F480544

General Info

Members Datasets Scaffolds Average Seq Length
781 424 719 206

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10012424|JGI24739J22299_100124242
Length 216
Sequence MTTTTKTSERMDYPGNIFVVAAPSGAGKSSLVKALMELDSAVQPSVSHTTRSPRGQEKHGREYFFASPTEFDAMIAADGFVEWAHVHGHRYGTSKKAVEDRIAQGADVILEIDFQGALQIRKTFANAVMIFILPPSWEELRSRLERRGEDSASVIELRLKNAAEEMAQAGQFDFVIINELFERALFDLKAIVHAQRLRYSAQRRARADTFAALNIP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221570 Acidovorax sp. Root568 Isolate Unclassified
10 2643221596 Acidovorax sp. Root70 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
14 2643221652 Acidovorax sp. Root402 Isolate Unclassified
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2721755523 Delftia sp. HK171 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2818991446 Variovorax sp. 1180 Isolate Unclassified
27 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
30 2842677519 Variovorax sp. R-72495 Isolate Unclassified
31 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
32 2842733646 Variovorax sp. R-72446 Isolate Unclassified
33 2842747753 Variovorax sp. R-72060 Isolate Unclassified
34 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
35 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
36 2885198086 Variovorax sp. 679 Isolate Unclassified
37 2885211737 Variovorax sp. 553 Isolate Unclassified
38 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
39 2899924645 Variovorax sp. 369 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
43 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
44 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
45 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
46 2928037797 Variovorax sp. 1126 Isolate Unclassified
47 2928044640 Variovorax sp. 1128 Isolate Unclassified
48 2928051484 Variovorax sp. 1133 Isolate Unclassified
49 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
50 2928070936 Variovorax gossypii 1167 Isolate Unclassified
51 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
52 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
53 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
54 2929520902 Variovorax beijingensis 502 Isolate Unclassified
55 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
56 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
57 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
58 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
59 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
60 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
61 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
62 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
63 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
64 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
65 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
66 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
67 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
68 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
69 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
70 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
71 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
72 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
73 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
77 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
78 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
79 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
80 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
81 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
82 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
83 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
84 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
85 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
90 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
91 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
92 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
93 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
95 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
101 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
102 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
103 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
104 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
112 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
113 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
114 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
123 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
133 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
149 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
150 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
167 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
168 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
185 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
221 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
226 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
229 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
233 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
234 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
235 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
238 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
239 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
240 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
268 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
269 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
270 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
271 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
272 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
275 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
276 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
277 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
278 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
279 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
280 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
281 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
282 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
283 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
284 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
285 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
286 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
287 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
288 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
289 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
290 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
291 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
292 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
293 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
294 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
295 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
296 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
297 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
298 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
299 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
305 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
306 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
314 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
315 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
316 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
321 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
322 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
325 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
326 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
327 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
330 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
331 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
332 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
333 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
334 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
335 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
336 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
339 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
342 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
343 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
346 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
376 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
377 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
378 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
381 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
394 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
397 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
398 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
399 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
400 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
401 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
402 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
403 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
404 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
405 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
406 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
409 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
410 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
413 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
414 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
415 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
416 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
417 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
418 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
419 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
420 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
421 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
424 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.93
Metatranscriptomes 0.13
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.27
Nodule 0.64
Rhizoplane 2.18
Rhizosphere 53.27
Stem 0
Stem Tuber 0
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1208657 2162886007 Bacteria 956
2 JGI24740J21852_10007463 3300001979 Bacteria 4442
3 JGI24739J22299_10012424 3300001989 Bacteria 3127
4 JGI24739J22299_10052911 3300001989 Bacteria 1305
5 JGI25155J39150_1000085 3300002704 Bacteria 53417
6 JGI25156J39149_1000139 3300002705 Bacteria 53436
7 JGI25154J39366_1000154 3300002738 Bacteria 53436
8 JGI25158J39367_1010274 3300002739 Bacteria 1267
9 JGI25157J39369_1000181 3300002741 Bacteria 53436
10 JGI25152J39213_1004827 3300002773 Bacteria 4127
11 JGI25152J39213_1012417 3300002773 Bacteria 1828
12 JGI25150J39212_1003168 3300002774 Bacteria 3909
13 JGI25150J39212_1003655 3300002774 Bacteria 3568
14 JGI25150J39212_1004700 3300002774 Bacteria 3002
15 JGI25150J39212_1005571 3300002774 Bacteria 2675
16 JGI25159J45721_1000575 3300002987 Bacteria 16509
17 JGI25159J45721_1001104 3300002987 Bacteria 11520
18 JGI25159J45721_1008541 3300002987 Bacteria 2801
19 JGI25159J45721_1010488 3300002987 Bacteria 2355
20 JGI25159J45721_1021272 3300002987 Bacteria 1228
21 JGI25159J45721_1024325 3300002987 Bacteria 1080
22 JGI25151J46595_10001834 3300003187 Bacteria 13683
23 JGI25151J46595_10004515 3300003187 Bacteria 7347
24 JGI25151J46595_10007290 3300003187 Bacteria 5440
25 JGI25151J46595_10008309 3300003187 Bacteria 5001
26 JGI25151J46595_10023051 3300003187 Bacteria 2572
27 JGI25151J46595_10029761 3300003187 Bacteria 2156
28 JGI25153J46596_10008225 3300003215 Bacteria 5016
29 JGI25153J46596_10008252 3300003215 Bacteria 5001
30 rootH1_10044413 3300003316 Bacteria 1470
31 rootH1_10002122 3300003323 Bacteria 1893
32 rootH1_10058594 3300003323 Bacteria 1949
33 JGI25160J50197_1000129 3300003354 Bacteria 68068
34 JGI25160J50197_1005984 3300003354 Bacteria 4992
35 JGI25160J50197_1024715 3300003354 Bacteria 1698
36 JGI25161J50226_1000080 3300003374 Bacteria 79971
37 JGI25161J50226_1002297 3300003374 Bacteria 4986
38 Ga0055535_1000750 3300003761 Bacteria 24203
39 Ga0055542_1000583 3300003762 Bacteria 31637
40 Ga0055526_1015725 3300003771 Bacteria 3017
41 Ga0055526_1015747 3300003771 Bacteria 3014
42 Ga0055537_1000049 3300003773 Bacteria 87244
43 Ga0055537_1001823 3300003773 Bacteria 7717
44 Ga0055537_1003302 3300003773 Bacteria 5001
45 Ga0055537_1003310 3300003773 Bacteria 4994
46 Ga0055524_1000120 3300003775 Bacteria 91299
47 Ga0055524_1013849 3300003775 Bacteria 3017
48 Ga0055524_1013865 3300003775 Bacteria 3014
49 Ga0055536_1002156 3300003781 Bacteria 11218
50 Ga0055536_1002470 3300003781 Bacteria 10381
51 Ga0055536_1005584 3300003781 Bacteria 6099
52 Ga0055536_1009058 3300003781 Bacteria 4182
53 Ga0055536_1029492 3300003781 Bacteria 1473
54 Ga0055534_1000049 3300003784 Bacteria 92974
55 Ga0055534_1000343 3300003784 Bacteria 30091
56 Ga0055534_1001185 3300003784 Bacteria 10959
57 Ga0055534_1002822 3300003784 Bacteria 5797
58 Ga0055534_1003409 3300003784 Bacteria 5001
59 Ga0055528_1000623 3300003790 Bacteria 26273
60 Ga0055528_1007101 3300003790 Bacteria 5001
61 Ga0055528_1007116 3300003790 Bacteria 4994
62 Ga0055530_10001404 3300003791 Bacteria 17751
63 Ga0055530_10011762 3300003791 Bacteria 3111
64 Ga0055530_10017412 3300003791 Bacteria 2254
65 Ga0055540_1000067 3300003792 Bacteria 122108
66 Ga0055540_1000480 3300003792 Bacteria 30816
67 Ga0055540_1003384 3300003792 Bacteria 7728
68 Ga0055540_1004630 3300003792 Bacteria 6106
69 Ga0055540_1019477 3300003792 Bacteria 1825
70 Ga0055540_1033605 3300003792 Bacteria 1161
71 Ga0055531_10000034 3300003794 Bacteria 150210
72 Ga0055531_10000738 3300003794 Bacteria 27594
73 Ga0055531_10011804 3300003794 Bacteria 4170
74 Ga0055531_10017551 3300003794 Bacteria 3014
75 Ga0055531_10018250 3300003794 Bacteria 2907
76 Ga0055543_1000202 3300004625 Bacteria 48648
77 Ga0055543_1005905 3300004625 Bacteria 3051
78 Ga0055543_1006405 3300004625 Bacteria 2849
79 Ga0065165_1015225 3300005262 Bacteria 2943
80 Ga0065165_1027858 3300005262 Bacteria 1833
81 Ga0065714_10020441 3300005288 Bacteria 2421
82 Ga0065714_10096768 3300005288 Bacteria 1750
83 Ga0065704_10074991 3300005289 Bacteria 5864
84 Ga0065704_10091409 3300005289 Bacteria 2719
85 Ga0065704_10225657 3300005289 Bacteria 1059
86 Ga0065704_10230352 3300005289 Bacteria 1045
87 Ga0065707_10190962 3300005295 Bacteria 1343
88 Ga0070658_10067313 3300005327 Bacteria 2926
89 Ga0070658_10085691 3300005327 Bacteria 2591
90 Ga0070658_10459368 3300005327 Bacteria 1098
91 Ga0070676_10567991 3300005328 Bacteria 814
92 Ga0070670_100583674 3300005331 Bacteria 999
93 Ga0070670_100734809 3300005331 Bacteria 889
94 Ga0068869_100477178 3300005334 Bacteria 1038
95 Ga0070661_100982008 3300005344 Bacteria 700
96 Ga0070668_100225581 3300005347 Bacteria 1547
97 Ga0070668_100356478 3300005347 Bacteria 1239
98 Ga0070669_100161067 3300005353 Bacteria 1744
99 Ga0070675_100165430 3300005354 Bacteria 1905
100 Ga0070675_100427450 3300005354 Bacteria 1185
101 Ga0070674_100151075 3300005356 Bacteria 1753
102 Ga0070659_100227861 3300005366 Bacteria 1539
103 Ga0070667_100102296 3300005367 Bacteria 2475
104 Ga0070714_100043003 3300005435 Bacteria 3818
105 Ga0070678_100160771 3300005456 Bacteria 1819
106 Ga0070678_100226004 3300005456 Bacteria 1558
107 Ga0070662_100062742 3300005457 Bacteria 2716
108 Ga0070707_100109908 3300005468 Bacteria 2673
109 Ga0070699_100051375 3300005518 Bacteria 3568
110 Ga0068853_100032565 3300005539 Bacteria 4416
111 Ga0068853_100128401 3300005539 Bacteria 2267
112 Ga0068853_100990228 3300005539 Bacteria 809
113 Ga0068853_101068652 3300005539 Bacteria 778
114 Ga0070672_100256606 3300005543 Bacteria 1474
115 Ga0070672_100629341 3300005543 Bacteria 936
116 Ga0070693_100017394 3300005547 Bacteria 3737
117 Ga0070665_100033550 3300005548 Bacteria 5165
118 Ga0070665_100284408 3300005548 Bacteria 1656
119 Ga0068855_100004546 3300005563 Bacteria 16941
120 Ga0068855_100046799 3300005563 Bacteria 5113
121 Ga0068855_100276631 3300005563 Bacteria 1865
122 Ga0070664_100074593 3300005564 Bacteria 2912
123 Ga0068857_100227861 3300005577 Bacteria 1704
124 Ga0068856_100150449 3300005614 Bacteria 2337
125 Ga0068856_100375887 3300005614 Bacteria 1440
126 Ga0068859_100280526 3300005617 Bacteria 1759
127 Ga0068864_100021424 3300005618 Bacteria 5416
128 Ga0068851_10051418 3300005834 Bacteria 2094
129 Ga0068851_10257854 3300005834 Bacteria 991
130 Ga0068863_100279201 3300005841 Bacteria 1618
131 Ga0068862_100035693 3300005844 Bacteria 4213
132 Ga0068862_100278195 3300005844 Bacteria 1533
133 Ga0075365_10000296 3300006038 Bacteria 17289
134 Ga0075365_10658648 3300006038 Bacteria 740
135 Ga0075368_10048959 3300006042 Bacteria 1676
136 Ga0075368_10279720 3300006042 Bacteria 717
137 Ga0075363_100008947 3300006048 Bacteria 4688
138 Ga0075363_100047464 3300006048 Bacteria 2281
139 Ga0075363_100109222 3300006048 Bacteria 1536
140 Ga0075364_10004115 3300006051 Bacteria 8349
141 Ga0075364_10058479 3300006051 Bacteria 2526
142 Ga0075432_10009149 3300006058 Bacteria 3376
143 Ga0075432_10044150 3300006058 Bacteria 1562
144 Ga0075362_10008974 3300006177 Bacteria 3845
145 Ga0075362_10026548 3300006177 Bacteria 2475
146 Ga0075362_10098857 3300006177 Bacteria 1362
147 Ga0075367_10261552 3300006178 Bacteria 1086
148 Ga0075366_10003520 3300006195 Bacteria 8275
149 Ga0075366_10036281 3300006195 Bacteria 2906
150 Ga0075366_10066167 3300006195 Bacteria 2150
151 Ga0075366_10069482 3300006195 Bacteria 2096
152 Ga0097621_100412527 3300006237 Bacteria 1211
153 Ga0075370_10003918 3300006353 Bacteria 7144
154 Ga0075370_10013503 3300006353 Bacteria 4344
155 Ga0075370_10048867 3300006353 Bacteria 2397
156 Ga0075370_10135359 3300006353 Bacteria 1439
157 Ga0075370_10144711 3300006353 Bacteria 1391
158 Ga0075370_10237822 3300006353 Bacteria 1078
159 Ga0075430_100092876 3300006846 Bacteria 2522
160 Ga0097620_100280525 3300006931 Bacteria 1759
161 Ga0079104_1000003 3300006946 Bacteria 468966
162 Ga0105244_10016816 3300009036 Bacteria 4155
163 Ga0105244_10144859 3300009036 Bacteria 1141
164 Ga0105250_10001739 3300009092 Bacteria 11486
165 Ga0105240_10214478 3300009093 Bacteria 2247
166 Ga0105240_10626936 3300009093 Bacteria 1181
167 Ga0111539_11500683 3300009094 Bacteria 782
168 Ga0105245_10145029 3300009098 Bacteria 2239
169 Ga0105243_10001244 3300009148 Bacteria 22879
170 Ga0105243_10003162 3300009148 Bacteria 13505
171 Ga0105243_10062687 3300009148 Bacteria 2977
172 Ga0105243_10176906 3300009148 Bacteria 1853
173 Ga0105243_10858164 3300009148 Bacteria 900
174 Ga0105237_10136801 3300009545 Bacteria 2444
175 Ga0105237_10485238 3300009545 Bacteria 1242
176 Ga0105238_10049880 3300009551 Bacteria 4214
177 Ga0105238_10063487 3300009551 Bacteria 3694
178 Ga0105238_10809781 3300009551 Bacteria 952
179 Ga0105239_10665406 3300010375 Bacteria 1190
180 Ga0105246_10588438 3300011119 Bacteria 960
181 Ga0157347_1002693 3300012502 Bacteria 1544
182 Ga0157326_1002659 3300012513 Bacteria 1901
183 Ga0157373_10025215 3300013100 Bacteria 4303
184 Ga0157371_10038429 3300013102 Bacteria 3424
185 Ga0157370_10007822 3300013104 Bacteria 11582
186 Ga0157370_10441882 3300013104 Bacteria 1196
187 Ga0157369_10037367 3300013105 Bacteria 5316
188 Ga0157374_10581710 3300013296 Bacteria 1129
189 Ga0157374_10730989 3300013296 Bacteria 1004
190 Ga0157378_10599256 3300013297 Bacteria 1113
191 Ga0163162_10258502 3300013306 Bacteria 1873
192 Ga0157372_10063638 3300013307 Bacteria 4137
193 Ga0157380_10184459 3300014326 Bacteria 1836
194 Ga0182008_10000225 3300014497 Bacteria 44301
195 Ga0182008_10012137 3300014497 Bacteria 4556
196 Ga0182008_10028802 3300014497 Bacteria 2809
197 Ga0182008_10056970 3300014497 Bacteria 1930
198 Ga0182008_10236266 3300014497 Bacteria 939
199 Ga0182006_1004254 3300015261 Bacteria 7090
200 Ga0182007_10002590 3300015262 Bacteria 8902
201 Ga0182007_10005032 3300015262 Bacteria 5870
202 Ga0182005_1013873 3300015265 Bacteria 2263
203 Ga0183362_10005 3300015683 Bacteria 437616
204 Ga0163161_10000114 3300017792 Bacteria 76397
205 Ga0163161_10094488 3300017792 Bacteria 2217
206 Ga0163161_10251736 3300017792 Bacteria 1377
207 Ga0163161_10382323 3300017792 Bacteria 1125
208 Ga0213872_10007360 3300021361 Bacteria 5429
209 Ga0209435_100003 3300025206 Bacteria 669534
210 Ga0209436_101911 3300025208 Bacteria 6711
211 Ga0209436_106926 3300025208 Bacteria 2423
212 Ga0209436_120781 3300025208 Bacteria 879
213 Ga0209672_100477 3300025228 Bacteria 22499
214 Ga0209147_101499 3300025229 Bacteria 8245
215 Ga0209258_100568 3300025242 Bacteria 31666
216 Ga0207425_1000069 3300025245 Bacteria 120895
217 Ga0207425_1001640 3300025245 Bacteria 9021
218 Ga0207425_1013877 3300025245 Bacteria 1845
219 Ga0209646_1000008 3300025246 Bacteria 669534
220 Ga0209026_1000007 3300025250 Bacteria 669534
221 Ga0209148_1000033 3300025254 Bacteria 555508
222 Ga0209759_1000019 3300025256 Bacteria 357908
223 Ga0209129_1000233 3300025258 Bacteria 61174
224 Ga0209129_1001859 3300025258 Bacteria 11166
225 Ga0209565_1000020 3300025263 Bacteria 432627
226 Ga0209565_1000116 3300025263 Bacteria 114340
227 Ga0209565_1000171 3300025263 Bacteria 84566
228 Ga0209565_1000883 3300025263 Bacteria 16458
229 Ga0209565_1003079 3300025263 Bacteria 5601
230 Ga0209673_1000295 3300025273 Bacteria 92499
231 Ga0209673_1000301 3300025273 Bacteria 91435
232 Ga0209673_1000305 3300025273 Bacteria 91144
233 Ga0209673_1006536 3300025273 Bacteria 5601
234 Ga0209673_1007324 3300025273 Bacteria 5116
235 Ga0209673_1055071 3300025273 Bacteria 1027
236 Ga0209130_1000095 3300025284 Bacteria 145126
237 Ga0209130_1000134 3300025284 Bacteria 119102
238 Ga0209130_1000193 3300025284 Bacteria 84550
239 Ga0209130_1000366 3300025284 Bacteria 51201
240 Ga0209130_1001843 3300025284 Bacteria 12207
241 Ga0209130_1011467 3300025284 Bacteria 2371
242 Ga0209675_1000014 3300025291 Bacteria 421902
243 Ga0209675_1000249 3300025291 Bacteria 53443
244 Ga0209675_1000582 3300025291 Bacteria 26359
245 Ga0209675_1000599 3300025291 Bacteria 25864
246 Ga0209675_1002239 3300025291 Bacteria 10107
247 Ga0209675_1006897 3300025291 Bacteria 4465
248 Ga0209675_1011341 3300025291 Bacteria 2963
249 Ga0209675_1064714 3300025291 Bacteria 712
250 Ga0209676_1000048 3300025292 Bacteria 403716
251 Ga0209676_1000098 3300025292 Bacteria 234305
252 Ga0209676_1000123 3300025292 Bacteria 195351
253 Ga0209676_1000145 3300025292 Bacteria 174391
254 Ga0209676_1002365 3300025292 Bacteria 13576
255 Ga0209676_1015599 3300025292 Bacteria 2789
256 Ga0209676_1028023 3300025292 Bacteria 1762
257 Ga0209676_1039314 3300025292 Bacteria 1345
258 Ga0209025_1000204 3300025294 Bacteria 142193
259 Ga0209025_1000264 3300025294 Bacteria 123411
260 Ga0209025_1000348 3300025294 Bacteria 100228
261 Ga0209025_1002608 3300025294 Bacteria 18582
262 Ga0209025_1002728 3300025294 Bacteria 17919
263 Ga0209025_1005823 3300025294 Bacteria 9873
264 Ga0209025_1009284 3300025294 Bacteria 6886
265 Ga0209025_1021401 3300025294 Bacteria 3485
266 Ga0209025_1037201 3300025294 Bacteria 2163
267 Ga0209564_1000231 3300025295 Bacteria 123417
268 Ga0209564_1000728 3300025295 Bacteria 46991
269 Ga0209564_1001669 3300025295 Bacteria 21246
270 Ga0209564_1012287 3300025295 Bacteria 3746
271 Ga0209564_1037145 3300025295 Bacteria 1378
272 Ga0209758_1000222 3300025297 Bacteria 123411
273 Ga0209758_1014048 3300025297 Bacteria 4303
274 Ga0209758_1063264 3300025297 Bacteria 1206
275 Ga0209050_1000012 3300025298 Bacteria 813717
276 Ga0209050_1000023 3300025298 Bacteria 537172
277 Ga0209050_1001339 3300025298 Bacteria 27306
278 Ga0209050_1001596 3300025298 Bacteria 23431
279 Ga0209050_1002459 3300025298 Bacteria 15802
280 Ga0209050_1003820 3300025298 Bacteria 10747
281 Ga0209050_1025288 3300025298 Bacteria 2023
282 Ga0209050_1029263 3300025298 Bacteria 1766
283 Ga0209256_1000003 3300025299 Bacteria 1661127
284 Ga0209256_1000095 3300025299 Bacteria 206120
285 Ga0209256_1000284 3300025299 Bacteria 89178
286 Ga0209256_1031770 3300025299 Bacteria 1439
287 Ga0207426_1000058 3300025302 Bacteria 363857
288 Ga0207426_1000349 3300025302 Bacteria 84546
289 Ga0207426_1000397 3300025302 Bacteria 73966
290 Ga0207426_1000618 3300025302 Bacteria 45326
291 Ga0207426_1055373 3300025302 Bacteria 1162
292 Ga0209051_1000017 3300025303 Bacteria 537172
293 Ga0209051_1000019 3300025303 Bacteria 511268
294 Ga0209051_1000091 3300025303 Bacteria 173683
295 Ga0209051_1000098 3300025303 Bacteria 165284
296 Ga0209051_1000099 3300025303 Bacteria 165161
297 Ga0209051_1000342 3300025303 Bacteria 70022
298 Ga0209051_1018603 3300025303 Bacteria 3067
299 Ga0209051_1020469 3300025303 Bacteria 2848
300 Ga0209257_1000024 3300025304 Bacteria 726068
301 Ga0209257_1000041 3300025304 Bacteria 537172
302 Ga0209257_1000276 3300025304 Bacteria 116802
303 Ga0209257_1000497 3300025304 Bacteria 70185
304 Ga0209257_1000546 3300025304 Bacteria 64679
305 Ga0209257_1006622 3300025304 Bacteria 7372
306 Ga0207696_1009335 3300025711 Bacteria 3663
307 Ga0207655_1004280 3300025728 Bacteria 10209
308 Ga0207705_10065445 3300025909 Bacteria 2628
309 Ga0207705_10079722 3300025909 Bacteria 2385
310 Ga0207671_10162740 3300025914 Bacteria 1729
311 Ga0207660_10123091 3300025917 Bacteria 1966
312 Ga0207657_10009594 3300025919 Bacteria 9714
313 Ga0207681_10103927 3300025923 Bacteria 2054
314 Ga0207694_10219477 3300025924 Bacteria 1550
315 Ga0207650_10032708 3300025925 Bacteria 3763
316 Ga0207650_10625124 3300025925 Bacteria 907
317 Ga0207659_10327313 3300025926 Bacteria 1266
318 Ga0207687_10154572 3300025927 Bacteria 1754
319 Ga0207687_10245676 3300025927 Bacteria 1420
320 Ga0207706_10347491 3300025933 Bacteria 1290
321 Ga0207686_10149209 3300025934 Bacteria 1626
322 Ga0207709_10000244 3300025935 Bacteria 66920
323 Ga0207709_10000331 3300025935 Bacteria 50983
324 Ga0207709_10000464 3300025935 Bacteria 37316
325 Ga0207709_10059077 3300025935 Bacteria 2386
326 Ga0207709_10415126 3300025935 Bacteria 1032
327 Ga0207679_10012391 3300025945 Bacteria 5560
328 Ga0207667_10081950 3300025949 Bacteria 3342
329 Ga0207667_10838994 3300025949 Bacteria 914
330 Ga0207667_10957653 3300025949 Bacteria 845
331 Ga0207651_10141191 3300025960 Bacteria 1861
332 Ga0207651_10390888 3300025960 Bacteria 1181
333 Ga0207668_10212017 3300025972 Bacteria 1550
334 Ga0207658_10092183 3300025986 Bacteria 2353
335 Ga0207677_10020670 3300026023 Bacteria 4002
336 Ga0207639_10043606 3300026041 Bacteria 3369
337 Ga0207639_10206175 3300026041 Bacteria 1689
338 Ga0207639_10861708 3300026041 Bacteria 846
339 Ga0207708_10181400 3300026075 Bacteria 1672
340 Ga0207702_10260046 3300026078 Bacteria 1634
341 Ga0207702_11240859 3300026078 Bacteria 740
342 Ga0207641_10260934 3300026088 Bacteria 1622
343 Ga0207648_10062014 3300026089 Bacteria 3260
344 Ga0207676_10019562 3300026095 Bacteria 4942
345 Ga0207674_10272954 3300026116 Bacteria 1638
346 Ga0207674_10323136 3300026116 Bacteria 1492
347 Ga0207675_100427103 3300026118 Bacteria 1309
348 Ga0207683_10014305 3300026121 Bacteria 6760
349 Ga0207683_10096305 3300026121 Bacteria 2639
350 Ga0207698_10579988 3300026142 Bacteria 1103
351 Ga0207698_10583558 3300026142 Bacteria 1100
352 Ga0209281_1000002 3300027111 Bacteria 1924012
353 Ga0209973_1000067 3300027252 Bacteria 5559
354 Ga0209969_1015987 3300027360 Bacteria 1098
355 Ga0209982_1023872 3300027552 Bacteria 947
356 Ga0209970_1003961 3300027614 Bacteria 2472
357 Ga0209970_1023275 3300027614 Bacteria 1054
358 Ga0209282_1018266 3300027666 Bacteria 4451
359 Ga0209971_1003849 3300027682 Bacteria 3551
360 Ga0209974_10002399 3300027876 Bacteria 6794
361 Ga0209974_10008078 3300027876 Bacteria 3606
362 Ga0209974_10039642 3300027876 Bacteria 1567
363 Ga0207428_10046728 3300027907 Bacteria 3480
364 Ga0268266_10040433 3300028379 Bacteria 3974
365 Ga0268266_10315543 3300028379 Bacteria 1462
366 Ga0268266_10357843 3300028379 Bacteria 1373
367 Ga0268265_10030005 3300028380 Bacteria 3912
368 Ga0307515_10000040 3300028794 Bacteria 322704
369 Ga0307515_10000213 3300028794 Bacteria 142742
370 Ga0307515_10155384 3300028794 Bacteria 2364
371 Ga0307515_10169485 3300028794 Bacteria 2184
372 Ga0265338_10359040 3300028800 Bacteria 1046
373 Ga0316177_1024879 3300030731 Bacteria 969
374 Ga0314311_1113039 3300030733 Bacteria 2616
375 Ga0316179_1109004 3300030734 Bacteria 6166
376 Ga0316178_1145172 3300030735 Bacteria 2940
377 Ga0316180_1167845 3300030736 Bacteria 3040
378 Ga0316183_1086557 3300030742 Bacteria 14600
379 Ga0316181_1115636 3300030744 Bacteria 1540
380 Ga0316182_1187259 3300030745 Bacteria 2621
381 Ga0265330_10000022 3300031235 Bacteria 154198
382 Ga0265330_10008061 3300031235 Bacteria 5095
383 Ga0265332_10000001 3300031238 Bacteria 863783
384 Ga0265332_10000005 3300031238 Bacteria 377525
385 Ga0265332_10235486 3300031238 Bacteria 759
386 Ga0265327_10000746 3300031251 Bacteria 50605
387 Ga0265316_10146729 3300031344 Bacteria 1769
388 Ga0307513_10000113 3300031456 Bacteria 114576
389 Ga0307513_10005571 3300031456 Bacteria 16606
390 Ga0307513_10092847 3300031456 Bacteria 3070
391 Ga0307513_10299091 3300031456 Bacteria 1377
392 Ga0307513_10375889 3300031456 Bacteria 1162
393 Ga0307408_100000101 3300031548 Bacteria 94089
394 Ga0307408_100268127 3300031548 Bacteria 1416
395 Ga0307408_100467496 3300031548 Bacteria 1097
396 Ga0307408_100578773 3300031548 Bacteria 994
397 Ga0307408_100587786 3300031548 Bacteria 987
398 Ga0307514_10008104 3300031649 Bacteria 8984
399 Ga0265314_10000013 3300031711 Bacteria 403405
400 Ga0265314_10006062 3300031711 Bacteria 10751
401 Ga0265314_10013920 3300031711 Bacteria 6471
402 Ga0307516_10006023 3300031730 Bacteria 14334
403 Ga0307405_10005856 3300031731 Bacteria 5985
404 Ga0307405_10123707 3300031731 Bacteria 1775
405 Ga0307405_10314599 3300031731 Bacteria 1193
406 Ga0307405_10360699 3300031731 Bacteria 1124
407 Ga0307413_10186773 3300031824 Bacteria 1484
408 Ga0307406_10000497 3300031901 Bacteria 22565
409 Ga0307406_10048612 3300031901 Bacteria 2680
410 Ga0307406_10075767 3300031901 Bacteria 2220
411 Ga0307406_10167341 3300031901 Bacteria 1587
412 Ga0307406_10330303 3300031901 Bacteria 1183
413 Ga0307412_10083258 3300031911 Bacteria 2217
414 Ga0307412_10256774 3300031911 Bacteria 1360
415 Ga0307412_10739866 3300031911 Bacteria 848
416 Ga0307412_10744320 3300031911 Bacteria 845
417 Ga0307416_100050999 3300032002 Bacteria 3302
418 Ga0307416_100078224 3300032002 Bacteria 2782
419 Ga0307416_100310432 3300032002 Bacteria 1573
420 Ga0307416_100334652 3300032002 Bacteria 1523
421 Ga0307416_100753437 3300032002 Bacteria 1067
422 Ga0307416_100901522 3300032002 Bacteria 984
423 Ga0307414_10005833 3300032004 Bacteria 6810
424 Ga0307411_10178326 3300032005 Bacteria 1610
425 Ga0307411_10679177 3300032005 Bacteria 895
426 Ga0373946_0124176 3300035171 Bacteria 1181
427 Ga0373955_0314262 3300035172 Bacteria 946
428 Ga0373931_0027422 3300035691 Bacteria 2908
429 Ga0373931_0136460 3300035691 Bacteria 1417
430 Ga0395899_0001018 3300037312 Bacteria 25619
431 Ga0395899_0058267 3300037312 Bacteria 2849
432 Ga0395900_0006133 3300037418 Bacteria 12539
433 Ga0395900_0030913 3300037418 Bacteria 5499
434 Ga0395900_0049698 3300037418 Bacteria 4320
435 Ga0395900_0156907 3300037418 Bacteria 2324
436 Ga0395900_0177793 3300037418 Bacteria 2164
437 Ga0395900_0668570 3300037418 Bacteria 974
438 Ga0395900_1023606 3300037418 Bacteria 745
439 Ga0395898_0006763 3300037466 Bacteria 12209
440 Ga0395898_0123537 3300037466 Bacteria 2480
441 Ga0395905_0002817 3300037471 Bacteria 19057
442 Ga0395905_0004508 3300037471 Bacteria 14433
443 Ga0395905_0008661 3300037471 Bacteria 10021
444 Ga0395905_0009367 3300037471 Bacteria 9576
445 Ga0395905_0029999 3300037471 Bacteria 5125
446 Ga0395905_0038724 3300037471 Bacteria 4472
447 Ga0395905_0059562 3300037471 Bacteria 3569
448 Ga0395905_0160158 3300037471 Bacteria 2115
449 Ga0395905_0172646 3300037471 Bacteria 2030
450 Ga0395905_0325203 3300037471 Bacteria 1428
451 Ga0395905_0393831 3300037471 Bacteria 1280
452 Ga0395905_0635677 3300037471 Bacteria 969
453 Ga0395905_0644099 3300037471 Bacteria 961
454 Ga0395901_0074018 3300038443 Bacteria 3553
455 Ga0395901_0121176 3300038443 Bacteria 2749
456 Ga0395901_0504515 3300038443 Bacteria 1231
457 Ga0400489_59002 3300039093 Bacteria 1199
458 Ga0436365_0775088 3300039437 Bacteria 937
459 Ga0436361_0021397 3300039447 Bacteria 46447
460 Ga0439436_0001099 3300041404 Bacteria 7629
461 Ga0439439_0058647 3300041406 Bacteria 1019
462 Ga0439447_016871 3300041407 Bacteria 1997
463 Ga0439461_0009606 3300041410 Bacteria 1757
464 Ga0439466_0003182 3300041411 Bacteria 6388
465 Ga0439466_0053882 3300041411 Bacteria 1311
466 Ga0439465_0026578 3300041413 Bacteria 1831
467 Ga0451789_0807840 3300041443 Bacteria 789
468 Ga0451798_0612806 3300041458 Bacteria 1248
469 Ga0451837_0249136 3300041494 Bacteria 761
470 Ga0439431_0000218 3300041997 Bacteria 11553
471 Ga0439433_0002090 3300041999 Bacteria 4205
472 Ga0439433_0009872 3300041999 Bacteria 2084
473 Ga0439442_002873 3300042002 Bacteria 3394
474 Ga0439445_0003096 3300042004 Bacteria 3728
475 Ga0439445_0021426 3300042004 Bacteria 1623
476 Ga0439432_004550 3300042006 Bacteria 5059
477 Ga0439449_0000120 3300042007 Bacteria 25953
478 Ga0439449_0001556 3300042007 Bacteria 8984
479 Ga0439449_0003368 3300042007 Bacteria 6226
480 Ga0439449_0045082 3300042007 Bacteria 1635
481 Ga0439452_001002 3300042010 Bacteria 12538
482 Ga0439452_008558 3300042010 Bacteria 3070
483 Ga0439457_005319 3300042014 Bacteria 3254
484 Ga0439462_0001389 3300042015 Bacteria 5361
485 Ga0439462_0006207 3300042015 Bacteria 2964
486 Ga0439462_0010823 3300042015 Bacteria 2315
487 Ga0439463_062467 3300042016 Bacteria 952
488 Ga0450911_001767 3300042115 Bacteria 4646
489 Ga0450921_011460 3300042123 Bacteria 757
490 Ga0450923_000492 3300042125 Bacteria 4346
491 Ga0450923_007168 3300042125 Bacteria 1875
492 Ga0450923_042023 3300042125 Bacteria 963
493 Ga0450890_004537 3300042127 Bacteria 1812
494 Ga0450897_000328 3300042128 Bacteria 2534
495 Ga0450897_014079 3300042128 Bacteria 805
496 Ga0450898_004589 3300042134 Bacteria 2049
497 Ga0450903_010922 3300042138 Bacteria 1467
498 Ga0450906_006638 3300042145 Bacteria 2321
499 Ga0450910_007034 3300042147 Bacteria 1562
500 Ga0439446_0017255 3300042156 Bacteria 2016
501 Ga0439446_0026497 3300042156 Bacteria 1661
502 Ga0439446_0073973 3300042156 Bacteria 1046
503 Ga0450908_016735 3300042184 Bacteria 1306
504 Ga0450908_018645 3300042184 Bacteria 1225
505 Ga0439434_0014899 3300042435 Bacteria 2314
506 Ga0439434_0061187 3300042435 Bacteria 1177
507 Ga0439459_0006375 3300042438 Bacteria 1964
508 Ga0439464_0009630 3300042439 Bacteria 2545
509 Ga0450893_0044338 3300042532 Bacteria 821
510 Ga0450893_0046800 3300042532 Bacteria 803
511 Ga0451577_0001869 3300042876 Bacteria 26831
512 Ga0451577_0010826 3300042876 Bacteria 8669
513 Ga0451577_0021172 3300042876 Bacteria 5954
514 Ga0451577_0028125 3300042876 Bacteria 5087
515 Ga0451577_0103510 3300042876 Bacteria 2544
516 Ga0451577_0451523 3300042876 Bacteria 1167
517 Ga0451577_0472121 3300042876 Bacteria 1139
518 Ga0466969_0007544 3300044656 Bacteria 5782
519 Ga0453683_0003686 3300044673 Bacteria 11226
520 Ga0453683_0034464 3300044673 Bacteria 3191
521 Ga0466965_0024297 3300044683 Bacteria 2931
522 Ga0466965_0073083 3300044683 Bacteria 1726
523 Ga0466966_0012868 3300044684 Bacteria 5541
524 Ga0466961_0006061 3300044693 Bacteria 7664
525 Ga0453684_0411237 3300044712 Bacteria 1513
526 Ga0453684_0598960 3300044712 Bacteria 1208
527 Ga0466970_0031303 3300044765 Bacteria 2810
528 Ga0466957_0231453 3300044842 Bacteria 1223
529 Ga0466960_0203963 3300044901 Bacteria 1081
530 Ga0466960_0256796 3300044901 Bacteria 972
531 Ga0466959_0158765 3300045049 Bacteria 1590
532 Ga0451576_0004840 3300045051 Bacteria 17241
533 Ga0451576_0024858 3300045051 Bacteria 6462
534 Ga0451576_0056103 3300045051 Bacteria 4121
535 Ga0451576_0058688 3300045051 Bacteria 4020
536 Ga0451576_0629380 3300045051 Bacteria 1127
537 Ga0451576_0985937 3300045051 Bacteria 883
538 Ga0466958_0203965 3300045836 Bacteria 1259
539 Ga0466967_0529224 3300045976 Bacteria 1159
540 Ga0495627_015780 3300046453 Bacteria 2602
541 Ga0495627_022000 3300046453 Bacteria 2103
542 Ga0495629_0275228 3300046459 Bacteria 1156
543 Ga0495650_0047253 3300046471 Bacteria 1801
544 Ga0495639_0041351 3300046475 Bacteria 2076
545 Ga0495610_0017743 3300046512 Bacteria 4048
546 Ga0495616_0003735 3300046513 Bacteria 9714
547 Ga0495620_0240230 3300046515 Bacteria 691
548 Ga0495630_0334861 3300046517 Bacteria 1158
549 Ga0495631_0000163 3300046518 Bacteria 45348
550 Ga0495637_0010636 3300046520 Bacteria 4444
551 Ga0495643_0062287 3300046522 Bacteria 1975
552 Ga0495663_0008194 3300046525 Bacteria 2892
553 Ga0495663_0098668 3300046525 Bacteria 959
554 Ga0495642_0022614 3300046528 Bacteria 2478
555 Ga0495642_0042286 3300046528 Bacteria 1856
556 Ga0495654_0022444 3300046530 Bacteria 3277
557 Ga0495654_0042235 3300046530 Bacteria 2264
558 Ga0495654_0143264 3300046530 Bacteria 1063
559 Ga0495621_0000477 3300046539 Bacteria 9876
560 Ga0495621_0061262 3300046539 Bacteria 1366
561 Ga0495597_0000024 3300046542 Bacteria 143948
562 Ga0495633_0000305 3300046558 Bacteria 55923
563 Ga0495633_0056740 3300046558 Bacteria 1840
564 Ga0495656_0000163 3300046615 Bacteria 24459
565 Ga0495656_0032151 3300046615 Bacteria 2133
566 Ga0495656_0046422 3300046615 Bacteria 1838
567 Ga0495668_0159362 3300046616 Bacteria 1236
568 Ga0495625_0000045 3300046660 Bacteria 202475
569 Ga0495625_0022634 3300046660 Bacteria 4815
570 Ga0495625_0096944 3300046660 Bacteria 2030
571 Ga0495635_0180403 3300046663 Bacteria 1435
572 Ga0495588_0063114 3300046674 Bacteria 1920
573 Ga0495588_0136848 3300046674 Bacteria 1293
574 Ga0495588_0176096 3300046674 Bacteria 1130
575 Ga0495658_0043478 3300046683 Bacteria 2513
576 Ga0495658_0116710 3300046683 Bacteria 1610
577 Ga0495658_0258992 3300046683 Bacteria 1095
578 Ga0495669_0014099 3300046684 Bacteria 3416
579 Ga0495624_0086432 3300046690 Bacteria 1937
580 Ga0495671_0030456 3300046692 Bacteria 2763
581 Ga0495685_013506 3300047447 Bacteria 2772
582 Ga0495681_0059758 3300047470 Bacteria 1761
583 Ga0495681_0140824 3300047470 Bacteria 1019
584 Ga0495593_0002104 3300047673 Bacteria 11902
585 Ga0495593_0149658 3300047673 Bacteria 1181
586 Ga0495614_0020186 3300048089 Bacteria 2882
587 Ga0496101_0002871 3300048904 Bacteria 10597
588 Ga0496101_0119954 3300048904 Bacteria 1987
589 Ga0496102_0003824 3300048905 Bacteria 12732
590 Ga0496103_0162596 3300048906 Bacteria 1432
591 Ga0496104_0018497 3300048907 Bacteria 6357
592 Ga0496105_0002730 3300048908 Bacteria 12871
593 Ga0496106_0012008 3300048909 Bacteria 6391
594 Ga0496106_1275203 3300048909 Bacteria 571
595 Ga0496109_0140704 3300048912 Bacteria 2256
596 Ga0496110_0083819 3300048913 Bacteria 2844
597 Ga0496111_0294772 3300048914 Bacteria 1203
598 Ga0496112_0965172 3300048915 Bacteria 773
599 Ga0496116_0093641 3300048919 Bacteria 1818
600 Ga0496116_0105176 3300048919 Bacteria 1675
601 Ga0496117_0029279 3300048920 Bacteria 4248
602 Ga0496117_0114439 3300048920 Bacteria 1672
603 Ga0496117_0347496 3300048920 Bacteria 767
604 Ga0496118_0007557 3300048921 Bacteria 11476
605 Ga0496118_0057870 3300048921 Bacteria 2901
606 Ga0496121_0023232 3300048924 Bacteria 5980
607 Ga0496121_0320112 3300048924 Bacteria 1044
608 Ga0496122_0000331 3300048925 Bacteria 102617
609 Ga0496122_0076122 3300048925 Bacteria 2363
610 Ga0496123_0000124 3300048926 Bacteria 158327
611 Ga0496123_0056696 3300048926 Bacteria 2557
612 Ga0496123_0065327 3300048926 Bacteria 2313
613 Ga0496123_0084147 3300048926 Bacteria 1919
614 Ga0496123_0140086 3300048926 Bacteria 1324
615 Ga0496124_0041767 3300048927 Bacteria 3954
616 Ga0496124_0088951 3300048927 Bacteria 2523
617 Ga0496124_0096092 3300048927 Bacteria 2407
618 Ga0496125_0000522 3300048928 Bacteria 66680
619 Ga0496125_0008570 3300048928 Bacteria 10679
620 Ga0496125_0010233 3300048928 Bacteria 9502
621 Ga0496125_0024515 3300048928 Bacteria 5547
622 Ga0496125_0053052 3300048928 Bacteria 3328
623 Ga0496125_0055567 3300048928 Bacteria 3224
624 Ga0496125_0085350 3300048928 Bacteria 2392
625 Ga0496125_0109704 3300048928 Bacteria 2003
626 Ga0496126_0043356 3300048929 Bacteria 4150
627 Ga0496126_0077296 3300048929 Bacteria 2951
628 Ga0496126_0086157 3300048929 Bacteria 2769
629 Ga0501310_012752 3300049130 Bacteria 967
630 Ga0501031_0008183 3300049568 Bacteria 6805
631 Ga0501033_0350124 3300049570 Bacteria 1035
632 Ga0501034_0315662 3300049571 Bacteria 1496
633 Ga0501034_0451146 3300049571 Bacteria 1204
634 Ga0501036_0388512 3300049572 Bacteria 1164
635 Ga0501043_0228209 3300049579 Bacteria 1439
636 Ga0501043_0317600 3300049579 Bacteria 1188
637 Ga0501046_0065033 3300049580 Bacteria 2846
638 Ga0501047_0592282 3300049581 Bacteria 931
639 Ga0501067_0380650 3300049583 Bacteria 787
640 Ga0501073_0360247 3300049589 Bacteria 1004
641 Ga0501223_043704 3300049663 Bacteria 869
642 Ga0501249_002817 3300049679 Bacteria 3501
643 Ga0501257_060192 3300049686 Bacteria 959
644 Ga0501225_0028728 3300049705 Bacteria 1528
645 Ga0501080_0046276 3300049742 Bacteria 4051
646 Ga0501262_000738 3300049759 Bacteria 3771
647 Ga0501266_021566 3300049763 Bacteria 881
648 Ga0501035_0200756 3300049822 Bacteria 1710
649 Ga0501035_0294754 3300049822 Bacteria 1368
650 Ga0501044_0124106 3300049823 Bacteria 2580
651 Ga0501044_0682827 3300049823 Bacteria 913
652 nmdc:mga03683_126211_c1 3300050489 Bacteria 1141
653 nmdc:mga03683_127146_c1 3300050489 Bacteria 1138
654 nmdc:mga03683_19660_c1 3300050489 Bacteria 2581
655 nmdc:mga03683_29659_c1 3300050489 Bacteria 2182
656 nmdc:mga03n38_14244_c1 3300050490 Bacteria 3042
657 nmdc:mga03n38_204876_c1 3300050490 Bacteria 1023
658 nmdc:mga03n38_243523_c1 3300050490 Bacteria 947
659 nmdc:mga00v17_3326_c1 3300050491 Bacteria 8291
660 nmdc:mga00v17_499356_c1 3300050491 Bacteria 789
661 nmdc:mga0yw44_26196_c1 3300050492 Bacteria 3327
662 nmdc:mga0yw44_34273_c1 3300050492 Bacteria 2974
663 nmdc:mga0yw44_404726_c1 3300050492 Bacteria 923
664 nmdc:mga0k408_188983_c1 3300050493 Bacteria 1229
665 nmdc:mga0k408_213658_c1 3300050493 Bacteria 1152
666 nmdc:mga0k408_305474_c1 3300050493 Bacteria 949
667 nmdc:mga0k408_422527_c1 3300050493 Bacteria 792
668 nmdc:mga0k408_52363_c1 3300050493 Bacteria 2366
669 nmdc:mga0k408_738_c1 3300050493 Bacteria 8286
670 nmdc:mga0k408_92167_c1 3300050493 Bacteria 1781
671 nmdc:mga06z11_163388_c1 3300050494 Bacteria 1274
672 nmdc:mga04h51_56225_c1 3300050495 Bacteria 1335
673 nmdc:mga07m45_120095_c1 3300050496 Bacteria 1518
674 nmdc:mga07m45_145660_c1 3300050496 Bacteria 1373
675 nmdc:mga07m45_22907_c1 3300050496 Bacteria 3412
676 nmdc:mga07m45_283_c1 3300050496 Bacteria 20386
677 nmdc:mga07m45_317061_c1 3300050496 Bacteria 906
678 nmdc:mga07m45_70512_c1 3300050496 Bacteria 1988
679 nmdc:mga07m45_8102_c1 3300050496 Bacteria 5387
680 nmdc:mga0qj67_218259_c1 3300050509 Bacteria 1548
681 nmdc:mga0sz30_179706_c1 3300050516 Bacteria 939
682 nmdc:mga0sz30_255246_c1 3300050516 Bacteria 780
683 Ga0500610_0042474 3300053079 Bacteria 2352
684 Ga0500635_0180315 3300053080 Bacteria 816
685 Ga0500643_007054 3300053087 Bacteria 4605
686 Ga0500643_018032 3300053087 Bacteria 2351
687 Ga0500644_0001842 3300053088 Bacteria 5474
688 Ga0500644_0009713 3300053088 Bacteria 2583
689 Ga0500583_0171344 3300053092 Bacteria 1081
690 Ga0500651_0000560 3300053093 Bacteria 18911
691 Ga0500566_0098880 3300053094 Bacteria 1602
692 Ga0500650_0216580 3300053098 Bacteria 868
693 Ga0500555_098708 3300053103 Bacteria 744
694 Ga0500562_034163 3300053108 Bacteria 1344
695 Ga0500562_047595 3300053108 Bacteria 1145
696 Ga0500571_000133 3300053110 Bacteria 25072
697 Ga0500592_005679 3300053116 Bacteria 1985
698 Ga0500593_000065 3300053117 Bacteria 38993
699 Ga0500593_016801 3300053117 Bacteria 3174
700 Ga0500594_0002530 3300053118 Bacteria 3977
701 Ga0500597_083739 3300053120 Bacteria 1384
702 Ga0500607_000674 3300053121 Bacteria 32958
703 Ga0500655_001239 3300053133 Bacteria 4844
704 Ga0500658_0134915 3300053134 Bacteria 1103
705 Ga0500559_0000975 3300053136 Bacteria 17905
706 Ga0500559_0201170 3300053136 Bacteria 939
707 Ga0500564_097741 3300053138 Bacteria 1300
708 Ga0500568_0014612 3300053139 Bacteria 3539
709 Ga0500574_078088 3300053141 Bacteria 974
710 Ga0500616_0009752 3300053153 Bacteria 5802
711 Ga0500622_0202202 3300053156 Bacteria 903
712 Ga0500624_010138 3300053157 Bacteria 1352
713 Ga0500627_0001528 3300053158 Bacteria 6510
714 Ga0500634_0018009 3300053161 Bacteria 3788
715 Ga0500636_0072585 3300053177 Bacteria 1994
716 Ga0500645_086468 3300053730 Bacteria 891
717 Ga0500645_087961 3300053730 Bacteria 883
718 Ga0500661_014296 3300055283 Bacteria 1428
719 Ga0590075_026524 3300059424 Bacteria 1459

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_1275203 Ga0496106_1275203_30_557 175
2 3300041443 Ga0451789_0807840 Ga0451789_0807840_90_686 179
3 3300048924 Ga0496121_0320112 Ga0496121_0320112_487_1032 181
4 3300053108 Ga0500562_047595 Ga0500562_047595_587_1132 181
5 3300055283 Ga0500661_014296 Ga0500661_014296_871_1416 181
6 iso_pu_bacteria 2904541872 2904545229 181
7 3300044712 Ga0453684_0411237 Ga0453684_0411237_878_1447 185
8 3300005347 Ga0070668_100225581 Ga0070668_1002255812 187
9 3300005518 Ga0070699_100051375 Ga0070699_1000513754 187
10 3300006042 Ga0075368_10279720 Ga0075368_102797202 187
11 3300006195 Ga0075366_10036281 Ga0075366_100362813 187
12 3300006353 Ga0075370_10135359 Ga0075370_101353592 187
13 3300017792 Ga0163161_10382323 Ga0163161_103823232 187
14 3300042876 Ga0451577_0028125 Ga0451577_0028125_3519_4094 187
15 3300045051 Ga0451576_0056103 Ga0451576_0056103_702_1277 187
16 3300050493 nmdc:mga0k408_188983_c1 nmdc:mga0k408_188983_c1_262_882 187
17 3300050496 nmdc:mga07m45_8102_c1 nmdc:mga07m45_8102_c1_139_759 187
18 3300053087 Ga0500643_007054 Ga0500643_007054_3993_4565 188
19 3300005328 Ga0070676_10567991 Ga0070676_105679911 191
20 3300005354 Ga0070675_100165430 Ga0070675_1001654303 191
21 3300005456 Ga0070678_100226004 Ga0070678_1002260041 191
22 3300005543 Ga0070672_100256606 Ga0070672_1002566061 191
23 3300014326 Ga0157380_10184459 Ga0157380_101844592 191
24 3300025960 Ga0207651_10390888 Ga0207651_103908882 191
25 3300025986 Ga0207658_10092183 Ga0207658_100921833 191
26 3300028379 Ga0268266_10315543 Ga0268266_103155432 191
27 3300031901 Ga0307406_10330303 Ga0307406_103303032 191
28 3300042876 Ga0451577_0001869 Ga0451577_0001869_389_991 191
29 3300046539 Ga0495621_0000477 Ga0495621_0000477_3120_3740 191
30 3300046615 Ga0495656_0000163 Ga0495656_0000163_14561_15181 191
31 3300047470 Ga0495681_0059758 Ga0495681_0059758_102_722 191
32 3300013296 Ga0157374_10581710 Ga0157374_105817102 193
33 3300042876 Ga0451577_0451523 Ga0451577_0451523_488_1096 193
34 iso_pu_bacteria 2894023352 2894024465 193
35 3300038443 Ga0395901_0504515 Ga0395901_0504515_77_697 194
36 iso_pu_bacteria 2899924645 2899928068 194
37 iso_pu_bacteria 2928064002 2928066717 194
38 3300050516 nmdc:mga0sz30_179706_c1 nmdc:mga0sz30_179706_c1_12_608 198
39 3300042876 Ga0451577_0472121 Ga0451577_0472121_400_1008 200
40 3300039093 Ga0400489_59002 Ga0400489_59002_464_1069 201
41 iso_pu_bacteria 2511231002 2511247148 202
42 iso_pu_bacteria 2513020051 2513230381 202
43 iso_pu_bacteria 2547132374 2548498950 202
44 iso_pu_bacteria 2599185214 2599627964 202
45 iso_pu_bacteria 2599185226 2599677775 202
46 iso_pu_bacteria 2599185227 2599685594 202
47 iso_pu_bacteria 2599185229 2599697486 202
48 iso_pu_bacteria 2643221570 2643867832 202
49 iso_pu_bacteria 2643221596 2643991696 202
50 iso_pu_bacteria 2643221609 2644062396 202
51 iso_pu_bacteria 2643221611 2644071308 202
52 iso_pu_bacteria 2643221628 2644161783 202
53 iso_pu_bacteria 2643221652 2644293456 202
54 iso_pu_bacteria 2643221658 2644325803 202
55 iso_pu_bacteria 2643221672 2644399654 202
56 iso_pu_bacteria 2643221683 2644465166 202
57 iso_pu_bacteria 2643221717 2644648409 202
58 iso_pu_bacteria 2721755523 2722885282 202
59 iso_pu_bacteria 2738541277 2738724017 202
60 iso_pu_bacteria 2738541307 2738880581 202
61 iso_pu_bacteria 2738543012 2739246460 202
62 iso_pu_bacteria 2738543013 2739247907 202
63 iso_pu_bacteria 2738543019 2739284702 202
64 iso_pu_bacteria 2816332133 2816471156 202
65 iso_pu_bacteria 2818991446 2819600678 202
66 iso_pu_bacteria 2838054893 2838061724 202
67 iso_pu_bacteria 2839138175 2839138654 202
68 iso_pu_bacteria 2842677519 2842679755 202
69 iso_pu_bacteria 2842718218 2842718876 202
70 iso_pu_bacteria 2842733646 2842734092 202
71 iso_pu_bacteria 2842747753 2842752532 202
72 iso_pu_bacteria 2881101125 2881102707 202
73 iso_pu_bacteria 2885192300 2885193056 202
74 iso_pu_bacteria 2904449895 2904452516 202
75 iso_pu_bacteria 2904456579 2904460885 202
76 iso_pu_bacteria 2904479285 2904480858 202
77 iso_pu_bacteria 2919462493 2919463855 202
78 iso_pu_bacteria 2919704043 2919704160 202
79 iso_pu_bacteria 2928084124 2928088606 202
80 iso_pu_bacteria 2929160207 2929165421 202
81 iso_pu_bacteria 2929520902 2929522851 202
82 iso_pu_bacteria 2932422444 2932425361 202
83 iso_pu_bacteria 2945945610 2945945978 202
84 iso_pu_bacteria 2945972063 2945975596 202
85 iso_pu_bacteria 2974320154 2974320306 202
86 iso_pu_bacteria 2990710928 2990713858 202
87 3300026075 Ga0207708_10181400 Ga0207708_101814004 204
88 3300042532 Ga0450893_0046800 Ga0450893_0046800_12_659 204
89 3300005543 Ga0070672_100629341 Ga0070672_1006293412 205
90 3300006038 Ga0075365_10658648 Ga0075365_106586481 205
91 3300006846 Ga0075430_100092876 Ga0075430_1000928763 205
92 3300026089 Ga0207648_10062014 Ga0207648_100620142 205
93 3300031548 Ga0307408_100467496 Ga0307408_1004674962 205
94 3300037471 Ga0395905_0008661 Ga0395905_0008661_4200_4817 205
95 3300037471 Ga0395905_0325203 Ga0395905_0325203_282_899 205
96 3300042015 Ga0439462_0010823 Ga0439462_0010823_1665_2282 205
97 3300042123 Ga0450921_011460 Ga0450921_011460_27_644 205
98 3300042125 Ga0450923_042023 Ga0450923_042023_30_647 205
99 3300042128 Ga0450897_014079 Ga0450897_014079_94_711 205
100 3300042156 Ga0439446_0026497 Ga0439446_0026497_768_1385 205
101 3300042184 Ga0450908_018645 Ga0450908_018645_485_1102 205
102 3300042435 Ga0439434_0061187 Ga0439434_0061187_266_883 205
103 3300042438 Ga0439459_0006375 Ga0439459_0006375_1131_1748 205
104 3300042439 Ga0439464_0009630 Ga0439464_0009630_607_1224 205
105 3300044673 Ga0453683_0034464 Ga0453683_0034464_135_752 205
106 3300045051 Ga0451576_0024858 Ga0451576_0024858_4161_4778 205
107 3300049686 Ga0501257_060192 Ga0501257_060192_321_938 205
108 3300050509 nmdc:mga0qj67_218259_c1 nmdc:mga0qj67_218259_c1_689_1306 205
109 iso_pu_bacteria 2928115317 2928115568 205
110 2162886007 SwRhRL2b_contig_1208657 SwRhRL2b_0836.00006380 206
111 3300001979 JGI24740J21852_10007463 JGI24740J21852_100074634 206
112 3300001989 JGI24739J22299_10012424 JGI24739J22299_100124242 206
113 3300001989 JGI24739J22299_10052911 JGI24739J22299_100529113 206
114 3300002704 JGI25155J39150_1000085 JGI25155J39150_100008562 206
115 3300002705 JGI25156J39149_1000139 JGI25156J39149_100013962 206
116 3300002738 JGI25154J39366_1000154 JGI25154J39366_10001543 206
117 3300002739 JGI25158J39367_1010274 JGI25158J39367_10102742 206
118 3300002741 JGI25157J39369_1000181 JGI25157J39369_10001813 206
119 3300002773 JGI25152J39213_1004827 JGI25152J39213_10048271 206
120 3300002773 JGI25152J39213_1012417 JGI25152J39213_10124171 206
121 3300002774 JGI25150J39212_1003168 JGI25150J39212_10031683 206
122 3300002774 JGI25150J39212_1003655 JGI25150J39212_10036553 206
123 3300002774 JGI25150J39212_1004700 JGI25150J39212_10047003 206
124 3300002774 JGI25150J39212_1005571 JGI25150J39212_10055713 206
125 3300002987 JGI25159J45721_1000575 JGI25159J45721_100057521 206
126 3300002987 JGI25159J45721_1001104 JGI25159J45721_100110417 206
127 3300002987 JGI25159J45721_1008541 JGI25159J45721_10085413 206
128 3300002987 JGI25159J45721_1010488 JGI25159J45721_10104883 206
129 3300002987 JGI25159J45721_1021272 JGI25159J45721_10212722 206
130 3300002987 JGI25159J45721_1024325 JGI25159J45721_10243252 206
131 3300003187 JGI25151J46595_10001834 JGI25151J46595_100018345 206
132 3300003187 JGI25151J46595_10004515 JGI25151J46595_100045155 206
133 3300003187 JGI25151J46595_10007290 JGI25151J46595_100072903 206
134 3300003187 JGI25151J46595_10008309 JGI25151J46595_100083092 206
135 3300003187 JGI25151J46595_10023051 JGI25151J46595_100230513 206
136 3300003187 JGI25151J46595_10029761 JGI25151J46595_100297612 206
137 3300003215 JGI25153J46596_10008225 JGI25153J46596_100082255 206
138 3300003215 JGI25153J46596_10008252 JGI25153J46596_100082522 206
139 3300003316 rootH1_10044413 rootH1_100444131 206
140 3300003323 rootH1_10002122 rootH1_100021222 206
141 3300003323 rootH1_10058594 rootH1_100585943 206
142 3300003354 JGI25160J50197_1000129 JGI25160J50197_100012921 206
143 3300003354 JGI25160J50197_1005984 JGI25160J50197_10059842 206
144 3300003354 JGI25160J50197_1024715 JGI25160J50197_10247152 206
145 3300003374 JGI25161J50226_1000080 JGI25161J50226_100008040 206
146 3300003374 JGI25161J50226_1002297 JGI25161J50226_10022972 206
147 3300003761 Ga0055535_1000750 Ga0055535_100075016 206
148 3300003762 Ga0055542_1000583 Ga0055542_100058316 206
149 3300003771 Ga0055526_1015725 Ga0055526_10157253 206
150 3300003771 Ga0055526_1015747 Ga0055526_10157473 206
151 3300003773 Ga0055537_1000049 Ga0055537_100004922 206
152 3300003773 Ga0055537_1001823 Ga0055537_10018239 206
153 3300003773 Ga0055537_1003302 Ga0055537_10033022 206
154 3300003773 Ga0055537_1003310 Ga0055537_10033104 206
155 3300003775 Ga0055524_1000120 Ga0055524_100012049 206
156 3300003775 Ga0055524_1013849 Ga0055524_10138493 206
157 3300003775 Ga0055524_1013865 Ga0055524_10138652 206
158 3300003781 Ga0055536_1002156 Ga0055536_100215612 206
159 3300003781 Ga0055536_1002470 Ga0055536_10024708 206
160 3300003781 Ga0055536_1005584 Ga0055536_10055844 206
161 3300003781 Ga0055536_1009058 Ga0055536_10090583 206
162 3300003781 Ga0055536_1029492 Ga0055536_10294922 206
163 3300003784 Ga0055534_1000049 Ga0055534_100004977 206
164 3300003784 Ga0055534_1000343 Ga0055534_10003431 206
165 3300003784 Ga0055534_1001185 Ga0055534_10011858 206
166 3300003784 Ga0055534_1002822 Ga0055534_10028228 206
167 3300003784 Ga0055534_1003409 Ga0055534_10034092 206
168 3300003790 Ga0055528_1000623 Ga0055528_100062317 206
169 3300003790 Ga0055528_1007101 Ga0055528_10071012 206
170 3300003790 Ga0055528_1007116 Ga0055528_10071162 206
171 3300003791 Ga0055530_10001404 Ga0055530_1000140418 206
172 3300003791 Ga0055530_10011762 Ga0055530_100117623 206
173 3300003791 Ga0055530_10017412 Ga0055530_100174123 206
174 3300003792 Ga0055540_1000067 Ga0055540_100006779 206
175 3300003792 Ga0055540_1000480 Ga0055540_100048028 206
176 3300003792 Ga0055540_1003384 Ga0055540_10033848 206
177 3300003792 Ga0055540_1004630 Ga0055540_10046303 206
178 3300003792 Ga0055540_1019477 Ga0055540_10194771 206
179 3300003792 Ga0055540_1033605 Ga0055540_10336052 206
180 3300003794 Ga0055531_10000034 Ga0055531_100000342 206
181 3300003794 Ga0055531_10000738 Ga0055531_100007389 206
182 3300003794 Ga0055531_10011804 Ga0055531_100118043 206
183 3300003794 Ga0055531_10017551 Ga0055531_100175513 206
184 3300003794 Ga0055531_10018250 Ga0055531_100182503 206
185 3300004625 Ga0055543_1000202 Ga0055543_100020240 206
186 3300004625 Ga0055543_1005905 Ga0055543_10059053 206
187 3300004625 Ga0055543_1006405 Ga0055543_10064053 206
188 3300005262 Ga0065165_1015225 Ga0065165_10152253 206
189 3300005262 Ga0065165_1027858 Ga0065165_10278583 206
190 3300005288 Ga0065714_10020441 Ga0065714_100204413 206
191 3300005288 Ga0065714_10096768 Ga0065714_100967682 206
192 3300005289 Ga0065704_10074991 Ga0065704_100749913 206
193 3300005289 Ga0065704_10091409 Ga0065704_100914092 206
194 3300005289 Ga0065704_10225657 Ga0065704_102256572 206
195 3300005289 Ga0065704_10230352 Ga0065704_102303522 206
196 3300005295 Ga0065707_10190962 Ga0065707_101909622 206
197 3300005327 Ga0070658_10067313 Ga0070658_100673134 206
198 3300005327 Ga0070658_10085691 Ga0070658_100856913 206
199 3300005327 Ga0070658_10459368 Ga0070658_104593682 206
200 3300005331 Ga0070670_100583674 Ga0070670_1005836742 206
201 3300005331 Ga0070670_100734809 Ga0070670_1007348091 206
202 3300005334 Ga0068869_100477178 Ga0068869_1004771781 206
203 3300005344 Ga0070661_100982008 Ga0070661_1009820081 206
204 3300005347 Ga0070668_100356478 Ga0070668_1003564782 206
205 3300005353 Ga0070669_100161067 Ga0070669_1001610671 206
206 3300005354 Ga0070675_100427450 Ga0070675_1004274502 206
207 3300005356 Ga0070674_100151075 Ga0070674_1001510752 206
208 3300005366 Ga0070659_100227861 Ga0070659_1002278613 206
209 3300005367 Ga0070667_100102296 Ga0070667_1001022962 206
210 3300005435 Ga0070714_100043003 Ga0070714_1000430033 206
211 3300005456 Ga0070678_100160771 Ga0070678_1001607712 206
212 3300005457 Ga0070662_100062742 Ga0070662_1000627423 206
213 3300005468 Ga0070707_100109908 Ga0070707_1001099083 206
214 3300005539 Ga0068853_100032565 Ga0068853_1000325653 206
215 3300005539 Ga0068853_100128401 Ga0068853_1001284012 206
216 3300005539 Ga0068853_100990228 Ga0068853_1009902281 206
217 3300005539 Ga0068853_101068652 Ga0068853_1010686521 206
218 3300005547 Ga0070693_100017394 Ga0070693_1000173943 206
219 3300005548 Ga0070665_100033550 Ga0070665_1000335504 206
220 3300005548 Ga0070665_100284408 Ga0070665_1002844083 206
221 3300005563 Ga0068855_100004546 Ga0068855_10000454615 206
222 3300005563 Ga0068855_100046799 Ga0068855_1000467995 206
223 3300005563 Ga0068855_100276631 Ga0068855_1002766313 206
224 3300005564 Ga0070664_100074593 Ga0070664_1000745933 206
225 3300005577 Ga0068857_100227861 Ga0068857_1002278613 206
226 3300005614 Ga0068856_100150449 Ga0068856_1001504493 206
227 3300005614 Ga0068856_100375887 Ga0068856_1003758873 206
228 3300005617 Ga0068859_100280526 Ga0068859_1002805263 206
229 3300005618 Ga0068864_100021424 Ga0068864_1000214246 206
230 3300005834 Ga0068851_10051418 Ga0068851_100514183 206
231 3300005834 Ga0068851_10257854 Ga0068851_102578541 206
232 3300005841 Ga0068863_100279201 Ga0068863_1002792013 206
233 3300005844 Ga0068862_100035693 Ga0068862_1000356933 206
234 3300005844 Ga0068862_100278195 Ga0068862_1002781952 206
235 3300006038 Ga0075365_10000296 Ga0075365_1000029613 206
236 3300006042 Ga0075368_10048959 Ga0075368_100489592 206
237 3300006048 Ga0075363_100008947 Ga0075363_1000089475 206
238 3300006048 Ga0075363_100047464 Ga0075363_1000474643 206
239 3300006048 Ga0075363_100109222 Ga0075363_1001092222 206
240 3300006051 Ga0075364_10004115 Ga0075364_100041152 206
241 3300006051 Ga0075364_10058479 Ga0075364_100584792 206
242 3300006058 Ga0075432_10009149 Ga0075432_100091493 206
243 3300006058 Ga0075432_10044150 Ga0075432_100441502 206
244 3300006177 Ga0075362_10008974 Ga0075362_100089743 206
245 3300006177 Ga0075362_10026548 Ga0075362_100265482 206
246 3300006177 Ga0075362_10098857 Ga0075362_100988571 206
247 3300006178 Ga0075367_10261552 Ga0075367_102615522 206
248 3300006195 Ga0075366_10003520 Ga0075366_100035205 206
249 3300006195 Ga0075366_10066167 Ga0075366_100661673 206
250 3300006195 Ga0075366_10069482 Ga0075366_100694822 206
251 3300006237 Ga0097621_100412527 Ga0097621_1004125271 206
252 3300006353 Ga0075370_10003918 Ga0075370_100039186 206
253 3300006353 Ga0075370_10013503 Ga0075370_100135034 206
254 3300006353 Ga0075370_10048867 Ga0075370_100488672 206
255 3300006353 Ga0075370_10144711 Ga0075370_101447112 206
256 3300006353 Ga0075370_10237822 Ga0075370_102378222 206
257 3300006931 Ga0097620_100280525 Ga0097620_1002805253 206
258 3300006946 Ga0079104_1000003 Ga0079104_100000322 206
259 3300009036 Ga0105244_10016816 Ga0105244_100168162 206
260 3300009036 Ga0105244_10144859 Ga0105244_101448592 206
261 3300009092 Ga0105250_10001739 Ga0105250_100017396 206
262 3300009093 Ga0105240_10214478 Ga0105240_102144783 206
263 3300009093 Ga0105240_10626936 Ga0105240_106269363 206
264 3300009094 Ga0111539_11500683 Ga0111539_115006831 206
265 3300009098 Ga0105245_10145029 Ga0105245_101450293 206
266 3300009148 Ga0105243_10001244 Ga0105243_100012442 206
267 3300009148 Ga0105243_10003162 Ga0105243_100031629 206
268 3300009148 Ga0105243_10062687 Ga0105243_100626872 206
269 3300009148 Ga0105243_10176906 Ga0105243_101769062 206
270 3300009148 Ga0105243_10858164 Ga0105243_108581641 206
271 3300009545 Ga0105237_10136801 Ga0105237_101368013 206
272 3300009545 Ga0105237_10485238 Ga0105237_104852383 206
273 3300009551 Ga0105238_10049880 Ga0105238_100498803 206
274 3300009551 Ga0105238_10063487 Ga0105238_100634873 206
275 3300009551 Ga0105238_10809781 Ga0105238_108097811 206
276 3300010375 Ga0105239_10665406 Ga0105239_106654062 206
277 3300011119 Ga0105246_10588438 Ga0105246_105884382 206
278 3300012502 Ga0157347_1002693 Ga0157347_10026931 206
279 3300012513 Ga0157326_1002659 Ga0157326_10026592 206
280 3300013100 Ga0157373_10025215 Ga0157373_100252153 206
281 3300013102 Ga0157371_10038429 Ga0157371_100384293 206
282 3300013104 Ga0157370_10007822 Ga0157370_1000782213 206
283 3300013104 Ga0157370_10441882 Ga0157370_104418821 206
284 3300013105 Ga0157369_10037367 Ga0157369_100373676 206
285 3300013296 Ga0157374_10730989 Ga0157374_107309892 206
286 3300013297 Ga0157378_10599256 Ga0157378_105992562 206
287 3300013306 Ga0163162_10258502 Ga0163162_102585022 206
288 3300013307 Ga0157372_10063638 Ga0157372_100636383 206
289 3300014497 Ga0182008_10000225 Ga0182008_100002253 206
290 3300014497 Ga0182008_10012137 Ga0182008_100121373 206
291 3300014497 Ga0182008_10028802 Ga0182008_100288023 206
292 3300014497 Ga0182008_10056970 Ga0182008_100569701 206
293 3300014497 Ga0182008_10236266 Ga0182008_102362661 206
294 3300015261 Ga0182006_1004254 Ga0182006_10042543 206
295 3300015262 Ga0182007_10002590 Ga0182007_1000259010 206
296 3300015262 Ga0182007_10005032 Ga0182007_100050328 206
297 3300015265 Ga0182005_1013873 Ga0182005_10138733 206
298 3300015683 Ga0183362_10005 Ga0183362_10005335 206
299 3300017792 Ga0163161_10000114 Ga0163161_1000011443 206
300 3300017792 Ga0163161_10094488 Ga0163161_100944882 206
301 3300017792 Ga0163161_10251736 Ga0163161_102517363 206
302 3300021361 Ga0213872_10007360 Ga0213872_100073603 206
303 3300025206 Ga0209435_100003 Ga0209435_100003453 206
304 3300025208 Ga0209436_101911 Ga0209436_1019119 206
305 3300025208 Ga0209436_106926 Ga0209436_1069262 206
306 3300025208 Ga0209436_120781 Ga0209436_1207812 206
307 3300025228 Ga0209672_100477 Ga0209672_10047712 206
308 3300025229 Ga0209147_101499 Ga0209147_1014999 206
309 3300025242 Ga0209258_100568 Ga0209258_10056824 206
310 3300025245 Ga0207425_1000069 Ga0207425_100006993 206
311 3300025245 Ga0207425_1001640 Ga0207425_10016409 206
312 3300025245 Ga0207425_1013877 Ga0207425_10138772 206
313 3300025246 Ga0209646_1000008 Ga0209646_1000008453 206
314 3300025250 Ga0209026_1000007 Ga0209026_1000007453 206
315 3300025254 Ga0209148_1000033 Ga0209148_1000033106 206
316 3300025256 Ga0209759_1000019 Ga0209759_1000019174 206
317 3300025258 Ga0209129_1000233 Ga0209129_100023372 206
318 3300025258 Ga0209129_1001859 Ga0209129_10018593 206
319 3300025263 Ga0209565_1000020 Ga0209565_1000020382 206
320 3300025263 Ga0209565_1000116 Ga0209565_100011650 206
321 3300025263 Ga0209565_1000171 Ga0209565_100017172 206
322 3300025263 Ga0209565_1000883 Ga0209565_10008832 206
323 3300025263 Ga0209565_1003079 Ga0209565_10030795 206
324 3300025273 Ga0209673_1000295 Ga0209673_100029576 206
325 3300025273 Ga0209673_1000301 Ga0209673_100030151 206
326 3300025273 Ga0209673_1000305 Ga0209673_100030587 206
327 3300025273 Ga0209673_1006536 Ga0209673_10065363 206
328 3300025273 Ga0209673_1007324 Ga0209673_10073245 206
329 3300025273 Ga0209673_1055071 Ga0209673_10550712 206
330 3300025284 Ga0209130_1000095 Ga0209130_1000095116 206
331 3300025284 Ga0209130_1000134 Ga0209130_100013449 206
332 3300025284 Ga0209130_1000193 Ga0209130_100019339 206
333 3300025284 Ga0209130_1000366 Ga0209130_100036650 206
334 3300025284 Ga0209130_1001843 Ga0209130_100184310 206
335 3300025284 Ga0209130_1011467 Ga0209130_10114671 206
336 3300025291 Ga0209675_1000014 Ga0209675_1000014371 206
337 3300025291 Ga0209675_1000249 Ga0209675_100024918 206
338 3300025291 Ga0209675_1000582 Ga0209675_100058211 206
339 3300025291 Ga0209675_1000599 Ga0209675_10005992 206
340 3300025291 Ga0209675_1002239 Ga0209675_10022392 206
341 3300025291 Ga0209675_1006897 Ga0209675_10068972 206
342 3300025291 Ga0209675_1011341 Ga0209675_10113412 206
343 3300025291 Ga0209675_1064714 Ga0209675_10647141 206
344 3300025292 Ga0209676_1000048 Ga0209676_1000048223 206
345 3300025292 Ga0209676_1000098 Ga0209676_100009840 206
346 3300025292 Ga0209676_1000123 Ga0209676_100012329 206
347 3300025292 Ga0209676_1000145 Ga0209676_100014598 206
348 3300025292 Ga0209676_1002365 Ga0209676_100236510 206
349 3300025292 Ga0209676_1015599 Ga0209676_10155993 206
350 3300025292 Ga0209676_1028023 Ga0209676_10280232 206
351 3300025292 Ga0209676_1039314 Ga0209676_10393143 206
352 3300025294 Ga0209025_1000204 Ga0209025_100020467 206
353 3300025294 Ga0209025_1000264 Ga0209025_100026472 206
354 3300025294 Ga0209025_1000348 Ga0209025_100034825 206
355 3300025294 Ga0209025_1002608 Ga0209025_100260820 206
356 3300025294 Ga0209025_1002728 Ga0209025_100272820 206
357 3300025294 Ga0209025_1005823 Ga0209025_10058237 206
358 3300025294 Ga0209025_1009284 Ga0209025_10092849 206
359 3300025294 Ga0209025_1021401 Ga0209025_10214012 206
360 3300025294 Ga0209025_1037201 Ga0209025_10372012 206
361 3300025295 Ga0209564_1000231 Ga0209564_100023172 206
362 3300025295 Ga0209564_1000728 Ga0209564_100072832 206
363 3300025295 Ga0209564_1001669 Ga0209564_100166924 206
364 3300025295 Ga0209564_1012287 Ga0209564_10122873 206
365 3300025295 Ga0209564_1037145 Ga0209564_10371453 206
366 3300025297 Ga0209758_1000222 Ga0209758_100022272 206
367 3300025297 Ga0209758_1014048 Ga0209758_10140482 206
368 3300025297 Ga0209758_1063264 Ga0209758_10632642 206
369 3300025298 Ga0209050_1000012 Ga0209050_1000012223 206
370 3300025298 Ga0209050_1000023 Ga0209050_100002379 206
371 3300025298 Ga0209050_1001339 Ga0209050_10013399 206
372 3300025298 Ga0209050_1001596 Ga0209050_10015964 206
373 3300025298 Ga0209050_1002459 Ga0209050_100245917 206
374 3300025298 Ga0209050_1003820 Ga0209050_100382012 206
375 3300025298 Ga0209050_1025288 Ga0209050_10252882 206
376 3300025298 Ga0209050_1029263 Ga0209050_10292632 206
377 3300025299 Ga0209256_1000003 Ga0209256_1000003813 206
378 3300025299 Ga0209256_1000095 Ga0209256_100009564 206
379 3300025299 Ga0209256_1000284 Ga0209256_100028450 206
380 3300025299 Ga0209256_1031770 Ga0209256_10317703 206
381 3300025302 Ga0207426_1000058 Ga0207426_100005830 206
382 3300025302 Ga0207426_1000349 Ga0207426_100034939 206
383 3300025302 Ga0207426_1000397 Ga0207426_100039742 206
384 3300025302 Ga0207426_1000618 Ga0207426_10006186 206
385 3300025302 Ga0207426_1055373 Ga0207426_10553731 206
386 3300025303 Ga0209051_1000017 Ga0209051_100001779 206
387 3300025303 Ga0209051_1000019 Ga0209051_1000019142 206
388 3300025303 Ga0209051_1000091 Ga0209051_100009129 206
389 3300025303 Ga0209051_1000098 Ga0209051_100009840 206
390 3300025303 Ga0209051_1000099 Ga0209051_100009974 206
391 3300025303 Ga0209051_1000342 Ga0209051_100034227 206
392 3300025303 Ga0209051_1018603 Ga0209051_10186032 206
393 3300025303 Ga0209051_1020469 Ga0209051_10204693 206
394 3300025304 Ga0209257_1000024 Ga0209257_1000024169 206
395 3300025304 Ga0209257_1000041 Ga0209257_100004179 206
396 3300025304 Ga0209257_1000276 Ga0209257_10002762 206
397 3300025304 Ga0209257_1000497 Ga0209257_100049733 206
398 3300025304 Ga0209257_1000546 Ga0209257_100054692 206
399 3300025304 Ga0209257_1006622 Ga0209257_10066224 206
400 3300025711 Ga0207696_1009335 Ga0207696_10093353 206
401 3300025728 Ga0207655_1004280 Ga0207655_10042803 206
402 3300025909 Ga0207705_10065445 Ga0207705_100654453 206
403 3300025909 Ga0207705_10079722 Ga0207705_100797222 206
404 3300025914 Ga0207671_10162740 Ga0207671_101627402 206
405 3300025917 Ga0207660_10123091 Ga0207660_101230911 206
406 3300025919 Ga0207657_10009594 Ga0207657_100095942 206
407 3300025923 Ga0207681_10103927 Ga0207681_101039271 206
408 3300025924 Ga0207694_10219477 Ga0207694_102194773 206
409 3300025925 Ga0207650_10032708 Ga0207650_100327082 206
410 3300025925 Ga0207650_10625124 Ga0207650_106251241 206
411 3300025926 Ga0207659_10327313 Ga0207659_103273132 206
412 3300025927 Ga0207687_10154572 Ga0207687_101545722 206
413 3300025927 Ga0207687_10245676 Ga0207687_102456762 206
414 3300025933 Ga0207706_10347491 Ga0207706_103474913 206
415 3300025934 Ga0207686_10149209 Ga0207686_101492093 206
416 3300025935 Ga0207709_10000244 Ga0207709_1000024413 206
417 3300025935 Ga0207709_10000331 Ga0207709_1000033128 206
418 3300025935 Ga0207709_10000464 Ga0207709_1000046425 206
419 3300025935 Ga0207709_10059077 Ga0207709_100590772 206
420 3300025935 Ga0207709_10415126 Ga0207709_104151262 206
421 3300025945 Ga0207679_10012391 Ga0207679_100123917 206
422 3300025949 Ga0207667_10081950 Ga0207667_100819502 206
423 3300025949 Ga0207667_10838994 Ga0207667_108389941 206
424 3300025949 Ga0207667_10957653 Ga0207667_109576532 206
425 3300025960 Ga0207651_10141191 Ga0207651_101411912 206
426 3300025972 Ga0207668_10212017 Ga0207668_102120172 206
427 3300026023 Ga0207677_10020670 Ga0207677_100206703 206
428 3300026041 Ga0207639_10043606 Ga0207639_100436063 206
429 3300026041 Ga0207639_10206175 Ga0207639_102061752 206
430 3300026041 Ga0207639_10861708 Ga0207639_108617082 206
431 3300026078 Ga0207702_10260046 Ga0207702_102600462 206
432 3300026078 Ga0207702_11240859 Ga0207702_112408591 206
433 3300026088 Ga0207641_10260934 Ga0207641_102609342 206
434 3300026095 Ga0207676_10019562 Ga0207676_100195625 206
435 3300026116 Ga0207674_10272954 Ga0207674_102729543 206
436 3300026116 Ga0207674_10323136 Ga0207674_103231362 206
437 3300026118 Ga0207675_100427103 Ga0207675_1004271032 206
438 3300026121 Ga0207683_10014305 Ga0207683_100143052 206
439 3300026121 Ga0207683_10096305 Ga0207683_100963052 206
440 3300026142 Ga0207698_10579988 Ga0207698_105799882 206
441 3300026142 Ga0207698_10583558 Ga0207698_105835582 206
442 3300027111 Ga0209281_1000002 Ga0209281_10000021238 206
443 3300027252 Ga0209973_1000067 Ga0209973_10000673 206
444 3300027360 Ga0209969_1015987 Ga0209969_10159872 206
445 3300027552 Ga0209982_1023872 Ga0209982_10238722 206
446 3300027614 Ga0209970_1003961 Ga0209970_10039612 206
447 3300027614 Ga0209970_1023275 Ga0209970_10232752 206
448 3300027666 Ga0209282_1018266 Ga0209282_10182663 206
449 3300027682 Ga0209971_1003849 Ga0209971_10038493 206
450 3300027876 Ga0209974_10002399 Ga0209974_100023997 206
451 3300027876 Ga0209974_10008078 Ga0209974_100080783 206
452 3300027876 Ga0209974_10039642 Ga0209974_100396423 206
453 3300027907 Ga0207428_10046728 Ga0207428_100467283 206
454 3300028379 Ga0268266_10040433 Ga0268266_100404333 206
455 3300028379 Ga0268266_10357843 Ga0268266_103578432 206
456 3300028380 Ga0268265_10030005 Ga0268265_100300053 206
457 3300028794 Ga0307515_10000040 Ga0307515_10000040143 206
458 3300028794 Ga0307515_10000213 Ga0307515_10000213115 206
459 3300028794 Ga0307515_10155384 Ga0307515_101553842 206
460 3300028794 Ga0307515_10169485 Ga0307515_101694853 206
461 3300028800 Ga0265338_10359040 Ga0265338_103590402 206
462 3300030731 Ga0316177_1024879 Ga0316177_10248792 206
463 3300030733 Ga0314311_1113039 Ga0314311_11130393 206
464 3300030734 Ga0316179_1109004 Ga0316179_11090049 206
465 3300030735 Ga0316178_1145172 Ga0316178_11451723 206
466 3300030736 Ga0316180_1167845 Ga0316180_11678453 206
467 3300030742 Ga0316183_1086557 Ga0316183_108655712 206
468 3300030744 Ga0316181_1115636 Ga0316181_11156363 206
469 3300030745 Ga0316182_1187259 Ga0316182_11872592 206
470 3300031235 Ga0265330_10000022 Ga0265330_1000002224 206
471 3300031235 Ga0265330_10008061 Ga0265330_100080615 206
472 3300031238 Ga0265332_10000001 Ga0265332_10000001533 206
473 3300031238 Ga0265332_10000005 Ga0265332_10000005262 206
474 3300031238 Ga0265332_10235486 Ga0265332_102354861 206
475 3300031251 Ga0265327_10000746 Ga0265327_1000074610 206
476 3300031344 Ga0265316_10146729 Ga0265316_101467292 206
477 3300031456 Ga0307513_10000113 Ga0307513_1000011331 206
478 3300031456 Ga0307513_10005571 Ga0307513_1000557111 206
479 3300031456 Ga0307513_10092847 Ga0307513_100928473 206
480 3300031456 Ga0307513_10299091 Ga0307513_102990912 206
481 3300031456 Ga0307513_10375889 Ga0307513_103758892 206
482 3300031548 Ga0307408_100000101 Ga0307408_10000010165 206
483 3300031548 Ga0307408_100268127 Ga0307408_1002681272 206
484 3300031548 Ga0307408_100578773 Ga0307408_1005787731 206
485 3300031548 Ga0307408_100587786 Ga0307408_1005877862 206
486 3300031649 Ga0307514_10008104 Ga0307514_1000810410 206
487 3300031711 Ga0265314_10000013 Ga0265314_10000013284 206
488 3300031711 Ga0265314_10006062 Ga0265314_100060628 206
489 3300031711 Ga0265314_10013920 Ga0265314_100139206 206
490 3300031730 Ga0307516_10006023 Ga0307516_1000602313 206
491 3300031731 Ga0307405_10005856 Ga0307405_100058567 206
492 3300031731 Ga0307405_10123707 Ga0307405_101237072 206
493 3300031731 Ga0307405_10314599 Ga0307405_103145992 206
494 3300031731 Ga0307405_10360699 Ga0307405_103606992 206
495 3300031824 Ga0307413_10186773 Ga0307413_101867732 206
496 3300031901 Ga0307406_10000497 Ga0307406_100004972 206
497 3300031901 Ga0307406_10048612 Ga0307406_100486123 206
498 3300031901 Ga0307406_10075767 Ga0307406_100757672 206
499 3300031901 Ga0307406_10167341 Ga0307406_101673412 206
500 3300031911 Ga0307412_10083258 Ga0307412_100832583 206
501 3300031911 Ga0307412_10256774 Ga0307412_102567742 206
502 3300031911 Ga0307412_10739866 Ga0307412_107398661 206
503 3300031911 Ga0307412_10744320 Ga0307412_107443202 206
504 3300032002 Ga0307416_100050999 Ga0307416_1000509993 206
505 3300032002 Ga0307416_100078224 Ga0307416_1000782242 206
506 3300032002 Ga0307416_100310432 Ga0307416_1003104322 206
507 3300032002 Ga0307416_100334652 Ga0307416_1003346521 206
508 3300032002 Ga0307416_100753437 Ga0307416_1007534372 206
509 3300032002 Ga0307416_100901522 Ga0307416_1009015222 206
510 3300032004 Ga0307414_10005833 Ga0307414_100058334 206
511 3300032005 Ga0307411_10178326 Ga0307411_101783263 206
512 3300032005 Ga0307411_10679177 Ga0307411_106791771 206
513 3300035171 Ga0373946_0124176 Ga0373946_0124176_47_667 206
514 3300035172 Ga0373955_0314262 Ga0373955_0314262_45_665 206
515 3300035691 Ga0373931_0027422 Ga0373931_0027422_102_722 206
516 3300035691 Ga0373931_0136460 Ga0373931_0136460_775_1395 206
517 3300037312 Ga0395899_0001018 Ga0395899_0001018_13760_14380 206
518 3300037312 Ga0395899_0058267 Ga0395899_0058267_44_664 206
519 3300037418 Ga0395900_0006133 Ga0395900_0006133_10734_11354 206
520 3300037418 Ga0395900_0030913 Ga0395900_0030913_511_1131 206
521 3300037418 Ga0395900_0049698 Ga0395900_0049698_333_953 206
522 3300037418 Ga0395900_0156907 Ga0395900_0156907_984_1604 206
523 3300037418 Ga0395900_0177793 Ga0395900_0177793_670_1290 206
524 3300037418 Ga0395900_0668570 Ga0395900_0668570_121_741 206
525 3300037418 Ga0395900_1023606 Ga0395900_1023606_12_632 206
526 3300037466 Ga0395898_0006763 Ga0395898_0006763_10928_11548 206
527 3300037466 Ga0395898_0123537 Ga0395898_0123537_325_945 206
528 3300037471 Ga0395905_0002817 Ga0395905_0002817_6181_6801 206
529 3300037471 Ga0395905_0004508 Ga0395905_0004508_11017_11637 206
530 3300037471 Ga0395905_0009367 Ga0395905_0009367_7490_8110 206
531 3300037471 Ga0395905_0029999 Ga0395905_0029999_721_1341 206
532 3300037471 Ga0395905_0038724 Ga0395905_0038724_1429_2049 206
533 3300037471 Ga0395905_0059562 Ga0395905_0059562_139_759 206
534 3300037471 Ga0395905_0160158 Ga0395905_0160158_1346_1966 206
535 3300037471 Ga0395905_0172646 Ga0395905_0172646_110_730 206
536 3300037471 Ga0395905_0393831 Ga0395905_0393831_104_724 206
537 3300037471 Ga0395905_0635677 Ga0395905_0635677_12_632 206
538 3300037471 Ga0395905_0644099 Ga0395905_0644099_16_636 206
539 3300038443 Ga0395901_0074018 Ga0395901_0074018_1838_2458 206
540 3300038443 Ga0395901_0121176 Ga0395901_0121176_1004_1624 206
541 3300039437 Ga0436365_0775088 Ga0436365_0775088_305_925 206
542 3300039447 Ga0436361_0021397 Ga0436361_0021397_18310_18930 206
543 3300041404 Ga0439436_0001099 Ga0439436_0001099_3528_4148 206
544 3300041406 Ga0439439_0058647 Ga0439439_0058647_199_819 206
545 3300041407 Ga0439447_016871 Ga0439447_016871_630_1250 206
546 3300041410 Ga0439461_0009606 Ga0439461_0009606_144_764 206
547 3300041411 Ga0439466_0003182 Ga0439466_0003182_571_1191 206
548 3300041411 Ga0439466_0053882 Ga0439466_0053882_23_643 206
549 3300041413 Ga0439465_0026578 Ga0439465_0026578_1071_1691 206
550 3300041458 Ga0451798_0612806 Ga0451798_0612806_70_690 206
551 3300041494 Ga0451837_0249136 Ga0451837_0249136_83_703 206
552 3300041997 Ga0439431_0000218 Ga0439431_0000218_8724_9344 206
553 3300041999 Ga0439433_0002090 Ga0439433_0002090_2873_3493 206
554 3300041999 Ga0439433_0009872 Ga0439433_0009872_193_813 206
555 3300042002 Ga0439442_002873 Ga0439442_002873_1198_1818 206
556 3300042004 Ga0439445_0003096 Ga0439445_0003096_1609_2229 206
557 3300042004 Ga0439445_0021426 Ga0439445_0021426_430_1050 206
558 3300042006 Ga0439432_004550 Ga0439432_004550_1558_2178 206
559 3300042007 Ga0439449_0000120 Ga0439449_0000120_21207_21827 206
560 3300042007 Ga0439449_0001556 Ga0439449_0001556_407_1027 206
561 3300042007 Ga0439449_0003368 Ga0439449_0003368_1446_2066 206
562 3300042007 Ga0439449_0045082 Ga0439449_0045082_64_684 206
563 3300042010 Ga0439452_001002 Ga0439452_001002_9925_10545 206
564 3300042010 Ga0439452_008558 Ga0439452_008558_870_1490 206
565 3300042014 Ga0439457_005319 Ga0439457_005319_1210_1830 206
566 3300042015 Ga0439462_0001389 Ga0439462_0001389_3401_4021 206
567 3300042015 Ga0439462_0006207 Ga0439462_0006207_129_749 206
568 3300042016 Ga0439463_062467 Ga0439463_062467_160_780 206
569 3300042115 Ga0450911_001767 Ga0450911_001767_3644_4264 206
570 3300042125 Ga0450923_000492 Ga0450923_000492_2390_3010 206
571 3300042125 Ga0450923_007168 Ga0450923_007168_95_715 206
572 3300042127 Ga0450890_004537 Ga0450890_004537_987_1607 206
573 3300042128 Ga0450897_000328 Ga0450897_000328_1631_2251 206
574 3300042134 Ga0450898_004589 Ga0450898_004589_53_673 206
575 3300042138 Ga0450903_010922 Ga0450903_010922_464_1084 206
576 3300042145 Ga0450906_006638 Ga0450906_006638_1481_2101 206
577 3300042147 Ga0450910_007034 Ga0450910_007034_154_774 206
578 3300042156 Ga0439446_0017255 Ga0439446_0017255_525_1145 206
579 3300042156 Ga0439446_0073973 Ga0439446_0073973_222_842 206
580 3300042184 Ga0450908_016735 Ga0450908_016735_102_722 206
581 3300042435 Ga0439434_0014899 Ga0439434_0014899_331_951 206
582 3300042532 Ga0450893_0044338 Ga0450893_0044338_20_640 206
583 3300042876 Ga0451577_0010826 Ga0451577_0010826_953_1573 206
584 3300042876 Ga0451577_0021172 Ga0451577_0021172_143_793 206
585 3300042876 Ga0451577_0103510 Ga0451577_0103510_381_1001 206
586 3300044656 Ga0466969_0007544 Ga0466969_0007544_1617_2237 206
587 3300044673 Ga0453683_0003686 Ga0453683_0003686_8758_9378 206
588 3300044683 Ga0466965_0024297 Ga0466965_0024297_1170_1790 206
589 3300044683 Ga0466965_0073083 Ga0466965_0073083_596_1216 206
590 3300044684 Ga0466966_0012868 Ga0466966_0012868_3846_4466 206
591 3300044693 Ga0466961_0006061 Ga0466961_0006061_4767_5387 206
592 3300044712 Ga0453684_0598960 Ga0453684_0598960_539_1159 206
593 3300044765 Ga0466970_0031303 Ga0466970_0031303_1250_1870 206
594 3300044842 Ga0466957_0231453 Ga0466957_0231453_505_1125 206
595 3300044901 Ga0466960_0203963 Ga0466960_0203963_430_1050 206
596 3300044901 Ga0466960_0256796 Ga0466960_0256796_21_641 206
597 3300045049 Ga0466959_0158765 Ga0466959_0158765_667_1287 206
598 3300045051 Ga0451576_0004840 Ga0451576_0004840_5313_5933 206
599 3300045051 Ga0451576_0058688 Ga0451576_0058688_1923_2543 206
600 3300045051 Ga0451576_0629380 Ga0451576_0629380_261_881 206
601 3300045051 Ga0451576_0985937 Ga0451576_0985937_62_682 206
602 3300045836 Ga0466958_0203965 Ga0466958_0203965_55_675 206
603 3300045976 Ga0466967_0529224 Ga0466967_0529224_214_834 206
604 3300046453 Ga0495627_015780 Ga0495627_015780_1499_2137 206
605 3300046453 Ga0495627_022000 Ga0495627_022000_53_673 206
606 3300046459 Ga0495629_0275228 Ga0495629_0275228_148_768 206
607 3300046471 Ga0495650_0047253 Ga0495650_0047253_23_643 206
608 3300046475 Ga0495639_0041351 Ga0495639_0041351_559_1179 206
609 3300046512 Ga0495610_0017743 Ga0495610_0017743_973_1593 206
610 3300046513 Ga0495616_0003735 Ga0495616_0003735_7169_7789 206
611 3300046515 Ga0495620_0240230 Ga0495620_0240230_30_668 206
612 3300046517 Ga0495630_0334861 Ga0495630_0334861_144_764 206
613 3300046518 Ga0495631_0000163 Ga0495631_0000163_43355_43993 206
614 3300046520 Ga0495637_0010636 Ga0495637_0010636_495_1115 206
615 3300046522 Ga0495643_0062287 Ga0495643_0062287_767_1387 206
616 3300046525 Ga0495663_0008194 Ga0495663_0008194_996_1616 206
617 3300046525 Ga0495663_0098668 Ga0495663_0098668_282_920 206
618 3300046528 Ga0495642_0022614 Ga0495642_0022614_472_1092 206
619 3300046528 Ga0495642_0042286 Ga0495642_0042286_360_980 206
620 3300046530 Ga0495654_0022444 Ga0495654_0022444_1438_2058 206
621 3300046530 Ga0495654_0042235 Ga0495654_0042235_1330_1950 206
622 3300046530 Ga0495654_0143264 Ga0495654_0143264_248_868 206
623 3300046539 Ga0495621_0061262 Ga0495621_0061262_518_1156 206
624 3300046542 Ga0495597_0000024 Ga0495597_0000024_137919_138539 206
625 3300046558 Ga0495633_0000305 Ga0495633_0000305_1325_1963 206
626 3300046558 Ga0495633_0056740 Ga0495633_0056740_749_1369 206
627 3300046615 Ga0495656_0032151 Ga0495656_0032151_243_863 206
628 3300046615 Ga0495656_0046422 Ga0495656_0046422_186_806 206
629 3300046616 Ga0495668_0159362 Ga0495668_0159362_173_811 206
630 3300046660 Ga0495625_0000045 Ga0495625_0000045_137597_138217 206
631 3300046660 Ga0495625_0022634 Ga0495625_0022634_1969_2589 206
632 3300046660 Ga0495625_0096944 Ga0495625_0096944_1159_1797 206
633 3300046663 Ga0495635_0180403 Ga0495635_0180403_311_931 206
634 3300046674 Ga0495588_0063114 Ga0495588_0063114_323_943 206
635 3300046674 Ga0495588_0136848 Ga0495588_0136848_263_883 206
636 3300046674 Ga0495588_0176096 Ga0495588_0176096_424_1044 206
637 3300046683 Ga0495658_0043478 Ga0495658_0043478_458_1078 206
638 3300046683 Ga0495658_0116710 Ga0495658_0116710_930_1550 206
639 3300046683 Ga0495658_0258992 Ga0495658_0258992_208_846 206
640 3300046684 Ga0495669_0014099 Ga0495669_0014099_957_1577 206
641 3300046690 Ga0495624_0086432 Ga0495624_0086432_1141_1761 206
642 3300046692 Ga0495671_0030456 Ga0495671_0030456_734_1372 206
643 3300047447 Ga0495685_013506 Ga0495685_013506_454_1074 206
644 3300047470 Ga0495681_0140824 Ga0495681_0140824_131_751 206
645 3300047673 Ga0495593_0002104 Ga0495593_0002104_4650_5270 206
646 3300047673 Ga0495593_0149658 Ga0495593_0149658_504_1124 206
647 3300048089 Ga0495614_0020186 Ga0495614_0020186_782_1402 206
648 3300048904 Ga0496101_0002871 Ga0496101_0002871_7041_7661 206
649 3300048904 Ga0496101_0119954 Ga0496101_0119954_1174_1794 206
650 3300048905 Ga0496102_0003824 Ga0496102_0003824_11563_12183 206
651 3300048906 Ga0496103_0162596 Ga0496103_0162596_280_900 206
652 3300048907 Ga0496104_0018497 Ga0496104_0018497_832_1452 206
653 3300048908 Ga0496105_0002730 Ga0496105_0002730_8690_9310 206
654 3300048909 Ga0496106_0012008 Ga0496106_0012008_2656_3276 206
655 3300048912 Ga0496109_0140704 Ga0496109_0140704_1240_1860 206
656 3300048913 Ga0496110_0083819 Ga0496110_0083819_634_1254 206
657 3300048914 Ga0496111_0294772 Ga0496111_0294772_214_834 206
658 3300048915 Ga0496112_0965172 Ga0496112_0965172_17_637 206
659 3300048919 Ga0496116_0093641 Ga0496116_0093641_1095_1715 206
660 3300048919 Ga0496116_0105176 Ga0496116_0105176_61_681 206
661 3300048920 Ga0496117_0029279 Ga0496117_0029279_2981_3601 206
662 3300048920 Ga0496117_0114439 Ga0496117_0114439_204_824 206
663 3300048920 Ga0496117_0347496 Ga0496117_0347496_104_724 206
664 3300048921 Ga0496118_0007557 Ga0496118_0007557_271_891 206
665 3300048921 Ga0496118_0057870 Ga0496118_0057870_1033_1653 206
666 3300048924 Ga0496121_0023232 Ga0496121_0023232_1087_1707 206
667 3300048925 Ga0496122_0000331 Ga0496122_0000331_49963_50583 206
668 3300048925 Ga0496122_0076122 Ga0496122_0076122_303_923 206
669 3300048926 Ga0496123_0000124 Ga0496123_0000124_13232_13852 206
670 3300048926 Ga0496123_0056696 Ga0496123_0056696_387_1007 206
671 3300048926 Ga0496123_0065327 Ga0496123_0065327_1291_1911 206
672 3300048926 Ga0496123_0084147 Ga0496123_0084147_740_1360 206
673 3300048926 Ga0496123_0140086 Ga0496123_0140086_613_1242 206
674 3300048927 Ga0496124_0041767 Ga0496124_0041767_2269_2889 206
675 3300048927 Ga0496124_0088951 Ga0496124_0088951_301_921 206
676 3300048927 Ga0496124_0096092 Ga0496124_0096092_1367_1987 206
677 3300048928 Ga0496125_0000522 Ga0496125_0000522_54200_54820 206
678 3300048928 Ga0496125_0008570 Ga0496125_0008570_786_1406 206
679 3300048928 Ga0496125_0010233 Ga0496125_0010233_4556_5176 206
680 3300048928 Ga0496125_0024515 Ga0496125_0024515_1582_2202 206
681 3300048928 Ga0496125_0053052 Ga0496125_0053052_672_1292 206
682 3300048928 Ga0496125_0055567 Ga0496125_0055567_1986_2624 206
683 3300048928 Ga0496125_0085350 Ga0496125_0085350_1400_2047 206
684 3300048928 Ga0496125_0109704 Ga0496125_0109704_686_1306 206
685 3300048929 Ga0496126_0043356 Ga0496126_0043356_970_1590 206
686 3300048929 Ga0496126_0077296 Ga0496126_0077296_42_662 206
687 3300048929 Ga0496126_0086157 Ga0496126_0086157_2054_2674 206
688 3300049130 Ga0501310_012752 Ga0501310_012752_232_852 206
689 3300049568 Ga0501031_0008183 Ga0501031_0008183_1626_2255 206
690 3300049570 Ga0501033_0350124 Ga0501033_0350124_383_1003 206
691 3300049571 Ga0501034_0315662 Ga0501034_0315662_53_673 206
692 3300049571 Ga0501034_0451146 Ga0501034_0451146_55_675 206
693 3300049572 Ga0501036_0388512 Ga0501036_0388512_206_826 206
694 3300049579 Ga0501043_0228209 Ga0501043_0228209_611_1231 206
695 3300049579 Ga0501043_0317600 Ga0501043_0317600_67_687 206
696 3300049580 Ga0501046_0065033 Ga0501046_0065033_187_807 206
697 3300049581 Ga0501047_0592282 Ga0501047_0592282_55_675 206
698 3300049583 Ga0501067_0380650 Ga0501067_0380650_10_630 206
699 3300049589 Ga0501073_0360247 Ga0501073_0360247_238_858 206
700 3300049663 Ga0501223_043704 Ga0501223_043704_93_713 206
701 3300049679 Ga0501249_002817 Ga0501249_002817_1573_2193 206
702 3300049705 Ga0501225_0028728 Ga0501225_0028728_473_1093 206
703 3300049742 Ga0501080_0046276 Ga0501080_0046276_507_1127 206
704 3300049759 Ga0501262_000738 Ga0501262_000738_1508_2128 206
705 3300049763 Ga0501266_021566 Ga0501266_021566_171_791 206
706 3300049822 Ga0501035_0200756 Ga0501035_0200756_876_1496 206
707 3300049822 Ga0501035_0294754 Ga0501035_0294754_585_1205 206
708 3300049823 Ga0501044_0124106 Ga0501044_0124106_1334_1954 206
709 3300049823 Ga0501044_0682827 Ga0501044_0682827_29_649 206
710 3300050489 nmdc:mga03683_126211_c1 nmdc:mga03683_126211_c1_152_772 206
711 3300050489 nmdc:mga03683_127146_c1 nmdc:mga03683_127146_c1_67_687 206
712 3300050489 nmdc:mga03683_19660_c1 nmdc:mga03683_19660_c1_1472_2092 206
713 3300050489 nmdc:mga03683_29659_c1 nmdc:mga03683_29659_c1_629_1249 206
714 3300050490 nmdc:mga03n38_14244_c1 nmdc:mga03n38_14244_c1_1065_1685 206
715 3300050490 nmdc:mga03n38_204876_c1 nmdc:mga03n38_204876_c1_308_928 206
716 3300050490 nmdc:mga03n38_243523_c1 nmdc:mga03n38_243523_c1_198_818 206
717 3300050491 nmdc:mga00v17_3326_c1 nmdc:mga00v17_3326_c1_1041_1661 206
718 3300050491 nmdc:mga00v17_499356_c1 nmdc:mga00v17_499356_c1_113_733 206
719 3300050492 nmdc:mga0yw44_26196_c1 nmdc:mga0yw44_26196_c1_2548_3168 206
720 3300050492 nmdc:mga0yw44_34273_c1 nmdc:mga0yw44_34273_c1_731_1351 206
721 3300050492 nmdc:mga0yw44_404726_c1 nmdc:mga0yw44_404726_c1_35_655 206
722 3300050493 nmdc:mga0k408_213658_c1 nmdc:mga0k408_213658_c1_155_775 206
723 3300050493 nmdc:mga0k408_305474_c1 nmdc:mga0k408_305474_c1_166_786 206
724 3300050493 nmdc:mga0k408_422527_c1 nmdc:mga0k408_422527_c1_153_773 206
725 3300050493 nmdc:mga0k408_52363_c1 nmdc:mga0k408_52363_c1_1335_1955 206
726 3300050493 nmdc:mga0k408_738_c1 nmdc:mga0k408_738_c1_3326_3946 206
727 3300050493 nmdc:mga0k408_92167_c1 nmdc:mga0k408_92167_c1_98_718 206
728 3300050494 nmdc:mga06z11_163388_c1 nmdc:mga06z11_163388_c1_620_1240 206
729 3300050495 nmdc:mga04h51_56225_c1 nmdc:mga04h51_56225_c1_186_806 206
730 3300050496 nmdc:mga07m45_120095_c1 nmdc:mga07m45_120095_c1_375_995 206
731 3300050496 nmdc:mga07m45_145660_c1 nmdc:mga07m45_145660_c1_627_1247 206
732 3300050496 nmdc:mga07m45_22907_c1 nmdc:mga07m45_22907_c1_1424_2044 206
733 3300050496 nmdc:mga07m45_283_c1 nmdc:mga07m45_283_c1_18697_19317 206
734 3300050496 nmdc:mga07m45_317061_c1 nmdc:mga07m45_317061_c1_156_776 206
735 3300050496 nmdc:mga07m45_70512_c1 nmdc:mga07m45_70512_c1_691_1311 206
736 3300050516 nmdc:mga0sz30_255246_c1 nmdc:mga0sz30_255246_c1_47_667 206
737 3300053079 Ga0500610_0042474 Ga0500610_0042474_556_1194 206
738 3300053080 Ga0500635_0180315 Ga0500635_0180315_84_704 206
739 3300053087 Ga0500643_018032 Ga0500643_018032_1093_1731 206
740 3300053088 Ga0500644_0001842 Ga0500644_0001842_3670_4290 206
741 3300053088 Ga0500644_0009713 Ga0500644_0009713_689_1309 206
742 3300053092 Ga0500583_0171344 Ga0500583_0171344_323_943 206
743 3300053093 Ga0500651_0000560 Ga0500651_0000560_15128_15748 206
744 3300053094 Ga0500566_0098880 Ga0500566_0098880_778_1398 206
745 3300053098 Ga0500650_0216580 Ga0500650_0216580_63_683 206
746 3300053103 Ga0500555_098708 Ga0500555_098708_42_680 206
747 3300053108 Ga0500562_034163 Ga0500562_034163_215_835 206
748 3300053110 Ga0500571_000133 Ga0500571_000133_22944_23564 206
749 3300053116 Ga0500592_005679 Ga0500592_005679_339_977 206
750 3300053117 Ga0500593_000065 Ga0500593_000065_18033_18653 206
751 3300053117 Ga0500593_016801 Ga0500593_016801_950_1588 206
752 3300053118 Ga0500594_0002530 Ga0500594_0002530_1725_2363 206
753 3300053120 Ga0500597_083739 Ga0500597_083739_81_701 206
754 3300053121 Ga0500607_000674 Ga0500607_000674_31776_32414 206
755 3300053133 Ga0500655_001239 Ga0500655_001239_61_681 206
756 3300053134 Ga0500658_0134915 Ga0500658_0134915_391_1011 206
757 3300053136 Ga0500559_0000975 Ga0500559_0000975_16337_16957 206
758 3300053136 Ga0500559_0201170 Ga0500559_0201170_137_757 206
759 3300053138 Ga0500564_097741 Ga0500564_097741_123_743 206
760 3300053139 Ga0500568_0014612 Ga0500568_0014612_1158_1778 206
761 3300053141 Ga0500574_078088 Ga0500574_078088_64_684 206
762 3300053153 Ga0500616_0009752 Ga0500616_0009752_1813_2433 206
763 3300053156 Ga0500622_0202202 Ga0500622_0202202_178_798 206
764 3300053157 Ga0500624_010138 Ga0500624_010138_183_803 206
765 3300053158 Ga0500627_0001528 Ga0500627_0001528_728_1366 206
766 3300053161 Ga0500634_0018009 Ga0500634_0018009_1476_2114 206
767 3300053177 Ga0500636_0072585 Ga0500636_0072585_123_743 206
768 3300053730 Ga0500645_086468 Ga0500645_086468_80_700 206
769 3300053730 Ga0500645_087961 Ga0500645_087961_49_687 206
770 3300059424 Ga0590075_026524 Ga0590075_026524_819_1439 206
771 iso_pu_bacteria 2831265667 2831268089 206
772 iso_pu_bacteria 2885198086 2885203148 206
773 iso_pu_bacteria 2885211737 2885216455 206
774 iso_pu_bacteria 2928037797 2928041072 206
775 iso_pu_bacteria 2928044640 2928047914 206
776 iso_pu_bacteria 2928051484 2928055809 206
777 iso_pu_bacteria 2928070936 2928075223 206
778 iso_pu_bacteria 2939631187 2939631406 206
779 iso_pu_bacteria 2945909444 2945909935 206
780 iso_pu_bacteria 2945984333 2945988104 206
781 iso_pu_bacteria 2954767861 2954768960 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00625

Guanylate_kin

Guanylate kinase

15

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yki-assembly1.cif.gz_A crystal structure of magi2 pdz0-gk domain in complex with phospho-sapap1 gbr3 peptide 0.9592 36 85
2f3t-assembly1.cif.gz_C crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.955 4 204
2f3t-assembly1.cif.gz_C crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate 0.9411 4 204
2anc-assembly1.cif.gz_F crystal structure of unliganded form of oligomeric e.coli guanylate kinase 0.9309 4 203
1z8f-assembly1.cif.gz_A guanylate kinase double mutant a58c, t157c from mycobacterium tuberculosis (rv1389) 0.9273 4 182
ID Description Score Start End Superfamily
af_Q94JM2_119_167_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9985 36 83 3.30.63.10
1s96B02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9893 36 95 3.30.63.10
af_Q2QPW1_160_210_3.30.63.10 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9755 36 85 3.30.63.10
1s96B02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9731 36 95 3.30.63.10
1s4qA02 Alpha Beta;2-Layer Sandwich;Guanylate Kinase phosphate binding domain;Guanylate Kinase phosphate binding domain 0.9653 36 95 3.30.63.10
ID Description Score Start End GO Terms
AF-Q12DV7-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9703 1 206 GO:0004385
GO:0005524
GO:0005829
AF-A0A2M8DQ33-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9669 3 182 GO:0004385
GO:0005524
GO:0005829
AF-A0A350H9Q1-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9649 1 185 GO:0004385
GO:0005524
GO:0005829
AF-A0A0Q7CNE3-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9622 1 206 GO:0004385
GO:0005524
GO:0005829
AF-A0A6J4I1N2-F1-model_v4 Guanylate kinase (EC 2.7.4.8) (GMP kinase) 0.9621 1 189 GO:0004385
GO:0005524
GO:0005829

Feature Viewer

pLDDT pTM Quality
92.22 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map