F480513

General Info

Members Datasets Scaffolds Average Seq Length
780 368 770 566

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10128100|Ga0105240_101281001
Length 628
Sequence MPTGAKNFEEPYGKHHRWSHFPGFVCVFALRNAQAGKLLTDFTMQTSGWIQLGLFVALLALITKPMGLYLVQVLDANGKTWLDPVLKPFERLTYRLLGVRADEEHDWRRYTWAMLLFSLVSCVFTYAILRLQDKLPFQSLFNPQGLPGLTPHLAFNTAVSFTTNTNWQSYGGESTMSYFSQMVALTIHNFTSAAVGIALAAALVRGIARHSTKLIGNFWVDVVRLTYYLLLPICLVFALFLVSQGMIQNFKPYTKAKLVEPMKISVAKTDKDGKPDQLVEEQTIVQGPMASQVAIKMLGTNGGGYANANAAHPFENPTPLSNFIQMLSIFAIGSGLTYYLGRMVKNQKHGWAVWAAMTILFLGGTVLCWWAEAKGNPIHQQLGVIAADGNMEGKEVRFGLFNSALFATITTDASCGAVNSMHDSFTALGGFIPLFNIQLGEIIFGGVGAGLYGMIVFIVLAVFIAGLMVGRTPEYLGKKIHSFEVKMAMLALLVXXXDILAFAAWAAVSQWGLAGLNNTGPHGLSAMLYAFSSGTGNNGSAFAGLTTNTPWYNTTLGIAMLVGRFLMIIPIMAMAGALAEKKLIPASAGTFVILLLGTILLVGALNFLPVLALGPIVEHFLMLKGTLF

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
6 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
7 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
8 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
246 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
247 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
248 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
249 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
273 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
297 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
355 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
356 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
357 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.56
Nodule 0
Rhizoplane 1.92
Rhizosphere 87.56
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003251 3300001904 Bacteria 2828
2 JGI24741J21665_1000047 3300001915 Bacteria 29688
3 JGI24746J21847_1001047 3300001977 Bacteria 4345
4 JGI24739J22299_10001426 3300001989 Bacteria 8995
5 JGI24735J21928_10001887 3300002067 Bacteria 7356
6 JGI24735J21928_10006499 3300002067 Bacteria 3845
7 JGI24744J21845_10003434 3300002077 Bacteria 3256
8 JGI24751J29686_10000055 3300002459 Bacteria 64731
9 JGI25165J46597_1000173 3300003214 Bacteria 100834
10 rootH2_10055959 3300003320 Bacteria 4324
11 Ga0055536_1003196 3300003781 Bacteria 8879
12 Ga0055530_10000028 3300003791 Bacteria 128474
13 Ga0055531_10000971 3300003794 Bacteria 22919
14 Ga0055531_10001496 3300003794 Bacteria 17161
15 JGI25405J52794_10001065 3300003911 Bacteria 4382
16 Ga0065165_1010373 3300005262 Bacteria 4039
17 Ga0065704_10079831 3300005289 Bacteria 4072
18 Ga0065712_10009254 3300005290 Bacteria 3788
19 Ga0065715_10108316 3300005293 Bacteria 2709
20 Ga0065707_10008947 3300005295 Bacteria 3364
21 Ga0065707_10099641 3300005295 Bacteria 2975
22 Ga0065707_10104456 3300005295 Bacteria 2694
23 Ga0070658_10001414 3300005327 Bacteria 20533
24 Ga0070658_10004898 3300005327 Bacteria 10909
25 Ga0070676_10033259 3300005328 Bacteria 2958
26 Ga0070676_10049757 3300005328 Bacteria 2454
27 Ga0070676_10058369 3300005328 Bacteria 2287
28 Ga0070683_100111165 3300005329 Bacteria 2585
29 Ga0070690_100053179 3300005330 Bacteria 2590
30 Ga0070670_100001196 3300005331 Bacteria 20604
31 Ga0070670_100016887 3300005331 Bacteria 6266
32 Ga0070670_100023871 3300005331 Bacteria 5261
33 Ga0070670_100084662 3300005331 Bacteria 2724
34 Ga0068869_100000086 3300005334 Bacteria 42241
35 Ga0070666_10000057 3300005335 Bacteria 91177
36 Ga0070666_10011221 3300005335 Bacteria 5619
37 Ga0070682_100009293 3300005337 Bacteria 5565
38 Ga0068868_100047428 3300005338 Bacteria 3367
39 Ga0070689_100003098 3300005340 Bacteria 10975
40 Ga0070689_100075257 3300005340 Bacteria 2643
41 Ga0070668_100002466 3300005347 Bacteria 13623
42 Ga0070668_100017464 3300005347 Bacteria 5378
43 Ga0070668_100024340 3300005347 Bacteria 4586
44 Ga0070668_100042888 3300005347 Bacteria 3467
45 Ga0070669_100000004 3300005353 Bacteria 314707
46 Ga0070669_100012314 3300005353 Bacteria 6068
47 Ga0070671_100000029 3300005355 Bacteria 112712
48 Ga0070671_100021738 3300005355 Bacteria 5239
49 Ga0070671_100026407 3300005355 Bacteria 4772
50 Ga0070671_100077042 3300005355 Bacteria 2786
51 Ga0070674_100037553 3300005356 Bacteria 3259
52 Ga0070674_100044383 3300005356 Bacteria 3030
53 Ga0070673_100020155 3300005364 Bacteria 4804
54 Ga0070673_100041977 3300005364 Bacteria 3523
55 Ga0070688_100067559 3300005365 Bacteria 2277
56 Ga0070659_100009846 3300005366 Bacteria 7030
57 Ga0070667_100005017 3300005367 Bacteria 11080
58 Ga0070667_100006806 3300005367 Bacteria 9493
59 Ga0070667_100014200 3300005367 Bacteria 6579
60 Ga0070667_100026251 3300005367 Bacteria 4844
61 Ga0070667_100027783 3300005367 Bacteria 4708
62 Ga0070703_10000387 3300005406 Bacteria 18520
63 Ga0070714_100001634 3300005435 Bacteria 16312
64 Ga0070713_100153342 3300005436 Bacteria 2051
65 Ga0070705_100001737 3300005440 Bacteria 11329
66 Ga0070700_100065267 3300005441 Bacteria 2308
67 Ga0070708_100011564 3300005445 Bacteria 7186
68 Ga0070708_100013918 3300005445 Bacteria 6608
69 Ga0070708_100042525 3300005445 Bacteria 3989
70 Ga0070708_100208127 3300005445 Bacteria 1833
71 Ga0070678_100030709 3300005456 Bacteria 3697
72 Ga0070678_100111501 3300005456 Bacteria 2141
73 Ga0070662_100022504 3300005457 Bacteria 4317
74 Ga0070681_10005122 3300005458 Bacteria 12653
75 Ga0068867_100000124 3300005459 Bacteria 49521
76 Ga0068867_100000596 3300005459 Bacteria 23910
77 Ga0068867_100037165 3300005459 Bacteria 3539
78 Ga0070685_10003083 3300005466 Bacteria 8477
79 Ga0070706_100000011 3300005467 Bacteria 198585
80 Ga0070706_100002067 3300005467 Bacteria 20512
81 Ga0070706_100010532 3300005467 Bacteria 8584
82 Ga0070706_100035218 3300005467 Bacteria 4623
83 Ga0070707_100014606 3300005468 Bacteria 7362
84 Ga0070707_100043592 3300005468 Bacteria 4293
85 Ga0070707_100110532 3300005468 Bacteria 2665
86 Ga0070698_100002638 3300005471 Bacteria 19754
87 Ga0070698_100007185 3300005471 Bacteria 12065
88 Ga0070698_100028917 3300005471 Bacteria 5754
89 Ga0070698_100063262 3300005471 Bacteria 3732
90 Ga0070699_100000089 3300005518 Bacteria 87470
91 Ga0070699_100023100 3300005518 Bacteria 5358
92 Ga0070699_100098764 3300005518 Bacteria 2558
93 Ga0070697_100001987 3300005536 Bacteria 15658
94 Ga0070697_100004449 3300005536 Bacteria 10767
95 Ga0070697_100011528 3300005536 Bacteria 6908
96 Ga0068853_100021318 3300005539 Bacteria 5401
97 Ga0070686_100010603 3300005544 Bacteria 5204
98 Ga0070665_100001672 3300005548 Bacteria 25562
99 Ga0070704_100015233 3300005549 Bacteria 4825
100 Ga0068855_100000921 3300005563 Bacteria 36597
101 Ga0068855_100005065 3300005563 Bacteria 16074
102 Ga0068855_100027503 3300005563 Bacteria 6802
103 Ga0070664_100011678 3300005564 Bacteria 7127
104 Ga0068857_100000176 3300005577 Bacteria 40531
105 Ga0068857_100062408 3300005577 Bacteria 3312
106 Ga0068854_100004135 3300005578 Bacteria 9119
107 Ga0068856_100020716 3300005614 Bacteria 6388
108 Ga0068852_100023583 3300005616 Bacteria 4955
109 Ga0068859_100000370 3300005617 Bacteria 44819
110 Ga0068859_100002609 3300005617 Bacteria 18330
111 Ga0068859_100008329 3300005617 Bacteria 10508
112 Ga0068859_100099460 3300005617 Bacteria 2964
113 Ga0068864_100001088 3300005618 Bacteria 22775
114 Ga0068864_100012451 3300005618 Bacteria 7033
115 Ga0068864_100058101 3300005618 Bacteria 3342
116 Ga0068861_100003376 3300005719 Bacteria 10583
117 Ga0068863_100000006 3300005841 Bacteria 265379
118 Ga0068863_100000259 3300005841 Bacteria 55368
119 Ga0068863_100001229 3300005841 Bacteria 25559
120 Ga0068863_100021158 3300005841 Bacteria 6212
121 Ga0068863_100028402 3300005841 Bacteria 5341
122 Ga0068858_100000102 3300005842 Bacteria 88959
123 Ga0068858_100002318 3300005842 Bacteria 19230
124 Ga0068860_100000119 3300005843 Bacteria 127040
125 Ga0068860_100027677 3300005843 Bacteria 5458
126 Ga0068860_100032015 3300005843 Bacteria 5056
127 Ga0068862_100000538 3300005844 Bacteria 39616
128 Ga0068862_100001724 3300005844 Bacteria 19782
129 Ga0068862_100041857 3300005844 Bacteria 3899
130 Ga0081455_10000398 3300005937 Bacteria 57265
131 Ga0081455_10001384 3300005937 Bacteria 29929
132 Ga0081455_10020762 3300005937 Bacteria 6174
133 Ga0081455_10022661 3300005937 Bacteria 5862
134 Ga0081538_10001293 3300005981 Bacteria 25953
135 Ga0081538_10016797 3300005981 Bacteria 5589
136 Ga0081538_10019422 3300005981 Bacteria 5052
137 Ga0081540_1000010 3300005983 Bacteria 193206
138 Ga0081540_1045285 3300005983 Bacteria 2236
139 Ga0081539_10009526 3300005985 Bacteria 8091
140 Ga0070717_10003667 3300006028 Bacteria 11021
141 Ga0075368_10000386 3300006042 Bacteria 12961
142 Ga0075363_100005451 3300006048 Bacteria 5661
143 Ga0075363_100008802 3300006048 Bacteria 4720
144 Ga0070712_100015642 3300006175 Bacteria 4891
145 Ga0070712_100061474 3300006175 Bacteria 2653
146 Ga0075362_10008771 3300006177 Bacteria 3884
147 Ga0075367_10000494 3300006178 Bacteria 14805
148 Ga0075366_10005154 3300006195 Bacteria 7070
149 Ga0097621_100077117 3300006237 Bacteria 2766
150 Ga0075370_10004047 3300006353 Bacteria 7048
151 Ga0075370_10009261 3300006353 Bacteria 5106
152 Ga0068871_100004028 3300006358 Bacteria 10148
153 Ga0068871_100005532 3300006358 Bacteria 8862
154 Ga0075428_100005871 3300006844 Bacteria 13639
155 Ga0075431_100173221 3300006847 Bacteria 2217
156 Ga0075433_10006296 3300006852 Bacteria 9374
157 Ga0075429_100054412 3300006880 Bacteria 3481
158 Ga0075429_100166539 3300006880 Bacteria 1931
159 Ga0068865_100001574 3300006881 Bacteria 13329
160 Ga0075436_100044026 3300006914 Bacteria 3077
161 Ga0097620_100000370 3300006931 Bacteria 44819
162 Ga0097620_100008329 3300006931 Bacteria 10508
163 Ga0097620_100099458 3300006931 Bacteria 2964
164 Ga0075435_100028686 3300007076 Bacteria 4366
165 Ga0105244_10002893 3300009036 Bacteria 12696
166 Ga0105240_10000163 3300009093 Bacteria 136503
167 Ga0105240_10002613 3300009093 Bacteria 28786
168 Ga0105240_10008262 3300009093 Bacteria 14900
169 Ga0105240_10040387 3300009093 Bacteria 5968
170 Ga0105240_10128100 3300009093 Bacteria 3047
171 Ga0111539_10011192 3300009094 Bacteria 11275
172 Ga0111539_10016208 3300009094 Bacteria 9246
173 Ga0111539_10119710 3300009094 Bacteria 3085
174 Ga0105245_10001046 3300009098 Bacteria 25053
175 Ga0105247_10034777 3300009101 Bacteria 3069
176 Ga0114129_10021725 3300009147 Bacteria 9107
177 Ga0105243_10000049 3300009148 Bacteria 145575
178 Ga0105241_10002560 3300009174 Bacteria 13653
179 Ga0105241_10067719 3300009174 Bacteria 2764
180 Ga0105248_10000014 3300009177 Bacteria 324729
181 Ga0105248_10023788 3300009177 Bacteria 6809
182 Ga0105248_10064297 3300009177 Bacteria 4119
183 Ga0105237_10003590 3300009545 Bacteria 18358
184 Ga0105238_10004619 3300009551 Bacteria 13631
185 Ga0105238_10013389 3300009551 Bacteria 8279
186 Ga0105238_10020205 3300009551 Bacteria 6779
187 Ga0105249_10000161 3300009553 Bacteria 80491
188 Ga0105249_10002596 3300009553 Bacteria 15646
189 Ga0105249_10037655 3300009553 Bacteria 4389
190 Ga0157370_10000095 3300013104 Bacteria 100727
191 Ga0157369_10007626 3300013105 Bacteria 12449
192 Ga0157369_10242734 3300013105 Bacteria 1881
193 Ga0157374_10010673 3300013296 Bacteria 7912
194 Ga0157378_10002107 3300013297 Bacteria 17725
195 Ga0157378_10046360 3300013297 Bacteria 3864
196 Ga0163162_10026948 3300013306 Bacteria 5683
197 Ga0163162_10059451 3300013306 Bacteria 3854
198 Ga0163162_10121945 3300013306 Bacteria 2711
199 Ga0157372_10027415 3300013307 Bacteria 6203
200 Ga0157372_10147063 3300013307 Bacteria 2717
201 Ga0157375_10000040 3300013308 Bacteria 164344
202 Ga0157375_10021788 3300013308 Bacteria 5885
203 Ga0157375_10090254 3300013308 Bacteria 3122
204 Ga0163163_10000165 3300014325 Bacteria 69209
205 Ga0163163_10054212 3300014325 Bacteria 3961
206 Ga0157380_10099388 3300014326 Bacteria 2420
207 Ga0157380_10101358 3300014326 Bacteria 2399
208 Ga0157377_10000732 3300014745 Bacteria 13549
209 Ga0157377_10030284 3300014745 Bacteria 2930
210 Ga0157379_10011558 3300014968 Bacteria 7706
211 Ga0157379_10034206 3300014968 Bacteria 4530
212 Ga0157376_10052923 3300014969 Bacteria 3378
213 Ga0157376_10094614 3300014969 Bacteria 2596
214 Ga0157376_10096419 3300014969 Bacteria 2574
215 Ga0163161_10006031 3300017792 Bacteria 8399
216 Ga0163161_10037083 3300017792 Bacteria 3494
217 Ga0213871_10003745 3300021441 Bacteria 2971
218 Ga0207427_101282 3300025231 Bacteria 9565
219 Ga0209148_1000749 3300025254 Bacteria 24958
220 Ga0209233_1000003 3300025261 Bacteria 1607366
221 Ga0209675_1000235 3300025291 Bacteria 55378
222 Ga0209676_1000045 3300025292 Bacteria 412331
223 Ga0209676_1000220 3300025292 Bacteria 125094
224 Ga0209676_1000246 3300025292 Bacteria 116315
225 Ga0209025_1014254 3300025294 Bacteria 4910
226 Ga0209050_1000112 3300025298 Bacteria 210320
227 Ga0209050_1005294 3300025298 Bacteria 8204
228 Ga0209050_1011460 3300025298 Bacteria 4196
229 Ga0209257_1000169 3300025304 Bacteria 171227
230 Ga0209257_1000213 3300025304 Bacteria 138144
231 Ga0209257_1001548 3300025304 Bacteria 26689
232 Ga0207697_10000135 3300025315 Bacteria 35637
233 Ga0207697_10000301 3300025315 Bacteria 27565
234 Ga0207697_10001649 3300025315 Bacteria 12068
235 Ga0207655_1000130 3300025728 Bacteria 148370
236 Ga0207653_10000176 3300025885 Bacteria 44920
237 Ga0207710_10017369 3300025900 Bacteria 3052
238 Ga0207710_10047055 3300025900 Bacteria 1927
239 Ga0207688_10003054 3300025901 Bacteria 9124
240 Ga0207688_10025054 3300025901 Bacteria 3274
241 Ga0207688_10053845 3300025901 Bacteria 2257
242 Ga0207680_10000316 3300025903 Bacteria 23086
243 Ga0207699_10069411 3300025906 Bacteria 2149
244 Ga0207645_10009360 3300025907 Bacteria 6782
245 Ga0207645_10025139 3300025907 Bacteria 3855
246 Ga0207645_10056150 3300025907 Bacteria 2514
247 Ga0207645_10068074 3300025907 Bacteria 2276
248 Ga0207643_10054706 3300025908 Bacteria 2269
249 Ga0207705_10000155 3300025909 Bacteria 73779
250 Ga0207705_10003229 3300025909 Bacteria 12409
251 Ga0207684_10000052 3300025910 Bacteria 228510
252 Ga0207684_10001151 3300025910 Bacteria 29527
253 Ga0207684_10012294 3300025910 Bacteria 7451
254 Ga0207684_10017741 3300025910 Bacteria 6106
255 Ga0207684_10030423 3300025910 Bacteria 4595
256 Ga0207684_10048039 3300025910 Bacteria 3620
257 Ga0207695_10000472 3300025913 Bacteria 87457
258 Ga0207695_10025841 3300025913 Bacteria 6564
259 Ga0207695_10029573 3300025913 Bacteria 6048
260 Ga0207695_10065360 3300025913 Bacteria 3740
261 Ga0207671_10012807 3300025914 Bacteria 6721
262 Ga0207663_10002821 3300025916 Bacteria 8387
263 Ga0207663_10026621 3300025916 Bacteria 3359
264 Ga0207663_10042639 3300025916 Bacteria 2773
265 Ga0207662_10005326 3300025918 Bacteria 6843
266 Ga0207646_10005357 3300025922 Bacteria 13511
267 Ga0207646_10011262 3300025922 Bacteria 8685
268 Ga0207646_10015134 3300025922 Bacteria 7297
269 Ga0207646_10077903 3300025922 Bacteria 2962
270 Ga0207646_10130152 3300025922 Bacteria 2265
271 Ga0207681_10000010 3300025923 Bacteria 403379
272 Ga0207681_10020639 3300025923 Bacteria 4178
273 Ga0207681_10050098 3300025923 Bacteria 2825
274 Ga0207694_10016478 3300025924 Bacteria 5581
275 Ga0207694_10016720 3300025924 Bacteria 5545
276 Ga0207694_10031665 3300025924 Bacteria 4042
277 Ga0207694_10043451 3300025924 Bacteria 3469
278 Ga0207694_10061439 3300025924 Bacteria 2924
279 Ga0207650_10000050 3300025925 Bacteria 169589
280 Ga0207650_10030620 3300025925 Bacteria 3878
281 Ga0207659_10028321 3300025926 Bacteria 3806
282 Ga0207644_10000007 3300025931 Bacteria 381778
283 Ga0207644_10066929 3300025931 Bacteria 2617
284 Ga0207706_10006115 3300025933 Bacteria 11181
285 Ga0207709_10000097 3300025935 Bacteria 136507
286 Ga0207670_10001459 3300025936 Bacteria 12408
287 Ga0207704_10047124 3300025938 Bacteria 2574
288 Ga0207665_10048256 3300025939 Bacteria 2857
289 Ga0207711_10000021 3300025941 Bacteria 355952
290 Ga0207711_10138592 3300025941 Bacteria 2187
291 Ga0207689_10000023 3300025942 Bacteria 107806
292 Ga0207661_10017338 3300025944 Bacteria 5326
293 Ga0207667_10037040 3300025949 Bacteria 5218
294 Ga0207651_10024723 3300025960 Bacteria 3721
295 Ga0207651_10045644 3300025960 Bacteria 2940
296 Ga0207712_10000059 3300025961 Bacteria 137849
297 Ga0207712_10001010 3300025961 Bacteria 20031
298 Ga0207712_10003209 3300025961 Bacteria 10390
299 Ga0207668_10000327 3300025972 Bacteria 30795
300 Ga0207668_10000492 3300025972 Bacteria 24731
301 Ga0207668_10019718 3300025972 Bacteria 4269
302 Ga0207668_10036247 3300025972 Bacteria 3290
303 Ga0207668_10046546 3300025972 Bacteria 2964
304 Ga0207640_10000314 3300025981 Bacteria 32442
305 Ga0207658_10000749 3300025986 Bacteria 27980
306 Ga0207658_10001925 3300025986 Bacteria 15494
307 Ga0207658_10004256 3300025986 Bacteria 9971
308 Ga0207703_10000190 3300026035 Bacteria 72096
309 Ga0207703_10008968 3300026035 Bacteria 7879
310 Ga0207639_10000511 3300026041 Bacteria 26861
311 Ga0207639_10033193 3300026041 Bacteria 3805
312 Ga0207678_10000053 3300026067 Bacteria 88489
313 Ga0207702_10004291 3300026078 Bacteria 12711
314 Ga0207702_10072844 3300026078 Bacteria 2961
315 Ga0207641_10000054 3300026088 Bacteria 170887
316 Ga0207641_10000482 3300026088 Bacteria 45003
317 Ga0207641_10024217 3300026088 Bacteria 5004
318 Ga0207641_10155560 3300026088 Bacteria 2074
319 Ga0207648_10000083 3300026089 Bacteria 89416
320 Ga0207648_10001277 3300026089 Bacteria 28143
321 Ga0207648_10028640 3300026089 Bacteria 4937
322 Ga0207676_10000004 3300026095 Bacteria 725417
323 Ga0207674_10001786 3300026116 Bacteria 27456
324 Ga0207674_10003039 3300026116 Bacteria 20778
325 Ga0207675_100003014 3300026118 Bacteria 16514
326 Ga0207675_100038057 3300026118 Bacteria 4489
327 Ga0207683_10008702 3300026121 Bacteria 8672
328 Ga0207698_10016690 3300026142 Bacteria 4959
329 Ga0209813_10000023 3300027866 Bacteria 72775
330 Ga0207428_10000139 3300027907 Bacteria 98277
331 Ga0207428_10004571 3300027907 Bacteria 13117
332 Ga0268266_10020391 3300028379 Bacteria 5650
333 Ga0268266_10039321 3300028379 Bacteria 4028
334 Ga0268265_10000255 3300028380 Bacteria 60546
335 Ga0268265_10000281 3300028380 Bacteria 57698
336 Ga0268265_10022662 3300028380 Bacteria 4416
337 Ga0268264_10000128 3300028381 Bacteria 183164
338 Ga0268264_10000218 3300028381 Bacteria 113449
339 Ga0268264_10009366 3300028381 Bacteria 8106
340 Ga0268264_10105137 3300028381 Bacteria 2462
341 Ga0265337_1000035 3300028556 Bacteria 58448
342 Ga0265337_1000467 3300028556 Bacteria 21420
343 Ga0265337_1001667 3300028556 Bacteria 10777
344 Ga0265337_1003994 3300028556 Bacteria 6240
345 Ga0265326_10002757 3300028558 Bacteria 5891
346 Ga0265326_10004597 3300028558 Bacteria 4408
347 Ga0265319_1000001 3300028563 Bacteria 549513
348 Ga0265319_1000080 3300028563 Bacteria 75462
349 Ga0265319_1000767 3300028563 Bacteria 20851
350 Ga0265319_1000857 3300028563 Bacteria 19336
351 Ga0265319_1001183 3300028563 Bacteria 16145
352 Ga0265319_1004676 3300028563 Bacteria 6715
353 Ga0265319_1010337 3300028563 Bacteria 3899
354 Ga0265319_1012344 3300028563 Bacteria 3458
355 Ga0265319_1018558 3300028563 Bacteria 2616
356 Ga0265319_1018863 3300028563 Bacteria 2588
357 Ga0265334_10000081 3300028573 Bacteria 68529
358 Ga0265334_10000445 3300028573 Bacteria 21581
359 Ga0265334_10025849 3300028573 Bacteria 2375
360 Ga0265334_10026217 3300028573 Bacteria 2354
361 Ga0265318_10000124 3300028577 Bacteria 71647
362 Ga0265318_10000213 3300028577 Bacteria 50502
363 Ga0265318_10000325 3300028577 Bacteria 38213
364 Ga0265318_10000833 3300028577 Bacteria 20287
365 Ga0265318_10001256 3300028577 Bacteria 15349
366 Ga0265318_10002479 3300028577 Bacteria 9857
367 Ga0265318_10003845 3300028577 Bacteria 7429
368 Ga0265318_10006104 3300028577 Bacteria 5584
369 Ga0265318_10009527 3300028577 Bacteria 4265
370 Ga0265323_10000012 3300028653 Bacteria 108344
371 Ga0265323_10000043 3300028653 Bacteria 69334
372 Ga0265322_10009724 3300028654 Bacteria 2792
373 Ga0265336_10000631 3300028666 Bacteria 19394
374 Ga0265338_10000008 3300028800 Bacteria 481542
375 Ga0265338_10000041 3300028800 Bacteria 230676
376 Ga0265338_10000402 3300028800 Bacteria 77555
377 Ga0265338_10000702 3300028800 Bacteria 57422
378 Ga0265338_10000710 3300028800 Bacteria 56899
379 Ga0265338_10001171 3300028800 Bacteria 43298
380 Ga0265338_10001731 3300028800 Bacteria 34533
381 Ga0265338_10001819 3300028800 Bacteria 33490
382 Ga0265338_10003775 3300028800 Bacteria 21045
383 Ga0265338_10005041 3300028800 Bacteria 17437
384 Ga0265338_10006441 3300028800 Bacteria 14965
385 Ga0265338_10006519 3300028800 Bacteria 14840
386 Ga0265338_10007563 3300028800 Bacteria 13434
387 Ga0265338_10009864 3300028800 Bacteria 11306
388 Ga0265338_10011656 3300028800 Bacteria 10125
389 Ga0265338_10011925 3300028800 Bacteria 9972
390 Ga0265338_10016162 3300028800 Bacteria 8141
391 Ga0265338_10017860 3300028800 Bacteria 7622
392 Ga0265338_10017930 3300028800 Bacteria 7604
393 Ga0265338_10025691 3300028800 Bacteria 5968
394 Ga0265338_10068580 3300028800 Bacteria 3055
395 Ga0265338_10074620 3300028800 Bacteria 2883
396 Ga0265338_10100467 3300028800 Bacteria 2359
397 Ga0265338_10138038 3300028800 Bacteria 1913
398 Ga0265324_10000028 3300029957 Bacteria 143704
399 Ga0265324_10000422 3300029957 Bacteria 30430
400 Ga0265324_10000851 3300029957 Bacteria 19621
401 Ga0265324_10004032 3300029957 Bacteria 6757
402 Ga0265324_10008564 3300029957 Bacteria 4059
403 Ga0265324_10008779 3300029957 Bacteria 3988
404 Ga0265324_10009579 3300029957 Bacteria 3774
405 Ga0265324_10012106 3300029957 Bacteria 3264
406 Ga0265324_10012252 3300029957 Bacteria 3242
407 Ga0265330_10000469 3300031235 Bacteria 27057
408 Ga0265330_10001253 3300031235 Bacteria 14878
409 Ga0265330_10002312 3300031235 Bacteria 10469
410 Ga0265330_10003836 3300031235 Bacteria 7740
411 Ga0265330_10023778 3300031235 Bacteria 2781
412 Ga0265332_10000178 3300031238 Bacteria 52516
413 Ga0265332_10011078 3300031238 Bacteria 4006
414 Ga0265332_10012937 3300031238 Bacteria 3700
415 Ga0265328_10005781 3300031239 Bacteria 5280
416 Ga0265320_10000030 3300031240 Bacteria 155388
417 Ga0265320_10000050 3300031240 Bacteria 116002
418 Ga0265320_10000290 3300031240 Bacteria 40860
419 Ga0265320_10000303 3300031240 Bacteria 40288
420 Ga0265320_10000318 3300031240 Bacteria 39227
421 Ga0265320_10000376 3300031240 Bacteria 36363
422 Ga0265320_10002752 3300031240 Bacteria 12138
423 Ga0265320_10003614 3300031240 Bacteria 10334
424 Ga0265320_10004093 3300031240 Bacteria 9578
425 Ga0265320_10010013 3300031240 Bacteria 5668
426 Ga0265320_10011564 3300031240 Bacteria 5186
427 Ga0265320_10025393 3300031240 Bacteria 3115
428 Ga0265320_10034430 3300031240 Bacteria 2576
429 Ga0265325_10000591 3300031241 Bacteria 26441
430 Ga0265325_10004713 3300031241 Bacteria 8545
431 Ga0265325_10015432 3300031241 Bacteria 4295
432 Ga0265329_10000153 3300031242 Bacteria 33838
433 Ga0265329_10000822 3300031242 Bacteria 15803
434 Ga0265329_10005571 3300031242 Bacteria 5074
435 Ga0265329_10009352 3300031242 Bacteria 3663
436 Ga0265340_10000160 3300031247 Bacteria 33915
437 Ga0265340_10004505 3300031247 Bacteria 7775
438 Ga0265340_10018361 3300031247 Bacteria 3608
439 Ga0265339_10003160 3300031249 Bacteria 11595
440 Ga0265339_10003494 3300031249 Bacteria 10987
441 Ga0265331_10000088 3300031250 Bacteria 125176
442 Ga0265331_10000403 3300031250 Bacteria 44394
443 Ga0265331_10001723 3300031250 Bacteria 15748
444 Ga0265331_10005786 3300031250 Bacteria 7406
445 Ga0265331_10016731 3300031250 Bacteria 3843
446 Ga0265331_10030438 3300031250 Bacteria 2687
447 Ga0265327_10000127 3300031251 Bacteria 166247
448 Ga0265327_10000313 3300031251 Bacteria 93102
449 Ga0265327_10000457 3300031251 Bacteria 73150
450 Ga0265327_10000887 3300031251 Bacteria 44153
451 Ga0265327_10000917 3300031251 Bacteria 43226
452 Ga0265327_10003651 3300031251 Bacteria 14462
453 Ga0265327_10003676 3300031251 Bacteria 14368
454 Ga0265327_10004123 3300031251 Bacteria 13126
455 Ga0265327_10008488 3300031251 Bacteria 7639
456 Ga0265327_10012367 3300031251 Bacteria 5766
457 Ga0265327_10026286 3300031251 Bacteria 3374
458 Ga0265327_10029584 3300031251 Bacteria 3114
459 Ga0265316_10000479 3300031344 Bacteria 45442
460 Ga0265316_10000803 3300031344 Bacteria 34665
461 Ga0265316_10002480 3300031344 Bacteria 19122
462 Ga0265316_10003402 3300031344 Bacteria 16104
463 Ga0265316_10006896 3300031344 Bacteria 10779
464 Ga0265316_10009016 3300031344 Bacteria 9200
465 Ga0265316_10013130 3300031344 Bacteria 7378
466 Ga0265316_10018842 3300031344 Bacteria 5925
467 Ga0265316_10045951 3300031344 Bacteria 3463
468 Ga0265316_10129627 3300031344 Bacteria 1900
469 Ga0307513_10087156 3300031456 Bacteria 3197
470 Ga0307408_100000021 3300031548 Bacteria 312158
471 Ga0307408_100001362 3300031548 Bacteria 18234
472 Ga0307408_100008690 3300031548 Bacteria 6708
473 Ga0265313_10000040 3300031595 Bacteria 120713
474 Ga0265313_10000230 3300031595 Bacteria 60452
475 Ga0265313_10000252 3300031595 Bacteria 58494
476 Ga0265313_10000687 3300031595 Bacteria 34809
477 Ga0265313_10005682 3300031595 Bacteria 9100
478 Ga0265313_10007259 3300031595 Bacteria 7611
479 Ga0265313_10019596 3300031595 Bacteria 3759
480 Ga0265313_10024217 3300031595 Bacteria 3247
481 Ga0307508_10000011 3300031616 Bacteria 248001
482 Ga0307508_10000309 3300031616 Bacteria 59143
483 Ga0265314_10000600 3300031711 Bacteria 44965
484 Ga0265314_10000632 3300031711 Bacteria 43168
485 Ga0265314_10001043 3300031711 Bacteria 32303
486 Ga0265314_10002440 3300031711 Bacteria 19047
487 Ga0265314_10002765 3300031711 Bacteria 17523
488 Ga0265314_10005606 3300031711 Bacteria 11278
489 Ga0265314_10006660 3300031711 Bacteria 10155
490 Ga0265314_10006940 3300031711 Bacteria 9916
491 Ga0265314_10014825 3300031711 Bacteria 6215
492 Ga0265342_10000037 3300031712 Bacteria 140873
493 Ga0265342_10003002 3300031712 Bacteria 14161
494 Ga0265342_10005292 3300031712 Bacteria 9890
495 Ga0307405_10026166 3300031731 Bacteria 3362
496 Ga0307413_10014451 3300031824 Bacteria 4010
497 Ga0307413_10022978 3300031824 Bacteria 3372
498 Ga0307406_10000672 3300031901 Bacteria 19299
499 Ga0307406_10004208 3300031901 Bacteria 7832
500 Ga0307406_10042785 3300031901 Bacteria 2830
501 Ga0307407_10000155 3300031903 Bacteria 21204
502 Ga0307412_10000037 3300031911 Bacteria 192170
503 Ga0307412_10000844 3300031911 Bacteria 17637
504 Ga0307412_10009240 3300031911 Bacteria 5651
505 Ga0307412_10035181 3300031911 Bacteria 3198
506 Ga0307409_100008320 3300031995 Bacteria 6288
507 Ga0307416_100002045 3300032002 Bacteria 11357
508 Ga0307414_10000083 3300032004 Bacteria 87233
509 Ga0307414_10002397 3300032004 Bacteria 9809
510 Ga0307414_10029036 3300032004 Bacteria 3595
511 Ga0307414_10109670 3300032004 Bacteria 2097
512 Ga0307411_10001866 3300032005 Bacteria 8969
513 Ga0307411_10053054 3300032005 Bacteria 2654
514 Ga0307411_10073389 3300032005 Bacteria 2327
515 Ga0307415_100009576 3300032126 Bacteria 5440
516 Ga0373928_0001877 3300035084 Bacteria 4111
517 Ga0373929_0000185 3300035085 Bacteria 11094
518 Ga0373944_0000181 3300035089 Bacteria 13075
519 Ga0373951_0009355 3300035091 Bacteria 2208
520 Ga0373932_0000001 3300035112 Bacteria 1459067
521 Ga0373945_0016905 3300035116 Bacteria 2467
522 Ga0373962_0000332 3300035242 Bacteria 10341
523 Ga0373931_0000002 3300035691 Bacteria 599830
524 Ga0373927_0001758 3300035695 Bacteria 16176
525 Ga0373927_0003479 3300035695 Bacteria 11273
526 Ga0373933_0016693 3300035724 Bacteria 4111
527 Ga0373937_0003062 3300036401 Bacteria 13981
528 Ga0373937_0031350 3300036401 Bacteria 4817
529 Ga0373937_0117179 3300036401 Bacteria 2481
530 Ga0373925_0000215 3300037068 Bacteria 62800
531 Ga0373925_0025051 3300037068 Bacteria 4358
532 Ga0373925_0066810 3300037068 Bacteria 2711
533 Ga0395899_0009551 3300037312 Bacteria 7447
534 Ga0395899_0036822 3300037312 Bacteria 3669
535 Ga0395898_0001668 3300037466 Bacteria 29795
536 Ga0395898_0010711 3300037466 Bacteria 9580
537 Ga0395905_0000257 3300037471 Bacteria 79555
538 Ga0436364_1214207 3300037853 Bacteria 4491
539 Ga0395901_0002048 3300038443 Bacteria 20663
540 Ga0395901_0011719 3300038443 Bacteria 8885
541 Ga0436365_0010485 3300039437 Bacteria 4210
542 Ga0436360_0509447 3300039438 Bacteria 4614
543 Ga0436360_1132709 3300039438 Bacteria 6058
544 Ga0436361_0946705 3300039447 Bacteria 2705
545 Ga0436363_0014397 3300039450 Bacteria 20368
546 Ga0436363_1479676 3300039450 Bacteria 9888
547 Ga0439453_0001153 3300041408 Bacteria 3310
548 Ga0450890_000001 3300042127 Bacteria 192635
549 Ga0450892_000093 3300042130 Bacteria 9885
550 Ga0439460_0000772 3300042461 Bacteria 7215
551 Ga0450893_0000243 3300042532 Bacteria 7341
552 Ga0450893_0000244 3300042532 Bacteria 7328
553 Ga0451577_0000347 3300042876 Bacteria 86343
554 Ga0451577_0001507 3300042876 Bacteria 30779
555 Ga0451577_0003252 3300042876 Bacteria 18265
556 Ga0451577_0011240 3300042876 Bacteria 8485
557 Ga0451577_0022655 3300042876 Bacteria 5735
558 Ga0451577_0026203 3300042876 Bacteria 5280
559 Ga0466969_0001480 3300044656 Bacteria 12627
560 Ga0453683_0033209 3300044673 Bacteria 3255
561 Ga0466966_0000437 3300044684 Bacteria 26827
562 Ga0466961_0016375 3300044693 Bacteria 4762
563 Ga0466961_0036291 3300044693 Bacteria 3164
564 Ga0466961_0042472 3300044693 Bacteria 2914
565 Ga0466963_0015003 3300044694 Bacteria 4789
566 Ga0453684_0000147 3300044712 Bacteria 308490
567 Ga0453684_0000306 3300044712 Bacteria 207333
568 Ga0453684_0000367 3300044712 Bacteria 185852
569 Ga0453684_0000666 3300044712 Bacteria 122914
570 Ga0453684_0001441 3300044712 Bacteria 67854
571 Ga0453684_0010836 3300044712 Bacteria 15451
572 Ga0453684_0013884 3300044712 Bacteria 12994
573 Ga0453684_0016995 3300044712 Bacteria 11304
574 Ga0453684_0017033 3300044712 Bacteria 11287
575 Ga0453684_0023716 3300044712 Bacteria 9013
576 Ga0453684_0082530 3300044712 Bacteria 4004
577 Ga0453684_0100115 3300044712 Bacteria 3548
578 Ga0466971_0000095 3300044719 Bacteria 32391
579 Ga0466970_0007557 3300044765 Bacteria 5450
580 Ga0466957_0000308 3300044842 Bacteria 23942
581 Ga0466959_0000240 3300045049 Bacteria 34052
582 Ga0451576_0000255 3300045051 Bacteria 131310
583 Ga0451576_0000342 3300045051 Bacteria 112294
584 Ga0451576_0024921 3300045051 Bacteria 6455
585 Ga0451576_0026250 3300045051 Bacteria 6266
586 Ga0451576_0126632 3300045051 Bacteria 2661
587 Ga0466958_0000923 3300045836 Bacteria 13221
588 Ga0495627_013361 3300046453 Bacteria 2889
589 Ga0495592_0000115 3300046454 Bacteria 70181
590 Ga0495592_0011665 3300046454 Bacteria 6655
591 Ga0495629_0026909 3300046459 Bacteria 4085
592 Ga0495638_0000051 3300046460 Bacteria 206003
593 Ga0495651_0018964 3300046462 Bacteria 5330
594 Ga0495650_0000756 3300046471 Bacteria 40391
595 Ga0495582_0004637 3300046473 Bacteria 7723
596 Ga0495664_0009171 3300046477 Bacteria 5530
597 Ga0495596_0001188 3300046500 Bacteria 15231
598 Ga0495606_0009719 3300046507 Bacteria 8093
599 Ga0495610_0003390 3300046512 Bacteria 12450
600 Ga0495618_0000975 3300046514 Bacteria 19607
601 Ga0495618_0001376 3300046514 Bacteria 16351
602 Ga0495630_0000063 3300046517 Bacteria 85919
603 Ga0495630_0006172 3300046517 Bacteria 8497
604 Ga0495630_0065897 3300046517 Bacteria 2722
605 Ga0495632_0000356 3300046519 Bacteria 43508
606 Ga0495648_0000032 3300046524 Bacteria 205970
607 Ga0495652_0010069 3300046529 Bacteria 8571
608 Ga0495652_0012166 3300046529 Bacteria 7772
609 Ga0495652_0136377 3300046529 Bacteria 1936
610 Ga0495640_0029986 3300046533 Bacteria 3899
611 Ga0495586_0000009 3300046535 Bacteria 144639
612 Ga0495586_0000653 3300046535 Bacteria 19874
613 Ga0495586_0000849 3300046535 Bacteria 17549
614 Ga0495586_0057828 3300046535 Bacteria 2105
615 Ga0495587_0009829 3300046536 Bacteria 6111
616 Ga0495645_0010239 3300046543 Bacteria 6570
617 Ga0495668_0000229 3300046616 Bacteria 80748
618 Ga0495634_0002082 3300046642 Bacteria 16904
619 Ga0495634_0021066 3300046642 Bacteria 4616
620 Ga0495634_0028603 3300046642 Bacteria 3868
621 Ga0495625_0008293 3300046660 Bacteria 8879
622 Ga0495625_0011513 3300046660 Bacteria 7206
623 Ga0495599_0006697 3300046678 Bacteria 6956
624 Ga0495599_0012981 3300046678 Bacteria 5142
625 Ga0495599_0030939 3300046678 Bacteria 3360
626 Ga0495658_0016099 3300046683 Bacteria 3847
627 Ga0495613_0002258 3300046689 Bacteria 14566
628 Ga0495613_0029767 3300046689 Bacteria 4059
629 Ga0495613_0086269 3300046689 Bacteria 2276
630 Ga0495624_0032470 3300046690 Bacteria 3385
631 Ga0495671_0000020 3300046692 Bacteria 268306
632 Ga0495674_0000451 3300047319 Bacteria 37104
633 Ga0495674_0018560 3300047319 Bacteria 6474
634 Ga0495674_0060353 3300047319 Bacteria 3309
635 Ga0495680_0043464 3300047322 Bacteria 3557
636 Ga0495673_0000076 3300047469 Bacteria 205985
637 Ga0495681_0000017 3300047470 Bacteria 178067
638 Ga0495684_0007052 3300047471 Bacteria 8727
639 Ga0495602_0019855 3300048088 Bacteria 6656
640 Ga0495602_0035158 3300048088 Bacteria 4676
641 Ga0495626_0001137 3300048091 Bacteria 22237
642 Ga0496100_0012063 3300048903 Bacteria 4942
643 Ga0496101_0012929 3300048904 Bacteria 5583
644 Ga0496101_0052333 3300048904 Bacteria 2944
645 Ga0496102_0004371 3300048905 Bacteria 11936
646 Ga0496102_0055986 3300048905 Bacteria 3597
647 Ga0496102_0166895 3300048905 Bacteria 2072
648 Ga0496106_0000319 3300048909 Bacteria 33834
649 Ga0496108_0049746 3300048911 Bacteria 3506
650 Ga0496109_0014517 3300048912 Bacteria 6852
651 Ga0496114_0002161 3300048917 Bacteria 14963
652 Ga0496115_0001415 3300048918 Bacteria 17182
653 Ga0496115_0018523 3300048918 Bacteria 5348
654 Ga0496115_0054063 3300048918 Bacteria 3224
655 Ga0496115_0114880 3300048918 Bacteria 2213
656 Ga0496116_0001205 3300048919 Bacteria 30260
657 Ga0496118_0001488 3300048921 Bacteria 35067
658 Ga0496118_0041732 3300048921 Bacteria 3628
659 Ga0496119_0000815 3300048922 Bacteria 41661
660 Ga0496120_0000854 3300048923 Bacteria 43100
661 Ga0496121_0002328 3300048924 Bacteria 29355
662 Ga0496124_0000876 3300048927 Bacteria 48996
663 Ga0496125_0083640 3300048928 Bacteria 2427
664 Ga0501031_0029252 3300049568 Bacteria 3594
665 Ga0501032_0001015 3300049569 Bacteria 22677
666 Ga0501032_0041745 3300049569 Bacteria 3114
667 Ga0501033_0061252 3300049570 Bacteria 2774
668 Ga0501034_0002397 3300049571 Bacteria 22709
669 Ga0501034_0011410 3300049571 Bacteria 9211
670 Ga0501036_0003006 3300049572 Bacteria 13418
671 Ga0501036_0062076 3300049572 Bacteria 3165
672 Ga0501036_0093816 3300049572 Bacteria 2536
673 Ga0501037_0003669 3300049573 Bacteria 11144
674 Ga0501038_0023098 3300049574 Bacteria 5565
675 Ga0501038_0025144 3300049574 Bacteria 5309
676 Ga0501039_0031340 3300049575 Bacteria 4099
677 Ga0501039_0214812 3300049575 Bacteria 1512
678 Ga0501040_0004707 3300049576 Bacteria 8856
679 Ga0501040_0007720 3300049576 Bacteria 6960
680 Ga0501040_0010268 3300049576 Bacteria 6124
681 Ga0501040_0052569 3300049576 Bacteria 2789
682 Ga0501041_0035536 3300049577 Bacteria 3019
683 Ga0501041_0064987 3300049577 Bacteria 2234
684 Ga0501046_0004199 3300049580 Bacteria 13115
685 Ga0501046_0005038 3300049580 Bacteria 11855
686 Ga0501046_0118875 3300049580 Bacteria 2012
687 Ga0501047_0002411 3300049581 Bacteria 17866
688 Ga0501047_0014871 3300049581 Bacteria 7408
689 Ga0501047_0021047 3300049581 Bacteria 6263
690 Ga0501047_0100119 3300049581 Bacteria 2777
691 Ga0501048_0032468 3300049582 Bacteria 3772
692 Ga0501048_0057163 3300049582 Bacteria 2767
693 Ga0501070_0048016 3300049586 Bacteria 3547
694 Ga0501071_0041341 3300049587 Bacteria 3301
695 Ga0501072_0009262 3300049588 Bacteria 7482
696 Ga0501072_0061824 3300049588 Bacteria 2954
697 Ga0501072_0084256 3300049588 Bacteria 2520
698 Ga0501075_0006760 3300049591 Bacteria 7914
699 Ga0501075_0033713 3300049591 Bacteria 3809
700 Ga0501075_0134795 3300049591 Bacteria 1881
701 Ga0501076_0036259 3300049592 Bacteria 3863
702 Ga0501076_0101740 3300049592 Bacteria 2316
703 Ga0501076_0117227 3300049592 Bacteria 2155
704 Ga0501076_0139599 3300049592 Bacteria 1968
705 Ga0501079_0087136 3300049741 Bacteria 2417
706 Ga0501079_0134068 3300049741 Bacteria 1928
707 Ga0501080_0002022 3300049742 Bacteria 17530
708 Ga0501080_0007541 3300049742 Bacteria 9831
709 Ga0501080_0008215 3300049742 Bacteria 9452
710 Ga0501081_0008930 3300049743 Bacteria 6513
711 Ga0501083_0006326 3300049744 Bacteria 8394
712 Ga0501035_0015647 3300049822 Bacteria 7002
713 Ga0501035_0019229 3300049822 Bacteria 6288
714 Ga0501035_0035638 3300049822 Bacteria 4514
715 Ga0501035_0049775 3300049822 Bacteria 3755
716 Ga0501044_0013063 3300049823 Bacteria 8986
717 Ga0501044_0029386 3300049823 Bacteria 5796
718 Ga0501044_0046662 3300049823 Bacteria 4484
719 Ga0501045_0016386 3300049824 Bacteria 5262
720 Ga0501045_0019065 3300049824 Bacteria 4885
721 Ga0501045_0020510 3300049824 Bacteria 4722
722 Ga0501045_0088826 3300049824 Bacteria 2283
723 nmdc:mga03683_2015_c1 3300050489 Bacteria 6218
724 nmdc:mga03n38_1059_c1 3300050490 Bacteria 7584
725 nmdc:mga00v17_15437_c2 3300050491 Bacteria 3691
726 nmdc:mga0k408_8435_c1 3300050493 Bacteria 5532
727 nmdc:mga06z11_66_c1 3300050494 Bacteria 43000
728 nmdc:mga04h51_79_c1 3300050495 Bacteria 31613
729 nmdc:mga07m45_3130_c1 3300050496 Bacteria 7083
730 nmdc:mga05p37_5199_c1 3300050507 Bacteria 15272
731 nmdc:mga05p37_70631_c1 3300050507 Bacteria 4295
732 nmdc:mga08y16_14553_c1 3300050511 Bacteria 8273
733 nmdc:mga08y16_6925_c1 3300050511 Bacteria 11886
734 nmdc:mga0n895_139263_c1 3300050512 Bacteria 2454
735 nmdc:mga0n895_80675_c1 3300050512 Bacteria 3242
736 nmdc:mga0a205_174574_c1 3300050515 Bacteria 2044
737 nmdc:mga0a205_8114_c1 3300050515 Bacteria 9542
738 nmdc:mga0a205_9311_c1 3300050515 Bacteria 8970
739 nmdc:mga0sz30_8076_c1 3300050516 Bacteria 3965
740 Ga0500635_0000942 3300053080 Bacteria 7026
741 Ga0500643_000135 3300053087 Bacteria 74911
742 Ga0500643_001053 3300053087 Bacteria 16728
743 Ga0500643_001915 3300053087 Bacteria 11310
744 Ga0500643_004062 3300053087 Bacteria 6751
745 Ga0500643_004577 3300053087 Bacteria 6193
746 Ga0500555_000003 3300053103 Bacteria 392994
747 Ga0500555_000200 3300053103 Bacteria 27842
748 Ga0500556_0000044 3300053104 Bacteria 132744
749 Ga0500556_0000090 3300053104 Bacteria 84279
750 Ga0500592_001159 3300053116 Bacteria 4288
751 Ga0500607_000011 3300053121 Bacteria 110773
752 Ga0500608_000185 3300053122 Bacteria 24956
753 Ga0500642_0000014 3300053130 Bacteria 182110
754 Ga0500642_0007335 3300053130 Bacteria 3700
755 Ga0500658_0001071 3300053134 Bacteria 11206
756 Ga0500559_0009476 3300053136 Bacteria 4213
757 Ga0500616_0005968 3300053153 Bacteria 8124
758 Ga0500624_000122 3300053157 Bacteria 35389
759 Ga0500636_0024115 3300053177 Bacteria 3596
760 Ga0500645_002407 3300053730 Bacteria 8387
761 Ga0500596_004823 3300053735 Bacteria 2438
762 Ga0501084_0001331 3300054114 Bacteria 19487
763 Ga0501084_0002721 3300054114 Bacteria 14253
764 Ga0501082_0017073 3300060353 Bacteria 6253
765 Ga0466962_0001879 3300061719 Bacteria 9888
766 Ga0530510_0008853 3300061734 Bacteria 7045
767 Ga0530510_0016249 3300061734 Bacteria 5263
768 Ga0530510_0023032 3300061734 Bacteria 4439
769 Ga0530510_0027056 3300061734 Bacteria 4108
770 Ga0530510_0040735 3300061734 Bacteria 3353

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0214812 Ga0501039_0214812_90_1496 410
2 3300005331 Ga0070670_100023871 Ga0070670_1000238713 433
3 3300005440 Ga0070705_100001737 Ga0070705_1000017376 433
4 3300005617 Ga0068859_100000370 Ga0068859_10000037029 433
5 3300005842 Ga0068858_100002318 Ga0068858_10000231819 433
6 3300006931 Ga0097620_100000370 Ga0097620_10000037029 433
7 3300014968 Ga0157379_10011558 Ga0157379_100115584 433
8 3300025925 Ga0207650_10030620 Ga0207650_100306203 433
9 3300025961 Ga0207712_10003209 Ga0207712_100032096 433
10 3300025972 Ga0207668_10000327 Ga0207668_1000032724 433
11 3300026035 Ga0207703_10008968 Ga0207703_100089683 433
12 3300028381 Ga0268264_10000218 Ga0268264_1000021875 433
13 3300049577 Ga0501041_0035536 Ga0501041_0035536_17_1432 450
14 3300046529 Ga0495652_0136377 Ga0495652_0136377_194_1900 483
15 3300046689 Ga0495613_0029767 Ga0495613_0029767_2399_3982 483
16 3300006852 Ga0075433_10006296 Ga0075433_100062966 484
17 3300009094 Ga0111539_10016208 Ga0111539_100162086 484
18 3300009147 Ga0114129_10021725 Ga0114129_100217256 484
19 3300027907 Ga0207428_10004571 Ga0207428_100045715 484
20 3300050507 nmdc:mga05p37_5199_c1 nmdc:mga05p37_5199_c1_8112_9785 484
21 3300050511 nmdc:mga08y16_14553_c1 nmdc:mga08y16_14553_c1_3622_5295 484
22 3300050515 nmdc:mga0a205_9311_c1 nmdc:mga0a205_9311_c1_4688_6361 484
23 3300049581 Ga0501047_0021047 Ga0501047_0021047_2435_4150 485
24 3300006048 Ga0075363_100008802 Ga0075363_1000088026 489
25 3300049572 Ga0501036_0093816 Ga0501036_0093816_144_1817 491
26 3300049576 Ga0501040_0007720 Ga0501040_0007720_654_2327 495
27 3300049588 Ga0501072_0061824 Ga0501072_0061824_212_1885 495
28 3300049592 Ga0501076_0101740 Ga0501076_0101740_318_1991 495
29 3300009094 Ga0111539_10119710 Ga0111539_101197102 496
30 3300031456 Ga0307513_10087156 Ga0307513_100871562 499
31 3300039447 Ga0436361_0946705 Ga0436361_0946705_690_2501 503
32 3300005466 Ga0070685_10003083 Ga0070685_100030834 505
33 3300006880 Ga0075429_100054412 Ga0075429_1000544123 509
34 3300049581 Ga0501047_0002411 Ga0501047_0002411_8115_9842 510
35 3300049742 Ga0501080_0002022 Ga0501080_0002022_10329_12056 510
36 3300005518 Ga0070699_100023100 Ga0070699_1000231004 513
37 3300025922 Ga0207646_10130152 Ga0207646_101301522 513
38 3300028563 Ga0265319_1004676 Ga0265319_10046762 513
39 3300042461 Ga0439460_0000772 Ga0439460_0000772_2951_4702 514
40 3300049568 Ga0501031_0029252 Ga0501031_0029252_693_2396 514
41 3300049569 Ga0501032_0001015 Ga0501032_0001015_19882_21585 514
42 3300049572 Ga0501036_0062076 Ga0501036_0062076_158_1861 514
43 3300049575 Ga0501039_0031340 Ga0501039_0031340_2380_4083 514
44 3300049822 Ga0501035_0035638 Ga0501035_0035638_2502_4205 514
45 3300049823 Ga0501044_0046662 Ga0501044_0046662_1868_3571 514
46 3300046543 Ga0495645_0010239 Ga0495645_0010239_2551_4233 515
47 3300005518 Ga0070699_100000089 Ga0070699_10000008916 516
48 3300031240 Ga0265320_10025393 Ga0265320_100253933 516
49 3300031250 Ga0265331_10030438 Ga0265331_100304382 516
50 3300031711 Ga0265314_10006660 Ga0265314_1000666011 516
51 3300050515 nmdc:mga0a205_8114_c1 nmdc:mga0a205_8114_c1_1693_3411 516
52 3300005367 Ga0070667_100027783 Ga0070667_1000277832 517
53 3300014326 Ga0157380_10101358 Ga0157380_101013582 517
54 3300028379 Ga0268266_10039321 Ga0268266_100393212 517
55 3300049588 Ga0501072_0084256 Ga0501072_0084256_28_1680 517
56 iso_pu_bacteria 2784132109 2784473290 518
57 3300046533 Ga0495640_0029986 Ga0495640_0029986_462_2378 520
58 3300005445 Ga0070708_100013918 Ga0070708_1000139184 521
59 3300005468 Ga0070707_100043592 Ga0070707_1000435924 521
60 3300005471 Ga0070698_100007185 Ga0070698_1000071854 521
61 3300028573 Ga0265334_10026217 Ga0265334_100262173 521
62 3300031242 Ga0265329_10009352 Ga0265329_100093526 521
63 3300031251 Ga0265327_10000887 Ga0265327_1000088722 521
64 3300042876 Ga0451577_0001507 Ga0451577_0001507_12619_14364 521
65 3300049569 Ga0501032_0041745 Ga0501032_0041745_846_2633 521
66 3300037853 Ga0436364_1214207 Ga0436364_1214207_2219_4030 523
67 3300039450 Ga0436363_0014397 Ga0436363_0014397_14148_15959 523
68 3300005331 Ga0070670_100084662 Ga0070670_1000846623 524
69 3300005347 Ga0070668_100042888 Ga0070668_1000428881 524
70 3300005364 Ga0070673_100041977 Ga0070673_1000419772 524
71 3300005456 Ga0070678_100111501 Ga0070678_1001115012 524
72 3300005841 Ga0068863_100028402 Ga0068863_1000284022 524
73 3300005843 Ga0068860_100032015 Ga0068860_1000320156 524
74 3300006847 Ga0075431_100173221 Ga0075431_1001732214 524
75 3300014969 Ga0157376_10096419 Ga0157376_100964192 524
76 3300025901 Ga0207688_10025054 Ga0207688_100250542 524
77 3300025907 Ga0207645_10025139 Ga0207645_100251393 524
78 3300025972 Ga0207668_10046546 Ga0207668_100465462 524
79 3300028381 Ga0268264_10009366 Ga0268264_100093666 524
80 3300042876 Ga0451577_0026203 Ga0451577_0026203_1857_3656 524
81 3300046460 Ga0495638_0000051 Ga0495638_0000051_155334_157037 524
82 3300046524 Ga0495648_0000032 Ga0495648_0000032_48947_50650 524
83 3300046678 Ga0495599_0030939 Ga0495599_0030939_1613_3346 525
84 3300048905 Ga0496102_0166895 Ga0496102_0166895_14_1726 525
85 3300053157 Ga0500624_000122 Ga0500624_000122_1505_3208 525
86 3300053177 Ga0500636_0024115 Ga0500636_0024115_1535_3238 525
87 3300049592 Ga0501076_0117227 Ga0501076_0117227_18_1712 526
88 3300061719 Ga0466962_0001879 Ga0466962_0001879_13_1656 526
89 3300005617 Ga0068859_100099460 Ga0068859_1000994605 527
90 3300006931 Ga0097620_100099458 Ga0097620_1000994585 527
91 3300028800 Ga0265338_10138038 Ga0265338_101380381 527
92 3300037466 Ga0395898_0001668 Ga0395898_0001668_4009_5700 527
93 3300039450 Ga0436363_1479676 Ga0436363_1479676_2284_4101 527
94 3300049571 Ga0501034_0011410 Ga0501034_0011410_623_2311 527
95 3300053122 Ga0500608_000185 Ga0500608_000185_20695_22428 527
96 3300005364 Ga0070673_100020155 Ga0070673_1000201553 528
97 3300005406 Ga0070703_10000387 Ga0070703_1000038713 528
98 3300005445 Ga0070708_100208127 Ga0070708_1002081271 528
99 3300006914 Ga0075436_100044026 Ga0075436_1000440262 528
100 3300025885 Ga0207653_10000176 Ga0207653_100001766 528
101 3300025910 Ga0207684_10030423 Ga0207684_100304233 528
102 3300025960 Ga0207651_10024723 Ga0207651_100247232 528
103 3300031251 Ga0265327_10026286 Ga0265327_100262862 528
104 3300031344 Ga0265316_10009016 Ga0265316_100090162 529
105 3300037466 Ga0395898_0010711 Ga0395898_0010711_829_2520 529
106 3300038443 Ga0395901_0011719 Ga0395901_0011719_4686_6377 529
107 3300049576 Ga0501040_0010268 Ga0501040_0010268_3647_5386 529
108 3300049591 Ga0501075_0134795 Ga0501075_0134795_128_1867 529
109 3300049824 Ga0501045_0020510 Ga0501045_0020510_2236_3975 529
110 3300005467 Ga0070706_100002067 Ga0070706_1000020677 530
111 3300025910 Ga0207684_10001151 Ga0207684_1000115115 530
112 3300031240 Ga0265320_10000030 Ga0265320_10000030114 530
113 3300031711 Ga0265314_10002440 Ga0265314_100024409 530
114 3300053087 Ga0500643_001915 Ga0500643_001915_4070_5779 530
115 3300013306 Ga0163162_10121945 Ga0163162_101219452 531
116 3300028556 Ga0265337_1000035 Ga0265337_10000357 531
117 3300028800 Ga0265338_10003775 Ga0265338_1000377513 531
118 3300028800 Ga0265338_10006441 Ga0265338_1000644111 531
119 3300028800 Ga0265338_10025691 Ga0265338_100256912 531
120 3300029957 Ga0265324_10000028 Ga0265324_10000028109 531
121 3300031344 Ga0265316_10006896 Ga0265316_100068962 531
122 3300031344 Ga0265316_10018842 Ga0265316_100188423 531
123 3300031548 Ga0307408_100008690 Ga0307408_1000086904 531
124 3300031824 Ga0307413_10014451 Ga0307413_100144512 531
125 3300032004 Ga0307414_10109670 Ga0307414_101096703 531
126 3300032005 Ga0307411_10073389 Ga0307411_100733892 531
127 3300032126 Ga0307415_100009576 Ga0307415_1000095764 531
128 3300049743 Ga0501081_0008930 Ga0501081_0008930_3392_5107 531
129 3300054114 Ga0501084_0001331 Ga0501084_0001331_9347_11062 531
130 3300005937 Ga0081455_10022661 Ga0081455_100226614 532
131 3300006177 Ga0075362_10008771 Ga0075362_100087712 532
132 3300021441 Ga0213871_10003745 Ga0213871_100037452 532
133 3300028563 Ga0265319_1000001 Ga0265319_100000162 532
134 3300028563 Ga0265319_1000857 Ga0265319_100085711 532
135 3300028577 Ga0265318_10009527 Ga0265318_100095272 532
136 3300028800 Ga0265338_10000702 Ga0265338_1000070236 532
137 3300028800 Ga0265338_10100467 Ga0265338_101004672 532
138 3300031235 Ga0265330_10001253 Ga0265330_1000125315 532
139 3300031238 Ga0265332_10011078 Ga0265332_100110782 532
140 3300031240 Ga0265320_10000318 Ga0265320_1000031832 532
141 3300031240 Ga0265320_10003614 Ga0265320_100036143 532
142 3300031247 Ga0265340_10018361 Ga0265340_100183614 532
143 3300031251 Ga0265327_10000127 Ga0265327_1000012782 532
144 3300031595 Ga0265313_10000252 Ga0265313_1000025244 532
145 3300031711 Ga0265314_10000632 Ga0265314_100006325 532
146 3300031712 Ga0265342_10003002 Ga0265342_1000300213 532
147 3300035724 Ga0373933_0016693 Ga0373933_0016693_1737_3536 532
148 3300036401 Ga0373937_0003062 Ga0373937_0003062_9054_10853 532
149 3300039438 Ga0436360_0509447 Ga0436360_0509447_2489_4300 532
150 3300039438 Ga0436360_1132709 Ga0436360_1132709_2035_3846 532
151 3300044712 Ga0453684_0023716 Ga0453684_0023716_3747_5549 532
152 3300046459 Ga0495629_0026909 Ga0495629_0026909_1232_3031 532
153 3300046514 Ga0495618_0000975 Ga0495618_0000975_8507_10306 532
154 3300046535 Ga0495586_0000849 Ga0495586_0000849_1988_3787 532
155 3300046642 Ga0495634_0002082 Ga0495634_0002082_2469_4268 532
156 3300046689 Ga0495613_0002258 Ga0495613_0002258_4531_6330 532
157 3300047322 Ga0495680_0043464 Ga0495680_0043464_1706_3505 532
158 3300049741 Ga0501079_0134068 Ga0501079_0134068_64_1776 532
159 3300050489 nmdc:mga03683_2015_c1 nmdc:mga03683_2015_c1_4057_5868 532
160 3300050490 nmdc:mga03n38_1059_c1 nmdc:mga03n38_1059_c1_2892_4703 532
161 3300050512 nmdc:mga0n895_80675_c1 nmdc:mga0n895_80675_c1_429_2144 532
162 3300053103 Ga0500555_000200 Ga0500555_000200_7479_9290 532
163 3300053104 Ga0500556_0000090 Ga0500556_0000090_35461_37272 532
164 3300053130 Ga0500642_0007335 Ga0500642_0007335_1698_3509 532
165 3300061734 Ga0530510_0023032 Ga0530510_0023032_2090_3802 532
166 3300005335 Ga0070666_10000057 Ga0070666_1000005740 533
167 3300005353 Ga0070669_100000004 Ga0070669_10000000465 533
168 3300005355 Ga0070671_100000029 Ga0070671_10000002961 533
169 3300005367 Ga0070667_100005017 Ga0070667_1000050174 533
170 3300005719 Ga0068861_100003376 Ga0068861_1000033767 533
171 3300005844 Ga0068862_100000538 Ga0068862_10000053824 533
172 3300006353 Ga0075370_10004047 Ga0075370_100040472 533
173 3300009093 Ga0105240_10000163 Ga0105240_1000016390 533
174 3300009545 Ga0105237_10003590 Ga0105237_100035902 533
175 3300025315 Ga0207697_10000301 Ga0207697_1000030125 533
176 3300025900 Ga0207710_10047055 Ga0207710_100470551 533
177 3300025903 Ga0207680_10000316 Ga0207680_1000031615 533
178 3300025913 Ga0207695_10000472 Ga0207695_1000047222 533
179 3300025914 Ga0207671_10012807 Ga0207671_100128072 533
180 3300025923 Ga0207681_10000010 Ga0207681_10000010339 533
181 3300025931 Ga0207644_10000007 Ga0207644_10000007326 533
182 3300025986 Ga0207658_10001925 Ga0207658_100019255 533
183 3300026118 Ga0207675_100003014 Ga0207675_1000030149 533
184 3300028380 Ga0268265_10000255 Ga0268265_1000025534 533
185 3300042876 Ga0451577_0003252 Ga0451577_0003252_14296_16014 533
186 3300044712 Ga0453684_0000367 Ga0453684_0000367_44315_46033 533
187 3300045051 Ga0451576_0000342 Ga0451576_0000342_44315_46033 533
188 3300049570 Ga0501033_0061252 Ga0501033_0061252_47_1822 533
189 3300049571 Ga0501034_0002397 Ga0501034_0002397_18938_20671 533
190 3300049581 Ga0501047_0014871 Ga0501047_0014871_5036_6763 533
191 3300049586 Ga0501070_0048016 Ga0501070_0048016_354_2057 533
192 3300050491 nmdc:mga00v17_15437_c2 nmdc:mga00v17_15437_c2_687_2390 533
193 3300050496 nmdc:mga07m45_3130_c1 nmdc:mga07m45_3130_c1_3400_5211 533
194 3300050516 nmdc:mga0sz30_8076_c1 nmdc:mga0sz30_8076_c1_1649_3352 533
195 3300005347 Ga0070668_100024340 Ga0070668_1000243403 534
196 3300005539 Ga0068853_100021318 Ga0068853_1000213184 534
197 3300028558 Ga0265326_10004597 Ga0265326_100045973 534
198 3300028563 Ga0265319_1000080 Ga0265319_100008058 534
199 3300028563 Ga0265319_1018863 Ga0265319_10188631 534
200 3300028573 Ga0265334_10025849 Ga0265334_100258492 534
201 3300028577 Ga0265318_10000833 Ga0265318_100008336 534
202 3300028800 Ga0265338_10007563 Ga0265338_1000756312 534
203 3300029957 Ga0265324_10008779 Ga0265324_100087792 534
204 3300031240 Ga0265320_10010013 Ga0265320_100100133 534
205 3300031249 Ga0265339_10003494 Ga0265339_100034944 534
206 3300031251 Ga0265327_10003651 Ga0265327_1000365111 534
207 3300031595 Ga0265313_10007259 Ga0265313_100072595 534
208 3300031595 Ga0265313_10024217 Ga0265313_100242172 534
209 3300031711 Ga0265314_10005606 Ga0265314_100056065 534
210 3300031712 Ga0265342_10005292 Ga0265342_100052927 534
211 3300049573 Ga0501037_0003669 Ga0501037_0003669_1107_2921 534
212 3300049581 Ga0501047_0100119 Ga0501047_0100119_1009_2712 534
213 3300049823 Ga0501044_0029386 Ga0501044_0029386_371_2185 534
214 3300001977 JGI24746J21847_1001047 JGI24746J21847_10010473 535
215 3300005295 Ga0065707_10099641 Ga0065707_100996411 535
216 3300005328 Ga0070676_10033259 Ga0070676_100332592 535
217 3300005459 Ga0068867_100000124 Ga0068867_10000012420 535
218 3300005983 Ga0081540_1000010 Ga0081540_1000010100 535
219 3300006175 Ga0070712_100061474 Ga0070712_1000614742 535
220 3300006237 Ga0097621_100077117 Ga0097621_1000771173 535
221 3300006358 Ga0068871_100005532 Ga0068871_1000055326 535
222 3300009148 Ga0105243_10000049 Ga0105243_1000004984 535
223 3300014745 Ga0157377_10000732 Ga0157377_100007325 535
224 3300025907 Ga0207645_10068074 Ga0207645_100680743 535
225 3300025935 Ga0207709_10000097 Ga0207709_1000009770 535
226 3300026089 Ga0207648_10000083 Ga0207648_1000008321 535
227 3300028800 Ga0265338_10074620 Ga0265338_100746202 535
228 3300035091 Ga0373951_0009355 Ga0373951_0009355_277_2094 535
229 3300036401 Ga0373937_0117179 Ga0373937_0117179_453_2252 535
230 3300048904 Ga0496101_0052333 Ga0496101_0052333_852_2657 535
231 3300048918 Ga0496115_0018523 Ga0496115_0018523_2188_3993 535
232 3300049580 Ga0501046_0118875 Ga0501046_0118875_225_1949 535
233 3300049822 Ga0501035_0049775 Ga0501035_0049775_428_2152 535
234 3300053136 Ga0500559_0009476 Ga0500559_0009476_2196_3983 535
235 3300005564 Ga0070664_100011678 Ga0070664_1000116783 536
236 3300009036 Ga0105244_10002893 Ga0105244_100028937 536
237 3300013307 Ga0157372_10027415 Ga0157372_100274154 536
238 3300025728 Ga0207655_1000130 Ga0207655_100013038 536
239 3300031241 Ga0265325_10015432 Ga0265325_100154323 536
240 3300031901 Ga0307406_10000672 Ga0307406_100006727 536
241 3300031911 Ga0307412_10000037 Ga0307412_1000003748 536
242 3300005295 Ga0065707_10104456 Ga0065707_101044562 537
243 3300005337 Ga0070682_100009293 Ga0070682_1000092932 537
244 3300005844 Ga0068862_100001724 Ga0068862_1000017242 537
245 3300006175 Ga0070712_100015642 Ga0070712_1000156422 537
246 3300009553 Ga0105249_10000161 Ga0105249_100001615 537
247 3300025961 Ga0207712_10000059 Ga0207712_1000005972 537
248 3300028380 Ga0268265_10000281 Ga0268265_1000028121 537
249 3300028577 Ga0265318_10006104 Ga0265318_100061045 537
250 3300031251 Ga0265327_10012367 Ga0265327_100123674 537
251 3300031344 Ga0265316_10045951 Ga0265316_100459512 537
252 3300046689 Ga0495613_0086269 Ga0495613_0086269_307_2223 537
253 3300049742 Ga0501080_0007541 Ga0501080_0007541_3654_5387 537
254 3300005340 Ga0070689_100003098 Ga0070689_1000030986 538
255 3300005456 Ga0070678_100030709 Ga0070678_1000307093 538
256 3300005577 Ga0068857_100000176 Ga0068857_10000017635 538
257 3300013308 Ga0157375_10090254 Ga0157375_100902543 538
258 3300025936 Ga0207670_10001459 Ga0207670_100014594 538
259 3300026116 Ga0207674_10001786 Ga0207674_100017868 538
260 3300026121 Ga0207683_10008702 Ga0207683_100087024 538
261 3300028556 Ga0265337_1001667 Ga0265337_10016673 538
262 3300028563 Ga0265319_1010337 Ga0265319_10103372 538
263 3300028563 Ga0265319_1012344 Ga0265319_10123442 538
264 3300028563 Ga0265319_1018558 Ga0265319_10185583 538
265 3300028577 Ga0265318_10002479 Ga0265318_100024794 538
266 3300028800 Ga0265338_10001819 Ga0265338_100018192 538
267 3300028800 Ga0265338_10017860 Ga0265338_100178607 538
268 3300029957 Ga0265324_10012252 Ga0265324_100122524 538
269 3300031240 Ga0265320_10000290 Ga0265320_1000029011 538
270 3300031240 Ga0265320_10002752 Ga0265320_100027529 538
271 3300031240 Ga0265320_10034430 Ga0265320_100344303 538
272 3300031241 Ga0265325_10004713 Ga0265325_100047132 538
273 3300031250 Ga0265331_10016731 Ga0265331_100167312 538
274 3300031251 Ga0265327_10000917 Ga0265327_100009179 538
275 3300031595 Ga0265313_10000230 Ga0265313_1000023015 538
276 3300047319 Ga0495674_0060353 Ga0495674_0060353_707_2422 538
277 3300053087 Ga0500643_004062 Ga0500643_004062_720_2423 538
278 3300053153 Ga0500616_0005968 Ga0500616_0005968_5873_7684 538
279 3300003320 rootH2_10055959 rootH2_100559592 539
280 3300005334 Ga0068869_100000086 Ga0068869_10000008620 539
281 3300005338 Ga0068868_100047428 Ga0068868_1000474282 539
282 3300005347 Ga0070668_100017464 Ga0070668_1000174642 539
283 3300005356 Ga0070674_100044383 Ga0070674_1000443832 539
284 3300005445 Ga0070708_100011564 Ga0070708_1000115643 539
285 3300005459 Ga0068867_100000596 Ga0068867_10000059616 539
286 3300005467 Ga0070706_100035218 Ga0070706_1000352183 539
287 3300005536 Ga0070697_100004449 Ga0070697_1000044492 539
288 3300006358 Ga0068871_100004028 Ga0068871_1000040288 539
289 3300006881 Ga0068865_100001574 Ga0068865_10000157411 539
290 3300013296 Ga0157374_10010673 Ga0157374_100106735 539
291 3300013297 Ga0157378_10046360 Ga0157378_100463603 539
292 3300025315 Ga0207697_10000135 Ga0207697_1000013519 539
293 3300025901 Ga0207688_10053845 Ga0207688_100538452 539
294 3300025910 Ga0207684_10017741 Ga0207684_100177413 539
295 3300025922 Ga0207646_10005357 Ga0207646_100053578 539
296 3300025923 Ga0207681_10020639 Ga0207681_100206392 539
297 3300025938 Ga0207704_10047124 Ga0207704_100471242 539
298 3300025942 Ga0207689_10000023 Ga0207689_1000002386 539
299 3300026089 Ga0207648_10001277 Ga0207648_100012775 539
300 3300026089 Ga0207648_10028640 Ga0207648_100286402 539
301 3300044712 Ga0453684_0013884 Ga0453684_0013884_10739_12460 539
302 3300045051 Ga0451576_0000255 Ga0451576_0000255_123408_125222 539
303 3300005355 Ga0070671_100026407 Ga0070671_1000264072 540
304 3300005467 Ga0070706_100000011 Ga0070706_100000011164 540
305 3300005471 Ga0070698_100063262 Ga0070698_1000632622 540
306 3300025910 Ga0207684_10000052 Ga0207684_10000052178 540
307 3300028577 Ga0265318_10000124 Ga0265318_1000012421 540
308 3300031240 Ga0265320_10004093 Ga0265320_100040933 540
309 3300031250 Ga0265331_10005786 Ga0265331_100057866 540
310 3300031595 Ga0265313_10005682 Ga0265313_100056826 540
311 3300031711 Ga0265314_10002765 Ga0265314_1000276510 540
312 3300044712 Ga0453684_0016995 Ga0453684_0016995_7261_8952 540
313 3300048911 Ga0496108_0049746 Ga0496108_0049746_33_1832 540
314 3300049744 Ga0501083_0006326 Ga0501083_0006326_771_2585 540
315 3300005518 Ga0070699_100098764 Ga0070699_1000987642 541
316 3300006028 Ga0070717_10003667 Ga0070717_100036677 541
317 3300028800 Ga0265338_10005041 Ga0265338_1000504111 541
318 3300005578 Ga0068854_100004135 Ga0068854_1000041354 542
319 3300009551 Ga0105238_10020205 Ga0105238_100202052 542
320 3300014969 Ga0157376_10094614 Ga0157376_100946142 542
321 3300025924 Ga0207694_10061439 Ga0207694_100614392 542
322 3300025981 Ga0207640_10000314 Ga0207640_100003144 542
323 3300026041 Ga0207639_10033193 Ga0207639_100331934 542
324 3300028653 Ga0265323_10000012 Ga0265323_1000001247 542
325 3300031251 Ga0265327_10008488 Ga0265327_100084886 542
326 3300031344 Ga0265316_10000803 Ga0265316_1000080320 542
327 3300031995 Ga0307409_100008320 Ga0307409_1000083204 542
328 3300044712 Ga0453684_0100115 Ga0453684_0100115_51_1784 542
329 3300031247 Ga0265340_10004505 Ga0265340_100045053 543
330 3300044712 Ga0453684_0010836 Ga0453684_0010836_434_2149 543
331 3300049574 Ga0501038_0025144 Ga0501038_0025144_3239_4969 543
332 3300049576 Ga0501040_0004707 Ga0501040_0004707_3092_4822 543
333 3300049577 Ga0501041_0064987 Ga0501041_0064987_416_2146 543
334 3300049580 Ga0501046_0005038 Ga0501046_0005038_9685_11415 543
335 3300049582 Ga0501048_0032468 Ga0501048_0032468_287_2017 543
336 3300049587 Ga0501071_0041341 Ga0501071_0041341_13_1743 543
337 3300049591 Ga0501075_0033713 Ga0501075_0033713_1954_3684 543
338 3300049822 Ga0501035_0015647 Ga0501035_0015647_13_1743 543
339 3300049824 Ga0501045_0016386 Ga0501045_0016386_865_2595 543
340 3300053087 Ga0500643_001053 Ga0500643_001053_12264_13982 543
341 3300053103 Ga0500555_000003 Ga0500555_000003_285015_286814 543
342 3300061734 Ga0530510_0027056 Ga0530510_0027056_426_2156 543
343 3300005563 Ga0068855_100005065 Ga0068855_10000506511 544
344 3300006195 Ga0075366_10005154 Ga0075366_100051542 544
345 3300006880 Ga0075429_100166539 Ga0075429_1001665392 544
346 3300009094 Ga0111539_10011192 Ga0111539_100111926 544
347 3300025916 Ga0207663_10002821 Ga0207663_100028213 544
348 3300027907 Ga0207428_10000139 Ga0207428_1000013973 544
349 3300028573 Ga0265334_10000081 Ga0265334_1000008126 544
350 3300028573 Ga0265334_10000445 Ga0265334_100004459 544
351 3300029957 Ga0265324_10009579 Ga0265324_100095792 544
352 3300037471 Ga0395905_0000257 Ga0395905_0000257_24764_26494 544
353 3300042876 Ga0451577_0022655 Ga0451577_0022655_1526_3292 544
354 3300044693 Ga0466961_0016375 Ga0466961_0016375_1443_3158 544
355 3300045051 Ga0451576_0024921 Ga0451576_0024921_335_2101 544
356 3300046519 Ga0495632_0000356 Ga0495632_0000356_35575_37278 544
357 3300046692 Ga0495671_0000020 Ga0495671_0000020_154704_156407 544
358 3300047469 Ga0495673_0000076 Ga0495673_0000076_49066_50769 544
359 3300050493 nmdc:mga0k408_8435_c1 nmdc:mga0k408_8435_c1_1466_3181 544
360 3300050511 nmdc:mga08y16_6925_c1 nmdc:mga08y16_6925_c1_1135_2850 544
361 3300053735 Ga0500596_004823 Ga0500596_004823_498_2198 544
362 3300005328 Ga0070676_10058369 Ga0070676_100583692 545
363 3300005355 Ga0070671_100077042 Ga0070671_1000770422 545
364 3300005544 Ga0070686_100010603 Ga0070686_1000106032 545
365 3300005549 Ga0070704_100015233 Ga0070704_1000152333 545
366 3300005985 Ga0081539_10009526 Ga0081539_100095265 545
367 3300009093 Ga0105240_10128100 Ga0105240_101281001 545
368 3300013307 Ga0157372_10147063 Ga0157372_101470632 545
369 3300025298 Ga0209050_1005294 Ga0209050_10052944 545
370 3300025924 Ga0207694_10016478 Ga0207694_100164783 545
371 3300028800 Ga0265338_10000402 Ga0265338_1000040250 545
372 3300028800 Ga0265338_10017930 Ga0265338_100179304 545
373 3300028800 Ga0265338_10068580 Ga0265338_100685804 545
374 3300048919 Ga0496116_0001205 Ga0496116_0001205_1638_3317 545
375 3300048922 Ga0496119_0000815 Ga0496119_0000815_10290_11969 545
376 3300048923 Ga0496120_0000854 Ga0496120_0000854_3710_5389 545
377 3300048927 Ga0496124_0000876 Ga0496124_0000876_29854_31533 545
378 3300002067 JGI24735J21928_10001887 JGI24735J21928_100018874 546
379 3300002077 JGI24744J21845_10003434 JGI24744J21845_100034342 546
380 3300003214 JGI25165J46597_1000173 JGI25165J46597_100017318 546
381 3300005327 Ga0070658_10001414 Ga0070658_100014142 546
382 3300005328 Ga0070676_10049757 Ga0070676_100497572 546
383 3300009093 Ga0105240_10008262 Ga0105240_100082629 546
384 3300013104 Ga0157370_10000095 Ga0157370_1000009530 546
385 3300013105 Ga0157369_10007626 Ga0157369_100076269 546
386 3300013306 Ga0163162_10026948 Ga0163162_100269483 546
387 3300014969 Ga0157376_10052923 Ga0157376_100529232 546
388 3300025231 Ga0207427_101282 Ga0207427_1012827 546
389 3300025261 Ga0209233_1000003 Ga0209233_10000031207 546
390 3300025304 Ga0209257_1001548 Ga0209257_10015489 546
391 3300025907 Ga0207645_10056150 Ga0207645_100561503 546
392 3300025909 Ga0207705_10003229 Ga0207705_100032292 546
393 3300025913 Ga0207695_10025841 Ga0207695_100258417 546
394 3300025913 Ga0207695_10029573 Ga0207695_100295732 546
395 3300025926 Ga0207659_10028321 Ga0207659_100283212 546
396 3300025960 Ga0207651_10045644 Ga0207651_100456442 546
397 3300028800 Ga0265338_10016162 Ga0265338_100161627 546
398 3300035084 Ga0373928_0001877 Ga0373928_0001877_534_2450 546
399 3300035085 Ga0373929_0000185 Ga0373929_0000185_1820_3736 546
400 3300035089 Ga0373944_0000181 Ga0373944_0000181_1638_3554 546
401 3300035112 Ga0373932_0000001 Ga0373932_0000001_1307489_1309405 546
402 3300035242 Ga0373962_0000332 Ga0373962_0000332_1572_3488 546
403 3300035691 Ga0373931_0000002 Ga0373931_0000002_185993_187909 546
404 3300035695 Ga0373927_0003479 Ga0373927_0003479_8611_10527 546
405 3300037068 Ga0373925_0000215 Ga0373925_0000215_24679_26595 546
406 3300037312 Ga0395899_0009551 Ga0395899_0009551_4329_6032 546
407 3300045051 Ga0451576_0026250 Ga0451576_0026250_4090_5889 546
408 3300046660 Ga0495625_0011513 Ga0495625_0011513_3467_5170 546
409 3300046678 Ga0495599_0012981 Ga0495599_0012981_438_2237 546
410 3300048921 Ga0496118_0041732 Ga0496118_0041732_224_1927 546
411 3300048928 Ga0496125_0083640 Ga0496125_0083640_694_2397 546
412 3300049741 Ga0501079_0087136 Ga0501079_0087136_646_2355 546
413 3300049824 Ga0501045_0088826 Ga0501045_0088826_43_1752 546
414 3300061734 Ga0530510_0008853 Ga0530510_0008853_4905_6614 546
415 3300005293 Ga0065715_10108316 Ga0065715_101083162 547
416 3300005353 Ga0070669_100012314 Ga0070669_1000123142 547
417 3300005367 Ga0070667_100014200 Ga0070667_1000142003 547
418 3300005937 Ga0081455_10020762 Ga0081455_100207622 547
419 3300005981 Ga0081538_10001293 Ga0081538_1000129319 547
420 3300013105 Ga0157369_10242734 Ga0157369_102427341 547
421 3300013306 Ga0163162_10059451 Ga0163162_100594513 547
422 3300017792 Ga0163161_10037083 Ga0163161_100370832 547
423 3300025315 Ga0207697_10001649 Ga0207697_100016497 547
424 3300025901 Ga0207688_10003054 Ga0207688_100030544 547
425 3300025906 Ga0207699_10069411 Ga0207699_100694111 547
426 3300025907 Ga0207645_10009360 Ga0207645_100093603 547
427 3300025916 Ga0207663_10042639 Ga0207663_100426391 547
428 3300025923 Ga0207681_10050098 Ga0207681_100500982 547
429 3300025933 Ga0207706_10006115 Ga0207706_1000611510 547
430 3300025939 Ga0207665_10048256 Ga0207665_100482563 547
431 3300025972 Ga0207668_10036247 Ga0207668_100362473 547
432 3300028800 Ga0265338_10001731 Ga0265338_1000173122 547
433 3300029957 Ga0265324_10008564 Ga0265324_100085644 547
434 3300031238 Ga0265332_10012937 Ga0265332_100129372 547
435 3300031240 Ga0265320_10000376 Ga0265320_1000037612 547
436 3300031251 Ga0265327_10000313 Ga0265327_1000031331 547
437 3300035116 Ga0373945_0016905 Ga0373945_0016905_361_2154 547
438 3300037068 Ga0373925_0066810 Ga0373925_0066810_589_2388 547
439 3300044712 Ga0453684_0000666 Ga0453684_0000666_11562_13289 547
440 3300046454 Ga0495592_0000115 Ga0495592_0000115_27289_29088 547
441 3300046477 Ga0495664_0009171 Ga0495664_0009171_162_1961 547
442 3300046514 Ga0495618_0001376 Ga0495618_0001376_5161_6960 547
443 3300046517 Ga0495630_0006172 Ga0495630_0006172_2514_4313 547
444 3300046529 Ga0495652_0010069 Ga0495652_0010069_219_2018 547
445 3300046535 Ga0495586_0000653 Ga0495586_0000653_10041_11840 547
446 3300046690 Ga0495624_0032470 Ga0495624_0032470_1345_3144 547
447 3300047319 Ga0495674_0018560 Ga0495674_0018560_1783_3582 547
448 3300048903 Ga0496100_0012063 Ga0496100_0012063_3082_4881 547
449 3300049572 Ga0501036_0003006 Ga0501036_0003006_8455_10167 547
450 3300049580 Ga0501046_0004199 Ga0501046_0004199_11133_12845 547
451 3300049588 Ga0501072_0009262 Ga0501072_0009262_1114_2826 547
452 3300049592 Ga0501076_0036259 Ga0501076_0036259_1554_3266 547
453 3300049824 Ga0501045_0019065 Ga0501045_0019065_2759_4471 547
454 3300053087 Ga0500643_004577 Ga0500643_004577_1564_3267 547
455 3300053104 Ga0500556_0000044 Ga0500556_0000044_116524_118227 547
456 3300053130 Ga0500642_0000014 Ga0500642_0000014_142952_144655 547
457 3300053134 Ga0500658_0001071 Ga0500658_0001071_1444_3147 547
458 3300054114 Ga0501084_0002721 Ga0501084_0002721_10792_12504 547
459 3300060353 Ga0501082_0017073 Ga0501082_0017073_3764_5476 547
460 3300005459 Ga0068867_100037165 Ga0068867_1000371652 548
461 3300005471 Ga0070698_100028917 Ga0070698_1000289174 548
462 3300009093 Ga0105240_10002613 Ga0105240_1000261323 548
463 3300009177 Ga0105248_10064297 Ga0105248_100642975 548
464 3300025913 Ga0207695_10065360 Ga0207695_100653602 548
465 3300025944 Ga0207661_10017338 Ga0207661_100173384 548
466 iso_pu_bacteria 2786546517 2787438008 548
467 iso_pu_bacteria 2786546940 2788434621 548
468 3300005563 Ga0068855_100027503 Ga0068855_1000275032 549
469 3300025949 Ga0207667_10037040 Ga0207667_100370402 549
470 3300028381 Ga0268264_10105137 Ga0268264_101051372 549
471 3300031251 Ga0265327_10003676 Ga0265327_100036769 549
472 3300031711 Ga0265314_10006940 Ga0265314_100069404 549
473 3300032004 Ga0307414_10029036 Ga0307414_100290364 549
474 3300049823 Ga0501044_0013063 Ga0501044_0013063_2502_4214 549
475 3300005458 Ga0070681_10005122 Ga0070681_100051227 550
476 3300028563 Ga0265319_1001183 Ga0265319_100118314 550
477 3300028577 Ga0265318_10000213 Ga0265318_1000021311 550
478 3300028577 Ga0265318_10000325 Ga0265318_1000032513 550
479 3300031235 Ga0265330_10000469 Ga0265330_1000046918 550
480 3300031238 Ga0265332_10000178 Ga0265332_1000017846 550
481 3300031239 Ga0265328_10005781 Ga0265328_100057813 550
482 3300031240 Ga0265320_10000050 Ga0265320_1000005079 550
483 3300031241 Ga0265325_10000591 Ga0265325_1000059113 550
484 3300031242 Ga0265329_10000153 Ga0265329_1000015325 550
485 3300031247 Ga0265340_10000160 Ga0265340_100001605 550
486 3300031249 Ga0265339_10003160 Ga0265339_100031606 550
487 3300031250 Ga0265331_10001723 Ga0265331_1000172313 550
488 3300031251 Ga0265327_10029584 Ga0265327_100295842 550
489 3300031344 Ga0265316_10000479 Ga0265316_100004795 550
490 3300031344 Ga0265316_10003402 Ga0265316_100034023 550
491 3300031595 Ga0265313_10000040 Ga0265313_1000004087 550
492 3300031595 Ga0265313_10000687 Ga0265313_1000068717 550
493 3300031711 Ga0265314_10000600 Ga0265314_1000060022 550
494 3300031712 Ga0265342_10000037 Ga0265342_1000003749 550
495 3300031824 Ga0307413_10022978 Ga0307413_100229785 550
496 3300031901 Ga0307406_10042785 Ga0307406_100427852 550
497 3300031911 Ga0307412_10035181 Ga0307412_100351814 550
498 3300032004 Ga0307414_10002397 Ga0307414_100023974 550
499 3300032005 Ga0307411_10001866 Ga0307411_100018665 550
500 3300044712 Ga0453684_0000306 Ga0453684_0000306_122627_124366 550
501 3300044712 Ga0453684_0082530 Ga0453684_0082530_1916_3658 550
502 3300049582 Ga0501048_0057163 Ga0501048_0057163_199_1914 550
503 iso_pu_bacteria 2522572158 2523103710 550
504 iso_pu_bacteria 2524023250 2524613894 550
505 iso_pu_bacteria 2643221541 2643729428 550
506 iso_pu_bacteria 2643221563 2643832839 550
507 iso_pu_bacteria 2739367756 2739792239 550
508 iso_pu_bacteria 2808606401 2809065191 550
509 iso_pu_bacteria 2852653556 2852654248 550
510 3300003781 Ga0055536_1003196 Ga0055536_10031968 551
511 3300003791 Ga0055530_10000028 Ga0055530_1000002889 551
512 3300003794 Ga0055531_10000971 Ga0055531_1000097111 551
513 3300003911 JGI25405J52794_10001065 JGI25405J52794_100010651 551
514 3300005841 Ga0068863_100000259 Ga0068863_10000025934 551
515 3300005937 Ga0081455_10001384 Ga0081455_1000138422 551
516 3300025291 Ga0209675_1000235 Ga0209675_100023528 551
517 3300025292 Ga0209676_1000220 Ga0209676_100022030 551
518 3300025294 Ga0209025_1014254 Ga0209025_10142543 551
519 3300025298 Ga0209050_1000112 Ga0209050_1000112161 551
520 3300025304 Ga0209257_1000213 Ga0209257_100021325 551
521 3300026088 Ga0207641_10000482 Ga0207641_1000048222 551
522 3300029957 Ga0265324_10012106 Ga0265324_100121063 551
523 3300031344 Ga0265316_10002480 Ga0265316_100024802 551
524 3300031344 Ga0265316_10013130 Ga0265316_100131307 551
525 3300031711 Ga0265314_10001043 Ga0265314_1000104314 551
526 3300031711 Ga0265314_10014825 Ga0265314_100148252 551
527 3300031911 Ga0307412_10009240 Ga0307412_100092406 551
528 3300039437 Ga0436365_0010485 Ga0436365_0010485_278_2104 551
529 3300049822 Ga0501035_0019229 Ga0501035_0019229_897_2627 551
530 3300005289 Ga0065704_10079831 Ga0065704_100798312 552
531 3300005290 Ga0065712_10009254 Ga0065712_100092541 552
532 3300005330 Ga0070690_100053179 Ga0070690_1000531792 552
533 3300005355 Ga0070671_100021738 Ga0070671_1000217383 552
534 3300005365 Ga0070688_100067559 Ga0070688_1000675592 552
535 3300005435 Ga0070714_100001634 Ga0070714_1000016346 552
536 3300005436 Ga0070713_100153342 Ga0070713_1001533421 552
537 3300005445 Ga0070708_100042525 Ga0070708_1000425251 552
538 3300005468 Ga0070707_100110532 Ga0070707_1001105322 552
539 3300005471 Ga0070698_100002638 Ga0070698_1000026385 552
540 3300005536 Ga0070697_100001987 Ga0070697_1000019879 552
541 3300005536 Ga0070697_100011528 Ga0070697_1000115283 552
542 3300005842 Ga0068858_100000102 Ga0068858_10000010237 552
543 3300005937 Ga0081455_10000398 Ga0081455_1000039821 552
544 3300005983 Ga0081540_1045285 Ga0081540_10452851 552
545 3300009101 Ga0105247_10034777 Ga0105247_100347774 552
546 3300009174 Ga0105241_10067719 Ga0105241_100677192 552
547 3300009177 Ga0105248_10000014 Ga0105248_10000014299 552
548 3300009551 Ga0105238_10013389 Ga0105238_100133894 552
549 3300009553 Ga0105249_10002596 Ga0105249_100025969 552
550 3300009553 Ga0105249_10037655 Ga0105249_100376554 552
551 3300013297 Ga0157378_10002107 Ga0157378_100021076 552
552 3300013308 Ga0157375_10000040 Ga0157375_10000040101 552
553 3300013308 Ga0157375_10021788 Ga0157375_100217882 552
554 3300014325 Ga0163163_10000165 Ga0163163_1000016526 552
555 3300014325 Ga0163163_10054212 Ga0163163_100542122 552
556 3300014968 Ga0157379_10034206 Ga0157379_100342064 552
557 3300025900 Ga0207710_10017369 Ga0207710_100173692 552
558 3300025910 Ga0207684_10048039 Ga0207684_100480392 552
559 3300025916 Ga0207663_10026621 Ga0207663_100266212 552
560 3300025922 Ga0207646_10077903 Ga0207646_100779032 552
561 3300025924 Ga0207694_10043451 Ga0207694_100434512 552
562 3300025941 Ga0207711_10000021 Ga0207711_1000002131 552
563 3300025961 Ga0207712_10001010 Ga0207712_1000101014 552
564 3300025972 Ga0207668_10019718 Ga0207668_100197182 552
565 3300026035 Ga0207703_10000190 Ga0207703_1000019032 552
566 3300026078 Ga0207702_10072844 Ga0207702_100728442 552
567 3300026116 Ga0207674_10003039 Ga0207674_100030398 552
568 3300028556 Ga0265337_1000467 Ga0265337_100046715 552
569 3300028556 Ga0265337_1003994 Ga0265337_10039942 552
570 3300028558 Ga0265326_10002757 Ga0265326_100027573 552
571 3300028563 Ga0265319_1000767 Ga0265319_100076717 552
572 3300028577 Ga0265318_10003845 Ga0265318_100038455 552
573 3300028653 Ga0265323_10000043 Ga0265323_100000439 552
574 3300028666 Ga0265336_10000631 Ga0265336_100006319 552
575 3300028800 Ga0265338_10000008 Ga0265338_10000008309 552
576 3300028800 Ga0265338_10000041 Ga0265338_10000041128 552
577 3300028800 Ga0265338_10000710 Ga0265338_1000071035 552
578 3300028800 Ga0265338_10001171 Ga0265338_1000117125 552
579 3300028800 Ga0265338_10006519 Ga0265338_100065192 552
580 3300028800 Ga0265338_10009864 Ga0265338_100098645 552
581 3300028800 Ga0265338_10011656 Ga0265338_100116566 552
582 3300028800 Ga0265338_10011925 Ga0265338_100119255 552
583 3300029957 Ga0265324_10000422 Ga0265324_100004227 552
584 3300031240 Ga0265320_10000303 Ga0265320_1000030332 552
585 3300031242 Ga0265329_10005571 Ga0265329_100055712 552
586 3300031251 Ga0265327_10004123 Ga0265327_100041235 552
587 3300031548 Ga0307408_100000021 Ga0307408_10000002187 552
588 3300031616 Ga0307508_10000309 Ga0307508_1000030920 552
589 3300031903 Ga0307407_10000155 Ga0307407_1000015518 552
590 3300032004 Ga0307414_10000083 Ga0307414_1000008354 552
591 3300032005 Ga0307411_10053054 Ga0307411_100530542 552
592 3300035695 Ga0373927_0001758 Ga0373927_0001758_11840_13639 552
593 3300036401 Ga0373937_0031350 Ga0373937_0031350_1260_3053 552
594 3300037068 Ga0373925_0025051 Ga0373925_0025051_2437_4236 552
595 3300041408 Ga0439453_0001153 Ga0439453_0001153_1067_2854 552
596 3300042127 Ga0450890_000001 Ga0450890_000001_119594_121381 552
597 3300042130 Ga0450892_000093 Ga0450892_000093_1462_3249 552
598 3300042532 Ga0450893_0000243 Ga0450893_0000243_50_1837 552
599 3300042532 Ga0450893_0000244 Ga0450893_0000244_4686_6473 552
600 3300042876 Ga0451577_0000347 Ga0451577_0000347_63143_64942 552
601 3300042876 Ga0451577_0011240 Ga0451577_0011240_3517_5316 552
602 3300044656 Ga0466969_0001480 Ga0466969_0001480_8456_10189 552
603 3300044673 Ga0453683_0033209 Ga0453683_0033209_1384_3198 552
604 3300044684 Ga0466966_0000437 Ga0466966_0000437_20859_22592 552
605 3300044693 Ga0466961_0036291 Ga0466961_0036291_939_2672 552
606 3300044693 Ga0466961_0042472 Ga0466961_0042472_499_2301 552
607 3300044694 Ga0466963_0015003 Ga0466963_0015003_2830_4563 552
608 3300044712 Ga0453684_0001441 Ga0453684_0001441_26511_28310 552
609 3300044712 Ga0453684_0017033 Ga0453684_0017033_7014_8813 552
610 3300044719 Ga0466971_0000095 Ga0466971_0000095_20929_22662 552
611 3300044765 Ga0466970_0007557 Ga0466970_0007557_1688_3421 552
612 3300044842 Ga0466957_0000308 Ga0466957_0000308_701_2434 552
613 3300045049 Ga0466959_0000240 Ga0466959_0000240_13123_14856 552
614 3300045051 Ga0451576_0126632 Ga0451576_0126632_793_2592 552
615 3300045836 Ga0466958_0000923 Ga0466958_0000923_8102_9835 552
616 3300046454 Ga0495592_0011665 Ga0495592_0011665_2725_4518 552
617 3300046473 Ga0495582_0004637 Ga0495582_0004637_93_2009 552
618 3300046517 Ga0495630_0000063 Ga0495630_0000063_40092_42008 552
619 3300046517 Ga0495630_0065897 Ga0495630_0065897_829_2631 552
620 3300046529 Ga0495652_0012166 Ga0495652_0012166_3512_5305 552
621 3300046535 Ga0495586_0000009 Ga0495586_0000009_58445_60361 552
622 3300046535 Ga0495586_0057828 Ga0495586_0057828_229_2022 552
623 3300046536 Ga0495587_0009829 Ga0495587_0009829_2451_4244 552
624 3300046642 Ga0495634_0021066 Ga0495634_0021066_2246_4048 552
625 3300046642 Ga0495634_0028603 Ga0495634_0028603_98_1891 552
626 3300046678 Ga0495599_0006697 Ga0495599_0006697_1219_3012 552
627 3300046683 Ga0495658_0016099 Ga0495658_0016099_2024_3823 552
628 3300047319 Ga0495674_0000451 Ga0495674_0000451_31900_33816 552
629 3300047471 Ga0495684_0007052 Ga0495684_0007052_4295_6088 552
630 3300048088 Ga0495602_0019855 Ga0495602_0019855_4598_6391 552
631 3300048904 Ga0496101_0012929 Ga0496101_0012929_772_2475 552
632 3300048905 Ga0496102_0055986 Ga0496102_0055986_1560_3359 552
633 3300048912 Ga0496109_0014517 Ga0496109_0014517_3627_5420 552
634 3300048917 Ga0496114_0002161 Ga0496114_0002161_11789_13588 552
635 3300048918 Ga0496115_0001415 Ga0496115_0001415_7195_9006 552
636 3300048918 Ga0496115_0054063 Ga0496115_0054063_875_2668 552
637 3300049742 Ga0501080_0008215 Ga0501080_0008215_763_2604 552
638 3300050507 nmdc:mga05p37_70631_c1 nmdc:mga05p37_70631_c1_1991_3790 552
639 3300050515 nmdc:mga0a205_174574_c1 nmdc:mga0a205_174574_c1_204_1997 552
640 3300053730 Ga0500645_002407 Ga0500645_002407_1561_3264 552
641 3300005331 Ga0070670_100016887 Ga0070670_1000168872 553
642 3300005340 Ga0070689_100075257 Ga0070689_1000752572 553
643 3300005367 Ga0070667_100006806 Ga0070667_1000068065 553
644 3300005367 Ga0070667_100026251 Ga0070667_1000262512 553
645 3300005441 Ga0070700_100065267 Ga0070700_1000652672 553
646 3300005467 Ga0070706_100010532 Ga0070706_1000105326 553
647 3300005468 Ga0070707_100014606 Ga0070707_1000146065 553
648 3300005548 Ga0070665_100001672 Ga0070665_1000016722 553
649 3300005617 Ga0068859_100008329 Ga0068859_1000083293 553
650 3300005618 Ga0068864_100058101 Ga0068864_1000581016 553
651 3300005841 Ga0068863_100000006 Ga0068863_100000006227 553
652 3300005843 Ga0068860_100000119 Ga0068860_10000011945 553
653 3300005844 Ga0068862_100041857 Ga0068862_1000418574 553
654 3300006844 Ga0075428_100005871 Ga0075428_1000058716 553
655 3300006931 Ga0097620_100008329 Ga0097620_1000083293 553
656 3300007076 Ga0075435_100028686 Ga0075435_1000286862 553
657 3300014326 Ga0157380_10099388 Ga0157380_100993882 553
658 3300014745 Ga0157377_10030284 Ga0157377_100302842 553
659 3300025908 Ga0207643_10054706 Ga0207643_100547063 553
660 3300025910 Ga0207684_10012294 Ga0207684_100122944 553
661 3300025918 Ga0207662_10005326 Ga0207662_100053264 553
662 3300025922 Ga0207646_10011262 Ga0207646_100112626 553
663 3300025922 Ga0207646_10015134 Ga0207646_100151346 553
664 3300025941 Ga0207711_10138592 Ga0207711_101385923 553
665 3300025986 Ga0207658_10000749 Ga0207658_100007494 553
666 3300025986 Ga0207658_10004256 Ga0207658_100042565 553
667 3300026088 Ga0207641_10000054 Ga0207641_1000005432 553
668 3300026088 Ga0207641_10155560 Ga0207641_101555602 553
669 3300026118 Ga0207675_100038057 Ga0207675_1000380573 553
670 3300028379 Ga0268266_10020391 Ga0268266_100203913 553
671 3300028380 Ga0268265_10022662 Ga0268265_100226622 553
672 3300028381 Ga0268264_10000128 Ga0268264_1000012887 553
673 3300048924 Ga0496121_0002328 Ga0496121_0002328_16287_17987 553
674 3300050512 nmdc:mga0n895_139263_c1 nmdc:mga0n895_139263_c1_394_2109 553
675 3300053087 Ga0500643_000135 Ga0500643_000135_30148_31887 553
676 3300053121 Ga0500607_000011 Ga0500607_000011_1529_3232 553
677 3300001904 JGI24736J21556_1003251 JGI24736J21556_10032512 554
678 3300001915 JGI24741J21665_1000047 JGI24741J21665_10000478 554
679 3300001989 JGI24739J22299_10001426 JGI24739J22299_100014263 554
680 3300002067 JGI24735J21928_10006499 JGI24735J21928_100064994 554
681 3300002459 JGI24751J29686_10000055 JGI24751J29686_1000005557 554
682 3300003794 Ga0055531_10001496 Ga0055531_100014967 554
683 3300005262 Ga0065165_1010373 Ga0065165_10103732 554
684 3300005295 Ga0065707_10008947 Ga0065707_100089472 554
685 3300005327 Ga0070658_10004898 Ga0070658_100048983 554
686 3300005329 Ga0070683_100111165 Ga0070683_1001111652 554
687 3300005331 Ga0070670_100001196 Ga0070670_10000119614 554
688 3300005335 Ga0070666_10011221 Ga0070666_100112214 554
689 3300005347 Ga0070668_100002466 Ga0070668_1000024664 554
690 3300005356 Ga0070674_100037553 Ga0070674_1000375532 554
691 3300005366 Ga0070659_100009846 Ga0070659_1000098462 554
692 3300005457 Ga0070662_100022504 Ga0070662_1000225045 554
693 3300005563 Ga0068855_100000921 Ga0068855_1000009214 554
694 3300005577 Ga0068857_100062408 Ga0068857_1000624084 554
695 3300005614 Ga0068856_100020716 Ga0068856_1000207164 554
696 3300005616 Ga0068852_100023583 Ga0068852_1000235834 554
697 3300005617 Ga0068859_100002609 Ga0068859_1000026096 554
698 3300005618 Ga0068864_100001088 Ga0068864_10000108814 554
699 3300005618 Ga0068864_100012451 Ga0068864_1000124517 554
700 3300005841 Ga0068863_100001229 Ga0068863_10000122918 554
701 3300005841 Ga0068863_100021158 Ga0068863_1000211585 554
702 3300005843 Ga0068860_100027677 Ga0068860_1000276772 554
703 3300005981 Ga0081538_10016797 Ga0081538_100167972 554
704 3300005981 Ga0081538_10019422 Ga0081538_100194222 554
705 3300006042 Ga0075368_10000386 Ga0075368_100003866 554
706 3300006048 Ga0075363_100005451 Ga0075363_1000054514 554
707 3300006178 Ga0075367_10000494 Ga0075367_100004944 554
708 3300006353 Ga0075370_10009261 Ga0075370_100092614 554
709 3300009093 Ga0105240_10040387 Ga0105240_100403876 554
710 3300009098 Ga0105245_10001046 Ga0105245_1000104615 554
711 3300009174 Ga0105241_10002560 Ga0105241_100025604 554
712 3300009177 Ga0105248_10023788 Ga0105248_100237886 554
713 3300009551 Ga0105238_10004619 Ga0105238_100046198 554
714 3300017792 Ga0163161_10006031 Ga0163161_100060319 554
715 3300025254 Ga0209148_1000749 Ga0209148_100074917 554
716 3300025292 Ga0209676_1000045 Ga0209676_1000045130 554
717 3300025292 Ga0209676_1000246 Ga0209676_100024665 554
718 3300025298 Ga0209050_1011460 Ga0209050_10114602 554
719 3300025304 Ga0209257_1000169 Ga0209257_100016983 554
720 3300025909 Ga0207705_10000155 Ga0207705_1000015566 554
721 3300025924 Ga0207694_10016720 Ga0207694_100167202 554
722 3300025924 Ga0207694_10031665 Ga0207694_100316652 554
723 3300025925 Ga0207650_10000050 Ga0207650_10000050171 554
724 3300025931 Ga0207644_10066929 Ga0207644_100669292 554
725 3300025972 Ga0207668_10000492 Ga0207668_100004925 554
726 3300026041 Ga0207639_10000511 Ga0207639_1000051113 554
727 3300026067 Ga0207678_10000053 Ga0207678_1000005335 554
728 3300026078 Ga0207702_10004291 Ga0207702_100042919 554
729 3300026088 Ga0207641_10024217 Ga0207641_100242175 554
730 3300026095 Ga0207676_10000004 Ga0207676_10000004172 554
731 3300026142 Ga0207698_10016690 Ga0207698_100166904 554
732 3300027866 Ga0209813_10000023 Ga0209813_100000239 554
733 3300028577 Ga0265318_10001256 Ga0265318_100012568 554
734 3300028654 Ga0265322_10009724 Ga0265322_100097244 554
735 3300029957 Ga0265324_10000851 Ga0265324_100008512 554
736 3300029957 Ga0265324_10004032 Ga0265324_100040322 554
737 3300031235 Ga0265330_10002312 Ga0265330_1000231210 554
738 3300031235 Ga0265330_10003836 Ga0265330_100038367 554
739 3300031235 Ga0265330_10023778 Ga0265330_100237781 554
740 3300031240 Ga0265320_10011564 Ga0265320_100115642 554
741 3300031242 Ga0265329_10000822 Ga0265329_100008226 554
742 3300031250 Ga0265331_10000088 Ga0265331_1000008820 554
743 3300031250 Ga0265331_10000403 Ga0265331_100004036 554
744 3300031251 Ga0265327_10000457 Ga0265327_1000045751 554
745 3300031344 Ga0265316_10129627 Ga0265316_101296272 554
746 3300031548 Ga0307408_100001362 Ga0307408_1000013628 554
747 3300031595 Ga0265313_10019596 Ga0265313_100195962 554
748 3300031616 Ga0307508_10000011 Ga0307508_10000011174 554
749 3300031731 Ga0307405_10026166 Ga0307405_100261664 554
750 3300031901 Ga0307406_10004208 Ga0307406_100042087 554
751 3300031911 Ga0307412_10000844 Ga0307412_1000084410 554
752 3300032002 Ga0307416_100002045 Ga0307416_1000020457 554
753 3300037312 Ga0395899_0036822 Ga0395899_0036822_102_1829 554
754 3300038443 Ga0395901_0002048 Ga0395901_0002048_10580_12307 554
755 3300044712 Ga0453684_0000147 Ga0453684_0000147_188447_190168 554
756 3300046453 Ga0495627_013361 Ga0495627_013361_304_2007 554
757 3300046462 Ga0495651_0018964 Ga0495651_0018964_3021_4748 554
758 3300046471 Ga0495650_0000756 Ga0495650_0000756_20834_22537 554
759 3300046500 Ga0495596_0001188 Ga0495596_0001188_1484_3187 554
760 3300046507 Ga0495606_0009719 Ga0495606_0009719_844_2547 554
761 3300046512 Ga0495610_0003390 Ga0495610_0003390_8705_10408 554
762 3300046616 Ga0495668_0000229 Ga0495668_0000229_71055_72758 554
763 3300046660 Ga0495625_0008293 Ga0495625_0008293_5888_7591 554
764 3300047470 Ga0495681_0000017 Ga0495681_0000017_101071_102774 554
765 3300048088 Ga0495602_0035158 Ga0495602_0035158_1114_2841 554
766 3300048091 Ga0495626_0001137 Ga0495626_0001137_7370_9073 554
767 3300048905 Ga0496102_0004371 Ga0496102_0004371_818_2521 554
768 3300048909 Ga0496106_0000319 Ga0496106_0000319_24749_26452 554
769 3300048918 Ga0496115_0114880 Ga0496115_0114880_174_1895 554
770 3300048921 Ga0496118_0001488 Ga0496118_0001488_27277_28980 554
771 3300049574 Ga0501038_0023098 Ga0501038_0023098_1950_3653 554
772 3300049576 Ga0501040_0052569 Ga0501040_0052569_910_2646 554
773 3300049591 Ga0501075_0006760 Ga0501075_0006760_4656_6392 554
774 3300049592 Ga0501076_0139599 Ga0501076_0139599_129_1865 554
775 3300050494 nmdc:mga06z11_66_c1 nmdc:mga06z11_66_c1_38613_40316 554
776 3300050495 nmdc:mga04h51_79_c1 nmdc:mga04h51_79_c1_7706_9409 554
777 3300053080 Ga0500635_0000942 Ga0500635_0000942_2193_4019 554
778 3300053116 Ga0500592_001159 Ga0500592_001159_1087_2790 554
779 3300061734 Ga0530510_0016249 Ga0530510_0016249_255_1991 554
780 3300061734 Ga0530510_0040735 Ga0530510_0040735_1288_3024 554

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03814

KdpA

Potassium-transporting ATPase A subunit

53

620

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nnl-assembly1.cif.gz_A cryo-em structure of the kdpfabc complex in an e1-atp conformation loaded with k+ 0.9541 1 546
5mrw-assembly2.cif.gz_E structure of the kdpfabc complex 0.9529 1 546
7nnp-assembly1.cif.gz_A rb-loaded cryo-em structure of the e1-atp kdpfabc complex. 0.9481 1 546
7nnl-assembly1.cif.gz_A cryo-em structure of the kdpfabc complex in an e1-atp conformation loaded with k+ 0.9389 1 546
5mrw-assembly2.cif.gz_E structure of the kdpfabc complex 0.9376 1 546
ID Description Score Start End Superfamily
af_D4AA82_391_633_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3748 103 298 1.20.1070.10
af_U4PFA8_90_276_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.332 366 488 1.10.287.70
af_D4AA82_391_633_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2927 103 298 1.20.1070.10
af_A0A0R4IU63_604_837_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.287 45 343 1.20.1070.10
af_A3KPM6_590_828_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2867 76 343 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A6L3ZV93-F1-model_v4 deleted 0.9938 1 265
AF-A0A4Q2ZEI1-F1-model_v4 Potassium-transporting ATPase subunit A 0.9897 1 327 GO:0005886
GO:0008556
AF-A0A520D4Y7-F1-model_v4 deleted 0.9891 1 216
AF-A0A7Y5VMV4-F1-model_v4 Potassium-transporting ATPase subunit A 0.9889 1 318 GO:0005886
GO:0008556
AF-A0A354V3K5-F1-model_v4 Potassium-transporting ATPase subunit KdpA (EC 3.6.3.12) 0.9889 1 277 GO:0005886
GO:0008556
GO:0016787

Feature Viewer

pLDDT pTM Quality
86.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map