | |||
| 1137 | Ga0207428_10014951 | |||
| 1138 | Ga0207428_10085930 | |||
| 1139 | Ga0268266_10086554 | |||
| 1140 | Ga0268265_10000114 | |||
| 1141 | Ga0268265_10002149 | |||
| 1142 | Ga0268265_10097925 | |||
| 1143 | Ga0268264_10000562 | |||
| 1144 | Ga0268264_10018337 | |||
| 1145 | Ga0268264_10096693 | |||
| 1146 | Ga0268264_10161239 | |||
| 1147 | Ga0268264_10185166 | |||
| 1148 | Ga0268264_10387470 | |||
| 1149 | Ga0265326_10003138 | |||
| 1150 | Ga0265334_10010215 | |||
| 1151 | Ga0265318_10001836 | |||
| 1152 | Ga0307515_10045057 | |||
| 1153 | Ga0265338_10027362 | |||
| 1154 | Ga0307511_10000268 | |||
| 1155 | Ga0265330_10004483 | |||
| 1156 | Ga0265332_10003174 | |||
| 1157 | Ga0265328_10014767 | |||
| 1158 | Ga0265328_10034097 | |||
| 1159 | Ga0265320_10010245 | |||
| 1160 | Ga0265320_10044698 | |||
| 1161 | Ga0265329_10002693 | |||
| 1162 | Ga0265339_10074777 | |||
| 1163 | Ga0265331_10009724 | |||
| 1164 | Ga0265327_10001660 | |||
| 1165 | Ga0265316_10049287 | |||
| 1166 | Ga0307513_10002752 | |||
| 1167 | Ga0307513_10020402 | |||
| 1168 | Ga0307509_10003194 | |||
| 1169 | Ga0307408_100016261 | |||
| 1170 | Ga0307508_10061746 | |||
| 1171 | Ga0265314_10022086 | |||
| 1172 | Ga0265342_10012843 | |||
| 1173 | Ga0316576_10017920 | |||
| 1174 | Ga0307405_10315093 | |||
| 1175 | Ga0307413_10031975 | |||
| 1176 | Ga0307410_10191260 | |||
| 1177 | Ga0307410_10219450 | |||
| 1178 | Ga0307410_10233460 | |||
| 1179 | Ga0307412_10100891 | |||
| 1180 | Ga0307409_100028297 | |||
| 1181 | Ga0307409_100289090 | |||
| 1182 | Ga0307416_100003094 | |||
| 1183 | Ga0307416_100042886 | |||
| 1184 | Ga0307414_10013586 | |||
| 1185 | Ga0307414_10022560 | |||
| 1186 | Ga0307414_10038574 | |||
| 1187 | Ga0307411_10048225 | |||
| 1188 | Ga0307415_100001180 | |||
| 1189 | Ga0373923_0020999 | |||
| 1190 | Ga0373945_0023197 | |||
| 1191 | Ga0373945_0068007 | |||
| 1192 | Ga0373943_0047771 | |||
| 1193 | Ga0373946_0017825 | |||
| 1194 | Ga0373946_0094953 | |||
| 1195 | Ga0373942_0010698 | |||
| 1196 | Ga0373961_0031387 | |||
| 1197 | Ga0373962_0028711 | |||
| 1198 | Ga0373931_0088269 | |||
| 1199 | Ga0373931_0155118 | |||
| 1200 | Ga0373935_0108787 | |||
| 1201 | Ga0373927_0006326 | |||
| 1202 | Ga0373927_0015626 | |||
| 1203 | Ga0373927_0148040 | |||
| 1204 | Ga0373933_0012987 | |||
| 1205 | Ga0373947_0140208 | |||
| 1206 | Ga0373947_0185355 | |||
| 1207 | Ga0373937_0031120 | |||
| 1208 | Ga0373937_0048457 | |||
| 1209 | Ga0373937_0100366 | |||
| 1210 | Ga0316584_0068487 | |||
| 1211 | Ga0373925_0093366 | |||
| 1212 | Ga0395900_0084547 | |||
| 1213 | Ga0395898_0020760 | |||
| 1214 | Ga0395898_0036071 | |||
| 1215 | Ga0395905_0000136 | |||
| 1216 | Ga0436364_0210071 | |||
| 1217 | Ga0436364_0560002 | |||
| 1218 | Ga0436364_0822555 | |||
| 1219 | Ga0436364_0856291 | |||
| 1220 | Ga0400489_17737 | |||
| 1221 | Ga0436365_0969803 | |||
| 1222 | Ga0436360_1031300 | |||
| 1223 | Ga0436361_0200397 | |||
| 1224 | Ga0436361_0328064 | |||
| 1225 | Ga0436361_1108648 | |||
| 1226 | Ga0436363_1410071 | |||
| 1227 | Ga0439454_005654 | |||
| 1228 | Ga0450920_007942 | |||
| 1229 | Ga0450890_007161 | |||
| 1230 | Ga0439446_0045152 | |||
| 1231 | Ga0439446_0054380 | |||
| 1232 | Ga0450908_003021 | |||
| 1233 | Ga0439434_0003968 | |||
| 1234 | Ga0439435_0001752 | |||
| 1235 | Ga0451577_0000194 | |||
| 1236 | Ga0451577_0041605 | |||
| 1237 | Ga0451577_0090539 | |||
| 1238 | Ga0451577_0106942 | |||
| 1239 | Ga0466969_0003345 | |||
| 1240 | Ga0466965_0224118 | |||
| 1241 | Ga0453684_0000218 | |||
| 1242 | Ga0466957_0130437 | |||
| 1243 | Ga0466959_0035356 | |||
| 1244 | Ga0451576_0000643 | |||
| 1245 | Ga0451576_0013885 | |||
| 1246 | Ga0451576_0049885 | |||
| 1247 | Ga0451576_0343852 | |||
| 1248 | Ga0495627_001458 | |||
| 1249 | Ga0495603_0006487 | |||
| 1250 | Ga0495603_0015445 | |||
| 1251 | Ga0495590_0013702 | |||
| 1252 | Ga0495629_0001118 | |||
| 1253 | Ga0495638_0000147 | |||
| 1254 | Ga0495638_0009919 | |||
| 1255 | Ga0495638_0012304 | |||
| 1256 | Ga0495638_0016883 | |||
| 1257 | Ga0495638_0063163 | |||
| 1258 | Ga0495650_0000045 | |||
| 1259 | Ga0495580_0003653 | |||
| 1260 | Ga0495580_0008705 | |||
| 1261 | Ga0495582_0000461 | |||
| 1262 | Ga0495639_0030378 | |||
| 1263 | Ga0495594_0000049 | |||
| 1264 | Ga0495594_0074049 | |||
| 1265 | Ga0495607_0140519 | |||
| 1266 | Ga0495583_0000005 | |||
| 1267 | Ga0495583_0023608 | |||
| 1268 | Ga0495606_0005055 | |||
| 1269 | Ga0495610_0000101 | |||
| 1270 | Ga0495610_0002849 | |||
| 1271 | Ga0495610_0112313 | |||
| 1272 | Ga0495616_0001495 | |||
| 1273 | Ga0495618_0149756 | |||
| 1274 | Ga0495620_0059358 | |||
| 1275 | Ga0495631_0002007 | |||
| 1276 | Ga0495632_0006366 | |||
| 1277 | Ga0495632_0067821 | |||
| 1278 | Ga0495648_0003254 | |||
| 1279 | Ga0495666_0053701 | |||
| 1280 | Ga0495654_0000018 | |||
| 1281 | Ga0495665_0014972 | |||
| 1282 | Ga0495597_0002750 | |||
| 1283 | Ga0495622_0002657 | |||
| 1284 | Ga0495622_0020281 | |||
| 1285 | Ga0495668_0000001 | |||
| 1286 | Ga0495668_0000026 | |||
| 1287 | Ga0495668_0051407 | |||
| 1288 | Ga0495668_0068994 | |||
| 1289 | Ga0495634_0040795 | |||
| 1290 | Ga0495611_0034808 | |||
| 1291 | Ga0495625_0000099 | |||
| 1292 | Ga0495625_0000373 | |||
| 1293 | Ga0495625_0023590 | |||
| 1294 | Ga0495625_0043033 | |||
| 1295 | Ga0495625_0052636 | |||
| 1296 | Ga0495625_0055958 | |||
| 1297 | Ga0495625_0138550 | |||
| 1298 | Ga0495669_0000321 | |||
| 1299 | Ga0495613_0000244 | |||
| 1300 | Ga0495649_0012413 | |||
| 1301 | Ga0495660_0007468 | |||
| 1302 | Ga0495581_0092426 | |||
| 1303 | Ga0495604_0043627 | |||
| 1304 | Ga0495672_0000472 | |||
| 1305 | Ga0495672_0091436 | |||
| 1306 | Ga0495676_0034293 | |||
| 1307 | Ga0495680_0113860 | |||
| 1308 | Ga0495687_040408 | |||
| 1309 | Ga0495673_0000119 | |||
| 1310 | Ga0495673_0000967 | |||
| 1311 | Ga0495673_0045019 | |||
| 1312 | Ga0495686_0023674 | |||
| 1313 | Ga0495686_0049321 | |||
| 1314 | Ga0495593_0008379 | |||
| 1315 | Ga0495593_0032243 | |||
| 1316 | Ga0495602_0048266 | |||
| 1317 | Ga0495626_0029671 | |||
| 1318 | Ga0496100_0003273 | |||
| 1319 | Ga0496100_0007689 | |||
| 1320 | Ga0496100_0217204 | |||
| 1321 | Ga0496100_0264167 | |||
| 1322 | Ga0496101_0025222 | |||
| 1323 | Ga0496101_0149515 | |||
| 1324 | Ga0496102_0006064 | |||
| 1325 | Ga0496102_0040309 | |||
| 1326 | Ga0496102_0042344 | |||
| 1327 | Ga0496102_0096849 | |||
| 1328 | Ga0496102_0097177 | |||
| 1329 | Ga0496102_0171477 | |||
| 1330 | Ga0496102_0223101 | |||
| 1331 | Ga0496102_0338449 | |||
| 1332 | Ga0496103_0023391 | |||
| 1333 | Ga0496103_0063876 | |||
| 1334 | Ga0496103_0130479 | |||
| 1335 | Ga0496104_0032491 | |||
| 1336 | Ga0496104_0211380 | |||
| 1337 | Ga0496105_0001071 | |||
| 1338 | Ga0496105_0005319 | |||
| 1339 | Ga0496105_0010006 | |||
| 1340 | Ga0496106_0002565 | |||
| 1341 | Ga0496106_0013682 | |||
| 1342 | Ga0496106_0034515 | |||
| 1343 | Ga0496107_0000168 | |||
| 1344 | Ga0496107_0001015 | |||
| 1345 | Ga0496107_0034840 | |||
| 1346 | Ga0496107_0039577 | |||
| 1347 | Ga0496108_0021858 | |||
| 1348 | Ga0496108_0171428 | |||
| 1349 | Ga0496108_0544658 | |||
| 1350 | Ga0496109_0011744 | |||
| 1351 | Ga0496109_0055487 | |||
| 1352 | Ga0496109_0115142 | |||
| 1353 | Ga0496109_0196080 | |||
| 1354 | Ga0496109_0204093 | |||
| 1355 | Ga0496110_0000749 | |||
| 1356 | Ga0496110_0035854 | |||
| 1357 | Ga0496110_0104477 | |||
| 1358 | Ga0496111_0065590 | |||
| 1359 | Ga0496111_0085738 | |||
| 1360 | Ga0496111_0087686 | |||
| 1361 | Ga0496111_0168869 | |||
| 1362 | Ga0496112_0011995 | |||
| 1363 | Ga0496112_0138205 | |||
| 1364 | Ga0496114_0004273 | |||
| 1365 | Ga0496114_0004355 | |||
| 1366 | Ga0496115_0016363 | |||
| 1367 | Ga0496115_0035704 | |||
| 1368 | Ga0496115_0129385 | |||
| 1369 | Ga0496115_0283866 | |||
| 1370 | Ga0496116_0064059 | |||
| 1371 | Ga0496117_0006424 | |||
| 1372 | Ga0496117_0031376 | |||
| 1373 | Ga0496118_0001617 | |||
| 1374 | Ga0496118_0013816 | |||
| 1375 | Ga0496118_0026400 | |||
| 1376 | Ga0496118_0036145 | |||
| 1377 | Ga0496118_0049114 | |||
| 1378 | Ga0496119_0017203 | |||
| 1379 | Ga0496121_0000067 | |||
| 1380 | Ga0496121_0000971 | |||
| 1381 | Ga0496121_0004117 | |||
| 1382 | Ga0496121_0014418 | |||
| 1383 | Ga0496121_0041725 | |||
| 1384 | Ga0496124_0009920 | |||
| 1385 | Ga0496125_0030293 | |||
| 1386 | Ga0496126_0002263 | |||
| 1387 | Ga0496126_0026027 | |||
| 1388 | Ga0495678_006910 | |||
| 1389 | Ga0501031_0022942 | |||
| 1390 | Ga0501031_0123276 | |||
| 1391 | Ga0501032_0063880 | |||
| 1392 | Ga0501033_0140245 | |||
| 1393 | Ga0501033_0210888 | |||
| 1394 | Ga0501034_0159316 | |||
| 1395 | Ga0501034_0229596 | |||
| 1396 | Ga0501036_0069542 | |||
| 1397 | Ga0501036_0127718 | |||
| 1398 | Ga0501038_0175975 | |||
| 1399 | Ga0501039_0060357 | |||
| 1400 | Ga0501039_0065361 | |||
| 1401 | Ga0501039_0223194 | |||
| 1402 | Ga0501040_0207821 | |||
| 1403 | Ga0501041_0007554 | |||
| 1404 | Ga0501041_0020253 | |||
| 1405 | Ga0501041_0151457 | |||
| 1406 | Ga0501042_0024795 | |||
| 1407 | Ga0501042_0028271 | |||
| 1408 | Ga0501042_0041353 | |||
| 1409 | Ga0501043_0047123 | |||
| 1410 | Ga0501043_0092072 | |||
| 1411 | Ga0501043_0288899 | |||
| 1412 | Ga0501046_0093862 | |||
| 1413 | Ga0501046_0104003 | |||
| 1414 | Ga0501047_0097175 | |||
| 1415 | Ga0501047_0371876 | |||
| 1416 | Ga0501048_0049420 | |||
| 1417 | Ga0501048_0059167 | |||
| 1418 | Ga0501067_0015248 | |||
| 1419 | Ga0501067_0046897 | |||
| 1420 | Ga0501067_0066958 | |||
| 1421 | Ga0501068_0021133 | |||
| 1422 | Ga0501068_0121652 | |||
| 1423 | Ga0501070_0268112 | |||
| 1424 | Ga0501071_0023605 | |||
| 1425 | Ga0501071_0180334 | |||
| 1426 | Ga0501071_0197755 | |||
| 1427 | Ga0501072_0023049 | |||
| 1428 | Ga0501072_0026249 | |||
| 1429 | Ga0501072_0060245 | |||
| 1430 | Ga0501072_0094984 | |||
| 1431 | Ga0501072_0120064 | |||
| 1432 | Ga0501072_0123769 | |||
| 1433 | Ga0501072_0199328 | |||
| 1434 | Ga0501073_0009857 | |||
| 1435 | Ga0501074_0056052 | |||
| 1436 | Ga0501074_0064797 | |||
| 1437 | Ga0501074_0238004 | |||
| 1438 | Ga0501075_0011522 | |||
| 1439 | Ga0501075_0154545 | |||
| 1440 | Ga0501076_0016491 | |||
| 1441 | Ga0501076_0050875 | |||
| 1442 | Ga0501076_0061808 | |||
| 1443 | Ga0501077_0007715 | |||
| 1444 | Ga0501077_0114284 | |||
| 1445 | Ga0501079_0001187 | |||
| 1446 | Ga0501079_0065344 | |||
| 1447 | Ga0501080_0002465 | |||
| 1448 | Ga0501080_0013521 | |||
| 1449 | Ga0501080_0112812 | |||
| 1450 | Ga0501080_0253779 | |||
| 1451 | Ga0501080_0356880 | |||
| 1452 | Ga0501080_0363716 | |||
| 1453 | Ga0501081_0000552 | |||
| 1454 | Ga0501081_0038542 | |||
| 1455 | Ga0501083_0023713 | |||
| 1456 | Ga0501083_0044876 | |||
| 1457 | Ga0501083_0069092 | |||
| 1458 | Ga0501035_0013774 | |||
| 1459 | Ga0501035_0107081 | |||
| 1460 | Ga0501035_0264077 | |||
| 1461 | Ga0501044_0019395 | |||
| 1462 | Ga0501045_0057758 | |||
| 1463 | nmdc:mga0k408_49235_c1 | |||
| 1464 | nmdc:mga05p37_156720_c1 | |||
| 1465 | nmdc:mga05p37_2656_c2 | |||
| 1466 | nmdc:mga09592_69991_c1 | |||
| 1467 | nmdc:mga06r32_221935_c1 | |||
| 1468 | nmdc:mga06r32_96795_c1 | |||
| 1469 | nmdc:mga08y16_16056_c1 | |||
| 1470 | nmdc:mga08y16_311774_c1 | |||
| 1471 | nmdc:mga08y16_328713_c1 | |||
| 1472 | nmdc:mga08y16_33445_c1 | |||
| 1473 | nmdc:mga08y16_51009_c1 | |||
| 1474 | nmdc:mga0n895_22023_c1 | |||
| 1475 | nmdc:mga0n895_61570_c1 | |||
| 1476 | nmdc:mga0rr50_103855_c1 | |||
| 1477 | nmdc:mga0rr50_167360_c1 | |||
| 1478 | nmdc:mga08x19_28543_c1 | |||
| 1479 | nmdc:mga0a205_5535_c1 | |||
| 1480 | nmdc:mga0a205_76398_c1 | |||
| 1481 | Ga0500635_0000052 | |||
| 1482 | Ga0495619_0005673 | |||
| 1483 | Ga0500578_0000124 | |||
| 1484 | Ga0500644_0000153 | |||
| 1485 | Ga0500583_0111747 | |||
| 1486 | Ga0500651_0020066 | |||
| 1487 | Ga0500555_003265 | |||
| 1488 | Ga0500556_0070161 | |||
| 1489 | Ga0500562_006378 | |||
| 1490 | Ga0500594_0000740 | |||
| 1491 | Ga0500595_015695 | |||
| 1492 | Ga0500607_065012 | |||
| 1493 | Ga0500608_000784 | |||
| 1494 | Ga0500608_001857 | |||
| 1495 | Ga0500608_010380 | |||
| 1496 | Ga0500614_008541 | |||
| 1497 | Ga0500618_001535 | |||
| 1498 | Ga0500642_0092318 | |||
| 1499 | Ga0500658_0006065 | |||
| 1500 | Ga0500658_0051430 | |||
| 1501 | Ga0500559_0001246 | |||
| 1502 | Ga0500559_0016293 | |||
| 1503 | Ga0500559_0046638 | |||
| 1504 | Ga0500564_002766 | |||
| 1505 | Ga0500622_0006026 | |||
| 1506 | Ga0500622_0078108 | |||
| 1507 | Ga0500627_0000005 | |||
| 1508 | Ga0500636_0023183 | |||
| 1509 | Ga0500637_0012684 | |||
| 1510 | Ga0500637_0040237 | |||
| 1511 | Ga0500637_0054807 | |||
| 1512 | Ga0500645_026619 | |||
| 1513 | Ga0501084_0012410 | |||
| 1514 | Ga0501084_0013640 | |||
| 1515 | Ga0501084_0068400 | |||
| 1516 | Ga0501084_0194466 | |||
| 1517 | Ga0501082_0006434 | |||
| 1518 | Ga0501082_0013531 | |||
| 1519 | Ga0501082_0033299 | |||
| 1520 | Ga0501082_0061877 | |||
| 1521 | Ga0501082_0105632 | |||
| 1522 | Ga0530510_0009039 | |||
| 1523 | Ga0530510_0025731 | |||
| 1524 | Ga0530510_0063005 | |||
| 1525 | Ga0530510_0123794 | |||
| 1526 | Ga0530510_0178921 | |||
| 1527 | 2511122906 | |||
| 1528 | 2585147874 | |||
| 1529 | 2585152312 | |||
| 1530 | 2585198983 | |||
| 1531 | 2587918372 | |||
| 1532 | 2643750041 | |||
| 1533 | 2643782537 | |||
| 1534 | 2643835892 | |||
| 1535 | 2643923189 | |||
| 1536 | 2643928748 | |||
| 1537 | 2644056817 | |||
| 1538 | 2644227736 | |||
| 1539 | 2644234003 | |||
| 1540 | 2644510803 | |||
| 1541 | 2738711057 | |||
| 1542 | 2738849482 | |||
| 1543 | 2738865211 | |||
| 1544 | 2739297729 | |||
| 1545 | 2739359407 | |||
| 1546 | 2739790377 | |||
| 1547 | 2753463060 | |||
| 1548 | 2792460183 | |||
| 1549 | 2819535658 | |||
| 1550 | 2819644933 | |||
| 1551 | 2843746752 | |||
| 1552 | 2849562832 | |||
| 1553 | 2849576739 | |||
| 1554 | 2851154033 | |||
| 1555 | 2852655473 | |||
| 1556 | 2852681393 | |||
| 1557 | 2857505423 | |||
| 1558 | 2884962312 | |||
| 1559 | 2898333356 | |||
| 1560 | 2928103669 | |||
| 1561 | 2928533118 | |||
| 1562 | 2928961318 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9431 | 1 | 193 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9381 | 1 | 176 |
| 3nix-assembly2.cif.gz_B | crystal structure of flavoprotein/dehydrogenase from cytophaga hutchinsonii. northeast structural genomics consortium target chr43. | 0.9372 | 271 | 299 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9339 | 1 | 176 |
| 7ahe-assembly1.cif.gz_C | opua inhibited inward facing | 0.9317 | 1 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9834 | 1 | 177 | 3.40.50.300 |
| 2awnC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9614 | 1 | 195 | 3.40.50.300 |
| 1oxuA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9602 | 1 | 196 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9569 | 1 | 195 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.955 | 1 | 178 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447PH14-F1-model_v4 | Putrescine transport ATP-binding protein PotG (EC 3.6.3.31) | 0.9887 | 50 | 183 |
GO:0005524
GO:0016887 |
| AF-A0A5J4F8B2-F1-model_v4 | Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) | 0.9815 | 1 | 200 |
GO:0005524
GO:0015419 GO:0016887 GO:0043190 |
| AF-A0A848WQ45-F1-model_v4 | ABC transporter ATP-binding protein | 0.9795 | 1 | 195 |
GO:0005524
GO:0016887 |
| AF-A0A382Y1F8-F1-model_v4 | ABC transporter domain-containing protein | 0.9795 | 1 | 157 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A534HSD0-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.979 | 1 | 179 |
GO:0005524
GO:0016887 |