F480544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 781 | 424 | 719 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10012424|JGI24739J22299_100124242 |
| Length | 216 |
| Sequence | MTTTTKTSERMDYPGNIFVVAAPSGAGKSSLVKALMELDSAVQPSVSHTTRSPRGQEKHGREYFFASPTEFDAMIAADGFVEWAHVHGHRYGTSKKAVEDRIAQGADVILEIDFQGALQIRKTFANAVMIFILPPSWEELRSRLERRGEDSASVIELRLKNAAEEMAQAGQFDFVIINELFERALFDLKAIVHAQRLRYSAQRRARADTFAALNIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 10 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 11 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 12 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 13 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 14 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 15 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 16 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 17 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 18 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 19 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 20 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 21 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 22 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 23 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 24 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 25 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 26 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 27 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 28 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 29 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 30 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 31 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 32 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 33 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 34 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 35 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 36 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 37 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 38 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 39 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 40 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 41 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 42 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 43 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 44 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 45 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 46 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 47 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 48 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 49 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 50 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 51 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 52 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 53 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 54 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 55 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 56 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 57 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 58 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 59 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 60 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 61 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 62 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 63 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 64 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 65 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 66 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 67 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 68 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 69 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 70 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 71 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 72 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 73 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 74 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 75 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 76 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 77 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 78 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 79 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 80 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 92 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 93 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 100 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 113 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 117 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 121 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 122 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 123 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 126 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 127 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 128 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 129 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 133 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 135 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 136 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 149 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 234 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 235 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 236 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 237 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 238 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 239 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 240 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 241 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 265 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 268 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 269 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 270 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 271 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 272 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 273 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 274 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 277 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 278 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 279 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 280 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 281 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 282 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 283 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 286 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 287 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 288 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 289 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 290 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 291 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 292 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 293 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 294 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 295 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 296 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 297 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 298 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 299 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 305 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 314 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 365 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 377 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 378 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 394 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 397 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 399 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 400 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 401 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 402 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 406 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 407 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 411 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 413 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 417 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 418 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 419 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 421 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 423 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 424 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.93 |
| Metatranscriptomes | 0.13 |
| Isolates | 7.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 32.27 |
| Nodule | 0.64 |
| Rhizoplane | 2.18 |
| Rhizosphere | 53.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1208657 | 2162886007 | Bacteria | 956 |
| 2 | JGI24740J21852_10007463 | 3300001979 | Bacteria | 4442 |
| 3 | JGI24739J22299_10012424 | 3300001989 | Bacteria | 3127 |
| 4 | JGI24739J22299_10052911 | 3300001989 | Bacteria | 1305 |
| 5 | JGI25155J39150_1000085 | 3300002704 | Bacteria | 53417 |
| 6 | JGI25156J39149_1000139 | 3300002705 | Bacteria | 53436 |
| 7 | JGI25154J39366_1000154 | 3300002738 | Bacteria | 53436 |
| 8 | JGI25158J39367_1010274 | 3300002739 | Bacteria | 1267 |
| 9 | JGI25157J39369_1000181 | 3300002741 | Bacteria | 53436 |
| 10 | JGI25152J39213_1004827 | 3300002773 | Bacteria | 4127 |
| 11 | JGI25152J39213_1012417 | 3300002773 | Bacteria | 1828 |
| 12 | JGI25150J39212_1003168 | 3300002774 | Bacteria | 3909 |
| 13 | JGI25150J39212_1003655 | 3300002774 | Bacteria | 3568 |
| 14 | JGI25150J39212_1004700 | 3300002774 | Bacteria | 3002 |
| 15 | JGI25150J39212_1005571 | 3300002774 | Bacteria | 2675 |
| 16 | JGI25159J45721_1000575 | 3300002987 | Bacteria | 16509 |
| 17 | JGI25159J45721_1001104 | 3300002987 | Bacteria | 11520 |
| 18 | JGI25159J45721_1008541 | 3300002987 | Bacteria | 2801 |
| 19 | JGI25159J45721_1010488 | 3300002987 | Bacteria | 2355 |
| 20 | JGI25159J45721_1021272 | 3300002987 | Bacteria | 1228 |
| 21 | JGI25159J45721_1024325 | 3300002987 | Bacteria | 1080 |
| 22 | JGI25151J46595_10001834 | 3300003187 | Bacteria | 13683 |
| 23 | JGI25151J46595_10004515 | 3300003187 | Bacteria | 7347 |
| 24 | JGI25151J46595_10007290 | 3300003187 | Bacteria | 5440 |
| 25 | JGI25151J46595_10008309 | 3300003187 | Bacteria | 5001 |
| 26 | JGI25151J46595_10023051 | 3300003187 | Bacteria | 2572 |
| 27 | JGI25151J46595_10029761 | 3300003187 | Bacteria | 2156 |
| 28 | JGI25153J46596_10008225 | 3300003215 | Bacteria | 5016 |
| 29 | JGI25153J46596_10008252 | 3300003215 | Bacteria | 5001 |
| 30 | rootH1_10044413 | 3300003316 | Bacteria | 1470 |
| 31 | rootH1_10002122 | 3300003323 | Bacteria | 1893 |
| 32 | rootH1_10058594 | 3300003323 | Bacteria | 1949 |
| 33 | JGI25160J50197_1000129 | 3300003354 | Bacteria | 68068 |
| 34 | JGI25160J50197_1005984 | 3300003354 | Bacteria | 4992 |
| 35 | JGI25160J50197_1024715 | 3300003354 | Bacteria | 1698 |
| 36 | JGI25161J50226_1000080 | 3300003374 | Bacteria | 79971 |
| 37 | JGI25161J50226_1002297 | 3300003374 | Bacteria | 4986 |
| 38 | Ga0055535_1000750 | 3300003761 | Bacteria | 24203 |
| 39 | Ga0055542_1000583 | 3300003762 | Bacteria | 31637 |
| 40 | Ga0055526_1015725 | 3300003771 | Bacteria | 3017 |
| 41 | Ga0055526_1015747 | 3300003771 | Bacteria | 3014 |
| 42 | Ga0055537_1000049 | 3300003773 | Bacteria | 87244 |
| 43 | Ga0055537_1001823 | 3300003773 | Bacteria | 7717 |
| 44 | Ga0055537_1003302 | 3300003773 | Bacteria | 5001 |
| 45 | Ga0055537_1003310 | 3300003773 | Bacteria | 4994 |
| 46 | Ga0055524_1000120 | 3300003775 | Bacteria | 91299 |
| 47 | Ga0055524_1013849 | 3300003775 | Bacteria | 3017 |
| 48 | Ga0055524_1013865 | 3300003775 | Bacteria | 3014 |
| 49 | Ga0055536_1002156 | 3300003781 | Bacteria | 11218 |
| 50 | Ga0055536_1002470 | 3300003781 | Bacteria | 10381 |
| 51 | Ga0055536_1005584 | 3300003781 | Bacteria | 6099 |
| 52 | Ga0055536_1009058 | 3300003781 | Bacteria | 4182 |
| 53 | Ga0055536_1029492 | 3300003781 | Bacteria | 1473 |
| 54 | Ga0055534_1000049 | 3300003784 | Bacteria | 92974 |
| 55 | Ga0055534_1000343 | 3300003784 | Bacteria | 30091 |
| 56 | Ga0055534_1001185 | 3300003784 | Bacteria | 10959 |
| 57 | Ga0055534_1002822 | 3300003784 | Bacteria | 5797 |
| 58 | Ga0055534_1003409 | 3300003784 | Bacteria | 5001 |
| 59 | Ga0055528_1000623 | 3300003790 | Bacteria | 26273 |
| 60 | Ga0055528_1007101 | 3300003790 | Bacteria | 5001 |
| 61 | Ga0055528_1007116 | 3300003790 | Bacteria | 4994 |
| 62 | Ga0055530_10001404 | 3300003791 | Bacteria | 17751 |
| 63 | Ga0055530_10011762 | 3300003791 | Bacteria | 3111 |
| 64 | Ga0055530_10017412 | 3300003791 | Bacteria | 2254 |
| 65 | Ga0055540_1000067 | 3300003792 | Bacteria | 122108 |
| 66 | Ga0055540_1000480 | 3300003792 | Bacteria | 30816 |
| 67 | Ga0055540_1003384 | 3300003792 | Bacteria | 7728 |
| 68 | Ga0055540_1004630 | 3300003792 | Bacteria | 6106 |
| 69 | Ga0055540_1019477 | 3300003792 | Bacteria | 1825 |
| 70 | Ga0055540_1033605 | 3300003792 | Bacteria | 1161 |
| 71 | Ga0055531_10000034 | 3300003794 | Bacteria | 150210 |
| 72 | Ga0055531_10000738 | 3300003794 | Bacteria | 27594 |
| 73 | Ga0055531_10011804 | 3300003794 | Bacteria | 4170 |
| 74 | Ga0055531_10017551 | 3300003794 | Bacteria | 3014 |
| 75 | Ga0055531_10018250 | 3300003794 | Bacteria | 2907 |
| 76 | Ga0055543_1000202 | 3300004625 | Bacteria | 48648 |
| 77 | Ga0055543_1005905 | 3300004625 | Bacteria | 3051 |
| 78 | Ga0055543_1006405 | 3300004625 | Bacteria | 2849 |
| 79 | Ga0065165_1015225 | 3300005262 | Bacteria | 2943 |
| 80 | Ga0065165_1027858 | 3300005262 | Bacteria | 1833 |
| 81 | Ga0065714_10020441 | 3300005288 | Bacteria | 2421 |
| 82 | Ga0065714_10096768 | 3300005288 | Bacteria | 1750 |
| 83 | Ga0065704_10074991 | 3300005289 | Bacteria | 5864 |
| 84 | Ga0065704_10091409 | 3300005289 | Bacteria | 2719 |
| 85 | Ga0065704_10225657 | 3300005289 | Bacteria | 1059 |
| 86 | Ga0065704_10230352 | 3300005289 | Bacteria | 1045 |
| 87 | Ga0065707_10190962 | 3300005295 | Bacteria | 1343 |
| 88 | Ga0070658_10067313 | 3300005327 | Bacteria | 2926 |
| 89 | Ga0070658_10085691 | 3300005327 | Bacteria | 2591 |
| 90 | Ga0070658_10459368 | 3300005327 | Bacteria | 1098 |
| 91 | Ga0070676_10567991 | 3300005328 | Bacteria | 814 |
| 92 | Ga0070670_100583674 | 3300005331 | Bacteria | 999 |
| 93 | Ga0070670_100734809 | 3300005331 | Bacteria | 889 |
| 94 | Ga0068869_100477178 | 3300005334 | Bacteria | 1038 |
| 95 | Ga0070661_100982008 | 3300005344 | Bacteria | 700 |
| 96 | Ga0070668_100225581 | 3300005347 | Bacteria | 1547 |
| 97 | Ga0070668_100356478 | 3300005347 | Bacteria | 1239 |
| 98 | Ga0070669_100161067 | 3300005353 | Bacteria | 1744 |
| 99 | Ga0070675_100165430 | 3300005354 | Bacteria | 1905 |
| 100 | Ga0070675_100427450 | 3300005354 | Bacteria | 1185 |
| 101 | Ga0070674_100151075 | 3300005356 | Bacteria | 1753 |
| 102 | Ga0070659_100227861 | 3300005366 | Bacteria | 1539 |
| 103 | Ga0070667_100102296 | 3300005367 | Bacteria | 2475 |
| 104 | Ga0070714_100043003 | 3300005435 | Bacteria | 3818 |
| 105 | Ga0070678_100160771 | 3300005456 | Bacteria | 1819 |
| 106 | Ga0070678_100226004 | 3300005456 | Bacteria | 1558 |
| 107 | Ga0070662_100062742 | 3300005457 | Bacteria | 2716 |
| 108 | Ga0070707_100109908 | 3300005468 | Bacteria | 2673 |
| 109 | Ga0070699_100051375 | 3300005518 | Bacteria | 3568 |
| 110 | Ga0068853_100032565 | 3300005539 | Bacteria | 4416 |
| 111 | Ga0068853_100128401 | 3300005539 | Bacteria | 2267 |
| 112 | Ga0068853_100990228 | 3300005539 | Bacteria | 809 |
| 113 | Ga0068853_101068652 | 3300005539 | Bacteria | 778 |
| 114 | Ga0070672_100256606 | 3300005543 | Bacteria | 1474 |
| 115 | Ga0070672_100629341 | 3300005543 | Bacteria | 936 |
| 116 | Ga0070693_100017394 | 3300005547 | Bacteria | 3737 |
| 117 | Ga0070665_100033550 | 3300005548 | Bacteria | 5165 |
| 118 | Ga0070665_100284408 | 3300005548 | Bacteria | 1656 |
| 119 | Ga0068855_100004546 | 3300005563 | Bacteria | 16941 |
| 120 | Ga0068855_100046799 | 3300005563 | Bacteria | 5113 |
| 121 | Ga0068855_100276631 | 3300005563 | Bacteria | 1865 |
| 122 | Ga0070664_100074593 | 3300005564 | Bacteria | 2912 |
| 123 | Ga0068857_100227861 | 3300005577 | Bacteria | 1704 |
| 124 | Ga0068856_100150449 | 3300005614 | Bacteria | 2337 |
| 125 | Ga0068856_100375887 | 3300005614 | Bacteria | 1440 |
| 126 | Ga0068859_100280526 | 3300005617 | Bacteria | 1759 |
| 127 | Ga0068864_100021424 | 3300005618 | Bacteria | 5416 |
| 128 | Ga0068851_10051418 | 3300005834 | Bacteria | 2094 |
| 129 | Ga0068851_10257854 | 3300005834 | Bacteria | 991 |
| 130 | Ga0068863_100279201 | 3300005841 | Bacteria | 1618 |
| 131 | Ga0068862_100035693 | 3300005844 | Bacteria | 4213 |
| 132 | Ga0068862_100278195 | 3300005844 | Bacteria | 1533 |
| 133 | Ga0075365_10000296 | 3300006038 | Bacteria | 17289 |
| 134 | Ga0075365_10658648 | 3300006038 | Bacteria | 740 |
| 135 | Ga0075368_10048959 | 3300006042 | Bacteria | 1676 |
| 136 | Ga0075368_10279720 | 3300006042 | Bacteria | 717 |
| 137 | Ga0075363_100008947 | 3300006048 | Bacteria | 4688 |
| 138 | Ga0075363_100047464 | 3300006048 | Bacteria | 2281 |
| 139 | Ga0075363_100109222 | 3300006048 | Bacteria | 1536 |
| 140 | Ga0075364_10004115 | 3300006051 | Bacteria | 8349 |
| 141 | Ga0075364_10058479 | 3300006051 | Bacteria | 2526 |
| 142 | Ga0075432_10009149 | 3300006058 | Bacteria | 3376 |
| 143 | Ga0075432_10044150 | 3300006058 | Bacteria | 1562 |
| 144 | Ga0075362_10008974 | 3300006177 | Bacteria | 3845 |
| 145 | Ga0075362_10026548 | 3300006177 | Bacteria | 2475 |
| 146 | Ga0075362_10098857 | 3300006177 | Bacteria | 1362 |
| 147 | Ga0075367_10261552 | 3300006178 | Bacteria | 1086 |
| 148 | Ga0075366_10003520 | 3300006195 | Bacteria | 8275 |
| 149 | Ga0075366_10036281 | 3300006195 | Bacteria | 2906 |
| 150 | Ga0075366_10066167 | 3300006195 | Bacteria | 2150 |
| 151 | Ga0075366_10069482 | 3300006195 | Bacteria | 2096 |
| 152 | Ga0097621_100412527 | 3300006237 | Bacteria | 1211 |
| 153 | Ga0075370_10003918 | 3300006353 | Bacteria | 7144 |
| 154 | Ga0075370_10013503 | 3300006353 | Bacteria | 4344 |
| 155 | Ga0075370_10048867 | 3300006353 | Bacteria | 2397 |
| 156 | Ga0075370_10135359 | 3300006353 | Bacteria | 1439 |
| 157 | Ga0075370_10144711 | 3300006353 | Bacteria | 1391 |
| 158 | Ga0075370_10237822 | 3300006353 | Bacteria | 1078 |
| 159 | Ga0075430_100092876 | 3300006846 | Bacteria | 2522 |
| 160 | Ga0097620_100280525 | 3300006931 | Bacteria | 1759 |
| 161 | Ga0079104_1000003 | 3300006946 | Bacteria | 468966 |
| 162 | Ga0105244_10016816 | 3300009036 | Bacteria | 4155 |
| 163 | Ga0105244_10144859 | 3300009036 | Bacteria | 1141 |
| 164 | Ga0105250_10001739 | 3300009092 | Bacteria | 11486 |
| 165 | Ga0105240_10214478 | 3300009093 | Bacteria | 2247 |
| 166 | Ga0105240_10626936 | 3300009093 | Bacteria | 1181 |
| 167 | Ga0111539_11500683 | 3300009094 | Bacteria | 782 |
| 168 | Ga0105245_10145029 | 3300009098 | Bacteria | 2239 |
| 169 | Ga0105243_10001244 | 3300009148 | Bacteria | 22879 |
| 170 | Ga0105243_10003162 | 3300009148 | Bacteria | 13505 |
| 171 | Ga0105243_10062687 | 3300009148 | Bacteria | 2977 |
| 172 | Ga0105243_10176906 | 3300009148 | Bacteria | 1853 |
| 173 | Ga0105243_10858164 | 3300009148 | Bacteria | 900 |
| 174 | Ga0105237_10136801 | 3300009545 | Bacteria | 2444 |
| 175 | Ga0105237_10485238 | 3300009545 | Bacteria | 1242 |
| 176 | Ga0105238_10049880 | 3300009551 | Bacteria | 4214 |
| 177 | Ga0105238_10063487 | 3300009551 | Bacteria | 3694 |
| 178 | Ga0105238_10809781 | 3300009551 | Bacteria | 952 |
| 179 | Ga0105239_10665406 | 3300010375 | Bacteria | 1190 |
| 180 | Ga0105246_10588438 | 3300011119 | Bacteria | 960 |
| 181 | Ga0157347_1002693 | 3300012502 | Bacteria | 1544 |
| 182 | Ga0157326_1002659 | 3300012513 | Bacteria | 1901 |
| 183 | Ga0157373_10025215 | 3300013100 | Bacteria | 4303 |
| 184 | Ga0157371_10038429 | 3300013102 | Bacteria | 3424 |
| 185 | Ga0157370_10007822 | 3300013104 | Bacteria | 11582 |
| 186 | Ga0157370_10441882 | 3300013104 | Bacteria | 1196 |
| 187 | Ga0157369_10037367 | 3300013105 | Bacteria | 5316 |
| 188 | Ga0157374_10581710 | 3300013296 | Bacteria | 1129 |
| 189 | Ga0157374_10730989 | 3300013296 | Bacteria | 1004 |
| 190 | Ga0157378_10599256 | 3300013297 | Bacteria | 1113 |
| 191 | Ga0163162_10258502 | 3300013306 | Bacteria | 1873 |
| 192 | Ga0157372_10063638 | 3300013307 | Bacteria | 4137 |
| 193 | Ga0157380_10184459 | 3300014326 | Bacteria | 1836 |
| 194 | Ga0182008_10000225 | 3300014497 | Bacteria | 44301 |
| 195 | Ga0182008_10012137 | 3300014497 | Bacteria | 4556 |
| 196 | Ga0182008_10028802 | 3300014497 | Bacteria | 2809 |
| 197 | Ga0182008_10056970 | 3300014497 | Bacteria | 1930 |
| 198 | Ga0182008_10236266 | 3300014497 | Bacteria | 939 |
| 199 | Ga0182006_1004254 | 3300015261 | Bacteria | 7090 |
| 200 | Ga0182007_10002590 | 3300015262 | Bacteria | 8902 |
| 201 | Ga0182007_10005032 | 3300015262 | Bacteria | 5870 |
| 202 | Ga0182005_1013873 | 3300015265 | Bacteria | 2263 |
| 203 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 204 | Ga0163161_10000114 | 3300017792 | Bacteria | 76397 |
| 205 | Ga0163161_10094488 | 3300017792 | Bacteria | 2217 |
| 206 | Ga0163161_10251736 | 3300017792 | Bacteria | 1377 |
| 207 | Ga0163161_10382323 | 3300017792 | Bacteria | 1125 |
| 208 | Ga0213872_10007360 | 3300021361 | Bacteria | 5429 |
| 209 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 210 | Ga0209436_101911 | 3300025208 | Bacteria | 6711 |
| 211 | Ga0209436_106926 | 3300025208 | Bacteria | 2423 |
| 212 | Ga0209436_120781 | 3300025208 | Bacteria | 879 |
| 213 | Ga0209672_100477 | 3300025228 | Bacteria | 22499 |
| 214 | Ga0209147_101499 | 3300025229 | Bacteria | 8245 |
| 215 | Ga0209258_100568 | 3300025242 | Bacteria | 31666 |
| 216 | Ga0207425_1000069 | 3300025245 | Bacteria | 120895 |
| 217 | Ga0207425_1001640 | 3300025245 | Bacteria | 9021 |
| 218 | Ga0207425_1013877 | 3300025245 | Bacteria | 1845 |
| 219 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 220 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 221 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 222 | Ga0209759_1000019 | 3300025256 | Bacteria | 357908 |
| 223 | Ga0209129_1000233 | 3300025258 | Bacteria | 61174 |
| 224 | Ga0209129_1001859 | 3300025258 | Bacteria | 11166 |
| 225 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 226 | Ga0209565_1000116 | 3300025263 | Bacteria | 114340 |
| 227 | Ga0209565_1000171 | 3300025263 | Bacteria | 84566 |
| 228 | Ga0209565_1000883 | 3300025263 | Bacteria | 16458 |
| 229 | Ga0209565_1003079 | 3300025263 | Bacteria | 5601 |
| 230 | Ga0209673_1000295 | 3300025273 | Bacteria | 92499 |
| 231 | Ga0209673_1000301 | 3300025273 | Bacteria | 91435 |
| 232 | Ga0209673_1000305 | 3300025273 | Bacteria | 91144 |
| 233 | Ga0209673_1006536 | 3300025273 | Bacteria | 5601 |
| 234 | Ga0209673_1007324 | 3300025273 | Bacteria | 5116 |
| 235 | Ga0209673_1055071 | 3300025273 | Bacteria | 1027 |
| 236 | Ga0209130_1000095 | 3300025284 | Bacteria | 145126 |
| 237 | Ga0209130_1000134 | 3300025284 | Bacteria | 119102 |
| 238 | Ga0209130_1000193 | 3300025284 | Bacteria | 84550 |
| 239 | Ga0209130_1000366 | 3300025284 | Bacteria | 51201 |
| 240 | Ga0209130_1001843 | 3300025284 | Bacteria | 12207 |
| 241 | Ga0209130_1011467 | 3300025284 | Bacteria | 2371 |
| 242 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 243 | Ga0209675_1000249 | 3300025291 | Bacteria | 53443 |
| 244 | Ga0209675_1000582 | 3300025291 | Bacteria | 26359 |
| 245 | Ga0209675_1000599 | 3300025291 | Bacteria | 25864 |
| 246 | Ga0209675_1002239 | 3300025291 | Bacteria | 10107 |
| 247 | Ga0209675_1006897 | 3300025291 | Bacteria | 4465 |
| 248 | Ga0209675_1011341 | 3300025291 | Bacteria | 2963 |
| 249 | Ga0209675_1064714 | 3300025291 | Bacteria | 712 |
| 250 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 251 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 252 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 253 | Ga0209676_1000145 | 3300025292 | Bacteria | 174391 |
| 254 | Ga0209676_1002365 | 3300025292 | Bacteria | 13576 |
| 255 | Ga0209676_1015599 | 3300025292 | Bacteria | 2789 |
| 256 | Ga0209676_1028023 | 3300025292 | Bacteria | 1762 |
| 257 | Ga0209676_1039314 | 3300025292 | Bacteria | 1345 |
| 258 | Ga0209025_1000204 | 3300025294 | Bacteria | 142193 |
| 259 | Ga0209025_1000264 | 3300025294 | Bacteria | 123411 |
| 260 | Ga0209025_1000348 | 3300025294 | Bacteria | 100228 |
| 261 | Ga0209025_1002608 | 3300025294 | Bacteria | 18582 |
| 262 | Ga0209025_1002728 | 3300025294 | Bacteria | 17919 |
| 263 | Ga0209025_1005823 | 3300025294 | Bacteria | 9873 |
| 264 | Ga0209025_1009284 | 3300025294 | Bacteria | 6886 |
| 265 | Ga0209025_1021401 | 3300025294 | Bacteria | 3485 |
| 266 | Ga0209025_1037201 | 3300025294 | Bacteria | 2163 |
| 267 | Ga0209564_1000231 | 3300025295 | Bacteria | 123417 |
| 268 | Ga0209564_1000728 | 3300025295 | Bacteria | 46991 |
| 269 | Ga0209564_1001669 | 3300025295 | Bacteria | 21246 |
| 270 | Ga0209564_1012287 | 3300025295 | Bacteria | 3746 |
| 271 | Ga0209564_1037145 | 3300025295 | Bacteria | 1378 |
| 272 | Ga0209758_1000222 | 3300025297 | Bacteria | 123411 |
| 273 | Ga0209758_1014048 | 3300025297 | Bacteria | 4303 |
| 274 | Ga0209758_1063264 | 3300025297 | Bacteria | 1206 |
| 275 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 276 | Ga0209050_1000023 | 3300025298 | Bacteria | 537172 |
| 277 | Ga0209050_1001339 | 3300025298 | Bacteria | 27306 |
| 278 | Ga0209050_1001596 | 3300025298 | Bacteria | 23431 |
| 279 | Ga0209050_1002459 | 3300025298 | Bacteria | 15802 |
| 280 | Ga0209050_1003820 | 3300025298 | Bacteria | 10747 |
| 281 | Ga0209050_1025288 | 3300025298 | Bacteria | 2023 |
| 282 | Ga0209050_1029263 | 3300025298 | Bacteria | 1766 |
| 283 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 284 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 285 | Ga0209256_1000284 | 3300025299 | Bacteria | 89178 |
| 286 | Ga0209256_1031770 | 3300025299 | Bacteria | 1439 |
| 287 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 288 | Ga0207426_1000349 | 3300025302 | Bacteria | 84546 |
| 289 | Ga0207426_1000397 | 3300025302 | Bacteria | 73966 |
| 290 | Ga0207426_1000618 | 3300025302 | Bacteria | 45326 |
| 291 | Ga0207426_1055373 | 3300025302 | Bacteria | 1162 |
| 292 | Ga0209051_1000017 | 3300025303 | Bacteria | 537172 |
| 293 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 294 | Ga0209051_1000091 | 3300025303 | Bacteria | 173683 |
| 295 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 296 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 297 | Ga0209051_1000342 | 3300025303 | Bacteria | 70022 |
| 298 | Ga0209051_1018603 | 3300025303 | Bacteria | 3067 |
| 299 | Ga0209051_1020469 | 3300025303 | Bacteria | 2848 |
| 300 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 301 | Ga0209257_1000041 | 3300025304 | Bacteria | 537172 |
| 302 | Ga0209257_1000276 | 3300025304 | Bacteria | 116802 |
| 303 | Ga0209257_1000497 | 3300025304 | Bacteria | 70185 |
| 304 | Ga0209257_1000546 | 3300025304 | Bacteria | 64679 |
| 305 | Ga0209257_1006622 | 3300025304 | Bacteria | 7372 |
| 306 | Ga0207696_1009335 | 3300025711 | Bacteria | 3663 |
| 307 | Ga0207655_1004280 | 3300025728 | Bacteria | 10209 |
| 308 | Ga0207705_10065445 | 3300025909 | Bacteria | 2628 |
| 309 | Ga0207705_10079722 | 3300025909 | Bacteria | 2385 |
| 310 | Ga0207671_10162740 | 3300025914 | Bacteria | 1729 |
| 311 | Ga0207660_10123091 | 3300025917 | Bacteria | 1966 |
| 312 | Ga0207657_10009594 | 3300025919 | Bacteria | 9714 |
| 313 | Ga0207681_10103927 | 3300025923 | Bacteria | 2054 |
| 314 | Ga0207694_10219477 | 3300025924 | Bacteria | 1550 |
| 315 | Ga0207650_10032708 | 3300025925 | Bacteria | 3763 |
| 316 | Ga0207650_10625124 | 3300025925 | Bacteria | 907 |
| 317 | Ga0207659_10327313 | 3300025926 | Bacteria | 1266 |
| 318 | Ga0207687_10154572 | 3300025927 | Bacteria | 1754 |
| 319 | Ga0207687_10245676 | 3300025927 | Bacteria | 1420 |
| 320 | Ga0207706_10347491 | 3300025933 | Bacteria | 1290 |
| 321 | Ga0207686_10149209 | 3300025934 | Bacteria | 1626 |
| 322 | Ga0207709_10000244 | 3300025935 | Bacteria | 66920 |
| 323 | Ga0207709_10000331 | 3300025935 | Bacteria | 50983 |
| 324 | Ga0207709_10000464 | 3300025935 | Bacteria | 37316 |
| 325 | Ga0207709_10059077 | 3300025935 | Bacteria | 2386 |
| 326 | Ga0207709_10415126 | 3300025935 | Bacteria | 1032 |
| 327 | Ga0207679_10012391 | 3300025945 | Bacteria | 5560 |
| 328 | Ga0207667_10081950 | 3300025949 | Bacteria | 3342 |
| 329 | Ga0207667_10838994 | 3300025949 | Bacteria | 914 |
| 330 | Ga0207667_10957653 | 3300025949 | Bacteria | 845 |
| 331 | Ga0207651_10141191 | 3300025960 | Bacteria | 1861 |
| 332 | Ga0207651_10390888 | 3300025960 | Bacteria | 1181 |
| 333 | Ga0207668_10212017 | 3300025972 | Bacteria | 1550 |
| 334 | Ga0207658_10092183 | 3300025986 | Bacteria | 2353 |
| 335 | Ga0207677_10020670 | 3300026023 | Bacteria | 4002 |
| 336 | Ga0207639_10043606 | 3300026041 | Bacteria | 3369 |
| 337 | Ga0207639_10206175 | 3300026041 | Bacteria | 1689 |
| 338 | Ga0207639_10861708 | 3300026041 | Bacteria | 846 |
| 339 | Ga0207708_10181400 | 3300026075 | Bacteria | 1672 |
| 340 | Ga0207702_10260046 | 3300026078 | Bacteria | 1634 |
| 341 | Ga0207702_11240859 | 3300026078 | Bacteria | 740 |
| 342 | Ga0207641_10260934 | 3300026088 | Bacteria | 1622 |
| 343 | Ga0207648_10062014 | 3300026089 | Bacteria | 3260 |
| 344 | Ga0207676_10019562 | 3300026095 | Bacteria | 4942 |
| 345 | Ga0207674_10272954 | 3300026116 | Bacteria | 1638 |
| 346 | Ga0207674_10323136 | 3300026116 | Bacteria | 1492 |
| 347 | Ga0207675_100427103 | 3300026118 | Bacteria | 1309 |
| 348 | Ga0207683_10014305 | 3300026121 | Bacteria | 6760 |
| 349 | Ga0207683_10096305 | 3300026121 | Bacteria | 2639 |
| 350 | Ga0207698_10579988 | 3300026142 | Bacteria | 1103 |
| 351 | Ga0207698_10583558 | 3300026142 | Bacteria | 1100 |
| 352 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 353 | Ga0209973_1000067 | 3300027252 | Bacteria | 5559 |
| 354 | Ga0209969_1015987 | 3300027360 | Bacteria | 1098 |
| 355 | Ga0209982_1023872 | 3300027552 | Bacteria | 947 |
| 356 | Ga0209970_1003961 | 3300027614 | Bacteria | 2472 |
| 357 | Ga0209970_1023275 | 3300027614 | Bacteria | 1054 |
| 358 | Ga0209282_1018266 | 3300027666 | Bacteria | 4451 |
| 359 | Ga0209971_1003849 | 3300027682 | Bacteria | 3551 |
| 360 | Ga0209974_10002399 | 3300027876 | Bacteria | 6794 |
| 361 | Ga0209974_10008078 | 3300027876 | Bacteria | 3606 |
| 362 | Ga0209974_10039642 | 3300027876 | Bacteria | 1567 |
| 363 | Ga0207428_10046728 | 3300027907 | Bacteria | 3480 |
| 364 | Ga0268266_10040433 | 3300028379 | Bacteria | 3974 |
| 365 | Ga0268266_10315543 | 3300028379 | Bacteria | 1462 |
| 366 | Ga0268266_10357843 | 3300028379 | Bacteria | 1373 |
| 367 | Ga0268265_10030005 | 3300028380 | Bacteria | 3912 |
| 368 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 369 | Ga0307515_10000213 | 3300028794 | Bacteria | 142742 |
| 370 | Ga0307515_10155384 | 3300028794 | Bacteria | 2364 |
| 371 | Ga0307515_10169485 | 3300028794 | Bacteria | 2184 |
| 372 | Ga0265338_10359040 | 3300028800 | Bacteria | 1046 |
| 373 | Ga0316177_1024879 | 3300030731 | Bacteria | 969 |
| 374 | Ga0314311_1113039 | 3300030733 | Bacteria | 2616 |
| 375 | Ga0316179_1109004 | 3300030734 | Bacteria | 6166 |
| 376 | Ga0316178_1145172 | 3300030735 | Bacteria | 2940 |
| 377 | Ga0316180_1167845 | 3300030736 | Bacteria | 3040 |
| 378 | Ga0316183_1086557 | 3300030742 | Bacteria | 14600 |
| 379 | Ga0316181_1115636 | 3300030744 | Bacteria | 1540 |
| 380 | Ga0316182_1187259 | 3300030745 | Bacteria | 2621 |
| 381 | Ga0265330_10000022 | 3300031235 | Bacteria | 154198 |
| 382 | Ga0265330_10008061 | 3300031235 | Bacteria | 5095 |
| 383 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 384 | Ga0265332_10000005 | 3300031238 | Bacteria | 377525 |
| 385 | Ga0265332_10235486 | 3300031238 | Bacteria | 759 |
| 386 | Ga0265327_10000746 | 3300031251 | Bacteria | 50605 |
| 387 | Ga0265316_10146729 | 3300031344 | Bacteria | 1769 |
| 388 | Ga0307513_10000113 | 3300031456 | Bacteria | 114576 |
| 389 | Ga0307513_10005571 | 3300031456 | Bacteria | 16606 |
| 390 | Ga0307513_10092847 | 3300031456 | Bacteria | 3070 |
| 391 | Ga0307513_10299091 | 3300031456 | Bacteria | 1377 |
| 392 | Ga0307513_10375889 | 3300031456 | Bacteria | 1162 |
| 393 | Ga0307408_100000101 | 3300031548 | Bacteria | 94089 |
| 394 | Ga0307408_100268127 | 3300031548 | Bacteria | 1416 |
| 395 | Ga0307408_100467496 | 3300031548 | Bacteria | 1097 |
| 396 | Ga0307408_100578773 | 3300031548 | Bacteria | 994 |
| 397 | Ga0307408_100587786 | 3300031548 | Bacteria | 987 |
| 398 | Ga0307514_10008104 | 3300031649 | Bacteria | 8984 |
| 399 | Ga0265314_10000013 | 3300031711 | Bacteria | 403405 |
| 400 | Ga0265314_10006062 | 3300031711 | Bacteria | 10751 |
| 401 | Ga0265314_10013920 | 3300031711 | Bacteria | 6471 |
| 402 | Ga0307516_10006023 | 3300031730 | Bacteria | 14334 |
| 403 | Ga0307405_10005856 | 3300031731 | Bacteria | 5985 |
| 404 | Ga0307405_10123707 | 3300031731 | Bacteria | 1775 |
| 405 | Ga0307405_10314599 | 3300031731 | Bacteria | 1193 |
| 406 | Ga0307405_10360699 | 3300031731 | Bacteria | 1124 |
| 407 | Ga0307413_10186773 | 3300031824 | Bacteria | 1484 |
| 408 | Ga0307406_10000497 | 3300031901 | Bacteria | 22565 |
| 409 | Ga0307406_10048612 | 3300031901 | Bacteria | 2680 |
| 410 | Ga0307406_10075767 | 3300031901 | Bacteria | 2220 |
| 411 | Ga0307406_10167341 | 3300031901 | Bacteria | 1587 |
| 412 | Ga0307406_10330303 | 3300031901 | Bacteria | 1183 |
| 413 | Ga0307412_10083258 | 3300031911 | Bacteria | 2217 |
| 414 | Ga0307412_10256774 | 3300031911 | Bacteria | 1360 |
| 415 | Ga0307412_10739866 | 3300031911 | Bacteria | 848 |
| 416 | Ga0307412_10744320 | 3300031911 | Bacteria | 845 |
| 417 | Ga0307416_100050999 | 3300032002 | Bacteria | 3302 |
| 418 | Ga0307416_100078224 | 3300032002 | Bacteria | 2782 |
| 419 | Ga0307416_100310432 | 3300032002 | Bacteria | 1573 |
| 420 | Ga0307416_100334652 | 3300032002 | Bacteria | 1523 |
| 421 | Ga0307416_100753437 | 3300032002 | Bacteria | 1067 |
| 422 | Ga0307416_100901522 | 3300032002 | Bacteria | 984 |
| 423 | Ga0307414_10005833 | 3300032004 | Bacteria | 6810 |
| 424 | Ga0307411_10178326 | 3300032005 | Bacteria | 1610 |
| 425 | Ga0307411_10679177 | 3300032005 | Bacteria | 895 |
| 426 | Ga0373946_0124176 | 3300035171 | Bacteria | 1181 |
| 427 | Ga0373955_0314262 | 3300035172 | Bacteria | 946 |
| 428 | Ga0373931_0027422 | 3300035691 | Bacteria | 2908 |
| 429 | Ga0373931_0136460 | 3300035691 | Bacteria | 1417 |
| 430 | Ga0395899_0001018 | 3300037312 | Bacteria | 25619 |
| 431 | Ga0395899_0058267 | 3300037312 | Bacteria | 2849 |
| 432 | Ga0395900_0006133 | 3300037418 | Bacteria | 12539 |
| 433 | Ga0395900_0030913 | 3300037418 | Bacteria | 5499 |
| 434 | Ga0395900_0049698 | 3300037418 | Bacteria | 4320 |
| 435 | Ga0395900_0156907 | 3300037418 | Bacteria | 2324 |
| 436 | Ga0395900_0177793 | 3300037418 | Bacteria | 2164 |
| 437 | Ga0395900_0668570 | 3300037418 | Bacteria | 974 |
| 438 | Ga0395900_1023606 | 3300037418 | Bacteria | 745 |
| 439 | Ga0395898_0006763 | 3300037466 | Bacteria | 12209 |
| 440 | Ga0395898_0123537 | 3300037466 | Bacteria | 2480 |
| 441 | Ga0395905_0002817 | 3300037471 | Bacteria | 19057 |
| 442 | Ga0395905_0004508 | 3300037471 | Bacteria | 14433 |
| 443 | Ga0395905_0008661 | 3300037471 | Bacteria | 10021 |
| 444 | Ga0395905_0009367 | 3300037471 | Bacteria | 9576 |
| 445 | Ga0395905_0029999 | 3300037471 | Bacteria | 5125 |
| 446 | Ga0395905_0038724 | 3300037471 | Bacteria | 4472 |
| 447 | Ga0395905_0059562 | 3300037471 | Bacteria | 3569 |
| 448 | Ga0395905_0160158 | 3300037471 | Bacteria | 2115 |
| 449 | Ga0395905_0172646 | 3300037471 | Bacteria | 2030 |
| 450 | Ga0395905_0325203 | 3300037471 | Bacteria | 1428 |
| 451 | Ga0395905_0393831 | 3300037471 | Bacteria | 1280 |
| 452 | Ga0395905_0635677 | 3300037471 | Bacteria | 969 |
| 453 | Ga0395905_0644099 | 3300037471 | Bacteria | 961 |
| 454 | Ga0395901_0074018 | 3300038443 | Bacteria | 3553 |
| 455 | Ga0395901_0121176 | 3300038443 | Bacteria | 2749 |
| 456 | Ga0395901_0504515 | 3300038443 | Bacteria | 1231 |
| 457 | Ga0400489_59002 | 3300039093 | Bacteria | 1199 |
| 458 | Ga0436365_0775088 | 3300039437 | Bacteria | 937 |
| 459 | Ga0436361_0021397 | 3300039447 | Bacteria | 46447 |
| 460 | Ga0439436_0001099 | 3300041404 | Bacteria | 7629 |
| 461 | Ga0439439_0058647 | 3300041406 | Bacteria | 1019 |
| 462 | Ga0439447_016871 | 3300041407 | Bacteria | 1997 |
| 463 | Ga0439461_0009606 | 3300041410 | Bacteria | 1757 |
| 464 | Ga0439466_0003182 | 3300041411 | Bacteria | 6388 |
| 465 | Ga0439466_0053882 | 3300041411 | Bacteria | 1311 |
| 466 | Ga0439465_0026578 | 3300041413 | Bacteria | 1831 |
| 467 | Ga0451789_0807840 | 3300041443 | Bacteria | 789 |
| 468 | Ga0451798_0612806 | 3300041458 | Bacteria | 1248 |
| 469 | Ga0451837_0249136 | 3300041494 | Bacteria | 761 |
| 470 | Ga0439431_0000218 | 3300041997 | Bacteria | 11553 |
| 471 | Ga0439433_0002090 | 3300041999 | Bacteria | 4205 |
| 472 | Ga0439433_0009872 | 3300041999 | Bacteria | 2084 |
| 473 | Ga0439442_002873 | 3300042002 | Bacteria | 3394 |
| 474 | Ga0439445_0003096 | 3300042004 | Bacteria | 3728 |
| 475 | Ga0439445_0021426 | 3300042004 | Bacteria | 1623 |
| 476 | Ga0439432_004550 | 3300042006 | Bacteria | 5059 |
| 477 | Ga0439449_0000120 | 3300042007 | Bacteria | 25953 |
| 478 | Ga0439449_0001556 | 3300042007 | Bacteria | 8984 |
| 479 | Ga0439449_0003368 | 3300042007 | Bacteria | 6226 |
| 480 | Ga0439449_0045082 | 3300042007 | Bacteria | 1635 |
| 481 | Ga0439452_001002 | 3300042010 | Bacteria | 12538 |
| 482 | Ga0439452_008558 | 3300042010 | Bacteria | 3070 |
| 483 | Ga0439457_005319 | 3300042014 | Bacteria | 3254 |
| 484 | Ga0439462_0001389 | 3300042015 | Bacteria | 5361 |
| 485 | Ga0439462_0006207 | 3300042015 | Bacteria | 2964 |
| 486 | Ga0439462_0010823 | 3300042015 | Bacteria | 2315 |
| 487 | Ga0439463_062467 | 3300042016 | Bacteria | 952 |
| 488 | Ga0450911_001767 | 3300042115 | Bacteria | 4646 |
| 489 | Ga0450921_011460 | 3300042123 | Bacteria | 757 |
| 490 | Ga0450923_000492 | 3300042125 | Bacteria | 4346 |
| 491 | Ga0450923_007168 | 3300042125 | Bacteria | 1875 |
| 492 | Ga0450923_042023 | 3300042125 | Bacteria | 963 |
| 493 | Ga0450890_004537 | 3300042127 | Bacteria | 1812 |
| 494 | Ga0450897_000328 | 3300042128 | Bacteria | 2534 |
| 495 | Ga0450897_014079 | 3300042128 | Bacteria | 805 |
| 496 | Ga0450898_004589 | 3300042134 | Bacteria | 2049 |
| 497 | Ga0450903_010922 | 3300042138 | Bacteria | 1467 |
| 498 | Ga0450906_006638 | 3300042145 | Bacteria | 2321 |
| 499 | Ga0450910_007034 | 3300042147 | Bacteria | 1562 |
| 500 | Ga0439446_0017255 | 3300042156 | Bacteria | 2016 |
| 501 | Ga0439446_0026497 | 3300042156 | Bacteria | 1661 |
| 502 | Ga0439446_0073973 | 3300042156 | Bacteria | 1046 |
| 503 | Ga0450908_016735 | 3300042184 | Bacteria | 1306 |
| 504 | Ga0450908_018645 | 3300042184 | Bacteria | 1225 |
| 505 | Ga0439434_0014899 | 3300042435 | Bacteria | 2314 |
| 506 | Ga0439434_0061187 | 3300042435 | Bacteria | 1177 |
| 507 | Ga0439459_0006375 | 3300042438 | Bacteria | 1964 |
| 508 | Ga0439464_0009630 | 3300042439 | Bacteria | 2545 |
| 509 | Ga0450893_0044338 | 3300042532 | Bacteria | 821 |
| 510 | Ga0450893_0046800 | 3300042532 | Bacteria | 803 |
| 511 | Ga0451577_0001869 | 3300042876 | Bacteria | 26831 |
| 512 | Ga0451577_0010826 | 3300042876 | Bacteria | 8669 |
| 513 | Ga0451577_0021172 | 3300042876 | Bacteria | 5954 |
| 514 | Ga0451577_0028125 | 3300042876 | Bacteria | 5087 |
| 515 | Ga0451577_0103510 | 3300042876 | Bacteria | 2544 |
| 516 | Ga0451577_0451523 | 3300042876 | Bacteria | 1167 |
| 517 | Ga0451577_0472121 | 3300042876 | Bacteria | 1139 |
| 518 | Ga0466969_0007544 | 3300044656 | Bacteria | 5782 |
| 519 | Ga0453683_0003686 | 3300044673 | Bacteria | 11226 |
| 520 | Ga0453683_0034464 | 3300044673 | Bacteria | 3191 |
| 521 | Ga0466965_0024297 | 3300044683 | Bacteria | 2931 |
| 522 | Ga0466965_0073083 | 3300044683 | Bacteria | 1726 |
| 523 | Ga0466966_0012868 | 3300044684 | Bacteria | 5541 |
| 524 | Ga0466961_0006061 | 3300044693 | Bacteria | 7664 |
| 525 | Ga0453684_0411237 | 3300044712 | Bacteria | 1513 |
| 526 | Ga0453684_0598960 | 3300044712 | Bacteria | 1208 |
| 527 | Ga0466970_0031303 | 3300044765 | Bacteria | 2810 |
| 528 | Ga0466957_0231453 | 3300044842 | Bacteria | 1223 |
| 529 | Ga0466960_0203963 | 3300044901 | Bacteria | 1081 |
| 530 | Ga0466960_0256796 | 3300044901 | Bacteria | 972 |
| 531 | Ga0466959_0158765 | 3300045049 | Bacteria | 1590 |
| 532 | Ga0451576_0004840 | 3300045051 | Bacteria | 17241 |
| 533 | Ga0451576_0024858 | 3300045051 | Bacteria | 6462 |
| 534 | Ga0451576_0056103 | 3300045051 | Bacteria | 4121 |
| 535 | Ga0451576_0058688 | 3300045051 | Bacteria | 4020 |
| 536 | Ga0451576_0629380 | 3300045051 | Bacteria | 1127 |
| 537 | Ga0451576_0985937 | 3300045051 | Bacteria | 883 |
| 538 | Ga0466958_0203965 | 3300045836 | Bacteria | 1259 |
| 539 | Ga0466967_0529224 | 3300045976 | Bacteria | 1159 |
| 540 | Ga0495627_015780 | 3300046453 | Bacteria | 2602 |
| 541 | Ga0495627_022000 | 3300046453 | Bacteria | 2103 |
| 542 | Ga0495629_0275228 | 3300046459 | Bacteria | 1156 |
| 543 | Ga0495650_0047253 | 3300046471 | Bacteria | 1801 |
| 544 | Ga0495639_0041351 | 3300046475 | Bacteria | 2076 |
| 545 | Ga0495610_0017743 | 3300046512 | Bacteria | 4048 |
| 546 | Ga0495616_0003735 | 3300046513 | Bacteria | 9714 |
| 547 | Ga0495620_0240230 | 3300046515 | Bacteria | 691 |
| 548 | Ga0495630_0334861 | 3300046517 | Bacteria | 1158 |
| 549 | Ga0495631_0000163 | 3300046518 | Bacteria | 45348 |
| 550 | Ga0495637_0010636 | 3300046520 | Bacteria | 4444 |
| 551 | Ga0495643_0062287 | 3300046522 | Bacteria | 1975 |
| 552 | Ga0495663_0008194 | 3300046525 | Bacteria | 2892 |
| 553 | Ga0495663_0098668 | 3300046525 | Bacteria | 959 |
| 554 | Ga0495642_0022614 | 3300046528 | Bacteria | 2478 |
| 555 | Ga0495642_0042286 | 3300046528 | Bacteria | 1856 |
| 556 | Ga0495654_0022444 | 3300046530 | Bacteria | 3277 |
| 557 | Ga0495654_0042235 | 3300046530 | Bacteria | 2264 |
| 558 | Ga0495654_0143264 | 3300046530 | Bacteria | 1063 |
| 559 | Ga0495621_0000477 | 3300046539 | Bacteria | 9876 |
| 560 | Ga0495621_0061262 | 3300046539 | Bacteria | 1366 |
| 561 | Ga0495597_0000024 | 3300046542 | Bacteria | 143948 |
| 562 | Ga0495633_0000305 | 3300046558 | Bacteria | 55923 |
| 563 | Ga0495633_0056740 | 3300046558 | Bacteria | 1840 |
| 564 | Ga0495656_0000163 | 3300046615 | Bacteria | 24459 |
| 565 | Ga0495656_0032151 | 3300046615 | Bacteria | 2133 |
| 566 | Ga0495656_0046422 | 3300046615 | Bacteria | 1838 |
| 567 | Ga0495668_0159362 | 3300046616 | Bacteria | 1236 |
| 568 | Ga0495625_0000045 | 3300046660 | Bacteria | 202475 |
| 569 | Ga0495625_0022634 | 3300046660 | Bacteria | 4815 |
| 570 | Ga0495625_0096944 | 3300046660 | Bacteria | 2030 |
| 571 | Ga0495635_0180403 | 3300046663 | Bacteria | 1435 |
| 572 | Ga0495588_0063114 | 3300046674 | Bacteria | 1920 |
| 573 | Ga0495588_0136848 | 3300046674 | Bacteria | 1293 |
| 574 | Ga0495588_0176096 | 3300046674 | Bacteria | 1130 |
| 575 | Ga0495658_0043478 | 3300046683 | Bacteria | 2513 |
| 576 | Ga0495658_0116710 | 3300046683 | Bacteria | 1610 |
| 577 | Ga0495658_0258992 | 3300046683 | Bacteria | 1095 |
| 578 | Ga0495669_0014099 | 3300046684 | Bacteria | 3416 |
| 579 | Ga0495624_0086432 | 3300046690 | Bacteria | 1937 |
| 580 | Ga0495671_0030456 | 3300046692 | Bacteria | 2763 |
| 581 | Ga0495685_013506 | 3300047447 | Bacteria | 2772 |
| 582 | Ga0495681_0059758 | 3300047470 | Bacteria | 1761 |
| 583 | Ga0495681_0140824 | 3300047470 | Bacteria | 1019 |
| 584 | Ga0495593_0002104 | 3300047673 | Bacteria | 11902 |
| 585 | Ga0495593_0149658 | 3300047673 | Bacteria | 1181 |
| 586 | Ga0495614_0020186 | 3300048089 | Bacteria | 2882 |
| 587 | Ga0496101_0002871 | 3300048904 | Bacteria | 10597 |
| 588 | Ga0496101_0119954 | 3300048904 | Bacteria | 1987 |
| 589 | Ga0496102_0003824 | 3300048905 | Bacteria | 12732 |
| 590 | Ga0496103_0162596 | 3300048906 | Bacteria | 1432 |
| 591 | Ga0496104_0018497 | 3300048907 | Bacteria | 6357 |
| 592 | Ga0496105_0002730 | 3300048908 | Bacteria | 12871 |
| 593 | Ga0496106_0012008 | 3300048909 | Bacteria | 6391 |
| 594 | Ga0496106_1275203 | 3300048909 | Bacteria | 571 |
| 595 | Ga0496109_0140704 | 3300048912 | Bacteria | 2256 |
| 596 | Ga0496110_0083819 | 3300048913 | Bacteria | 2844 |
| 597 | Ga0496111_0294772 | 3300048914 | Bacteria | 1203 |
| 598 | Ga0496112_0965172 | 3300048915 | Bacteria | 773 |
| 599 | Ga0496116_0093641 | 3300048919 | Bacteria | 1818 |
| 600 | Ga0496116_0105176 | 3300048919 | Bacteria | 1675 |
| 601 | Ga0496117_0029279 | 3300048920 | Bacteria | 4248 |
| 602 | Ga0496117_0114439 | 3300048920 | Bacteria | 1672 |
| 603 | Ga0496117_0347496 | 3300048920 | Bacteria | 767 |
| 604 | Ga0496118_0007557 | 3300048921 | Bacteria | 11476 |
| 605 | Ga0496118_0057870 | 3300048921 | Bacteria | 2901 |
| 606 | Ga0496121_0023232 | 3300048924 | Bacteria | 5980 |
| 607 | Ga0496121_0320112 | 3300048924 | Bacteria | 1044 |
| 608 | Ga0496122_0000331 | 3300048925 | Bacteria | 102617 |
| 609 | Ga0496122_0076122 | 3300048925 | Bacteria | 2363 |
| 610 | Ga0496123_0000124 | 3300048926 | Bacteria | 158327 |
| 611 | Ga0496123_0056696 | 3300048926 | Bacteria | 2557 |
| 612 | Ga0496123_0065327 | 3300048926 | Bacteria | 2313 |
| 613 | Ga0496123_0084147 | 3300048926 | Bacteria | 1919 |
| 614 | Ga0496123_0140086 | 3300048926 | Bacteria | 1324 |
| 615 | Ga0496124_0041767 | 3300048927 | Bacteria | 3954 |
| 616 | Ga0496124_0088951 | 3300048927 | Bacteria | 2523 |
| 617 | Ga0496124_0096092 | 3300048927 | Bacteria | 2407 |
| 618 | Ga0496125_0000522 | 3300048928 | Bacteria | 66680 |
| 619 | Ga0496125_0008570 | 3300048928 | Bacteria | 10679 |
| 620 | Ga0496125_0010233 | 3300048928 | Bacteria | 9502 |
| 621 | Ga0496125_0024515 | 3300048928 | Bacteria | 5547 |
| 622 | Ga0496125_0053052 | 3300048928 | Bacteria | 3328 |
| 623 | Ga0496125_0055567 | 3300048928 | Bacteria | 3224 |
| 624 | Ga0496125_0085350 | 3300048928 | Bacteria | 2392 |
| 625 | Ga0496125_0109704 | 3300048928 | Bacteria | 2003 |
| 626 | Ga0496126_0043356 | 3300048929 | Bacteria | 4150 |
| 627 | Ga0496126_0077296 | 3300048929 | Bacteria | 2951 |
| 628 | Ga0496126_0086157 | 3300048929 | Bacteria | 2769 |
| 629 | Ga0501310_012752 | 3300049130 | Bacteria | 967 |
| 630 | Ga0501031_0008183 | 3300049568 | Bacteria | 6805 |
| 631 | Ga0501033_0350124 | 3300049570 | Bacteria | 1035 |
| 632 | Ga0501034_0315662 | 3300049571 | Bacteria | 1496 |
| 633 | Ga0501034_0451146 | 3300049571 | Bacteria | 1204 |
| 634 | Ga0501036_0388512 | 3300049572 | Bacteria | 1164 |
| 635 | Ga0501043_0228209 | 3300049579 | Bacteria | 1439 |
| 636 | Ga0501043_0317600 | 3300049579 | Bacteria | 1188 |
| 637 | Ga0501046_0065033 | 3300049580 | Bacteria | 2846 |
| 638 | Ga0501047_0592282 | 3300049581 | Bacteria | 931 |
| 639 | Ga0501067_0380650 | 3300049583 | Bacteria | 787 |
| 640 | Ga0501073_0360247 | 3300049589 | Bacteria | 1004 |
| 641 | Ga0501223_043704 | 3300049663 | Bacteria | 869 |
| 642 | Ga0501249_002817 | 3300049679 | Bacteria | 3501 |
| 643 | Ga0501257_060192 | 3300049686 | Bacteria | 959 |
| 644 | Ga0501225_0028728 | 3300049705 | Bacteria | 1528 |
| 645 | Ga0501080_0046276 | 3300049742 | Bacteria | 4051 |
| 646 | Ga0501262_000738 | 3300049759 | Bacteria | 3771 |
| 647 | Ga0501266_021566 | 3300049763 | Bacteria | 881 |
| 648 | Ga0501035_0200756 | 3300049822 | Bacteria | 1710 |
| 649 | Ga0501035_0294754 | 3300049822 | Bacteria | 1368 |
| 650 | Ga0501044_0124106 | 3300049823 | Bacteria | 2580 |
| 651 | Ga0501044_0682827 | 3300049823 | Bacteria | 913 |
| 652 | nmdc:mga03683_126211_c1 | 3300050489 | Bacteria | 1141 |
| 653 | nmdc:mga03683_127146_c1 | 3300050489 | Bacteria | 1138 |
| 654 | nmdc:mga03683_19660_c1 | 3300050489 | Bacteria | 2581 |
| 655 | nmdc:mga03683_29659_c1 | 3300050489 | Bacteria | 2182 |
| 656 | nmdc:mga03n38_14244_c1 | 3300050490 | Bacteria | 3042 |
| 657 | nmdc:mga03n38_204876_c1 | 3300050490 | Bacteria | 1023 |
| 658 | nmdc:mga03n38_243523_c1 | 3300050490 | Bacteria | 947 |
| 659 | nmdc:mga00v17_3326_c1 | 3300050491 | Bacteria | 8291 |
| 660 | nmdc:mga00v17_499356_c1 | 3300050491 | Bacteria | 789 |
| 661 | nmdc:mga0yw44_26196_c1 | 3300050492 | Bacteria | 3327 |
| 662 | nmdc:mga0yw44_34273_c1 | 3300050492 | Bacteria | 2974 |
| 663 | nmdc:mga0yw44_404726_c1 | 3300050492 | Bacteria | 923 |
| 664 | nmdc:mga0k408_188983_c1 | 3300050493 | Bacteria | 1229 |
| 665 | nmdc:mga0k408_213658_c1 | 3300050493 | Bacteria | 1152 |
| 666 | nmdc:mga0k408_305474_c1 | 3300050493 | Bacteria | 949 |
| 667 | nmdc:mga0k408_422527_c1 | 3300050493 | Bacteria | 792 |
| 668 | nmdc:mga0k408_52363_c1 | 3300050493 | Bacteria | 2366 |
| 669 | nmdc:mga0k408_738_c1 | 3300050493 | Bacteria | 8286 |
| 670 | nmdc:mga0k408_92167_c1 | 3300050493 | Bacteria | 1781 |
| 671 | nmdc:mga06z11_163388_c1 | 3300050494 | Bacteria | 1274 |
| 672 | nmdc:mga04h51_56225_c1 | 3300050495 | Bacteria | 1335 |
| 673 | nmdc:mga07m45_120095_c1 | 3300050496 | Bacteria | 1518 |
| 674 | nmdc:mga07m45_145660_c1 | 3300050496 | Bacteria | 1373 |
| 675 | nmdc:mga07m45_22907_c1 | 3300050496 | Bacteria | 3412 |
| 676 | nmdc:mga07m45_283_c1 | 3300050496 | Bacteria | 20386 |
| 677 | nmdc:mga07m45_317061_c1 | 3300050496 | Bacteria | 906 |
| 678 | nmdc:mga07m45_70512_c1 | 3300050496 | Bacteria | 1988 |
| 679 | nmdc:mga07m45_8102_c1 | 3300050496 | Bacteria | 5387 |
| 680 | nmdc:mga0qj67_218259_c1 | 3300050509 | Bacteria | 1548 |
| 681 | nmdc:mga0sz30_179706_c1 | 3300050516 | Bacteria | 939 |
| 682 | nmdc:mga0sz30_255246_c1 | 3300050516 | Bacteria | 780 |
| 683 | Ga0500610_0042474 | 3300053079 | Bacteria | 2352 |
| 684 | Ga0500635_0180315 | 3300053080 | Bacteria | 816 |
| 685 | Ga0500643_007054 | 3300053087 | Bacteria | 4605 |
| 686 | Ga0500643_018032 | 3300053087 | Bacteria | 2351 |
| 687 | Ga0500644_0001842 | 3300053088 | Bacteria | 5474 |
| 688 | Ga0500644_0009713 | 3300053088 | Bacteria | 2583 |
| 689 | Ga0500583_0171344 | 3300053092 | Bacteria | 1081 |
| 690 | Ga0500651_0000560 | 3300053093 | Bacteria | 18911 |
| 691 | Ga0500566_0098880 | 3300053094 | Bacteria | 1602 |
| 692 | Ga0500650_0216580 | 3300053098 | Bacteria | 868 |
| 693 | Ga0500555_098708 | 3300053103 | Bacteria | 744 |
| 694 | Ga0500562_034163 | 3300053108 | Bacteria | 1344 |
| 695 | Ga0500562_047595 | 3300053108 | Bacteria | 1145 |
| 696 | Ga0500571_000133 | 3300053110 | Bacteria | 25072 |
| 697 | Ga0500592_005679 | 3300053116 | Bacteria | 1985 |
| 698 | Ga0500593_000065 | 3300053117 | Bacteria | 38993 |
| 699 | Ga0500593_016801 | 3300053117 | Bacteria | 3174 |
| 700 | Ga0500594_0002530 | 3300053118 | Bacteria | 3977 |
| 701 | Ga0500597_083739 | 3300053120 | Bacteria | 1384 |
| 702 | Ga0500607_000674 | 3300053121 | Bacteria | 32958 |
| 703 | Ga0500655_001239 | 3300053133 | Bacteria | 4844 |
| 704 | Ga0500658_0134915 | 3300053134 | Bacteria | 1103 |
| 705 | Ga0500559_0000975 | 3300053136 | Bacteria | 17905 |
| 706 | Ga0500559_0201170 | 3300053136 | Bacteria | 939 |
| 707 | Ga0500564_097741 | 3300053138 | Bacteria | 1300 |
| 708 | Ga0500568_0014612 | 3300053139 | Bacteria | 3539 |
| 709 | Ga0500574_078088 | 3300053141 | Bacteria | 974 |
| 710 | Ga0500616_0009752 | 3300053153 | Bacteria | 5802 |
| 711 | Ga0500622_0202202 | 3300053156 | Bacteria | 903 |
| 712 | Ga0500624_010138 | 3300053157 | Bacteria | 1352 |
| 713 | Ga0500627_0001528 | 3300053158 | Bacteria | 6510 |
| 714 | Ga0500634_0018009 | 3300053161 | Bacteria | 3788 |
| 715 | Ga0500636_0072585 | 3300053177 | Bacteria | 1994 |
| 716 | Ga0500645_086468 | 3300053730 | Bacteria | 891 |
| 717 | Ga0500645_087961 | 3300053730 | Bacteria | 883 |
| 718 | Ga0500661_014296 | 3300055283 | Bacteria | 1428 |
| 719 | Ga0590075_026524 | 3300059424 | Bacteria | 1459 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048909 | Ga0496106_1275203 | Ga0496106_1275203_30_557 | 175 |
| 2 | 3300041443 | Ga0451789_0807840 | Ga0451789_0807840_90_686 | 179 |
| 3 | 3300048924 | Ga0496121_0320112 | Ga0496121_0320112_487_1032 | 181 |
| 4 | 3300053108 | Ga0500562_047595 | Ga0500562_047595_587_1132 | 181 |
| 5 | 3300055283 | Ga0500661_014296 | Ga0500661_014296_871_1416 | 181 |
| 6 | iso_pu_bacteria | 2904541872 | 2904545229 | 181 |
| 7 | 3300044712 | Ga0453684_0411237 | Ga0453684_0411237_878_1447 | 185 |
| 8 | 3300005347 | Ga0070668_100225581 | Ga0070668_1002255812 | 187 |
| 9 | 3300005518 | Ga0070699_100051375 | Ga0070699_1000513754 | 187 |
| 10 | 3300006042 | Ga0075368_10279720 | Ga0075368_102797202 | 187 |
| 11 | 3300006195 | Ga0075366_10036281 | Ga0075366_100362813 | 187 |
| 12 | 3300006353 | Ga0075370_10135359 | Ga0075370_101353592 | 187 |
| 13 | 3300017792 | Ga0163161_10382323 | Ga0163161_103823232 | 187 |
| 14 | 3300042876 | Ga0451577_0028125 | Ga0451577_0028125_3519_4094 | 187 |
| 15 | 3300045051 | Ga0451576_0056103 | Ga0451576_0056103_702_1277 | 187 |
| 16 | 3300050493 | nmdc:mga0k408_188983_c1 | nmdc:mga0k408_188983_c1_262_882 | 187 |
| 17 | 3300050496 | nmdc:mga07m45_8102_c1 | nmdc:mga07m45_8102_c1_139_759 | 187 |
| 18 | 3300053087 | Ga0500643_007054 | Ga0500643_007054_3993_4565 | 188 |
| 19 | 3300005328 | Ga0070676_10567991 | Ga0070676_105679911 | 191 |
| 20 | 3300005354 | Ga0070675_100165430 | Ga0070675_1001654303 | 191 |
| 21 | 3300005456 | Ga0070678_100226004 | Ga0070678_1002260041 | 191 |
| 22 | 3300005543 | Ga0070672_100256606 | Ga0070672_1002566061 | 191 |
| 23 | 3300014326 | Ga0157380_10184459 | Ga0157380_101844592 | 191 |
| 24 | 3300025960 | Ga0207651_10390888 | Ga0207651_103908882 | 191 |
| 25 | 3300025986 | Ga0207658_10092183 | Ga0207658_100921833 | 191 |
| 26 | 3300028379 | Ga0268266_10315543 | Ga0268266_103155432 | 191 |
| 27 | 3300031901 | Ga0307406_10330303 | Ga0307406_103303032 | 191 |
| 28 | 3300042876 | Ga0451577_0001869 | Ga0451577_0001869_389_991 | 191 |
| 29 | 3300046539 | Ga0495621_0000477 | Ga0495621_0000477_3120_3740 | 191 |
| 30 | 3300046615 | Ga0495656_0000163 | Ga0495656_0000163_14561_15181 | 191 |
| 31 | 3300047470 | Ga0495681_0059758 | Ga0495681_0059758_102_722 | 191 |
| 32 | 3300013296 | Ga0157374_10581710 | Ga0157374_105817102 | 193 |
| 33 | 3300042876 | Ga0451577_0451523 | Ga0451577_0451523_488_1096 | 193 |
| 34 | iso_pu_bacteria | 2894023352 | 2894024465 | 193 |
| 35 | 3300038443 | Ga0395901_0504515 | Ga0395901_0504515_77_697 | 194 |
| 36 | iso_pu_bacteria | 2899924645 | 2899928068 | 194 |
| 37 | iso_pu_bacteria | 2928064002 | 2928066717 | 194 |
| 38 | 3300050516 | nmdc:mga0sz30_179706_c1 | nmdc:mga0sz30_179706_c1_12_608 | 198 |
| 39 | 3300042876 | Ga0451577_0472121 | Ga0451577_0472121_400_1008 | 200 |
| 40 | 3300039093 | Ga0400489_59002 | Ga0400489_59002_464_1069 | 201 |
| 41 | iso_pu_bacteria | 2511231002 | 2511247148 | 202 |
| 42 | iso_pu_bacteria | 2513020051 | 2513230381 | 202 |
| 43 | iso_pu_bacteria | 2547132374 | 2548498950 | 202 |
| 44 | iso_pu_bacteria | 2599185214 | 2599627964 | 202 |
| 45 | iso_pu_bacteria | 2599185226 | 2599677775 | 202 |
| 46 | iso_pu_bacteria | 2599185227 | 2599685594 | 202 |
| 47 | iso_pu_bacteria | 2599185229 | 2599697486 | 202 |
| 48 | iso_pu_bacteria | 2643221570 | 2643867832 | 202 |
| 49 | iso_pu_bacteria | 2643221596 | 2643991696 | 202 |
| 50 | iso_pu_bacteria | 2643221609 | 2644062396 | 202 |
| 51 | iso_pu_bacteria | 2643221611 | 2644071308 | 202 |
| 52 | iso_pu_bacteria | 2643221628 | 2644161783 | 202 |
| 53 | iso_pu_bacteria | 2643221652 | 2644293456 | 202 |
| 54 | iso_pu_bacteria | 2643221658 | 2644325803 | 202 |
| 55 | iso_pu_bacteria | 2643221672 | 2644399654 | 202 |
| 56 | iso_pu_bacteria | 2643221683 | 2644465166 | 202 |
| 57 | iso_pu_bacteria | 2643221717 | 2644648409 | 202 |
| 58 | iso_pu_bacteria | 2721755523 | 2722885282 | 202 |
| 59 | iso_pu_bacteria | 2738541277 | 2738724017 | 202 |
| 60 | iso_pu_bacteria | 2738541307 | 2738880581 | 202 |
| 61 | iso_pu_bacteria | 2738543012 | 2739246460 | 202 |
| 62 | iso_pu_bacteria | 2738543013 | 2739247907 | 202 |
| 63 | iso_pu_bacteria | 2738543019 | 2739284702 | 202 |
| 64 | iso_pu_bacteria | 2816332133 | 2816471156 | 202 |
| 65 | iso_pu_bacteria | 2818991446 | 2819600678 | 202 |
| 66 | iso_pu_bacteria | 2838054893 | 2838061724 | 202 |
| 67 | iso_pu_bacteria | 2839138175 | 2839138654 | 202 |
| 68 | iso_pu_bacteria | 2842677519 | 2842679755 | 202 |
| 69 | iso_pu_bacteria | 2842718218 | 2842718876 | 202 |
| 70 | iso_pu_bacteria | 2842733646 | 2842734092 | 202 |
| 71 | iso_pu_bacteria | 2842747753 | 2842752532 | 202 |
| 72 | iso_pu_bacteria | 2881101125 | 2881102707 | 202 |
| 73 | iso_pu_bacteria | 2885192300 | 2885193056 | 202 |
| 74 | iso_pu_bacteria | 2904449895 | 2904452516 | 202 |
| 75 | iso_pu_bacteria | 2904456579 | 2904460885 | 202 |
| 76 | iso_pu_bacteria | 2904479285 | 2904480858 | 202 |
| 77 | iso_pu_bacteria | 2919462493 | 2919463855 | 202 |
| 78 | iso_pu_bacteria | 2919704043 | 2919704160 | 202 |
| 79 | iso_pu_bacteria | 2928084124 | 2928088606 | 202 |
| 80 | iso_pu_bacteria | 2929160207 | 2929165421 | 202 |
| 81 | iso_pu_bacteria | 2929520902 | 2929522851 | 202 |
| 82 | iso_pu_bacteria | 2932422444 | 2932425361 | 202 |
| 83 | iso_pu_bacteria | 2945945610 | 2945945978 | 202 |
| 84 | iso_pu_bacteria | 2945972063 | 2945975596 | 202 |
| 85 | iso_pu_bacteria | 2974320154 | 2974320306 | 202 |
| 86 | iso_pu_bacteria | 2990710928 | 2990713858 | 202 |
| 87 | 3300026075 | Ga0207708_10181400 | Ga0207708_101814004 | 204 |
| 88 | 3300042532 | Ga0450893_0046800 | Ga0450893_0046800_12_659 | 204 |
| 89 | 3300005543 | Ga0070672_100629341 | Ga0070672_1006293412 | 205 |
| 90 | 3300006038 | Ga0075365_10658648 | Ga0075365_106586481 | 205 |
| 91 | 3300006846 | Ga0075430_100092876 | Ga0075430_1000928763 | 205 |
| 92 | 3300026089 | Ga0207648_10062014 | Ga0207648_100620142 | 205 |
| 93 | 3300031548 | Ga0307408_100467496 | Ga0307408_1004674962 | 205 |
| 94 | 3300037471 | Ga0395905_0008661 | Ga0395905_0008661_4200_4817 | 205 |
| 95 | 3300037471 | Ga0395905_0325203 | Ga0395905_0325203_282_899 | 205 |
| 96 | 3300042015 | Ga0439462_0010823 | Ga0439462_0010823_1665_2282 | 205 |
| 97 | 3300042123 | Ga0450921_011460 | Ga0450921_011460_27_644 | 205 |
| 98 | 3300042125 | Ga0450923_042023 | Ga0450923_042023_30_647 | 205 |
| 99 | 3300042128 | Ga0450897_014079 | Ga0450897_014079_94_711 | 205 |
| 100 | 3300042156 | Ga0439446_0026497 | Ga0439446_0026497_768_1385 | 205 |
| 101 | 3300042184 | Ga0450908_018645 | Ga0450908_018645_485_1102 | 205 |
| 102 | 3300042435 | Ga0439434_0061187 | Ga0439434_0061187_266_883 | 205 |
| 103 | 3300042438 | Ga0439459_0006375 | Ga0439459_0006375_1131_1748 | 205 |
| 104 | 3300042439 | Ga0439464_0009630 | Ga0439464_0009630_607_1224 | 205 |
| 105 | 3300044673 | Ga0453683_0034464 | Ga0453683_0034464_135_752 | 205 |
| 106 | 3300045051 | Ga0451576_0024858 | Ga0451576_0024858_4161_4778 | 205 |
| 107 | 3300049686 | Ga0501257_060192 | Ga0501257_060192_321_938 | 205 |
| 108 | 3300050509 | nmdc:mga0qj67_218259_c1 | nmdc:mga0qj67_218259_c1_689_1306 | 205 |
| 109 | iso_pu_bacteria | 2928115317 | 2928115568 | 205 |
| 110 | 2162886007 | SwRhRL2b_contig_1208657 | SwRhRL2b_0836.00006380 | 206 |
| 111 | 3300001979 | JGI24740J21852_10007463 | JGI24740J21852_100074634 | 206 |
| 112 | 3300001989 | JGI24739J22299_10012424 | JGI24739J22299_100124242 | 206 |
| 113 | 3300001989 | JGI24739J22299_10052911 | JGI24739J22299_100529113 | 206 |
| 114 | 3300002704 | JGI25155J39150_1000085 | JGI25155J39150_100008562 | 206 |
| 115 | 3300002705 | JGI25156J39149_1000139 | JGI25156J39149_100013962 | 206 |
| 116 | 3300002738 | JGI25154J39366_1000154 | JGI25154J39366_10001543 | 206 |
| 117 | 3300002739 | JGI25158J39367_1010274 | JGI25158J39367_10102742 | 206 |
| 118 | 3300002741 | JGI25157J39369_1000181 | JGI25157J39369_10001813 | 206 |
| 119 | 3300002773 | JGI25152J39213_1004827 | JGI25152J39213_10048271 | 206 |
| 120 | 3300002773 | JGI25152J39213_1012417 | JGI25152J39213_10124171 | 206 |
| 121 | 3300002774 | JGI25150J39212_1003168 | JGI25150J39212_10031683 | 206 |
| 122 | 3300002774 | JGI25150J39212_1003655 | JGI25150J39212_10036553 | 206 |
| 123 | 3300002774 | JGI25150J39212_1004700 | JGI25150J39212_10047003 | 206 |
| 124 | 3300002774 | JGI25150J39212_1005571 | JGI25150J39212_10055713 | 206 |
| 125 | 3300002987 | JGI25159J45721_1000575 | JGI25159J45721_100057521 | 206 |
| 126 | 3300002987 | JGI25159J45721_1001104 | JGI25159J45721_100110417 | 206 |
| 127 | 3300002987 | JGI25159J45721_1008541 | JGI25159J45721_10085413 | 206 |
| 128 | 3300002987 | JGI25159J45721_1010488 | JGI25159J45721_10104883 | 206 |
| 129 | 3300002987 | JGI25159J45721_1021272 | JGI25159J45721_10212722 | 206 |
| 130 | 3300002987 | JGI25159J45721_1024325 | JGI25159J45721_10243252 | 206 |
| 131 | 3300003187 | JGI25151J46595_10001834 | JGI25151J46595_100018345 | 206 |
| 132 | 3300003187 | JGI25151J46595_10004515 | JGI25151J46595_100045155 | 206 |
| 133 | 3300003187 | JGI25151J46595_10007290 | JGI25151J46595_100072903 | 206 |
| 134 | 3300003187 | JGI25151J46595_10008309 | JGI25151J46595_100083092 | 206 |
| 135 | 3300003187 | JGI25151J46595_10023051 | JGI25151J46595_100230513 | 206 |
| 136 | 3300003187 | JGI25151J46595_10029761 | JGI25151J46595_100297612 | 206 |
| 137 | 3300003215 | JGI25153J46596_10008225 | JGI25153J46596_100082255 | 206 |
| 138 | 3300003215 | JGI25153J46596_10008252 | JGI25153J46596_100082522 | 206 |
| 139 | 3300003316 | rootH1_10044413 | rootH1_100444131 | 206 |
| 140 | 3300003323 | rootH1_10002122 | rootH1_100021222 | 206 |
| 141 | 3300003323 | rootH1_10058594 | rootH1_100585943 | 206 |
| 142 | 3300003354 | JGI25160J50197_1000129 | JGI25160J50197_100012921 | 206 |
| 143 | 3300003354 | JGI25160J50197_1005984 | JGI25160J50197_10059842 | 206 |
| 144 | 3300003354 | JGI25160J50197_1024715 | JGI25160J50197_10247152 | 206 |
| 145 | 3300003374 | JGI25161J50226_1000080 | JGI25161J50226_100008040 | 206 |
| 146 | 3300003374 | JGI25161J50226_1002297 | JGI25161J50226_10022972 | 206 |
| 147 | 3300003761 | Ga0055535_1000750 | Ga0055535_100075016 | 206 |
| 148 | 3300003762 | Ga0055542_1000583 | Ga0055542_100058316 | 206 |
| 149 | 3300003771 | Ga0055526_1015725 | Ga0055526_10157253 | 206 |
| 150 | 3300003771 | Ga0055526_1015747 | Ga0055526_10157473 | 206 |
| 151 | 3300003773 | Ga0055537_1000049 | Ga0055537_100004922 | 206 |
| 152 | 3300003773 | Ga0055537_1001823 | Ga0055537_10018239 | 206 |
| 153 | 3300003773 | Ga0055537_1003302 | Ga0055537_10033022 | 206 |
| 154 | 3300003773 | Ga0055537_1003310 | Ga0055537_10033104 | 206 |
| 155 | 3300003775 | Ga0055524_1000120 | Ga0055524_100012049 | 206 |
| 156 | 3300003775 | Ga0055524_1013849 | Ga0055524_10138493 | 206 |
| 157 | 3300003775 | Ga0055524_1013865 | Ga0055524_10138652 | 206 |
| 158 | 3300003781 | Ga0055536_1002156 | Ga0055536_100215612 | 206 |
| 159 | 3300003781 | Ga0055536_1002470 | Ga0055536_10024708 | 206 |
| 160 | 3300003781 | Ga0055536_1005584 | Ga0055536_10055844 | 206 |
| 161 | 3300003781 | Ga0055536_1009058 | Ga0055536_10090583 | 206 |
| 162 | 3300003781 | Ga0055536_1029492 | Ga0055536_10294922 | 206 |
| 163 | 3300003784 | Ga0055534_1000049 | Ga0055534_100004977 | 206 |
| 164 | 3300003784 | Ga0055534_1000343 | Ga0055534_10003431 | 206 |
| 165 | 3300003784 | Ga0055534_1001185 | Ga0055534_10011858 | 206 |
| 166 | 3300003784 | Ga0055534_1002822 | Ga0055534_10028228 | 206 |
| 167 | 3300003784 | Ga0055534_1003409 | Ga0055534_10034092 | 206 |
| 168 | 3300003790 | Ga0055528_1000623 | Ga0055528_100062317 | 206 |
| 169 | 3300003790 | Ga0055528_1007101 | Ga0055528_10071012 | 206 |
| 170 | 3300003790 | Ga0055528_1007116 | Ga0055528_10071162 | 206 |
| 171 | 3300003791 | Ga0055530_10001404 | Ga0055530_1000140418 | 206 |
| 172 | 3300003791 | Ga0055530_10011762 | Ga0055530_100117623 | 206 |
| 173 | 3300003791 | Ga0055530_10017412 | Ga0055530_100174123 | 206 |
| 174 | 3300003792 | Ga0055540_1000067 | Ga0055540_100006779 | 206 |
| 175 | 3300003792 | Ga0055540_1000480 | Ga0055540_100048028 | 206 |
| 176 | 3300003792 | Ga0055540_1003384 | Ga0055540_10033848 | 206 |
| 177 | 3300003792 | Ga0055540_1004630 | Ga0055540_10046303 | 206 |
| 178 | 3300003792 | Ga0055540_1019477 | Ga0055540_10194771 | 206 |
| 179 | 3300003792 | Ga0055540_1033605 | Ga0055540_10336052 | 206 |
| 180 | 3300003794 | Ga0055531_10000034 | Ga0055531_100000342 | 206 |
| 181 | 3300003794 | Ga0055531_10000738 | Ga0055531_100007389 | 206 |
| 182 | 3300003794 | Ga0055531_10011804 | Ga0055531_100118043 | 206 |
| 183 | 3300003794 | Ga0055531_10017551 | Ga0055531_100175513 | 206 |
| 184 | 3300003794 | Ga0055531_10018250 | Ga0055531_100182503 | 206 |
| 185 | 3300004625 | Ga0055543_1000202 | Ga0055543_100020240 | 206 |
| 186 | 3300004625 | Ga0055543_1005905 | Ga0055543_10059053 | 206 |
| 187 | 3300004625 | Ga0055543_1006405 | Ga0055543_10064053 | 206 |
| 188 | 3300005262 | Ga0065165_1015225 | Ga0065165_10152253 | 206 |
| 189 | 3300005262 | Ga0065165_1027858 | Ga0065165_10278583 | 206 |
| 190 | 3300005288 | Ga0065714_10020441 | Ga0065714_100204413 | 206 |
| 191 | 3300005288 | Ga0065714_10096768 | Ga0065714_100967682 | 206 |
| 192 | 3300005289 | Ga0065704_10074991 | Ga0065704_100749913 | 206 |
| 193 | 3300005289 | Ga0065704_10091409 | Ga0065704_100914092 | 206 |
| 194 | 3300005289 | Ga0065704_10225657 | Ga0065704_102256572 | 206 |
| 195 | 3300005289 | Ga0065704_10230352 | Ga0065704_102303522 | 206 |
| 196 | 3300005295 | Ga0065707_10190962 | Ga0065707_101909622 | 206 |
| 197 | 3300005327 | Ga0070658_10067313 | Ga0070658_100673134 | 206 |
| 198 | 3300005327 | Ga0070658_10085691 | Ga0070658_100856913 | 206 |
| 199 | 3300005327 | Ga0070658_10459368 | Ga0070658_104593682 | 206 |
| 200 | 3300005331 | Ga0070670_100583674 | Ga0070670_1005836742 | 206 |
| 201 | 3300005331 | Ga0070670_100734809 | Ga0070670_1007348091 | 206 |
| 202 | 3300005334 | Ga0068869_100477178 | Ga0068869_1004771781 | 206 |
| 203 | 3300005344 | Ga0070661_100982008 | Ga0070661_1009820081 | 206 |
| 204 | 3300005347 | Ga0070668_100356478 | Ga0070668_1003564782 | 206 |
| 205 | 3300005353 | Ga0070669_100161067 | Ga0070669_1001610671 | 206 |
| 206 | 3300005354 | Ga0070675_100427450 | Ga0070675_1004274502 | 206 |
| 207 | 3300005356 | Ga0070674_100151075 | Ga0070674_1001510752 | 206 |
| 208 | 3300005366 | Ga0070659_100227861 | Ga0070659_1002278613 | 206 |
| 209 | 3300005367 | Ga0070667_100102296 | Ga0070667_1001022962 | 206 |
| 210 | 3300005435 | Ga0070714_100043003 | Ga0070714_1000430033 | 206 |
| 211 | 3300005456 | Ga0070678_100160771 | Ga0070678_1001607712 | 206 |
| 212 | 3300005457 | Ga0070662_100062742 | Ga0070662_1000627423 | 206 |
| 213 | 3300005468 | Ga0070707_100109908 | Ga0070707_1001099083 | 206 |
| 214 | 3300005539 | Ga0068853_100032565 | Ga0068853_1000325653 | 206 |
| 215 | 3300005539 | Ga0068853_100128401 | Ga0068853_1001284012 | 206 |
| 216 | 3300005539 | Ga0068853_100990228 | Ga0068853_1009902281 | 206 |
| 217 | 3300005539 | Ga0068853_101068652 | Ga0068853_1010686521 | 206 |
| 218 | 3300005547 | Ga0070693_100017394 | Ga0070693_1000173943 | 206 |
| 219 | 3300005548 | Ga0070665_100033550 | Ga0070665_1000335504 | 206 |
| 220 | 3300005548 | Ga0070665_100284408 | Ga0070665_1002844083 | 206 |
| 221 | 3300005563 | Ga0068855_100004546 | Ga0068855_10000454615 | 206 |
| 222 | 3300005563 | Ga0068855_100046799 | Ga0068855_1000467995 | 206 |
| 223 | 3300005563 | Ga0068855_100276631 | Ga0068855_1002766313 | 206 |
| 224 | 3300005564 | Ga0070664_100074593 | Ga0070664_1000745933 | 206 |
| 225 | 3300005577 | Ga0068857_100227861 | Ga0068857_1002278613 | 206 |
| 226 | 3300005614 | Ga0068856_100150449 | Ga0068856_1001504493 | 206 |
| 227 | 3300005614 | Ga0068856_100375887 | Ga0068856_1003758873 | 206 |
| 228 | 3300005617 | Ga0068859_100280526 | Ga0068859_1002805263 | 206 |
| 229 | 3300005618 | Ga0068864_100021424 | Ga0068864_1000214246 | 206 |
| 230 | 3300005834 | Ga0068851_10051418 | Ga0068851_100514183 | 206 |
| 231 | 3300005834 | Ga0068851_10257854 | Ga0068851_102578541 | 206 |
| 232 | 3300005841 | Ga0068863_100279201 | Ga0068863_1002792013 | 206 |
| 233 | 3300005844 | Ga0068862_100035693 | Ga0068862_1000356933 | 206 |
| 234 | 3300005844 | Ga0068862_100278195 | Ga0068862_1002781952 | 206 |
| 235 | 3300006038 | Ga0075365_10000296 | Ga0075365_1000029613 | 206 |
| 236 | 3300006042 | Ga0075368_10048959 | Ga0075368_100489592 | 206 |
| 237 | 3300006048 | Ga0075363_100008947 | Ga0075363_1000089475 | 206 |
| 238 | 3300006048 | Ga0075363_100047464 | Ga0075363_1000474643 | 206 |
| 239 | 3300006048 | Ga0075363_100109222 | Ga0075363_1001092222 | 206 |
| 240 | 3300006051 | Ga0075364_10004115 | Ga0075364_100041152 | 206 |
| 241 | 3300006051 | Ga0075364_10058479 | Ga0075364_100584792 | 206 |
| 242 | 3300006058 | Ga0075432_10009149 | Ga0075432_100091493 | 206 |
| 243 | 3300006058 | Ga0075432_10044150 | Ga0075432_100441502 | 206 |
| 244 | 3300006177 | Ga0075362_10008974 | Ga0075362_100089743 | 206 |
| 245 | 3300006177 | Ga0075362_10026548 | Ga0075362_100265482 | 206 |
| 246 | 3300006177 | Ga0075362_10098857 | Ga0075362_100988571 | 206 |
| 247 | 3300006178 | Ga0075367_10261552 | Ga0075367_102615522 | 206 |
| 248 | 3300006195 | Ga0075366_10003520 | Ga0075366_100035205 | 206 |
| 249 | 3300006195 | Ga0075366_10066167 | Ga0075366_100661673 | 206 |
| 250 | 3300006195 | Ga0075366_10069482 | Ga0075366_100694822 | 206 |
| 251 | 3300006237 | Ga0097621_100412527 | Ga0097621_1004125271 | 206 |
| 252 | 3300006353 | Ga0075370_10003918 | Ga0075370_100039186 | 206 |
| 253 | 3300006353 | Ga0075370_10013503 | Ga0075370_100135034 | 206 |
| 254 | 3300006353 | Ga0075370_10048867 | Ga0075370_100488672 | 206 |
| 255 | 3300006353 | Ga0075370_10144711 | Ga0075370_101447112 | 206 |
| 256 | 3300006353 | Ga0075370_10237822 | Ga0075370_102378222 | 206 |
| 257 | 3300006931 | Ga0097620_100280525 | Ga0097620_1002805253 | 206 |
| 258 | 3300006946 | Ga0079104_1000003 | Ga0079104_100000322 | 206 |
| 259 | 3300009036 | Ga0105244_10016816 | Ga0105244_100168162 | 206 |
| 260 | 3300009036 | Ga0105244_10144859 | Ga0105244_101448592 | 206 |
| 261 | 3300009092 | Ga0105250_10001739 | Ga0105250_100017396 | 206 |
| 262 | 3300009093 | Ga0105240_10214478 | Ga0105240_102144783 | 206 |
| 263 | 3300009093 | Ga0105240_10626936 | Ga0105240_106269363 | 206 |
| 264 | 3300009094 | Ga0111539_11500683 | Ga0111539_115006831 | 206 |
| 265 | 3300009098 | Ga0105245_10145029 | Ga0105245_101450293 | 206 |
| 266 | 3300009148 | Ga0105243_10001244 | Ga0105243_100012442 | 206 |
| 267 | 3300009148 | Ga0105243_10003162 | Ga0105243_100031629 | 206 |
| 268 | 3300009148 | Ga0105243_10062687 | Ga0105243_100626872 | 206 |
| 269 | 3300009148 | Ga0105243_10176906 | Ga0105243_101769062 | 206 |
| 270 | 3300009148 | Ga0105243_10858164 | Ga0105243_108581641 | 206 |
| 271 | 3300009545 | Ga0105237_10136801 | Ga0105237_101368013 | 206 |
| 272 | 3300009545 | Ga0105237_10485238 | Ga0105237_104852383 | 206 |
| 273 | 3300009551 | Ga0105238_10049880 | Ga0105238_100498803 | 206 |
| 274 | 3300009551 | Ga0105238_10063487 | Ga0105238_100634873 | 206 |
| 275 | 3300009551 | Ga0105238_10809781 | Ga0105238_108097811 | 206 |
| 276 | 3300010375 | Ga0105239_10665406 | Ga0105239_106654062 | 206 |
| 277 | 3300011119 | Ga0105246_10588438 | Ga0105246_105884382 | 206 |
| 278 | 3300012502 | Ga0157347_1002693 | Ga0157347_10026931 | 206 |
| 279 | 3300012513 | Ga0157326_1002659 | Ga0157326_10026592 | 206 |
| 280 | 3300013100 | Ga0157373_10025215 | Ga0157373_100252153 | 206 |
| 281 | 3300013102 | Ga0157371_10038429 | Ga0157371_100384293 | 206 |
| 282 | 3300013104 | Ga0157370_10007822 | Ga0157370_1000782213 | 206 |
| 283 | 3300013104 | Ga0157370_10441882 | Ga0157370_104418821 | 206 |
| 284 | 3300013105 | Ga0157369_10037367 | Ga0157369_100373676 | 206 |
| 285 | 3300013296 | Ga0157374_10730989 | Ga0157374_107309892 | 206 |
| 286 | 3300013297 | Ga0157378_10599256 | Ga0157378_105992562 | 206 |
| 287 | 3300013306 | Ga0163162_10258502 | Ga0163162_102585022 | 206 |
| 288 | 3300013307 | Ga0157372_10063638 | Ga0157372_100636383 | 206 |
| 289 | 3300014497 | Ga0182008_10000225 | Ga0182008_100002253 | 206 |
| 290 | 3300014497 | Ga0182008_10012137 | Ga0182008_100121373 | 206 |
| 291 | 3300014497 | Ga0182008_10028802 | Ga0182008_100288023 | 206 |
| 292 | 3300014497 | Ga0182008_10056970 | Ga0182008_100569701 | 206 |
| 293 | 3300014497 | Ga0182008_10236266 | Ga0182008_102362661 | 206 |
| 294 | 3300015261 | Ga0182006_1004254 | Ga0182006_10042543 | 206 |
| 295 | 3300015262 | Ga0182007_10002590 | Ga0182007_1000259010 | 206 |
| 296 | 3300015262 | Ga0182007_10005032 | Ga0182007_100050328 | 206 |
| 297 | 3300015265 | Ga0182005_1013873 | Ga0182005_10138733 | 206 |
| 298 | 3300015683 | Ga0183362_10005 | Ga0183362_10005335 | 206 |
| 299 | 3300017792 | Ga0163161_10000114 | Ga0163161_1000011443 | 206 |
| 300 | 3300017792 | Ga0163161_10094488 | Ga0163161_100944882 | 206 |
| 301 | 3300017792 | Ga0163161_10251736 | Ga0163161_102517363 | 206 |
| 302 | 3300021361 | Ga0213872_10007360 | Ga0213872_100073603 | 206 |
| 303 | 3300025206 | Ga0209435_100003 | Ga0209435_100003453 | 206 |
| 304 | 3300025208 | Ga0209436_101911 | Ga0209436_1019119 | 206 |
| 305 | 3300025208 | Ga0209436_106926 | Ga0209436_1069262 | 206 |
| 306 | 3300025208 | Ga0209436_120781 | Ga0209436_1207812 | 206 |
| 307 | 3300025228 | Ga0209672_100477 | Ga0209672_10047712 | 206 |
| 308 | 3300025229 | Ga0209147_101499 | Ga0209147_1014999 | 206 |
| 309 | 3300025242 | Ga0209258_100568 | Ga0209258_10056824 | 206 |
| 310 | 3300025245 | Ga0207425_1000069 | Ga0207425_100006993 | 206 |
| 311 | 3300025245 | Ga0207425_1001640 | Ga0207425_10016409 | 206 |
| 312 | 3300025245 | Ga0207425_1013877 | Ga0207425_10138772 | 206 |
| 313 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008453 | 206 |
| 314 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007453 | 206 |
| 315 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033106 | 206 |
| 316 | 3300025256 | Ga0209759_1000019 | Ga0209759_1000019174 | 206 |
| 317 | 3300025258 | Ga0209129_1000233 | Ga0209129_100023372 | 206 |
| 318 | 3300025258 | Ga0209129_1001859 | Ga0209129_10018593 | 206 |
| 319 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020382 | 206 |
| 320 | 3300025263 | Ga0209565_1000116 | Ga0209565_100011650 | 206 |
| 321 | 3300025263 | Ga0209565_1000171 | Ga0209565_100017172 | 206 |
| 322 | 3300025263 | Ga0209565_1000883 | Ga0209565_10008832 | 206 |
| 323 | 3300025263 | Ga0209565_1003079 | Ga0209565_10030795 | 206 |
| 324 | 3300025273 | Ga0209673_1000295 | Ga0209673_100029576 | 206 |
| 325 | 3300025273 | Ga0209673_1000301 | Ga0209673_100030151 | 206 |
| 326 | 3300025273 | Ga0209673_1000305 | Ga0209673_100030587 | 206 |
| 327 | 3300025273 | Ga0209673_1006536 | Ga0209673_10065363 | 206 |
| 328 | 3300025273 | Ga0209673_1007324 | Ga0209673_10073245 | 206 |
| 329 | 3300025273 | Ga0209673_1055071 | Ga0209673_10550712 | 206 |
| 330 | 3300025284 | Ga0209130_1000095 | Ga0209130_1000095116 | 206 |
| 331 | 3300025284 | Ga0209130_1000134 | Ga0209130_100013449 | 206 |
| 332 | 3300025284 | Ga0209130_1000193 | Ga0209130_100019339 | 206 |
| 333 | 3300025284 | Ga0209130_1000366 | Ga0209130_100036650 | 206 |
| 334 | 3300025284 | Ga0209130_1001843 | Ga0209130_100184310 | 206 |
| 335 | 3300025284 | Ga0209130_1011467 | Ga0209130_10114671 | 206 |
| 336 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014371 | 206 |
| 337 | 3300025291 | Ga0209675_1000249 | Ga0209675_100024918 | 206 |
| 338 | 3300025291 | Ga0209675_1000582 | Ga0209675_100058211 | 206 |
| 339 | 3300025291 | Ga0209675_1000599 | Ga0209675_10005992 | 206 |
| 340 | 3300025291 | Ga0209675_1002239 | Ga0209675_10022392 | 206 |
| 341 | 3300025291 | Ga0209675_1006897 | Ga0209675_10068972 | 206 |
| 342 | 3300025291 | Ga0209675_1011341 | Ga0209675_10113412 | 206 |
| 343 | 3300025291 | Ga0209675_1064714 | Ga0209675_10647141 | 206 |
| 344 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048223 | 206 |
| 345 | 3300025292 | Ga0209676_1000098 | Ga0209676_100009840 | 206 |
| 346 | 3300025292 | Ga0209676_1000123 | Ga0209676_100012329 | 206 |
| 347 | 3300025292 | Ga0209676_1000145 | Ga0209676_100014598 | 206 |
| 348 | 3300025292 | Ga0209676_1002365 | Ga0209676_100236510 | 206 |
| 349 | 3300025292 | Ga0209676_1015599 | Ga0209676_10155993 | 206 |
| 350 | 3300025292 | Ga0209676_1028023 | Ga0209676_10280232 | 206 |
| 351 | 3300025292 | Ga0209676_1039314 | Ga0209676_10393143 | 206 |
| 352 | 3300025294 | Ga0209025_1000204 | Ga0209025_100020467 | 206 |
| 353 | 3300025294 | Ga0209025_1000264 | Ga0209025_100026472 | 206 |
| 354 | 3300025294 | Ga0209025_1000348 | Ga0209025_100034825 | 206 |
| 355 | 3300025294 | Ga0209025_1002608 | Ga0209025_100260820 | 206 |
| 356 | 3300025294 | Ga0209025_1002728 | Ga0209025_100272820 | 206 |
| 357 | 3300025294 | Ga0209025_1005823 | Ga0209025_10058237 | 206 |
| 358 | 3300025294 | Ga0209025_1009284 | Ga0209025_10092849 | 206 |
| 359 | 3300025294 | Ga0209025_1021401 | Ga0209025_10214012 | 206 |
| 360 | 3300025294 | Ga0209025_1037201 | Ga0209025_10372012 | 206 |
| 361 | 3300025295 | Ga0209564_1000231 | Ga0209564_100023172 | 206 |
| 362 | 3300025295 | Ga0209564_1000728 | Ga0209564_100072832 | 206 |
| 363 | 3300025295 | Ga0209564_1001669 | Ga0209564_100166924 | 206 |
| 364 | 3300025295 | Ga0209564_1012287 | Ga0209564_10122873 | 206 |
| 365 | 3300025295 | Ga0209564_1037145 | Ga0209564_10371453 | 206 |
| 366 | 3300025297 | Ga0209758_1000222 | Ga0209758_100022272 | 206 |
| 367 | 3300025297 | Ga0209758_1014048 | Ga0209758_10140482 | 206 |
| 368 | 3300025297 | Ga0209758_1063264 | Ga0209758_10632642 | 206 |
| 369 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012223 | 206 |
| 370 | 3300025298 | Ga0209050_1000023 | Ga0209050_100002379 | 206 |
| 371 | 3300025298 | Ga0209050_1001339 | Ga0209050_10013399 | 206 |
| 372 | 3300025298 | Ga0209050_1001596 | Ga0209050_10015964 | 206 |
| 373 | 3300025298 | Ga0209050_1002459 | Ga0209050_100245917 | 206 |
| 374 | 3300025298 | Ga0209050_1003820 | Ga0209050_100382012 | 206 |
| 375 | 3300025298 | Ga0209050_1025288 | Ga0209050_10252882 | 206 |
| 376 | 3300025298 | Ga0209050_1029263 | Ga0209050_10292632 | 206 |
| 377 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003813 | 206 |
| 378 | 3300025299 | Ga0209256_1000095 | Ga0209256_100009564 | 206 |
| 379 | 3300025299 | Ga0209256_1000284 | Ga0209256_100028450 | 206 |
| 380 | 3300025299 | Ga0209256_1031770 | Ga0209256_10317703 | 206 |
| 381 | 3300025302 | Ga0207426_1000058 | Ga0207426_100005830 | 206 |
| 382 | 3300025302 | Ga0207426_1000349 | Ga0207426_100034939 | 206 |
| 383 | 3300025302 | Ga0207426_1000397 | Ga0207426_100039742 | 206 |
| 384 | 3300025302 | Ga0207426_1000618 | Ga0207426_10006186 | 206 |
| 385 | 3300025302 | Ga0207426_1055373 | Ga0207426_10553731 | 206 |
| 386 | 3300025303 | Ga0209051_1000017 | Ga0209051_100001779 | 206 |
| 387 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019142 | 206 |
| 388 | 3300025303 | Ga0209051_1000091 | Ga0209051_100009129 | 206 |
| 389 | 3300025303 | Ga0209051_1000098 | Ga0209051_100009840 | 206 |
| 390 | 3300025303 | Ga0209051_1000099 | Ga0209051_100009974 | 206 |
| 391 | 3300025303 | Ga0209051_1000342 | Ga0209051_100034227 | 206 |
| 392 | 3300025303 | Ga0209051_1018603 | Ga0209051_10186032 | 206 |
| 393 | 3300025303 | Ga0209051_1020469 | Ga0209051_10204693 | 206 |
| 394 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024169 | 206 |
| 395 | 3300025304 | Ga0209257_1000041 | Ga0209257_100004179 | 206 |
| 396 | 3300025304 | Ga0209257_1000276 | Ga0209257_10002762 | 206 |
| 397 | 3300025304 | Ga0209257_1000497 | Ga0209257_100049733 | 206 |
| 398 | 3300025304 | Ga0209257_1000546 | Ga0209257_100054692 | 206 |
| 399 | 3300025304 | Ga0209257_1006622 | Ga0209257_10066224 | 206 |
| 400 | 3300025711 | Ga0207696_1009335 | Ga0207696_10093353 | 206 |
| 401 | 3300025728 | Ga0207655_1004280 | Ga0207655_10042803 | 206 |
| 402 | 3300025909 | Ga0207705_10065445 | Ga0207705_100654453 | 206 |
| 403 | 3300025909 | Ga0207705_10079722 | Ga0207705_100797222 | 206 |
| 404 | 3300025914 | Ga0207671_10162740 | Ga0207671_101627402 | 206 |
| 405 | 3300025917 | Ga0207660_10123091 | Ga0207660_101230911 | 206 |
| 406 | 3300025919 | Ga0207657_10009594 | Ga0207657_100095942 | 206 |
| 407 | 3300025923 | Ga0207681_10103927 | Ga0207681_101039271 | 206 |
| 408 | 3300025924 | Ga0207694_10219477 | Ga0207694_102194773 | 206 |
| 409 | 3300025925 | Ga0207650_10032708 | Ga0207650_100327082 | 206 |
| 410 | 3300025925 | Ga0207650_10625124 | Ga0207650_106251241 | 206 |
| 411 | 3300025926 | Ga0207659_10327313 | Ga0207659_103273132 | 206 |
| 412 | 3300025927 | Ga0207687_10154572 | Ga0207687_101545722 | 206 |
| 413 | 3300025927 | Ga0207687_10245676 | Ga0207687_102456762 | 206 |
| 414 | 3300025933 | Ga0207706_10347491 | Ga0207706_103474913 | 206 |
| 415 | 3300025934 | Ga0207686_10149209 | Ga0207686_101492093 | 206 |
| 416 | 3300025935 | Ga0207709_10000244 | Ga0207709_1000024413 | 206 |
| 417 | 3300025935 | Ga0207709_10000331 | Ga0207709_1000033128 | 206 |
| 418 | 3300025935 | Ga0207709_10000464 | Ga0207709_1000046425 | 206 |
| 419 | 3300025935 | Ga0207709_10059077 | Ga0207709_100590772 | 206 |
| 420 | 3300025935 | Ga0207709_10415126 | Ga0207709_104151262 | 206 |
| 421 | 3300025945 | Ga0207679_10012391 | Ga0207679_100123917 | 206 |
| 422 | 3300025949 | Ga0207667_10081950 | Ga0207667_100819502 | 206 |
| 423 | 3300025949 | Ga0207667_10838994 | Ga0207667_108389941 | 206 |
| 424 | 3300025949 | Ga0207667_10957653 | Ga0207667_109576532 | 206 |
| 425 | 3300025960 | Ga0207651_10141191 | Ga0207651_101411912 | 206 |
| 426 | 3300025972 | Ga0207668_10212017 | Ga0207668_102120172 | 206 |
| 427 | 3300026023 | Ga0207677_10020670 | Ga0207677_100206703 | 206 |
| 428 | 3300026041 | Ga0207639_10043606 | Ga0207639_100436063 | 206 |
| 429 | 3300026041 | Ga0207639_10206175 | Ga0207639_102061752 | 206 |
| 430 | 3300026041 | Ga0207639_10861708 | Ga0207639_108617082 | 206 |
| 431 | 3300026078 | Ga0207702_10260046 | Ga0207702_102600462 | 206 |
| 432 | 3300026078 | Ga0207702_11240859 | Ga0207702_112408591 | 206 |
| 433 | 3300026088 | Ga0207641_10260934 | Ga0207641_102609342 | 206 |
| 434 | 3300026095 | Ga0207676_10019562 | Ga0207676_100195625 | 206 |
| 435 | 3300026116 | Ga0207674_10272954 | Ga0207674_102729543 | 206 |
| 436 | 3300026116 | Ga0207674_10323136 | Ga0207674_103231362 | 206 |
| 437 | 3300026118 | Ga0207675_100427103 | Ga0207675_1004271032 | 206 |
| 438 | 3300026121 | Ga0207683_10014305 | Ga0207683_100143052 | 206 |
| 439 | 3300026121 | Ga0207683_10096305 | Ga0207683_100963052 | 206 |
| 440 | 3300026142 | Ga0207698_10579988 | Ga0207698_105799882 | 206 |
| 441 | 3300026142 | Ga0207698_10583558 | Ga0207698_105835582 | 206 |
| 442 | 3300027111 | Ga0209281_1000002 | Ga0209281_10000021238 | 206 |
| 443 | 3300027252 | Ga0209973_1000067 | Ga0209973_10000673 | 206 |
| 444 | 3300027360 | Ga0209969_1015987 | Ga0209969_10159872 | 206 |
| 445 | 3300027552 | Ga0209982_1023872 | Ga0209982_10238722 | 206 |
| 446 | 3300027614 | Ga0209970_1003961 | Ga0209970_10039612 | 206 |
| 447 | 3300027614 | Ga0209970_1023275 | Ga0209970_10232752 | 206 |
| 448 | 3300027666 | Ga0209282_1018266 | Ga0209282_10182663 | 206 |
| 449 | 3300027682 | Ga0209971_1003849 | Ga0209971_10038493 | 206 |
| 450 | 3300027876 | Ga0209974_10002399 | Ga0209974_100023997 | 206 |
| 451 | 3300027876 | Ga0209974_10008078 | Ga0209974_100080783 | 206 |
| 452 | 3300027876 | Ga0209974_10039642 | Ga0209974_100396423 | 206 |
| 453 | 3300027907 | Ga0207428_10046728 | Ga0207428_100467283 | 206 |
| 454 | 3300028379 | Ga0268266_10040433 | Ga0268266_100404333 | 206 |
| 455 | 3300028379 | Ga0268266_10357843 | Ga0268266_103578432 | 206 |
| 456 | 3300028380 | Ga0268265_10030005 | Ga0268265_100300053 | 206 |
| 457 | 3300028794 | Ga0307515_10000040 | Ga0307515_10000040143 | 206 |
| 458 | 3300028794 | Ga0307515_10000213 | Ga0307515_10000213115 | 206 |
| 459 | 3300028794 | Ga0307515_10155384 | Ga0307515_101553842 | 206 |
| 460 | 3300028794 | Ga0307515_10169485 | Ga0307515_101694853 | 206 |
| 461 | 3300028800 | Ga0265338_10359040 | Ga0265338_103590402 | 206 |
| 462 | 3300030731 | Ga0316177_1024879 | Ga0316177_10248792 | 206 |
| 463 | 3300030733 | Ga0314311_1113039 | Ga0314311_11130393 | 206 |
| 464 | 3300030734 | Ga0316179_1109004 | Ga0316179_11090049 | 206 |
| 465 | 3300030735 | Ga0316178_1145172 | Ga0316178_11451723 | 206 |
| 466 | 3300030736 | Ga0316180_1167845 | Ga0316180_11678453 | 206 |
| 467 | 3300030742 | Ga0316183_1086557 | Ga0316183_108655712 | 206 |
| 468 | 3300030744 | Ga0316181_1115636 | Ga0316181_11156363 | 206 |
| 469 | 3300030745 | Ga0316182_1187259 | Ga0316182_11872592 | 206 |
| 470 | 3300031235 | Ga0265330_10000022 | Ga0265330_1000002224 | 206 |
| 471 | 3300031235 | Ga0265330_10008061 | Ga0265330_100080615 | 206 |
| 472 | 3300031238 | Ga0265332_10000001 | Ga0265332_10000001533 | 206 |
| 473 | 3300031238 | Ga0265332_10000005 | Ga0265332_10000005262 | 206 |
| 474 | 3300031238 | Ga0265332_10235486 | Ga0265332_102354861 | 206 |
| 475 | 3300031251 | Ga0265327_10000746 | Ga0265327_1000074610 | 206 |
| 476 | 3300031344 | Ga0265316_10146729 | Ga0265316_101467292 | 206 |
| 477 | 3300031456 | Ga0307513_10000113 | Ga0307513_1000011331 | 206 |
| 478 | 3300031456 | Ga0307513_10005571 | Ga0307513_1000557111 | 206 |
| 479 | 3300031456 | Ga0307513_10092847 | Ga0307513_100928473 | 206 |
| 480 | 3300031456 | Ga0307513_10299091 | Ga0307513_102990912 | 206 |
| 481 | 3300031456 | Ga0307513_10375889 | Ga0307513_103758892 | 206 |
| 482 | 3300031548 | Ga0307408_100000101 | Ga0307408_10000010165 | 206 |
| 483 | 3300031548 | Ga0307408_100268127 | Ga0307408_1002681272 | 206 |
| 484 | 3300031548 | Ga0307408_100578773 | Ga0307408_1005787731 | 206 |
| 485 | 3300031548 | Ga0307408_100587786 | Ga0307408_1005877862 | 206 |
| 486 | 3300031649 | Ga0307514_10008104 | Ga0307514_1000810410 | 206 |
| 487 | 3300031711 | Ga0265314_10000013 | Ga0265314_10000013284 | 206 |
| 488 | 3300031711 | Ga0265314_10006062 | Ga0265314_100060628 | 206 |
| 489 | 3300031711 | Ga0265314_10013920 | Ga0265314_100139206 | 206 |
| 490 | 3300031730 | Ga0307516_10006023 | Ga0307516_1000602313 | 206 |
| 491 | 3300031731 | Ga0307405_10005856 | Ga0307405_100058567 | 206 |
| 492 | 3300031731 | Ga0307405_10123707 | Ga0307405_101237072 | 206 |
| 493 | 3300031731 | Ga0307405_10314599 | Ga0307405_103145992 | 206 |
| 494 | 3300031731 | Ga0307405_10360699 | Ga0307405_103606992 | 206 |
| 495 | 3300031824 | Ga0307413_10186773 | Ga0307413_101867732 | 206 |
| 496 | 3300031901 | Ga0307406_10000497 | Ga0307406_100004972 | 206 |
| 497 | 3300031901 | Ga0307406_10048612 | Ga0307406_100486123 | 206 |
| 498 | 3300031901 | Ga0307406_10075767 | Ga0307406_100757672 | 206 |
| 499 | 3300031901 | Ga0307406_10167341 | Ga0307406_101673412 | 206 |
| 500 | 3300031911 | Ga0307412_10083258 | Ga0307412_100832583 | 206 |
| 501 | 3300031911 | Ga0307412_10256774 | Ga0307412_102567742 | 206 |
| 502 | 3300031911 | Ga0307412_10739866 | Ga0307412_107398661 | 206 |
| 503 | 3300031911 | Ga0307412_10744320 | Ga0307412_107443202 | 206 |
| 504 | 3300032002 | Ga0307416_100050999 | Ga0307416_1000509993 | 206 |
| 505 | 3300032002 | Ga0307416_100078224 | Ga0307416_1000782242 | 206 |
| 506 | 3300032002 | Ga0307416_100310432 | Ga0307416_1003104322 | 206 |
| 507 | 3300032002 | Ga0307416_100334652 | Ga0307416_1003346521 | 206 |
| 508 | 3300032002 | Ga0307416_100753437 | Ga0307416_1007534372 | 206 |
| 509 | 3300032002 | Ga0307416_100901522 | Ga0307416_1009015222 | 206 |
| 510 | 3300032004 | Ga0307414_10005833 | Ga0307414_100058334 | 206 |
| 511 | 3300032005 | Ga0307411_10178326 | Ga0307411_101783263 | 206 |
| 512 | 3300032005 | Ga0307411_10679177 | Ga0307411_106791771 | 206 |
| 513 | 3300035171 | Ga0373946_0124176 | Ga0373946_0124176_47_667 | 206 |
| 514 | 3300035172 | Ga0373955_0314262 | Ga0373955_0314262_45_665 | 206 |
| 515 | 3300035691 | Ga0373931_0027422 | Ga0373931_0027422_102_722 | 206 |
| 516 | 3300035691 | Ga0373931_0136460 | Ga0373931_0136460_775_1395 | 206 |
| 517 | 3300037312 | Ga0395899_0001018 | Ga0395899_0001018_13760_14380 | 206 |
| 518 | 3300037312 | Ga0395899_0058267 | Ga0395899_0058267_44_664 | 206 |
| 519 | 3300037418 | Ga0395900_0006133 | Ga0395900_0006133_10734_11354 | 206 |
| 520 | 3300037418 | Ga0395900_0030913 | Ga0395900_0030913_511_1131 | 206 |
| 521 | 3300037418 | Ga0395900_0049698 | Ga0395900_0049698_333_953 | 206 |
| 522 | 3300037418 | Ga0395900_0156907 | Ga0395900_0156907_984_1604 | 206 |
| 523 | 3300037418 | Ga0395900_0177793 | Ga0395900_0177793_670_1290 | 206 |
| 524 | 3300037418 | Ga0395900_0668570 | Ga0395900_0668570_121_741 | 206 |
| 525 | 3300037418 | Ga0395900_1023606 | Ga0395900_1023606_12_632 | 206 |
| 526 | 3300037466 | Ga0395898_0006763 | Ga0395898_0006763_10928_11548 | 206 |
| 527 | 3300037466 | Ga0395898_0123537 | Ga0395898_0123537_325_945 | 206 |
| 528 | 3300037471 | Ga0395905_0002817 | Ga0395905_0002817_6181_6801 | 206 |
| 529 | 3300037471 | Ga0395905_0004508 | Ga0395905_0004508_11017_11637 | 206 |
| 530 | 3300037471 | Ga0395905_0009367 | Ga0395905_0009367_7490_8110 | 206 |
| 531 | 3300037471 | Ga0395905_0029999 | Ga0395905_0029999_721_1341 | 206 |
| 532 | 3300037471 | Ga0395905_0038724 | Ga0395905_0038724_1429_2049 | 206 |
| 533 | 3300037471 | Ga0395905_0059562 | Ga0395905_0059562_139_759 | 206 |
| 534 | 3300037471 | Ga0395905_0160158 | Ga0395905_0160158_1346_1966 | 206 |
| 535 | 3300037471 | Ga0395905_0172646 | Ga0395905_0172646_110_730 | 206 |
| 536 | 3300037471 | Ga0395905_0393831 | Ga0395905_0393831_104_724 | 206 |
| 537 | 3300037471 | Ga0395905_0635677 | Ga0395905_0635677_12_632 | 206 |
| 538 | 3300037471 | Ga0395905_0644099 | Ga0395905_0644099_16_636 | 206 |
| 539 | 3300038443 | Ga0395901_0074018 | Ga0395901_0074018_1838_2458 | 206 |
| 540 | 3300038443 | Ga0395901_0121176 | Ga0395901_0121176_1004_1624 | 206 |
| 541 | 3300039437 | Ga0436365_0775088 | Ga0436365_0775088_305_925 | 206 |
| 542 | 3300039447 | Ga0436361_0021397 | Ga0436361_0021397_18310_18930 | 206 |
| 543 | 3300041404 | Ga0439436_0001099 | Ga0439436_0001099_3528_4148 | 206 |
| 544 | 3300041406 | Ga0439439_0058647 | Ga0439439_0058647_199_819 | 206 |
| 545 | 3300041407 | Ga0439447_016871 | Ga0439447_016871_630_1250 | 206 |
| 546 | 3300041410 | Ga0439461_0009606 | Ga0439461_0009606_144_764 | 206 |
| 547 | 3300041411 | Ga0439466_0003182 | Ga0439466_0003182_571_1191 | 206 |
| 548 | 3300041411 | Ga0439466_0053882 | Ga0439466_0053882_23_643 | 206 |
| 549 | 3300041413 | Ga0439465_0026578 | Ga0439465_0026578_1071_1691 | 206 |
| 550 | 3300041458 | Ga0451798_0612806 | Ga0451798_0612806_70_690 | 206 |
| 551 | 3300041494 | Ga0451837_0249136 | Ga0451837_0249136_83_703 | 206 |
| 552 | 3300041997 | Ga0439431_0000218 | Ga0439431_0000218_8724_9344 | 206 |
| 553 | 3300041999 | Ga0439433_0002090 | Ga0439433_0002090_2873_3493 | 206 |
| 554 | 3300041999 | Ga0439433_0009872 | Ga0439433_0009872_193_813 | 206 |
| 555 | 3300042002 | Ga0439442_002873 | Ga0439442_002873_1198_1818 | 206 |
| 556 | 3300042004 | Ga0439445_0003096 | Ga0439445_0003096_1609_2229 | 206 |
| 557 | 3300042004 | Ga0439445_0021426 | Ga0439445_0021426_430_1050 | 206 |
| 558 | 3300042006 | Ga0439432_004550 | Ga0439432_004550_1558_2178 | 206 |
| 559 | 3300042007 | Ga0439449_0000120 | Ga0439449_0000120_21207_21827 | 206 |
| 560 | 3300042007 | Ga0439449_0001556 | Ga0439449_0001556_407_1027 | 206 |
| 561 | 3300042007 | Ga0439449_0003368 | Ga0439449_0003368_1446_2066 | 206 |
| 562 | 3300042007 | Ga0439449_0045082 | Ga0439449_0045082_64_684 | 206 |
| 563 | 3300042010 | Ga0439452_001002 | Ga0439452_001002_9925_10545 | 206 |
| 564 | 3300042010 | Ga0439452_008558 | Ga0439452_008558_870_1490 | 206 |
| 565 | 3300042014 | Ga0439457_005319 | Ga0439457_005319_1210_1830 | 206 |
| 566 | 3300042015 | Ga0439462_0001389 | Ga0439462_0001389_3401_4021 | 206 |
| 567 | 3300042015 | Ga0439462_0006207 | Ga0439462_0006207_129_749 | 206 |
| 568 | 3300042016 | Ga0439463_062467 | Ga0439463_062467_160_780 | 206 |
| 569 | 3300042115 | Ga0450911_001767 | Ga0450911_001767_3644_4264 | 206 |
| 570 | 3300042125 | Ga0450923_000492 | Ga0450923_000492_2390_3010 | 206 |
| 571 | 3300042125 | Ga0450923_007168 | Ga0450923_007168_95_715 | 206 |
| 572 | 3300042127 | Ga0450890_004537 | Ga0450890_004537_987_1607 | 206 |
| 573 | 3300042128 | Ga0450897_000328 | Ga0450897_000328_1631_2251 | 206 |
| 574 | 3300042134 | Ga0450898_004589 | Ga0450898_004589_53_673 | 206 |
| 575 | 3300042138 | Ga0450903_010922 | Ga0450903_010922_464_1084 | 206 |
| 576 | 3300042145 | Ga0450906_006638 | Ga0450906_006638_1481_2101 | 206 |
| 577 | 3300042147 | Ga0450910_007034 | Ga0450910_007034_154_774 | 206 |
| 578 | 3300042156 | Ga0439446_0017255 | Ga0439446_0017255_525_1145 | 206 |
| 579 | 3300042156 | Ga0439446_0073973 | Ga0439446_0073973_222_842 | 206 |
| 580 | 3300042184 | Ga0450908_016735 | Ga0450908_016735_102_722 | 206 |
| 581 | 3300042435 | Ga0439434_0014899 | Ga0439434_0014899_331_951 | 206 |
| 582 | 3300042532 | Ga0450893_0044338 | Ga0450893_0044338_20_640 | 206 |
| 583 | 3300042876 | Ga0451577_0010826 | Ga0451577_0010826_953_1573 | 206 |
| 584 | 3300042876 | Ga0451577_0021172 | Ga0451577_0021172_143_793 | 206 |
| 585 | 3300042876 | Ga0451577_0103510 | Ga0451577_0103510_381_1001 | 206 |
| 586 | 3300044656 | Ga0466969_0007544 | Ga0466969_0007544_1617_2237 | 206 |
| 587 | 3300044673 | Ga0453683_0003686 | Ga0453683_0003686_8758_9378 | 206 |
| 588 | 3300044683 | Ga0466965_0024297 | Ga0466965_0024297_1170_1790 | 206 |
| 589 | 3300044683 | Ga0466965_0073083 | Ga0466965_0073083_596_1216 | 206 |
| 590 | 3300044684 | Ga0466966_0012868 | Ga0466966_0012868_3846_4466 | 206 |
| 591 | 3300044693 | Ga0466961_0006061 | Ga0466961_0006061_4767_5387 | 206 |
| 592 | 3300044712 | Ga0453684_0598960 | Ga0453684_0598960_539_1159 | 206 |
| 593 | 3300044765 | Ga0466970_0031303 | Ga0466970_0031303_1250_1870 | 206 |
| 594 | 3300044842 | Ga0466957_0231453 | Ga0466957_0231453_505_1125 | 206 |
| 595 | 3300044901 | Ga0466960_0203963 | Ga0466960_0203963_430_1050 | 206 |
| 596 | 3300044901 | Ga0466960_0256796 | Ga0466960_0256796_21_641 | 206 |
| 597 | 3300045049 | Ga0466959_0158765 | Ga0466959_0158765_667_1287 | 206 |
| 598 | 3300045051 | Ga0451576_0004840 | Ga0451576_0004840_5313_5933 | 206 |
| 599 | 3300045051 | Ga0451576_0058688 | Ga0451576_0058688_1923_2543 | 206 |
| 600 | 3300045051 | Ga0451576_0629380 | Ga0451576_0629380_261_881 | 206 |
| 601 | 3300045051 | Ga0451576_0985937 | Ga0451576_0985937_62_682 | 206 |
| 602 | 3300045836 | Ga0466958_0203965 | Ga0466958_0203965_55_675 | 206 |
| 603 | 3300045976 | Ga0466967_0529224 | Ga0466967_0529224_214_834 | 206 |
| 604 | 3300046453 | Ga0495627_015780 | Ga0495627_015780_1499_2137 | 206 |
| 605 | 3300046453 | Ga0495627_022000 | Ga0495627_022000_53_673 | 206 |
| 606 | 3300046459 | Ga0495629_0275228 | Ga0495629_0275228_148_768 | 206 |
| 607 | 3300046471 | Ga0495650_0047253 | Ga0495650_0047253_23_643 | 206 |
| 608 | 3300046475 | Ga0495639_0041351 | Ga0495639_0041351_559_1179 | 206 |
| 609 | 3300046512 | Ga0495610_0017743 | Ga0495610_0017743_973_1593 | 206 |
| 610 | 3300046513 | Ga0495616_0003735 | Ga0495616_0003735_7169_7789 | 206 |
| 611 | 3300046515 | Ga0495620_0240230 | Ga0495620_0240230_30_668 | 206 |
| 612 | 3300046517 | Ga0495630_0334861 | Ga0495630_0334861_144_764 | 206 |
| 613 | 3300046518 | Ga0495631_0000163 | Ga0495631_0000163_43355_43993 | 206 |
| 614 | 3300046520 | Ga0495637_0010636 | Ga0495637_0010636_495_1115 | 206 |
| 615 | 3300046522 | Ga0495643_0062287 | Ga0495643_0062287_767_1387 | 206 |
| 616 | 3300046525 | Ga0495663_0008194 | Ga0495663_0008194_996_1616 | 206 |
| 617 | 3300046525 | Ga0495663_0098668 | Ga0495663_0098668_282_920 | 206 |
| 618 | 3300046528 | Ga0495642_0022614 | Ga0495642_0022614_472_1092 | 206 |
| 619 | 3300046528 | Ga0495642_0042286 | Ga0495642_0042286_360_980 | 206 |
| 620 | 3300046530 | Ga0495654_0022444 | Ga0495654_0022444_1438_2058 | 206 |
| 621 | 3300046530 | Ga0495654_0042235 | Ga0495654_0042235_1330_1950 | 206 |
| 622 | 3300046530 | Ga0495654_0143264 | Ga0495654_0143264_248_868 | 206 |
| 623 | 3300046539 | Ga0495621_0061262 | Ga0495621_0061262_518_1156 | 206 |
| 624 | 3300046542 | Ga0495597_0000024 | Ga0495597_0000024_137919_138539 | 206 |
| 625 | 3300046558 | Ga0495633_0000305 | Ga0495633_0000305_1325_1963 | 206 |
| 626 | 3300046558 | Ga0495633_0056740 | Ga0495633_0056740_749_1369 | 206 |
| 627 | 3300046615 | Ga0495656_0032151 | Ga0495656_0032151_243_863 | 206 |
| 628 | 3300046615 | Ga0495656_0046422 | Ga0495656_0046422_186_806 | 206 |
| 629 | 3300046616 | Ga0495668_0159362 | Ga0495668_0159362_173_811 | 206 |
| 630 | 3300046660 | Ga0495625_0000045 | Ga0495625_0000045_137597_138217 | 206 |
| 631 | 3300046660 | Ga0495625_0022634 | Ga0495625_0022634_1969_2589 | 206 |
| 632 | 3300046660 | Ga0495625_0096944 | Ga0495625_0096944_1159_1797 | 206 |
| 633 | 3300046663 | Ga0495635_0180403 | Ga0495635_0180403_311_931 | 206 |
| 634 | 3300046674 | Ga0495588_0063114 | Ga0495588_0063114_323_943 | 206 |
| 635 | 3300046674 | Ga0495588_0136848 | Ga0495588_0136848_263_883 | 206 |
| 636 | 3300046674 | Ga0495588_0176096 | Ga0495588_0176096_424_1044 | 206 |
| 637 | 3300046683 | Ga0495658_0043478 | Ga0495658_0043478_458_1078 | 206 |
| 638 | 3300046683 | Ga0495658_0116710 | Ga0495658_0116710_930_1550 | 206 |
| 639 | 3300046683 | Ga0495658_0258992 | Ga0495658_0258992_208_846 | 206 |
| 640 | 3300046684 | Ga0495669_0014099 | Ga0495669_0014099_957_1577 | 206 |
| 641 | 3300046690 | Ga0495624_0086432 | Ga0495624_0086432_1141_1761 | 206 |
| 642 | 3300046692 | Ga0495671_0030456 | Ga0495671_0030456_734_1372 | 206 |
| 643 | 3300047447 | Ga0495685_013506 | Ga0495685_013506_454_1074 | 206 |
| 644 | 3300047470 | Ga0495681_0140824 | Ga0495681_0140824_131_751 | 206 |
| 645 | 3300047673 | Ga0495593_0002104 | Ga0495593_0002104_4650_5270 | 206 |
| 646 | 3300047673 | Ga0495593_0149658 | Ga0495593_0149658_504_1124 | 206 |
| 647 | 3300048089 | Ga0495614_0020186 | Ga0495614_0020186_782_1402 | 206 |
| 648 | 3300048904 | Ga0496101_0002871 | Ga0496101_0002871_7041_7661 | 206 |
| 649 | 3300048904 | Ga0496101_0119954 | Ga0496101_0119954_1174_1794 | 206 |
| 650 | 3300048905 | Ga0496102_0003824 | Ga0496102_0003824_11563_12183 | 206 |
| 651 | 3300048906 | Ga0496103_0162596 | Ga0496103_0162596_280_900 | 206 |
| 652 | 3300048907 | Ga0496104_0018497 | Ga0496104_0018497_832_1452 | 206 |
| 653 | 3300048908 | Ga0496105_0002730 | Ga0496105_0002730_8690_9310 | 206 |
| 654 | 3300048909 | Ga0496106_0012008 | Ga0496106_0012008_2656_3276 | 206 |
| 655 | 3300048912 | Ga0496109_0140704 | Ga0496109_0140704_1240_1860 | 206 |
| 656 | 3300048913 | Ga0496110_0083819 | Ga0496110_0083819_634_1254 | 206 |
| 657 | 3300048914 | Ga0496111_0294772 | Ga0496111_0294772_214_834 | 206 |
| 658 | 3300048915 | Ga0496112_0965172 | Ga0496112_0965172_17_637 | 206 |
| 659 | 3300048919 | Ga0496116_0093641 | Ga0496116_0093641_1095_1715 | 206 |
| 660 | 3300048919 | Ga0496116_0105176 | Ga0496116_0105176_61_681 | 206 |
| 661 | 3300048920 | Ga0496117_0029279 | Ga0496117_0029279_2981_3601 | 206 |
| 662 | 3300048920 | Ga0496117_0114439 | Ga0496117_0114439_204_824 | 206 |
| 663 | 3300048920 | Ga0496117_0347496 | Ga0496117_0347496_104_724 | 206 |
| 664 | 3300048921 | Ga0496118_0007557 | Ga0496118_0007557_271_891 | 206 |
| 665 | 3300048921 | Ga0496118_0057870 | Ga0496118_0057870_1033_1653 | 206 |
| 666 | 3300048924 | Ga0496121_0023232 | Ga0496121_0023232_1087_1707 | 206 |
| 667 | 3300048925 | Ga0496122_0000331 | Ga0496122_0000331_49963_50583 | 206 |
| 668 | 3300048925 | Ga0496122_0076122 | Ga0496122_0076122_303_923 | 206 |
| 669 | 3300048926 | Ga0496123_0000124 | Ga0496123_0000124_13232_13852 | 206 |
| 670 | 3300048926 | Ga0496123_0056696 | Ga0496123_0056696_387_1007 | 206 |
| 671 | 3300048926 | Ga0496123_0065327 | Ga0496123_0065327_1291_1911 | 206 |
| 672 | 3300048926 | Ga0496123_0084147 | Ga0496123_0084147_740_1360 | 206 |
| 673 | 3300048926 | Ga0496123_0140086 | Ga0496123_0140086_613_1242 | 206 |
| 674 | 3300048927 | Ga0496124_0041767 | Ga0496124_0041767_2269_2889 | 206 |
| 675 | 3300048927 | Ga0496124_0088951 | Ga0496124_0088951_301_921 | 206 |
| 676 | 3300048927 | Ga0496124_0096092 | Ga0496124_0096092_1367_1987 | 206 |
| 677 | 3300048928 | Ga0496125_0000522 | Ga0496125_0000522_54200_54820 | 206 |
| 678 | 3300048928 | Ga0496125_0008570 | Ga0496125_0008570_786_1406 | 206 |
| 679 | 3300048928 | Ga0496125_0010233 | Ga0496125_0010233_4556_5176 | 206 |
| 680 | 3300048928 | Ga0496125_0024515 | Ga0496125_0024515_1582_2202 | 206 |
| 681 | 3300048928 | Ga0496125_0053052 | Ga0496125_0053052_672_1292 | 206 |
| 682 | 3300048928 | Ga0496125_0055567 | Ga0496125_0055567_1986_2624 | 206 |
| 683 | 3300048928 | Ga0496125_0085350 | Ga0496125_0085350_1400_2047 | 206 |
| 684 | 3300048928 | Ga0496125_0109704 | Ga0496125_0109704_686_1306 | 206 |
| 685 | 3300048929 | Ga0496126_0043356 | Ga0496126_0043356_970_1590 | 206 |
| 686 | 3300048929 | Ga0496126_0077296 | Ga0496126_0077296_42_662 | 206 |
| 687 | 3300048929 | Ga0496126_0086157 | Ga0496126_0086157_2054_2674 | 206 |
| 688 | 3300049130 | Ga0501310_012752 | Ga0501310_012752_232_852 | 206 |
| 689 | 3300049568 | Ga0501031_0008183 | Ga0501031_0008183_1626_2255 | 206 |
| 690 | 3300049570 | Ga0501033_0350124 | Ga0501033_0350124_383_1003 | 206 |
| 691 | 3300049571 | Ga0501034_0315662 | Ga0501034_0315662_53_673 | 206 |
| 692 | 3300049571 | Ga0501034_0451146 | Ga0501034_0451146_55_675 | 206 |
| 693 | 3300049572 | Ga0501036_0388512 | Ga0501036_0388512_206_826 | 206 |
| 694 | 3300049579 | Ga0501043_0228209 | Ga0501043_0228209_611_1231 | 206 |
| 695 | 3300049579 | Ga0501043_0317600 | Ga0501043_0317600_67_687 | 206 |
| 696 | 3300049580 | Ga0501046_0065033 | Ga0501046_0065033_187_807 | 206 |
| 697 | 3300049581 | Ga0501047_0592282 | Ga0501047_0592282_55_675 | 206 |
| 698 | 3300049583 | Ga0501067_0380650 | Ga0501067_0380650_10_630 | 206 |
| 699 | 3300049589 | Ga0501073_0360247 | Ga0501073_0360247_238_858 | 206 |
| 700 | 3300049663 | Ga0501223_043704 | Ga0501223_043704_93_713 | 206 |
| 701 | 3300049679 | Ga0501249_002817 | Ga0501249_002817_1573_2193 | 206 |
| 702 | 3300049705 | Ga0501225_0028728 | Ga0501225_0028728_473_1093 | 206 |
| 703 | 3300049742 | Ga0501080_0046276 | Ga0501080_0046276_507_1127 | 206 |
| 704 | 3300049759 | Ga0501262_000738 | Ga0501262_000738_1508_2128 | 206 |
| 705 | 3300049763 | Ga0501266_021566 | Ga0501266_021566_171_791 | 206 |
| 706 | 3300049822 | Ga0501035_0200756 | Ga0501035_0200756_876_1496 | 206 |
| 707 | 3300049822 | Ga0501035_0294754 | Ga0501035_0294754_585_1205 | 206 |
| 708 | 3300049823 | Ga0501044_0124106 | Ga0501044_0124106_1334_1954 | 206 |
| 709 | 3300049823 | Ga0501044_0682827 | Ga0501044_0682827_29_649 | 206 |
| 710 | 3300050489 | nmdc:mga03683_126211_c1 | nmdc:mga03683_126211_c1_152_772 | 206 |
| 711 | 3300050489 | nmdc:mga03683_127146_c1 | nmdc:mga03683_127146_c1_67_687 | 206 |
| 712 | 3300050489 | nmdc:mga03683_19660_c1 | nmdc:mga03683_19660_c1_1472_2092 | 206 |
| 713 | 3300050489 | nmdc:mga03683_29659_c1 | nmdc:mga03683_29659_c1_629_1249 | 206 |
| 714 | 3300050490 | nmdc:mga03n38_14244_c1 | nmdc:mga03n38_14244_c1_1065_1685 | 206 |
| 715 | 3300050490 | nmdc:mga03n38_204876_c1 | nmdc:mga03n38_204876_c1_308_928 | 206 |
| 716 | 3300050490 | nmdc:mga03n38_243523_c1 | nmdc:mga03n38_243523_c1_198_818 | 206 |
| 717 | 3300050491 | nmdc:mga00v17_3326_c1 | nmdc:mga00v17_3326_c1_1041_1661 | 206 |
| 718 | 3300050491 | nmdc:mga00v17_499356_c1 | nmdc:mga00v17_499356_c1_113_733 | 206 |
| 719 | 3300050492 | nmdc:mga0yw44_26196_c1 | nmdc:mga0yw44_26196_c1_2548_3168 | 206 |
| 720 | 3300050492 | nmdc:mga0yw44_34273_c1 | nmdc:mga0yw44_34273_c1_731_1351 | 206 |
| 721 | 3300050492 | nmdc:mga0yw44_404726_c1 | nmdc:mga0yw44_404726_c1_35_655 | 206 |
| 722 | 3300050493 | nmdc:mga0k408_213658_c1 | nmdc:mga0k408_213658_c1_155_775 | 206 |
| 723 | 3300050493 | nmdc:mga0k408_305474_c1 | nmdc:mga0k408_305474_c1_166_786 | 206 |
| 724 | 3300050493 | nmdc:mga0k408_422527_c1 | nmdc:mga0k408_422527_c1_153_773 | 206 |
| 725 | 3300050493 | nmdc:mga0k408_52363_c1 | nmdc:mga0k408_52363_c1_1335_1955 | 206 |
| 726 | 3300050493 | nmdc:mga0k408_738_c1 | nmdc:mga0k408_738_c1_3326_3946 | 206 |
| 727 | 3300050493 | nmdc:mga0k408_92167_c1 | nmdc:mga0k408_92167_c1_98_718 | 206 |
| 728 | 3300050494 | nmdc:mga06z11_163388_c1 | nmdc:mga06z11_163388_c1_620_1240 | 206 |
| 729 | 3300050495 | nmdc:mga04h51_56225_c1 | nmdc:mga04h51_56225_c1_186_806 | 206 |
| 730 | 3300050496 | nmdc:mga07m45_120095_c1 | nmdc:mga07m45_120095_c1_375_995 | 206 |
| 731 | 3300050496 | nmdc:mga07m45_145660_c1 | nmdc:mga07m45_145660_c1_627_1247 | 206 |
| 732 | 3300050496 | nmdc:mga07m45_22907_c1 | nmdc:mga07m45_22907_c1_1424_2044 | 206 |
| 733 | 3300050496 | nmdc:mga07m45_283_c1 | nmdc:mga07m45_283_c1_18697_19317 | 206 |
| 734 | 3300050496 | nmdc:mga07m45_317061_c1 | nmdc:mga07m45_317061_c1_156_776 | 206 |
| 735 | 3300050496 | nmdc:mga07m45_70512_c1 | nmdc:mga07m45_70512_c1_691_1311 | 206 |
| 736 | 3300050516 | nmdc:mga0sz30_255246_c1 | nmdc:mga0sz30_255246_c1_47_667 | 206 |
| 737 | 3300053079 | Ga0500610_0042474 | Ga0500610_0042474_556_1194 | 206 |
| 738 | 3300053080 | Ga0500635_0180315 | Ga0500635_0180315_84_704 | 206 |
| 739 | 3300053087 | Ga0500643_018032 | Ga0500643_018032_1093_1731 | 206 |
| 740 | 3300053088 | Ga0500644_0001842 | Ga0500644_0001842_3670_4290 | 206 |
| 741 | 3300053088 | Ga0500644_0009713 | Ga0500644_0009713_689_1309 | 206 |
| 742 | 3300053092 | Ga0500583_0171344 | Ga0500583_0171344_323_943 | 206 |
| 743 | 3300053093 | Ga0500651_0000560 | Ga0500651_0000560_15128_15748 | 206 |
| 744 | 3300053094 | Ga0500566_0098880 | Ga0500566_0098880_778_1398 | 206 |
| 745 | 3300053098 | Ga0500650_0216580 | Ga0500650_0216580_63_683 | 206 |
| 746 | 3300053103 | Ga0500555_098708 | Ga0500555_098708_42_680 | 206 |
| 747 | 3300053108 | Ga0500562_034163 | Ga0500562_034163_215_835 | 206 |
| 748 | 3300053110 | Ga0500571_000133 | Ga0500571_000133_22944_23564 | 206 |
| 749 | 3300053116 | Ga0500592_005679 | Ga0500592_005679_339_977 | 206 |
| 750 | 3300053117 | Ga0500593_000065 | Ga0500593_000065_18033_18653 | 206 |
| 751 | 3300053117 | Ga0500593_016801 | Ga0500593_016801_950_1588 | 206 |
| 752 | 3300053118 | Ga0500594_0002530 | Ga0500594_0002530_1725_2363 | 206 |
| 753 | 3300053120 | Ga0500597_083739 | Ga0500597_083739_81_701 | 206 |
| 754 | 3300053121 | Ga0500607_000674 | Ga0500607_000674_31776_32414 | 206 |
| 755 | 3300053133 | Ga0500655_001239 | Ga0500655_001239_61_681 | 206 |
| 756 | 3300053134 | Ga0500658_0134915 | Ga0500658_0134915_391_1011 | 206 |
| 757 | 3300053136 | Ga0500559_0000975 | Ga0500559_0000975_16337_16957 | 206 |
| 758 | 3300053136 | Ga0500559_0201170 | Ga0500559_0201170_137_757 | 206 |
| 759 | 3300053138 | Ga0500564_097741 | Ga0500564_097741_123_743 | 206 |
| 760 | 3300053139 | Ga0500568_0014612 | Ga0500568_0014612_1158_1778 | 206 |
| 761 | 3300053141 | Ga0500574_078088 | Ga0500574_078088_64_684 | 206 |
| 762 | 3300053153 | Ga0500616_0009752 | Ga0500616_0009752_1813_2433 | 206 |
| 763 | 3300053156 | Ga0500622_0202202 | Ga0500622_0202202_178_798 | 206 |
| 764 | 3300053157 | Ga0500624_010138 | Ga0500624_010138_183_803 | 206 |
| 765 | 3300053158 | Ga0500627_0001528 | Ga0500627_0001528_728_1366 | 206 |
| 766 | 3300053161 | Ga0500634_0018009 | Ga0500634_0018009_1476_2114 | 206 |
| 767 | 3300053177 | Ga0500636_0072585 | Ga0500636_0072585_123_743 | 206 |
| 768 | 3300053730 | Ga0500645_086468 | Ga0500645_086468_80_700 | 206 |
| 769 | 3300053730 | Ga0500645_087961 | Ga0500645_087961_49_687 | 206 |
| 770 | 3300059424 | Ga0590075_026524 | Ga0590075_026524_819_1439 | 206 |
| 771 | iso_pu_bacteria | 2831265667 | 2831268089 | 206 |
| 772 | iso_pu_bacteria | 2885198086 | 2885203148 | 206 |
| 773 | iso_pu_bacteria | 2885211737 | 2885216455 | 206 |
| 774 | iso_pu_bacteria | 2928037797 | 2928041072 | 206 |
| 775 | iso_pu_bacteria | 2928044640 | 2928047914 | 206 |
| 776 | iso_pu_bacteria | 2928051484 | 2928055809 | 206 |
| 777 | iso_pu_bacteria | 2928070936 | 2928075223 | 206 |
| 778 | iso_pu_bacteria | 2939631187 | 2939631406 | 206 |
| 779 | iso_pu_bacteria | 2945909444 | 2945909935 | 206 |
| 780 | iso_pu_bacteria | 2945984333 | 2945988104 | 206 |
| 781 | iso_pu_bacteria | 2954767861 | 2954768960 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yki-assembly1.cif.gz_A | crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide | 0.9592 | 36 | 85 |
| 2f3t-assembly1.cif.gz_C | crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate | 0.955 | 4 | 204 |
| 2f3t-assembly1.cif.gz_C | crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate | 0.9411 | 4 | 204 |
| 2anc-assembly1.cif.gz_F | crystal structure of unliganded form of oligomeric e.coli guanylate kinase | 0.9309 | 4 | 203 |
| 1z8f-assembly1.cif.gz_A | guanylate kinase double mutant a58c, t157c from mycobacterium tuberculosis (rv1389) | 0.9273 | 4 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q94JM2_119_167_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9985 | 36 | 83 | 3.30.63.10 |
| 1s96B02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9893 | 36 | 95 | 3.30.63.10 |
| af_Q2QPW1_160_210_3.30.63.10 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9755 | 36 | 85 | 3.30.63.10 |
| 1s96B02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9731 | 36 | 95 | 3.30.63.10 |
| 1s4qA02 | Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain | 0.9653 | 36 | 95 | 3.30.63.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q12DV7-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9703 | 1 | 206 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A2M8DQ33-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9669 | 3 | 182 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A350H9Q1-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9649 | 1 | 185 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A0Q7CNE3-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9622 | 1 | 206 |
GO:0004385
GO:0005524 GO:0005829 |
| AF-A0A6J4I1N2-F1-model_v4 | Guanylate kinase (EC 2.7.4.8) (GMP kinase) | 0.9621 | 1 | 189 |
GO:0004385
GO:0005524 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar