F480513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 780 | 368 | 770 | 566 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10128100|Ga0105240_101281001 |
| Length | 628 |
| Sequence | MPTGAKNFEEPYGKHHRWSHFPGFVCVFALRNAQAGKLLTDFTMQTSGWIQLGLFVALLALITKPMGLYLVQVLDANGKTWLDPVLKPFERLTYRLLGVRADEEHDWRRYTWAMLLFSLVSCVFTYAILRLQDKLPFQSLFNPQGLPGLTPHLAFNTAVSFTTNTNWQSYGGESTMSYFSQMVALTIHNFTSAAVGIALAAALVRGIARHSTKLIGNFWVDVVRLTYYLLLPICLVFALFLVSQGMIQNFKPYTKAKLVEPMKISVAKTDKDGKPDQLVEEQTIVQGPMASQVAIKMLGTNGGGYANANAAHPFENPTPLSNFIQMLSIFAIGSGLTYYLGRMVKNQKHGWAVWAAMTILFLGGTVLCWWAEAKGNPIHQQLGVIAADGNMEGKEVRFGLFNSALFATITTDASCGAVNSMHDSFTALGGFIPLFNIQLGEIIFGGVGAGLYGMIVFIVLAVFIAGLMVGRTPEYLGKKIHSFEVKMAMLALLVXXXDILAFAAWAAVSQWGLAGLNNTGPHGLSAMLYAFSSGTGNNGSAFAGLTTNTPWYNTTLGIAMLVGRFLMIIPIMAMAGALAEKKLIPASAGTFVILLLGTILLVGALNFLPVLALGPIVEHFLMLKGTLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 6 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 7 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 8 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 9 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 10 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 246 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 247 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 248 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 249 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 309 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 310 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 311 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 312 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 313 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 353 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 0 |
| Isolates | 1.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.56 |
| Nodule | 0 |
| Rhizoplane | 1.92 |
| Rhizosphere | 87.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003251 | 3300001904 | Bacteria | 2828 |
| 2 | JGI24741J21665_1000047 | 3300001915 | Bacteria | 29688 |
| 3 | JGI24746J21847_1001047 | 3300001977 | Bacteria | 4345 |
| 4 | JGI24739J22299_10001426 | 3300001989 | Bacteria | 8995 |
| 5 | JGI24735J21928_10001887 | 3300002067 | Bacteria | 7356 |
| 6 | JGI24735J21928_10006499 | 3300002067 | Bacteria | 3845 |
| 7 | JGI24744J21845_10003434 | 3300002077 | Bacteria | 3256 |
| 8 | JGI24751J29686_10000055 | 3300002459 | Bacteria | 64731 |
| 9 | JGI25165J46597_1000173 | 3300003214 | Bacteria | 100834 |
| 10 | rootH2_10055959 | 3300003320 | Bacteria | 4324 |
| 11 | Ga0055536_1003196 | 3300003781 | Bacteria | 8879 |
| 12 | Ga0055530_10000028 | 3300003791 | Bacteria | 128474 |
| 13 | Ga0055531_10000971 | 3300003794 | Bacteria | 22919 |
| 14 | Ga0055531_10001496 | 3300003794 | Bacteria | 17161 |
| 15 | JGI25405J52794_10001065 | 3300003911 | Bacteria | 4382 |
| 16 | Ga0065165_1010373 | 3300005262 | Bacteria | 4039 |
| 17 | Ga0065704_10079831 | 3300005289 | Bacteria | 4072 |
| 18 | Ga0065712_10009254 | 3300005290 | Bacteria | 3788 |
| 19 | Ga0065715_10108316 | 3300005293 | Bacteria | 2709 |
| 20 | Ga0065707_10008947 | 3300005295 | Bacteria | 3364 |
| 21 | Ga0065707_10099641 | 3300005295 | Bacteria | 2975 |
| 22 | Ga0065707_10104456 | 3300005295 | Bacteria | 2694 |
| 23 | Ga0070658_10001414 | 3300005327 | Bacteria | 20533 |
| 24 | Ga0070658_10004898 | 3300005327 | Bacteria | 10909 |
| 25 | Ga0070676_10033259 | 3300005328 | Bacteria | 2958 |
| 26 | Ga0070676_10049757 | 3300005328 | Bacteria | 2454 |
| 27 | Ga0070676_10058369 | 3300005328 | Bacteria | 2287 |
| 28 | Ga0070683_100111165 | 3300005329 | Bacteria | 2585 |
| 29 | Ga0070690_100053179 | 3300005330 | Bacteria | 2590 |
| 30 | Ga0070670_100001196 | 3300005331 | Bacteria | 20604 |
| 31 | Ga0070670_100016887 | 3300005331 | Bacteria | 6266 |
| 32 | Ga0070670_100023871 | 3300005331 | Bacteria | 5261 |
| 33 | Ga0070670_100084662 | 3300005331 | Bacteria | 2724 |
| 34 | Ga0068869_100000086 | 3300005334 | Bacteria | 42241 |
| 35 | Ga0070666_10000057 | 3300005335 | Bacteria | 91177 |
| 36 | Ga0070666_10011221 | 3300005335 | Bacteria | 5619 |
| 37 | Ga0070682_100009293 | 3300005337 | Bacteria | 5565 |
| 38 | Ga0068868_100047428 | 3300005338 | Bacteria | 3367 |
| 39 | Ga0070689_100003098 | 3300005340 | Bacteria | 10975 |
| 40 | Ga0070689_100075257 | 3300005340 | Bacteria | 2643 |
| 41 | Ga0070668_100002466 | 3300005347 | Bacteria | 13623 |
| 42 | Ga0070668_100017464 | 3300005347 | Bacteria | 5378 |
| 43 | Ga0070668_100024340 | 3300005347 | Bacteria | 4586 |
| 44 | Ga0070668_100042888 | 3300005347 | Bacteria | 3467 |
| 45 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 46 | Ga0070669_100012314 | 3300005353 | Bacteria | 6068 |
| 47 | Ga0070671_100000029 | 3300005355 | Bacteria | 112712 |
| 48 | Ga0070671_100021738 | 3300005355 | Bacteria | 5239 |
| 49 | Ga0070671_100026407 | 3300005355 | Bacteria | 4772 |
| 50 | Ga0070671_100077042 | 3300005355 | Bacteria | 2786 |
| 51 | Ga0070674_100037553 | 3300005356 | Bacteria | 3259 |
| 52 | Ga0070674_100044383 | 3300005356 | Bacteria | 3030 |
| 53 | Ga0070673_100020155 | 3300005364 | Bacteria | 4804 |
| 54 | Ga0070673_100041977 | 3300005364 | Bacteria | 3523 |
| 55 | Ga0070688_100067559 | 3300005365 | Bacteria | 2277 |
| 56 | Ga0070659_100009846 | 3300005366 | Bacteria | 7030 |
| 57 | Ga0070667_100005017 | 3300005367 | Bacteria | 11080 |
| 58 | Ga0070667_100006806 | 3300005367 | Bacteria | 9493 |
| 59 | Ga0070667_100014200 | 3300005367 | Bacteria | 6579 |
| 60 | Ga0070667_100026251 | 3300005367 | Bacteria | 4844 |
| 61 | Ga0070667_100027783 | 3300005367 | Bacteria | 4708 |
| 62 | Ga0070703_10000387 | 3300005406 | Bacteria | 18520 |
| 63 | Ga0070714_100001634 | 3300005435 | Bacteria | 16312 |
| 64 | Ga0070713_100153342 | 3300005436 | Bacteria | 2051 |
| 65 | Ga0070705_100001737 | 3300005440 | Bacteria | 11329 |
| 66 | Ga0070700_100065267 | 3300005441 | Bacteria | 2308 |
| 67 | Ga0070708_100011564 | 3300005445 | Bacteria | 7186 |
| 68 | Ga0070708_100013918 | 3300005445 | Bacteria | 6608 |
| 69 | Ga0070708_100042525 | 3300005445 | Bacteria | 3989 |
| 70 | Ga0070708_100208127 | 3300005445 | Bacteria | 1833 |
| 71 | Ga0070678_100030709 | 3300005456 | Bacteria | 3697 |
| 72 | Ga0070678_100111501 | 3300005456 | Bacteria | 2141 |
| 73 | Ga0070662_100022504 | 3300005457 | Bacteria | 4317 |
| 74 | Ga0070681_10005122 | 3300005458 | Bacteria | 12653 |
| 75 | Ga0068867_100000124 | 3300005459 | Bacteria | 49521 |
| 76 | Ga0068867_100000596 | 3300005459 | Bacteria | 23910 |
| 77 | Ga0068867_100037165 | 3300005459 | Bacteria | 3539 |
| 78 | Ga0070685_10003083 | 3300005466 | Bacteria | 8477 |
| 79 | Ga0070706_100000011 | 3300005467 | Bacteria | 198585 |
| 80 | Ga0070706_100002067 | 3300005467 | Bacteria | 20512 |
| 81 | Ga0070706_100010532 | 3300005467 | Bacteria | 8584 |
| 82 | Ga0070706_100035218 | 3300005467 | Bacteria | 4623 |
| 83 | Ga0070707_100014606 | 3300005468 | Bacteria | 7362 |
| 84 | Ga0070707_100043592 | 3300005468 | Bacteria | 4293 |
| 85 | Ga0070707_100110532 | 3300005468 | Bacteria | 2665 |
| 86 | Ga0070698_100002638 | 3300005471 | Bacteria | 19754 |
| 87 | Ga0070698_100007185 | 3300005471 | Bacteria | 12065 |
| 88 | Ga0070698_100028917 | 3300005471 | Bacteria | 5754 |
| 89 | Ga0070698_100063262 | 3300005471 | Bacteria | 3732 |
| 90 | Ga0070699_100000089 | 3300005518 | Bacteria | 87470 |
| 91 | Ga0070699_100023100 | 3300005518 | Bacteria | 5358 |
| 92 | Ga0070699_100098764 | 3300005518 | Bacteria | 2558 |
| 93 | Ga0070697_100001987 | 3300005536 | Bacteria | 15658 |
| 94 | Ga0070697_100004449 | 3300005536 | Bacteria | 10767 |
| 95 | Ga0070697_100011528 | 3300005536 | Bacteria | 6908 |
| 96 | Ga0068853_100021318 | 3300005539 | Bacteria | 5401 |
| 97 | Ga0070686_100010603 | 3300005544 | Bacteria | 5204 |
| 98 | Ga0070665_100001672 | 3300005548 | Bacteria | 25562 |
| 99 | Ga0070704_100015233 | 3300005549 | Bacteria | 4825 |
| 100 | Ga0068855_100000921 | 3300005563 | Bacteria | 36597 |
| 101 | Ga0068855_100005065 | 3300005563 | Bacteria | 16074 |
| 102 | Ga0068855_100027503 | 3300005563 | Bacteria | 6802 |
| 103 | Ga0070664_100011678 | 3300005564 | Bacteria | 7127 |
| 104 | Ga0068857_100000176 | 3300005577 | Bacteria | 40531 |
| 105 | Ga0068857_100062408 | 3300005577 | Bacteria | 3312 |
| 106 | Ga0068854_100004135 | 3300005578 | Bacteria | 9119 |
| 107 | Ga0068856_100020716 | 3300005614 | Bacteria | 6388 |
| 108 | Ga0068852_100023583 | 3300005616 | Bacteria | 4955 |
| 109 | Ga0068859_100000370 | 3300005617 | Bacteria | 44819 |
| 110 | Ga0068859_100002609 | 3300005617 | Bacteria | 18330 |
| 111 | Ga0068859_100008329 | 3300005617 | Bacteria | 10508 |
| 112 | Ga0068859_100099460 | 3300005617 | Bacteria | 2964 |
| 113 | Ga0068864_100001088 | 3300005618 | Bacteria | 22775 |
| 114 | Ga0068864_100012451 | 3300005618 | Bacteria | 7033 |
| 115 | Ga0068864_100058101 | 3300005618 | Bacteria | 3342 |
| 116 | Ga0068861_100003376 | 3300005719 | Bacteria | 10583 |
| 117 | Ga0068863_100000006 | 3300005841 | Bacteria | 265379 |
| 118 | Ga0068863_100000259 | 3300005841 | Bacteria | 55368 |
| 119 | Ga0068863_100001229 | 3300005841 | Bacteria | 25559 |
| 120 | Ga0068863_100021158 | 3300005841 | Bacteria | 6212 |
| 121 | Ga0068863_100028402 | 3300005841 | Bacteria | 5341 |
| 122 | Ga0068858_100000102 | 3300005842 | Bacteria | 88959 |
| 123 | Ga0068858_100002318 | 3300005842 | Bacteria | 19230 |
| 124 | Ga0068860_100000119 | 3300005843 | Bacteria | 127040 |
| 125 | Ga0068860_100027677 | 3300005843 | Bacteria | 5458 |
| 126 | Ga0068860_100032015 | 3300005843 | Bacteria | 5056 |
| 127 | Ga0068862_100000538 | 3300005844 | Bacteria | 39616 |
| 128 | Ga0068862_100001724 | 3300005844 | Bacteria | 19782 |
| 129 | Ga0068862_100041857 | 3300005844 | Bacteria | 3899 |
| 130 | Ga0081455_10000398 | 3300005937 | Bacteria | 57265 |
| 131 | Ga0081455_10001384 | 3300005937 | Bacteria | 29929 |
| 132 | Ga0081455_10020762 | 3300005937 | Bacteria | 6174 |
| 133 | Ga0081455_10022661 | 3300005937 | Bacteria | 5862 |
| 134 | Ga0081538_10001293 | 3300005981 | Bacteria | 25953 |
| 135 | Ga0081538_10016797 | 3300005981 | Bacteria | 5589 |
| 136 | Ga0081538_10019422 | 3300005981 | Bacteria | 5052 |
| 137 | Ga0081540_1000010 | 3300005983 | Bacteria | 193206 |
| 138 | Ga0081540_1045285 | 3300005983 | Bacteria | 2236 |
| 139 | Ga0081539_10009526 | 3300005985 | Bacteria | 8091 |
| 140 | Ga0070717_10003667 | 3300006028 | Bacteria | 11021 |
| 141 | Ga0075368_10000386 | 3300006042 | Bacteria | 12961 |
| 142 | Ga0075363_100005451 | 3300006048 | Bacteria | 5661 |
| 143 | Ga0075363_100008802 | 3300006048 | Bacteria | 4720 |
| 144 | Ga0070712_100015642 | 3300006175 | Bacteria | 4891 |
| 145 | Ga0070712_100061474 | 3300006175 | Bacteria | 2653 |
| 146 | Ga0075362_10008771 | 3300006177 | Bacteria | 3884 |
| 147 | Ga0075367_10000494 | 3300006178 | Bacteria | 14805 |
| 148 | Ga0075366_10005154 | 3300006195 | Bacteria | 7070 |
| 149 | Ga0097621_100077117 | 3300006237 | Bacteria | 2766 |
| 150 | Ga0075370_10004047 | 3300006353 | Bacteria | 7048 |
| 151 | Ga0075370_10009261 | 3300006353 | Bacteria | 5106 |
| 152 | Ga0068871_100004028 | 3300006358 | Bacteria | 10148 |
| 153 | Ga0068871_100005532 | 3300006358 | Bacteria | 8862 |
| 154 | Ga0075428_100005871 | 3300006844 | Bacteria | 13639 |
| 155 | Ga0075431_100173221 | 3300006847 | Bacteria | 2217 |
| 156 | Ga0075433_10006296 | 3300006852 | Bacteria | 9374 |
| 157 | Ga0075429_100054412 | 3300006880 | Bacteria | 3481 |
| 158 | Ga0075429_100166539 | 3300006880 | Bacteria | 1931 |
| 159 | Ga0068865_100001574 | 3300006881 | Bacteria | 13329 |
| 160 | Ga0075436_100044026 | 3300006914 | Bacteria | 3077 |
| 161 | Ga0097620_100000370 | 3300006931 | Bacteria | 44819 |
| 162 | Ga0097620_100008329 | 3300006931 | Bacteria | 10508 |
| 163 | Ga0097620_100099458 | 3300006931 | Bacteria | 2964 |
| 164 | Ga0075435_100028686 | 3300007076 | Bacteria | 4366 |
| 165 | Ga0105244_10002893 | 3300009036 | Bacteria | 12696 |
| 166 | Ga0105240_10000163 | 3300009093 | Bacteria | 136503 |
| 167 | Ga0105240_10002613 | 3300009093 | Bacteria | 28786 |
| 168 | Ga0105240_10008262 | 3300009093 | Bacteria | 14900 |
| 169 | Ga0105240_10040387 | 3300009093 | Bacteria | 5968 |
| 170 | Ga0105240_10128100 | 3300009093 | Bacteria | 3047 |
| 171 | Ga0111539_10011192 | 3300009094 | Bacteria | 11275 |
| 172 | Ga0111539_10016208 | 3300009094 | Bacteria | 9246 |
| 173 | Ga0111539_10119710 | 3300009094 | Bacteria | 3085 |
| 174 | Ga0105245_10001046 | 3300009098 | Bacteria | 25053 |
| 175 | Ga0105247_10034777 | 3300009101 | Bacteria | 3069 |
| 176 | Ga0114129_10021725 | 3300009147 | Bacteria | 9107 |
| 177 | Ga0105243_10000049 | 3300009148 | Bacteria | 145575 |
| 178 | Ga0105241_10002560 | 3300009174 | Bacteria | 13653 |
| 179 | Ga0105241_10067719 | 3300009174 | Bacteria | 2764 |
| 180 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 181 | Ga0105248_10023788 | 3300009177 | Bacteria | 6809 |
| 182 | Ga0105248_10064297 | 3300009177 | Bacteria | 4119 |
| 183 | Ga0105237_10003590 | 3300009545 | Bacteria | 18358 |
| 184 | Ga0105238_10004619 | 3300009551 | Bacteria | 13631 |
| 185 | Ga0105238_10013389 | 3300009551 | Bacteria | 8279 |
| 186 | Ga0105238_10020205 | 3300009551 | Bacteria | 6779 |
| 187 | Ga0105249_10000161 | 3300009553 | Bacteria | 80491 |
| 188 | Ga0105249_10002596 | 3300009553 | Bacteria | 15646 |
| 189 | Ga0105249_10037655 | 3300009553 | Bacteria | 4389 |
| 190 | Ga0157370_10000095 | 3300013104 | Bacteria | 100727 |
| 191 | Ga0157369_10007626 | 3300013105 | Bacteria | 12449 |
| 192 | Ga0157369_10242734 | 3300013105 | Bacteria | 1881 |
| 193 | Ga0157374_10010673 | 3300013296 | Bacteria | 7912 |
| 194 | Ga0157378_10002107 | 3300013297 | Bacteria | 17725 |
| 195 | Ga0157378_10046360 | 3300013297 | Bacteria | 3864 |
| 196 | Ga0163162_10026948 | 3300013306 | Bacteria | 5683 |
| 197 | Ga0163162_10059451 | 3300013306 | Bacteria | 3854 |
| 198 | Ga0163162_10121945 | 3300013306 | Bacteria | 2711 |
| 199 | Ga0157372_10027415 | 3300013307 | Bacteria | 6203 |
| 200 | Ga0157372_10147063 | 3300013307 | Bacteria | 2717 |
| 201 | Ga0157375_10000040 | 3300013308 | Bacteria | 164344 |
| 202 | Ga0157375_10021788 | 3300013308 | Bacteria | 5885 |
| 203 | Ga0157375_10090254 | 3300013308 | Bacteria | 3122 |
| 204 | Ga0163163_10000165 | 3300014325 | Bacteria | 69209 |
| 205 | Ga0163163_10054212 | 3300014325 | Bacteria | 3961 |
| 206 | Ga0157380_10099388 | 3300014326 | Bacteria | 2420 |
| 207 | Ga0157380_10101358 | 3300014326 | Bacteria | 2399 |
| 208 | Ga0157377_10000732 | 3300014745 | Bacteria | 13549 |
| 209 | Ga0157377_10030284 | 3300014745 | Bacteria | 2930 |
| 210 | Ga0157379_10011558 | 3300014968 | Bacteria | 7706 |
| 211 | Ga0157379_10034206 | 3300014968 | Bacteria | 4530 |
| 212 | Ga0157376_10052923 | 3300014969 | Bacteria | 3378 |
| 213 | Ga0157376_10094614 | 3300014969 | Bacteria | 2596 |
| 214 | Ga0157376_10096419 | 3300014969 | Bacteria | 2574 |
| 215 | Ga0163161_10006031 | 3300017792 | Bacteria | 8399 |
| 216 | Ga0163161_10037083 | 3300017792 | Bacteria | 3494 |
| 217 | Ga0213871_10003745 | 3300021441 | Bacteria | 2971 |
| 218 | Ga0207427_101282 | 3300025231 | Bacteria | 9565 |
| 219 | Ga0209148_1000749 | 3300025254 | Bacteria | 24958 |
| 220 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 221 | Ga0209675_1000235 | 3300025291 | Bacteria | 55378 |
| 222 | Ga0209676_1000045 | 3300025292 | Bacteria | 412331 |
| 223 | Ga0209676_1000220 | 3300025292 | Bacteria | 125094 |
| 224 | Ga0209676_1000246 | 3300025292 | Bacteria | 116315 |
| 225 | Ga0209025_1014254 | 3300025294 | Bacteria | 4910 |
| 226 | Ga0209050_1000112 | 3300025298 | Bacteria | 210320 |
| 227 | Ga0209050_1005294 | 3300025298 | Bacteria | 8204 |
| 228 | Ga0209050_1011460 | 3300025298 | Bacteria | 4196 |
| 229 | Ga0209257_1000169 | 3300025304 | Bacteria | 171227 |
| 230 | Ga0209257_1000213 | 3300025304 | Bacteria | 138144 |
| 231 | Ga0209257_1001548 | 3300025304 | Bacteria | 26689 |
| 232 | Ga0207697_10000135 | 3300025315 | Bacteria | 35637 |
| 233 | Ga0207697_10000301 | 3300025315 | Bacteria | 27565 |
| 234 | Ga0207697_10001649 | 3300025315 | Bacteria | 12068 |
| 235 | Ga0207655_1000130 | 3300025728 | Bacteria | 148370 |
| 236 | Ga0207653_10000176 | 3300025885 | Bacteria | 44920 |
| 237 | Ga0207710_10017369 | 3300025900 | Bacteria | 3052 |
| 238 | Ga0207710_10047055 | 3300025900 | Bacteria | 1927 |
| 239 | Ga0207688_10003054 | 3300025901 | Bacteria | 9124 |
| 240 | Ga0207688_10025054 | 3300025901 | Bacteria | 3274 |
| 241 | Ga0207688_10053845 | 3300025901 | Bacteria | 2257 |
| 242 | Ga0207680_10000316 | 3300025903 | Bacteria | 23086 |
| 243 | Ga0207699_10069411 | 3300025906 | Bacteria | 2149 |
| 244 | Ga0207645_10009360 | 3300025907 | Bacteria | 6782 |
| 245 | Ga0207645_10025139 | 3300025907 | Bacteria | 3855 |
| 246 | Ga0207645_10056150 | 3300025907 | Bacteria | 2514 |
| 247 | Ga0207645_10068074 | 3300025907 | Bacteria | 2276 |
| 248 | Ga0207643_10054706 | 3300025908 | Bacteria | 2269 |
| 249 | Ga0207705_10000155 | 3300025909 | Bacteria | 73779 |
| 250 | Ga0207705_10003229 | 3300025909 | Bacteria | 12409 |
| 251 | Ga0207684_10000052 | 3300025910 | Bacteria | 228510 |
| 252 | Ga0207684_10001151 | 3300025910 | Bacteria | 29527 |
| 253 | Ga0207684_10012294 | 3300025910 | Bacteria | 7451 |
| 254 | Ga0207684_10017741 | 3300025910 | Bacteria | 6106 |
| 255 | Ga0207684_10030423 | 3300025910 | Bacteria | 4595 |
| 256 | Ga0207684_10048039 | 3300025910 | Bacteria | 3620 |
| 257 | Ga0207695_10000472 | 3300025913 | Bacteria | 87457 |
| 258 | Ga0207695_10025841 | 3300025913 | Bacteria | 6564 |
| 259 | Ga0207695_10029573 | 3300025913 | Bacteria | 6048 |
| 260 | Ga0207695_10065360 | 3300025913 | Bacteria | 3740 |
| 261 | Ga0207671_10012807 | 3300025914 | Bacteria | 6721 |
| 262 | Ga0207663_10002821 | 3300025916 | Bacteria | 8387 |
| 263 | Ga0207663_10026621 | 3300025916 | Bacteria | 3359 |
| 264 | Ga0207663_10042639 | 3300025916 | Bacteria | 2773 |
| 265 | Ga0207662_10005326 | 3300025918 | Bacteria | 6843 |
| 266 | Ga0207646_10005357 | 3300025922 | Bacteria | 13511 |
| 267 | Ga0207646_10011262 | 3300025922 | Bacteria | 8685 |
| 268 | Ga0207646_10015134 | 3300025922 | Bacteria | 7297 |
| 269 | Ga0207646_10077903 | 3300025922 | Bacteria | 2962 |
| 270 | Ga0207646_10130152 | 3300025922 | Bacteria | 2265 |
| 271 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 272 | Ga0207681_10020639 | 3300025923 | Bacteria | 4178 |
| 273 | Ga0207681_10050098 | 3300025923 | Bacteria | 2825 |
| 274 | Ga0207694_10016478 | 3300025924 | Bacteria | 5581 |
| 275 | Ga0207694_10016720 | 3300025924 | Bacteria | 5545 |
| 276 | Ga0207694_10031665 | 3300025924 | Bacteria | 4042 |
| 277 | Ga0207694_10043451 | 3300025924 | Bacteria | 3469 |
| 278 | Ga0207694_10061439 | 3300025924 | Bacteria | 2924 |
| 279 | Ga0207650_10000050 | 3300025925 | Bacteria | 169589 |
| 280 | Ga0207650_10030620 | 3300025925 | Bacteria | 3878 |
| 281 | Ga0207659_10028321 | 3300025926 | Bacteria | 3806 |
| 282 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 283 | Ga0207644_10066929 | 3300025931 | Bacteria | 2617 |
| 284 | Ga0207706_10006115 | 3300025933 | Bacteria | 11181 |
| 285 | Ga0207709_10000097 | 3300025935 | Bacteria | 136507 |
| 286 | Ga0207670_10001459 | 3300025936 | Bacteria | 12408 |
| 287 | Ga0207704_10047124 | 3300025938 | Bacteria | 2574 |
| 288 | Ga0207665_10048256 | 3300025939 | Bacteria | 2857 |
| 289 | Ga0207711_10000021 | 3300025941 | Bacteria | 355952 |
| 290 | Ga0207711_10138592 | 3300025941 | Bacteria | 2187 |
| 291 | Ga0207689_10000023 | 3300025942 | Bacteria | 107806 |
| 292 | Ga0207661_10017338 | 3300025944 | Bacteria | 5326 |
| 293 | Ga0207667_10037040 | 3300025949 | Bacteria | 5218 |
| 294 | Ga0207651_10024723 | 3300025960 | Bacteria | 3721 |
| 295 | Ga0207651_10045644 | 3300025960 | Bacteria | 2940 |
| 296 | Ga0207712_10000059 | 3300025961 | Bacteria | 137849 |
| 297 | Ga0207712_10001010 | 3300025961 | Bacteria | 20031 |
| 298 | Ga0207712_10003209 | 3300025961 | Bacteria | 10390 |
| 299 | Ga0207668_10000327 | 3300025972 | Bacteria | 30795 |
| 300 | Ga0207668_10000492 | 3300025972 | Bacteria | 24731 |
| 301 | Ga0207668_10019718 | 3300025972 | Bacteria | 4269 |
| 302 | Ga0207668_10036247 | 3300025972 | Bacteria | 3290 |
| 303 | Ga0207668_10046546 | 3300025972 | Bacteria | 2964 |
| 304 | Ga0207640_10000314 | 3300025981 | Bacteria | 32442 |
| 305 | Ga0207658_10000749 | 3300025986 | Bacteria | 27980 |
| 306 | Ga0207658_10001925 | 3300025986 | Bacteria | 15494 |
| 307 | Ga0207658_10004256 | 3300025986 | Bacteria | 9971 |
| 308 | Ga0207703_10000190 | 3300026035 | Bacteria | 72096 |
| 309 | Ga0207703_10008968 | 3300026035 | Bacteria | 7879 |
| 310 | Ga0207639_10000511 | 3300026041 | Bacteria | 26861 |
| 311 | Ga0207639_10033193 | 3300026041 | Bacteria | 3805 |
| 312 | Ga0207678_10000053 | 3300026067 | Bacteria | 88489 |
| 313 | Ga0207702_10004291 | 3300026078 | Bacteria | 12711 |
| 314 | Ga0207702_10072844 | 3300026078 | Bacteria | 2961 |
| 315 | Ga0207641_10000054 | 3300026088 | Bacteria | 170887 |
| 316 | Ga0207641_10000482 | 3300026088 | Bacteria | 45003 |
| 317 | Ga0207641_10024217 | 3300026088 | Bacteria | 5004 |
| 318 | Ga0207641_10155560 | 3300026088 | Bacteria | 2074 |
| 319 | Ga0207648_10000083 | 3300026089 | Bacteria | 89416 |
| 320 | Ga0207648_10001277 | 3300026089 | Bacteria | 28143 |
| 321 | Ga0207648_10028640 | 3300026089 | Bacteria | 4937 |
| 322 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 323 | Ga0207674_10001786 | 3300026116 | Bacteria | 27456 |
| 324 | Ga0207674_10003039 | 3300026116 | Bacteria | 20778 |
| 325 | Ga0207675_100003014 | 3300026118 | Bacteria | 16514 |
| 326 | Ga0207675_100038057 | 3300026118 | Bacteria | 4489 |
| 327 | Ga0207683_10008702 | 3300026121 | Bacteria | 8672 |
| 328 | Ga0207698_10016690 | 3300026142 | Bacteria | 4959 |
| 329 | Ga0209813_10000023 | 3300027866 | Bacteria | 72775 |
| 330 | Ga0207428_10000139 | 3300027907 | Bacteria | 98277 |
| 331 | Ga0207428_10004571 | 3300027907 | Bacteria | 13117 |
| 332 | Ga0268266_10020391 | 3300028379 | Bacteria | 5650 |
| 333 | Ga0268266_10039321 | 3300028379 | Bacteria | 4028 |
| 334 | Ga0268265_10000255 | 3300028380 | Bacteria | 60546 |
| 335 | Ga0268265_10000281 | 3300028380 | Bacteria | 57698 |
| 336 | Ga0268265_10022662 | 3300028380 | Bacteria | 4416 |
| 337 | Ga0268264_10000128 | 3300028381 | Bacteria | 183164 |
| 338 | Ga0268264_10000218 | 3300028381 | Bacteria | 113449 |
| 339 | Ga0268264_10009366 | 3300028381 | Bacteria | 8106 |
| 340 | Ga0268264_10105137 | 3300028381 | Bacteria | 2462 |
| 341 | Ga0265337_1000035 | 3300028556 | Bacteria | 58448 |
| 342 | Ga0265337_1000467 | 3300028556 | Bacteria | 21420 |
| 343 | Ga0265337_1001667 | 3300028556 | Bacteria | 10777 |
| 344 | Ga0265337_1003994 | 3300028556 | Bacteria | 6240 |
| 345 | Ga0265326_10002757 | 3300028558 | Bacteria | 5891 |
| 346 | Ga0265326_10004597 | 3300028558 | Bacteria | 4408 |
| 347 | Ga0265319_1000001 | 3300028563 | Bacteria | 549513 |
| 348 | Ga0265319_1000080 | 3300028563 | Bacteria | 75462 |
| 349 | Ga0265319_1000767 | 3300028563 | Bacteria | 20851 |
| 350 | Ga0265319_1000857 | 3300028563 | Bacteria | 19336 |
| 351 | Ga0265319_1001183 | 3300028563 | Bacteria | 16145 |
| 352 | Ga0265319_1004676 | 3300028563 | Bacteria | 6715 |
| 353 | Ga0265319_1010337 | 3300028563 | Bacteria | 3899 |
| 354 | Ga0265319_1012344 | 3300028563 | Bacteria | 3458 |
| 355 | Ga0265319_1018558 | 3300028563 | Bacteria | 2616 |
| 356 | Ga0265319_1018863 | 3300028563 | Bacteria | 2588 |
| 357 | Ga0265334_10000081 | 3300028573 | Bacteria | 68529 |
| 358 | Ga0265334_10000445 | 3300028573 | Bacteria | 21581 |
| 359 | Ga0265334_10025849 | 3300028573 | Bacteria | 2375 |
| 360 | Ga0265334_10026217 | 3300028573 | Bacteria | 2354 |
| 361 | Ga0265318_10000124 | 3300028577 | Bacteria | 71647 |
| 362 | Ga0265318_10000213 | 3300028577 | Bacteria | 50502 |
| 363 | Ga0265318_10000325 | 3300028577 | Bacteria | 38213 |
| 364 | Ga0265318_10000833 | 3300028577 | Bacteria | 20287 |
| 365 | Ga0265318_10001256 | 3300028577 | Bacteria | 15349 |
| 366 | Ga0265318_10002479 | 3300028577 | Bacteria | 9857 |
| 367 | Ga0265318_10003845 | 3300028577 | Bacteria | 7429 |
| 368 | Ga0265318_10006104 | 3300028577 | Bacteria | 5584 |
| 369 | Ga0265318_10009527 | 3300028577 | Bacteria | 4265 |
| 370 | Ga0265323_10000012 | 3300028653 | Bacteria | 108344 |
| 371 | Ga0265323_10000043 | 3300028653 | Bacteria | 69334 |
| 372 | Ga0265322_10009724 | 3300028654 | Bacteria | 2792 |
| 373 | Ga0265336_10000631 | 3300028666 | Bacteria | 19394 |
| 374 | Ga0265338_10000008 | 3300028800 | Bacteria | 481542 |
| 375 | Ga0265338_10000041 | 3300028800 | Bacteria | 230676 |
| 376 | Ga0265338_10000402 | 3300028800 | Bacteria | 77555 |
| 377 | Ga0265338_10000702 | 3300028800 | Bacteria | 57422 |
| 378 | Ga0265338_10000710 | 3300028800 | Bacteria | 56899 |
| 379 | Ga0265338_10001171 | 3300028800 | Bacteria | 43298 |
| 380 | Ga0265338_10001731 | 3300028800 | Bacteria | 34533 |
| 381 | Ga0265338_10001819 | 3300028800 | Bacteria | 33490 |
| 382 | Ga0265338_10003775 | 3300028800 | Bacteria | 21045 |
| 383 | Ga0265338_10005041 | 3300028800 | Bacteria | 17437 |
| 384 | Ga0265338_10006441 | 3300028800 | Bacteria | 14965 |
| 385 | Ga0265338_10006519 | 3300028800 | Bacteria | 14840 |
| 386 | Ga0265338_10007563 | 3300028800 | Bacteria | 13434 |
| 387 | Ga0265338_10009864 | 3300028800 | Bacteria | 11306 |
| 388 | Ga0265338_10011656 | 3300028800 | Bacteria | 10125 |
| 389 | Ga0265338_10011925 | 3300028800 | Bacteria | 9972 |
| 390 | Ga0265338_10016162 | 3300028800 | Bacteria | 8141 |
| 391 | Ga0265338_10017860 | 3300028800 | Bacteria | 7622 |
| 392 | Ga0265338_10017930 | 3300028800 | Bacteria | 7604 |
| 393 | Ga0265338_10025691 | 3300028800 | Bacteria | 5968 |
| 394 | Ga0265338_10068580 | 3300028800 | Bacteria | 3055 |
| 395 | Ga0265338_10074620 | 3300028800 | Bacteria | 2883 |
| 396 | Ga0265338_10100467 | 3300028800 | Bacteria | 2359 |
| 397 | Ga0265338_10138038 | 3300028800 | Bacteria | 1913 |
| 398 | Ga0265324_10000028 | 3300029957 | Bacteria | 143704 |
| 399 | Ga0265324_10000422 | 3300029957 | Bacteria | 30430 |
| 400 | Ga0265324_10000851 | 3300029957 | Bacteria | 19621 |
| 401 | Ga0265324_10004032 | 3300029957 | Bacteria | 6757 |
| 402 | Ga0265324_10008564 | 3300029957 | Bacteria | 4059 |
| 403 | Ga0265324_10008779 | 3300029957 | Bacteria | 3988 |
| 404 | Ga0265324_10009579 | 3300029957 | Bacteria | 3774 |
| 405 | Ga0265324_10012106 | 3300029957 | Bacteria | 3264 |
| 406 | Ga0265324_10012252 | 3300029957 | Bacteria | 3242 |
| 407 | Ga0265330_10000469 | 3300031235 | Bacteria | 27057 |
| 408 | Ga0265330_10001253 | 3300031235 | Bacteria | 14878 |
| 409 | Ga0265330_10002312 | 3300031235 | Bacteria | 10469 |
| 410 | Ga0265330_10003836 | 3300031235 | Bacteria | 7740 |
| 411 | Ga0265330_10023778 | 3300031235 | Bacteria | 2781 |
| 412 | Ga0265332_10000178 | 3300031238 | Bacteria | 52516 |
| 413 | Ga0265332_10011078 | 3300031238 | Bacteria | 4006 |
| 414 | Ga0265332_10012937 | 3300031238 | Bacteria | 3700 |
| 415 | Ga0265328_10005781 | 3300031239 | Bacteria | 5280 |
| 416 | Ga0265320_10000030 | 3300031240 | Bacteria | 155388 |
| 417 | Ga0265320_10000050 | 3300031240 | Bacteria | 116002 |
| 418 | Ga0265320_10000290 | 3300031240 | Bacteria | 40860 |
| 419 | Ga0265320_10000303 | 3300031240 | Bacteria | 40288 |
| 420 | Ga0265320_10000318 | 3300031240 | Bacteria | 39227 |
| 421 | Ga0265320_10000376 | 3300031240 | Bacteria | 36363 |
| 422 | Ga0265320_10002752 | 3300031240 | Bacteria | 12138 |
| 423 | Ga0265320_10003614 | 3300031240 | Bacteria | 10334 |
| 424 | Ga0265320_10004093 | 3300031240 | Bacteria | 9578 |
| 425 | Ga0265320_10010013 | 3300031240 | Bacteria | 5668 |
| 426 | Ga0265320_10011564 | 3300031240 | Bacteria | 5186 |
| 427 | Ga0265320_10025393 | 3300031240 | Bacteria | 3115 |
| 428 | Ga0265320_10034430 | 3300031240 | Bacteria | 2576 |
| 429 | Ga0265325_10000591 | 3300031241 | Bacteria | 26441 |
| 430 | Ga0265325_10004713 | 3300031241 | Bacteria | 8545 |
| 431 | Ga0265325_10015432 | 3300031241 | Bacteria | 4295 |
| 432 | Ga0265329_10000153 | 3300031242 | Bacteria | 33838 |
| 433 | Ga0265329_10000822 | 3300031242 | Bacteria | 15803 |
| 434 | Ga0265329_10005571 | 3300031242 | Bacteria | 5074 |
| 435 | Ga0265329_10009352 | 3300031242 | Bacteria | 3663 |
| 436 | Ga0265340_10000160 | 3300031247 | Bacteria | 33915 |
| 437 | Ga0265340_10004505 | 3300031247 | Bacteria | 7775 |
| 438 | Ga0265340_10018361 | 3300031247 | Bacteria | 3608 |
| 439 | Ga0265339_10003160 | 3300031249 | Bacteria | 11595 |
| 440 | Ga0265339_10003494 | 3300031249 | Bacteria | 10987 |
| 441 | Ga0265331_10000088 | 3300031250 | Bacteria | 125176 |
| 442 | Ga0265331_10000403 | 3300031250 | Bacteria | 44394 |
| 443 | Ga0265331_10001723 | 3300031250 | Bacteria | 15748 |
| 444 | Ga0265331_10005786 | 3300031250 | Bacteria | 7406 |
| 445 | Ga0265331_10016731 | 3300031250 | Bacteria | 3843 |
| 446 | Ga0265331_10030438 | 3300031250 | Bacteria | 2687 |
| 447 | Ga0265327_10000127 | 3300031251 | Bacteria | 166247 |
| 448 | Ga0265327_10000313 | 3300031251 | Bacteria | 93102 |
| 449 | Ga0265327_10000457 | 3300031251 | Bacteria | 73150 |
| 450 | Ga0265327_10000887 | 3300031251 | Bacteria | 44153 |
| 451 | Ga0265327_10000917 | 3300031251 | Bacteria | 43226 |
| 452 | Ga0265327_10003651 | 3300031251 | Bacteria | 14462 |
| 453 | Ga0265327_10003676 | 3300031251 | Bacteria | 14368 |
| 454 | Ga0265327_10004123 | 3300031251 | Bacteria | 13126 |
| 455 | Ga0265327_10008488 | 3300031251 | Bacteria | 7639 |
| 456 | Ga0265327_10012367 | 3300031251 | Bacteria | 5766 |
| 457 | Ga0265327_10026286 | 3300031251 | Bacteria | 3374 |
| 458 | Ga0265327_10029584 | 3300031251 | Bacteria | 3114 |
| 459 | Ga0265316_10000479 | 3300031344 | Bacteria | 45442 |
| 460 | Ga0265316_10000803 | 3300031344 | Bacteria | 34665 |
| 461 | Ga0265316_10002480 | 3300031344 | Bacteria | 19122 |
| 462 | Ga0265316_10003402 | 3300031344 | Bacteria | 16104 |
| 463 | Ga0265316_10006896 | 3300031344 | Bacteria | 10779 |
| 464 | Ga0265316_10009016 | 3300031344 | Bacteria | 9200 |
| 465 | Ga0265316_10013130 | 3300031344 | Bacteria | 7378 |
| 466 | Ga0265316_10018842 | 3300031344 | Bacteria | 5925 |
| 467 | Ga0265316_10045951 | 3300031344 | Bacteria | 3463 |
| 468 | Ga0265316_10129627 | 3300031344 | Bacteria | 1900 |
| 469 | Ga0307513_10087156 | 3300031456 | Bacteria | 3197 |
| 470 | Ga0307408_100000021 | 3300031548 | Bacteria | 312158 |
| 471 | Ga0307408_100001362 | 3300031548 | Bacteria | 18234 |
| 472 | Ga0307408_100008690 | 3300031548 | Bacteria | 6708 |
| 473 | Ga0265313_10000040 | 3300031595 | Bacteria | 120713 |
| 474 | Ga0265313_10000230 | 3300031595 | Bacteria | 60452 |
| 475 | Ga0265313_10000252 | 3300031595 | Bacteria | 58494 |
| 476 | Ga0265313_10000687 | 3300031595 | Bacteria | 34809 |
| 477 | Ga0265313_10005682 | 3300031595 | Bacteria | 9100 |
| 478 | Ga0265313_10007259 | 3300031595 | Bacteria | 7611 |
| 479 | Ga0265313_10019596 | 3300031595 | Bacteria | 3759 |
| 480 | Ga0265313_10024217 | 3300031595 | Bacteria | 3247 |
| 481 | Ga0307508_10000011 | 3300031616 | Bacteria | 248001 |
| 482 | Ga0307508_10000309 | 3300031616 | Bacteria | 59143 |
| 483 | Ga0265314_10000600 | 3300031711 | Bacteria | 44965 |
| 484 | Ga0265314_10000632 | 3300031711 | Bacteria | 43168 |
| 485 | Ga0265314_10001043 | 3300031711 | Bacteria | 32303 |
| 486 | Ga0265314_10002440 | 3300031711 | Bacteria | 19047 |
| 487 | Ga0265314_10002765 | 3300031711 | Bacteria | 17523 |
| 488 | Ga0265314_10005606 | 3300031711 | Bacteria | 11278 |
| 489 | Ga0265314_10006660 | 3300031711 | Bacteria | 10155 |
| 490 | Ga0265314_10006940 | 3300031711 | Bacteria | 9916 |
| 491 | Ga0265314_10014825 | 3300031711 | Bacteria | 6215 |
| 492 | Ga0265342_10000037 | 3300031712 | Bacteria | 140873 |
| 493 | Ga0265342_10003002 | 3300031712 | Bacteria | 14161 |
| 494 | Ga0265342_10005292 | 3300031712 | Bacteria | 9890 |
| 495 | Ga0307405_10026166 | 3300031731 | Bacteria | 3362 |
| 496 | Ga0307413_10014451 | 3300031824 | Bacteria | 4010 |
| 497 | Ga0307413_10022978 | 3300031824 | Bacteria | 3372 |
| 498 | Ga0307406_10000672 | 3300031901 | Bacteria | 19299 |
| 499 | Ga0307406_10004208 | 3300031901 | Bacteria | 7832 |
| 500 | Ga0307406_10042785 | 3300031901 | Bacteria | 2830 |
| 501 | Ga0307407_10000155 | 3300031903 | Bacteria | 21204 |
| 502 | Ga0307412_10000037 | 3300031911 | Bacteria | 192170 |
| 503 | Ga0307412_10000844 | 3300031911 | Bacteria | 17637 |
| 504 | Ga0307412_10009240 | 3300031911 | Bacteria | 5651 |
| 505 | Ga0307412_10035181 | 3300031911 | Bacteria | 3198 |
| 506 | Ga0307409_100008320 | 3300031995 | Bacteria | 6288 |
| 507 | Ga0307416_100002045 | 3300032002 | Bacteria | 11357 |
| 508 | Ga0307414_10000083 | 3300032004 | Bacteria | 87233 |
| 509 | Ga0307414_10002397 | 3300032004 | Bacteria | 9809 |
| 510 | Ga0307414_10029036 | 3300032004 | Bacteria | 3595 |
| 511 | Ga0307414_10109670 | 3300032004 | Bacteria | 2097 |
| 512 | Ga0307411_10001866 | 3300032005 | Bacteria | 8969 |
| 513 | Ga0307411_10053054 | 3300032005 | Bacteria | 2654 |
| 514 | Ga0307411_10073389 | 3300032005 | Bacteria | 2327 |
| 515 | Ga0307415_100009576 | 3300032126 | Bacteria | 5440 |
| 516 | Ga0373928_0001877 | 3300035084 | Bacteria | 4111 |
| 517 | Ga0373929_0000185 | 3300035085 | Bacteria | 11094 |
| 518 | Ga0373944_0000181 | 3300035089 | Bacteria | 13075 |
| 519 | Ga0373951_0009355 | 3300035091 | Bacteria | 2208 |
| 520 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 521 | Ga0373945_0016905 | 3300035116 | Bacteria | 2467 |
| 522 | Ga0373962_0000332 | 3300035242 | Bacteria | 10341 |
| 523 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 524 | Ga0373927_0001758 | 3300035695 | Bacteria | 16176 |
| 525 | Ga0373927_0003479 | 3300035695 | Bacteria | 11273 |
| 526 | Ga0373933_0016693 | 3300035724 | Bacteria | 4111 |
| 527 | Ga0373937_0003062 | 3300036401 | Bacteria | 13981 |
| 528 | Ga0373937_0031350 | 3300036401 | Bacteria | 4817 |
| 529 | Ga0373937_0117179 | 3300036401 | Bacteria | 2481 |
| 530 | Ga0373925_0000215 | 3300037068 | Bacteria | 62800 |
| 531 | Ga0373925_0025051 | 3300037068 | Bacteria | 4358 |
| 532 | Ga0373925_0066810 | 3300037068 | Bacteria | 2711 |
| 533 | Ga0395899_0009551 | 3300037312 | Bacteria | 7447 |
| 534 | Ga0395899_0036822 | 3300037312 | Bacteria | 3669 |
| 535 | Ga0395898_0001668 | 3300037466 | Bacteria | 29795 |
| 536 | Ga0395898_0010711 | 3300037466 | Bacteria | 9580 |
| 537 | Ga0395905_0000257 | 3300037471 | Bacteria | 79555 |
| 538 | Ga0436364_1214207 | 3300037853 | Bacteria | 4491 |
| 539 | Ga0395901_0002048 | 3300038443 | Bacteria | 20663 |
| 540 | Ga0395901_0011719 | 3300038443 | Bacteria | 8885 |
| 541 | Ga0436365_0010485 | 3300039437 | Bacteria | 4210 |
| 542 | Ga0436360_0509447 | 3300039438 | Bacteria | 4614 |
| 543 | Ga0436360_1132709 | 3300039438 | Bacteria | 6058 |
| 544 | Ga0436361_0946705 | 3300039447 | Bacteria | 2705 |
| 545 | Ga0436363_0014397 | 3300039450 | Bacteria | 20368 |
| 546 | Ga0436363_1479676 | 3300039450 | Bacteria | 9888 |
| 547 | Ga0439453_0001153 | 3300041408 | Bacteria | 3310 |
| 548 | Ga0450890_000001 | 3300042127 | Bacteria | 192635 |
| 549 | Ga0450892_000093 | 3300042130 | Bacteria | 9885 |
| 550 | Ga0439460_0000772 | 3300042461 | Bacteria | 7215 |
| 551 | Ga0450893_0000243 | 3300042532 | Bacteria | 7341 |
| 552 | Ga0450893_0000244 | 3300042532 | Bacteria | 7328 |
| 553 | Ga0451577_0000347 | 3300042876 | Bacteria | 86343 |
| 554 | Ga0451577_0001507 | 3300042876 | Bacteria | 30779 |
| 555 | Ga0451577_0003252 | 3300042876 | Bacteria | 18265 |
| 556 | Ga0451577_0011240 | 3300042876 | Bacteria | 8485 |
| 557 | Ga0451577_0022655 | 3300042876 | Bacteria | 5735 |
| 558 | Ga0451577_0026203 | 3300042876 | Bacteria | 5280 |
| 559 | Ga0466969_0001480 | 3300044656 | Bacteria | 12627 |
| 560 | Ga0453683_0033209 | 3300044673 | Bacteria | 3255 |
| 561 | Ga0466966_0000437 | 3300044684 | Bacteria | 26827 |
| 562 | Ga0466961_0016375 | 3300044693 | Bacteria | 4762 |
| 563 | Ga0466961_0036291 | 3300044693 | Bacteria | 3164 |
| 564 | Ga0466961_0042472 | 3300044693 | Bacteria | 2914 |
| 565 | Ga0466963_0015003 | 3300044694 | Bacteria | 4789 |
| 566 | Ga0453684_0000147 | 3300044712 | Bacteria | 308490 |
| 567 | Ga0453684_0000306 | 3300044712 | Bacteria | 207333 |
| 568 | Ga0453684_0000367 | 3300044712 | Bacteria | 185852 |
| 569 | Ga0453684_0000666 | 3300044712 | Bacteria | 122914 |
| 570 | Ga0453684_0001441 | 3300044712 | Bacteria | 67854 |
| 571 | Ga0453684_0010836 | 3300044712 | Bacteria | 15451 |
| 572 | Ga0453684_0013884 | 3300044712 | Bacteria | 12994 |
| 573 | Ga0453684_0016995 | 3300044712 | Bacteria | 11304 |
| 574 | Ga0453684_0017033 | 3300044712 | Bacteria | 11287 |
| 575 | Ga0453684_0023716 | 3300044712 | Bacteria | 9013 |
| 576 | Ga0453684_0082530 | 3300044712 | Bacteria | 4004 |
| 577 | Ga0453684_0100115 | 3300044712 | Bacteria | 3548 |
| 578 | Ga0466971_0000095 | 3300044719 | Bacteria | 32391 |
| 579 | Ga0466970_0007557 | 3300044765 | Bacteria | 5450 |
| 580 | Ga0466957_0000308 | 3300044842 | Bacteria | 23942 |
| 581 | Ga0466959_0000240 | 3300045049 | Bacteria | 34052 |
| 582 | Ga0451576_0000255 | 3300045051 | Bacteria | 131310 |
| 583 | Ga0451576_0000342 | 3300045051 | Bacteria | 112294 |
| 584 | Ga0451576_0024921 | 3300045051 | Bacteria | 6455 |
| 585 | Ga0451576_0026250 | 3300045051 | Bacteria | 6266 |
| 586 | Ga0451576_0126632 | 3300045051 | Bacteria | 2661 |
| 587 | Ga0466958_0000923 | 3300045836 | Bacteria | 13221 |
| 588 | Ga0495627_013361 | 3300046453 | Bacteria | 2889 |
| 589 | Ga0495592_0000115 | 3300046454 | Bacteria | 70181 |
| 590 | Ga0495592_0011665 | 3300046454 | Bacteria | 6655 |
| 591 | Ga0495629_0026909 | 3300046459 | Bacteria | 4085 |
| 592 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 593 | Ga0495651_0018964 | 3300046462 | Bacteria | 5330 |
| 594 | Ga0495650_0000756 | 3300046471 | Bacteria | 40391 |
| 595 | Ga0495582_0004637 | 3300046473 | Bacteria | 7723 |
| 596 | Ga0495664_0009171 | 3300046477 | Bacteria | 5530 |
| 597 | Ga0495596_0001188 | 3300046500 | Bacteria | 15231 |
| 598 | Ga0495606_0009719 | 3300046507 | Bacteria | 8093 |
| 599 | Ga0495610_0003390 | 3300046512 | Bacteria | 12450 |
| 600 | Ga0495618_0000975 | 3300046514 | Bacteria | 19607 |
| 601 | Ga0495618_0001376 | 3300046514 | Bacteria | 16351 |
| 602 | Ga0495630_0000063 | 3300046517 | Bacteria | 85919 |
| 603 | Ga0495630_0006172 | 3300046517 | Bacteria | 8497 |
| 604 | Ga0495630_0065897 | 3300046517 | Bacteria | 2722 |
| 605 | Ga0495632_0000356 | 3300046519 | Bacteria | 43508 |
| 606 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 607 | Ga0495652_0010069 | 3300046529 | Bacteria | 8571 |
| 608 | Ga0495652_0012166 | 3300046529 | Bacteria | 7772 |
| 609 | Ga0495652_0136377 | 3300046529 | Bacteria | 1936 |
| 610 | Ga0495640_0029986 | 3300046533 | Bacteria | 3899 |
| 611 | Ga0495586_0000009 | 3300046535 | Bacteria | 144639 |
| 612 | Ga0495586_0000653 | 3300046535 | Bacteria | 19874 |
| 613 | Ga0495586_0000849 | 3300046535 | Bacteria | 17549 |
| 614 | Ga0495586_0057828 | 3300046535 | Bacteria | 2105 |
| 615 | Ga0495587_0009829 | 3300046536 | Bacteria | 6111 |
| 616 | Ga0495645_0010239 | 3300046543 | Bacteria | 6570 |
| 617 | Ga0495668_0000229 | 3300046616 | Bacteria | 80748 |
| 618 | Ga0495634_0002082 | 3300046642 | Bacteria | 16904 |
| 619 | Ga0495634_0021066 | 3300046642 | Bacteria | 4616 |
| 620 | Ga0495634_0028603 | 3300046642 | Bacteria | 3868 |
| 621 | Ga0495625_0008293 | 3300046660 | Bacteria | 8879 |
| 622 | Ga0495625_0011513 | 3300046660 | Bacteria | 7206 |
| 623 | Ga0495599_0006697 | 3300046678 | Bacteria | 6956 |
| 624 | Ga0495599_0012981 | 3300046678 | Bacteria | 5142 |
| 625 | Ga0495599_0030939 | 3300046678 | Bacteria | 3360 |
| 626 | Ga0495658_0016099 | 3300046683 | Bacteria | 3847 |
| 627 | Ga0495613_0002258 | 3300046689 | Bacteria | 14566 |
| 628 | Ga0495613_0029767 | 3300046689 | Bacteria | 4059 |
| 629 | Ga0495613_0086269 | 3300046689 | Bacteria | 2276 |
| 630 | Ga0495624_0032470 | 3300046690 | Bacteria | 3385 |
| 631 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 632 | Ga0495674_0000451 | 3300047319 | Bacteria | 37104 |
| 633 | Ga0495674_0018560 | 3300047319 | Bacteria | 6474 |
| 634 | Ga0495674_0060353 | 3300047319 | Bacteria | 3309 |
| 635 | Ga0495680_0043464 | 3300047322 | Bacteria | 3557 |
| 636 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 637 | Ga0495681_0000017 | 3300047470 | Bacteria | 178067 |
| 638 | Ga0495684_0007052 | 3300047471 | Bacteria | 8727 |
| 639 | Ga0495602_0019855 | 3300048088 | Bacteria | 6656 |
| 640 | Ga0495602_0035158 | 3300048088 | Bacteria | 4676 |
| 641 | Ga0495626_0001137 | 3300048091 | Bacteria | 22237 |
| 642 | Ga0496100_0012063 | 3300048903 | Bacteria | 4942 |
| 643 | Ga0496101_0012929 | 3300048904 | Bacteria | 5583 |
| 644 | Ga0496101_0052333 | 3300048904 | Bacteria | 2944 |
| 645 | Ga0496102_0004371 | 3300048905 | Bacteria | 11936 |
| 646 | Ga0496102_0055986 | 3300048905 | Bacteria | 3597 |
| 647 | Ga0496102_0166895 | 3300048905 | Bacteria | 2072 |
| 648 | Ga0496106_0000319 | 3300048909 | Bacteria | 33834 |
| 649 | Ga0496108_0049746 | 3300048911 | Bacteria | 3506 |
| 650 | Ga0496109_0014517 | 3300048912 | Bacteria | 6852 |
| 651 | Ga0496114_0002161 | 3300048917 | Bacteria | 14963 |
| 652 | Ga0496115_0001415 | 3300048918 | Bacteria | 17182 |
| 653 | Ga0496115_0018523 | 3300048918 | Bacteria | 5348 |
| 654 | Ga0496115_0054063 | 3300048918 | Bacteria | 3224 |
| 655 | Ga0496115_0114880 | 3300048918 | Bacteria | 2213 |
| 656 | Ga0496116_0001205 | 3300048919 | Bacteria | 30260 |
| 657 | Ga0496118_0001488 | 3300048921 | Bacteria | 35067 |
| 658 | Ga0496118_0041732 | 3300048921 | Bacteria | 3628 |
| 659 | Ga0496119_0000815 | 3300048922 | Bacteria | 41661 |
| 660 | Ga0496120_0000854 | 3300048923 | Bacteria | 43100 |
| 661 | Ga0496121_0002328 | 3300048924 | Bacteria | 29355 |
| 662 | Ga0496124_0000876 | 3300048927 | Bacteria | 48996 |
| 663 | Ga0496125_0083640 | 3300048928 | Bacteria | 2427 |
| 664 | Ga0501031_0029252 | 3300049568 | Bacteria | 3594 |
| 665 | Ga0501032_0001015 | 3300049569 | Bacteria | 22677 |
| 666 | Ga0501032_0041745 | 3300049569 | Bacteria | 3114 |
| 667 | Ga0501033_0061252 | 3300049570 | Bacteria | 2774 |
| 668 | Ga0501034_0002397 | 3300049571 | Bacteria | 22709 |
| 669 | Ga0501034_0011410 | 3300049571 | Bacteria | 9211 |
| 670 | Ga0501036_0003006 | 3300049572 | Bacteria | 13418 |
| 671 | Ga0501036_0062076 | 3300049572 | Bacteria | 3165 |
| 672 | Ga0501036_0093816 | 3300049572 | Bacteria | 2536 |
| 673 | Ga0501037_0003669 | 3300049573 | Bacteria | 11144 |
| 674 | Ga0501038_0023098 | 3300049574 | Bacteria | 5565 |
| 675 | Ga0501038_0025144 | 3300049574 | Bacteria | 5309 |
| 676 | Ga0501039_0031340 | 3300049575 | Bacteria | 4099 |
| 677 | Ga0501039_0214812 | 3300049575 | Bacteria | 1512 |
| 678 | Ga0501040_0004707 | 3300049576 | Bacteria | 8856 |
| 679 | Ga0501040_0007720 | 3300049576 | Bacteria | 6960 |
| 680 | Ga0501040_0010268 | 3300049576 | Bacteria | 6124 |
| 681 | Ga0501040_0052569 | 3300049576 | Bacteria | 2789 |
| 682 | Ga0501041_0035536 | 3300049577 | Bacteria | 3019 |
| 683 | Ga0501041_0064987 | 3300049577 | Bacteria | 2234 |
| 684 | Ga0501046_0004199 | 3300049580 | Bacteria | 13115 |
| 685 | Ga0501046_0005038 | 3300049580 | Bacteria | 11855 |
| 686 | Ga0501046_0118875 | 3300049580 | Bacteria | 2012 |
| 687 | Ga0501047_0002411 | 3300049581 | Bacteria | 17866 |
| 688 | Ga0501047_0014871 | 3300049581 | Bacteria | 7408 |
| 689 | Ga0501047_0021047 | 3300049581 | Bacteria | 6263 |
| 690 | Ga0501047_0100119 | 3300049581 | Bacteria | 2777 |
| 691 | Ga0501048_0032468 | 3300049582 | Bacteria | 3772 |
| 692 | Ga0501048_0057163 | 3300049582 | Bacteria | 2767 |
| 693 | Ga0501070_0048016 | 3300049586 | Bacteria | 3547 |
| 694 | Ga0501071_0041341 | 3300049587 | Bacteria | 3301 |
| 695 | Ga0501072_0009262 | 3300049588 | Bacteria | 7482 |
| 696 | Ga0501072_0061824 | 3300049588 | Bacteria | 2954 |
| 697 | Ga0501072_0084256 | 3300049588 | Bacteria | 2520 |
| 698 | Ga0501075_0006760 | 3300049591 | Bacteria | 7914 |
| 699 | Ga0501075_0033713 | 3300049591 | Bacteria | 3809 |
| 700 | Ga0501075_0134795 | 3300049591 | Bacteria | 1881 |
| 701 | Ga0501076_0036259 | 3300049592 | Bacteria | 3863 |
| 702 | Ga0501076_0101740 | 3300049592 | Bacteria | 2316 |
| 703 | Ga0501076_0117227 | 3300049592 | Bacteria | 2155 |
| 704 | Ga0501076_0139599 | 3300049592 | Bacteria | 1968 |
| 705 | Ga0501079_0087136 | 3300049741 | Bacteria | 2417 |
| 706 | Ga0501079_0134068 | 3300049741 | Bacteria | 1928 |
| 707 | Ga0501080_0002022 | 3300049742 | Bacteria | 17530 |
| 708 | Ga0501080_0007541 | 3300049742 | Bacteria | 9831 |
| 709 | Ga0501080_0008215 | 3300049742 | Bacteria | 9452 |
| 710 | Ga0501081_0008930 | 3300049743 | Bacteria | 6513 |
| 711 | Ga0501083_0006326 | 3300049744 | Bacteria | 8394 |
| 712 | Ga0501035_0015647 | 3300049822 | Bacteria | 7002 |
| 713 | Ga0501035_0019229 | 3300049822 | Bacteria | 6288 |
| 714 | Ga0501035_0035638 | 3300049822 | Bacteria | 4514 |
| 715 | Ga0501035_0049775 | 3300049822 | Bacteria | 3755 |
| 716 | Ga0501044_0013063 | 3300049823 | Bacteria | 8986 |
| 717 | Ga0501044_0029386 | 3300049823 | Bacteria | 5796 |
| 718 | Ga0501044_0046662 | 3300049823 | Bacteria | 4484 |
| 719 | Ga0501045_0016386 | 3300049824 | Bacteria | 5262 |
| 720 | Ga0501045_0019065 | 3300049824 | Bacteria | 4885 |
| 721 | Ga0501045_0020510 | 3300049824 | Bacteria | 4722 |
| 722 | Ga0501045_0088826 | 3300049824 | Bacteria | 2283 |
| 723 | nmdc:mga03683_2015_c1 | 3300050489 | Bacteria | 6218 |
| 724 | nmdc:mga03n38_1059_c1 | 3300050490 | Bacteria | 7584 |
| 725 | nmdc:mga00v17_15437_c2 | 3300050491 | Bacteria | 3691 |
| 726 | nmdc:mga0k408_8435_c1 | 3300050493 | Bacteria | 5532 |
| 727 | nmdc:mga06z11_66_c1 | 3300050494 | Bacteria | 43000 |
| 728 | nmdc:mga04h51_79_c1 | 3300050495 | Bacteria | 31613 |
| 729 | nmdc:mga07m45_3130_c1 | 3300050496 | Bacteria | 7083 |
| 730 | nmdc:mga05p37_5199_c1 | 3300050507 | Bacteria | 15272 |
| 731 | nmdc:mga05p37_70631_c1 | 3300050507 | Bacteria | 4295 |
| 732 | nmdc:mga08y16_14553_c1 | 3300050511 | Bacteria | 8273 |
| 733 | nmdc:mga08y16_6925_c1 | 3300050511 | Bacteria | 11886 |
| 734 | nmdc:mga0n895_139263_c1 | 3300050512 | Bacteria | 2454 |
| 735 | nmdc:mga0n895_80675_c1 | 3300050512 | Bacteria | 3242 |
| 736 | nmdc:mga0a205_174574_c1 | 3300050515 | Bacteria | 2044 |
| 737 | nmdc:mga0a205_8114_c1 | 3300050515 | Bacteria | 9542 |
| 738 | nmdc:mga0a205_9311_c1 | 3300050515 | Bacteria | 8970 |
| 739 | nmdc:mga0sz30_8076_c1 | 3300050516 | Bacteria | 3965 |
| 740 | Ga0500635_0000942 | 3300053080 | Bacteria | 7026 |
| 741 | Ga0500643_000135 | 3300053087 | Bacteria | 74911 |
| 742 | Ga0500643_001053 | 3300053087 | Bacteria | 16728 |
| 743 | Ga0500643_001915 | 3300053087 | Bacteria | 11310 |
| 744 | Ga0500643_004062 | 3300053087 | Bacteria | 6751 |
| 745 | Ga0500643_004577 | 3300053087 | Bacteria | 6193 |
| 746 | Ga0500555_000003 | 3300053103 | Bacteria | 392994 |
| 747 | Ga0500555_000200 | 3300053103 | Bacteria | 27842 |
| 748 | Ga0500556_0000044 | 3300053104 | Bacteria | 132744 |
| 749 | Ga0500556_0000090 | 3300053104 | Bacteria | 84279 |
| 750 | Ga0500592_001159 | 3300053116 | Bacteria | 4288 |
| 751 | Ga0500607_000011 | 3300053121 | Bacteria | 110773 |
| 752 | Ga0500608_000185 | 3300053122 | Bacteria | 24956 |
| 753 | Ga0500642_0000014 | 3300053130 | Bacteria | 182110 |
| 754 | Ga0500642_0007335 | 3300053130 | Bacteria | 3700 |
| 755 | Ga0500658_0001071 | 3300053134 | Bacteria | 11206 |
| 756 | Ga0500559_0009476 | 3300053136 | Bacteria | 4213 |
| 757 | Ga0500616_0005968 | 3300053153 | Bacteria | 8124 |
| 758 | Ga0500624_000122 | 3300053157 | Bacteria | 35389 |
| 759 | Ga0500636_0024115 | 3300053177 | Bacteria | 3596 |
| 760 | Ga0500645_002407 | 3300053730 | Bacteria | 8387 |
| 761 | Ga0500596_004823 | 3300053735 | Bacteria | 2438 |
| 762 | Ga0501084_0001331 | 3300054114 | Bacteria | 19487 |
| 763 | Ga0501084_0002721 | 3300054114 | Bacteria | 14253 |
| 764 | Ga0501082_0017073 | 3300060353 | Bacteria | 6253 |
| 765 | Ga0466962_0001879 | 3300061719 | Bacteria | 9888 |
| 766 | Ga0530510_0008853 | 3300061734 | Bacteria | 7045 |
| 767 | Ga0530510_0016249 | 3300061734 | Bacteria | 5263 |
| 768 | Ga0530510_0023032 | 3300061734 | Bacteria | 4439 |
| 769 | Ga0530510_0027056 | 3300061734 | Bacteria | 4108 |
| 770 | Ga0530510_0040735 | 3300061734 | Bacteria | 3353 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0214812 | Ga0501039_0214812_90_1496 | 410 |
| 2 | 3300005331 | Ga0070670_100023871 | Ga0070670_1000238713 | 433 |
| 3 | 3300005440 | Ga0070705_100001737 | Ga0070705_1000017376 | 433 |
| 4 | 3300005617 | Ga0068859_100000370 | Ga0068859_10000037029 | 433 |
| 5 | 3300005842 | Ga0068858_100002318 | Ga0068858_10000231819 | 433 |
| 6 | 3300006931 | Ga0097620_100000370 | Ga0097620_10000037029 | 433 |
| 7 | 3300014968 | Ga0157379_10011558 | Ga0157379_100115584 | 433 |
| 8 | 3300025925 | Ga0207650_10030620 | Ga0207650_100306203 | 433 |
| 9 | 3300025961 | Ga0207712_10003209 | Ga0207712_100032096 | 433 |
| 10 | 3300025972 | Ga0207668_10000327 | Ga0207668_1000032724 | 433 |
| 11 | 3300026035 | Ga0207703_10008968 | Ga0207703_100089683 | 433 |
| 12 | 3300028381 | Ga0268264_10000218 | Ga0268264_1000021875 | 433 |
| 13 | 3300049577 | Ga0501041_0035536 | Ga0501041_0035536_17_1432 | 450 |
| 14 | 3300046529 | Ga0495652_0136377 | Ga0495652_0136377_194_1900 | 483 |
| 15 | 3300046689 | Ga0495613_0029767 | Ga0495613_0029767_2399_3982 | 483 |
| 16 | 3300006852 | Ga0075433_10006296 | Ga0075433_100062966 | 484 |
| 17 | 3300009094 | Ga0111539_10016208 | Ga0111539_100162086 | 484 |
| 18 | 3300009147 | Ga0114129_10021725 | Ga0114129_100217256 | 484 |
| 19 | 3300027907 | Ga0207428_10004571 | Ga0207428_100045715 | 484 |
| 20 | 3300050507 | nmdc:mga05p37_5199_c1 | nmdc:mga05p37_5199_c1_8112_9785 | 484 |
| 21 | 3300050511 | nmdc:mga08y16_14553_c1 | nmdc:mga08y16_14553_c1_3622_5295 | 484 |
| 22 | 3300050515 | nmdc:mga0a205_9311_c1 | nmdc:mga0a205_9311_c1_4688_6361 | 484 |
| 23 | 3300049581 | Ga0501047_0021047 | Ga0501047_0021047_2435_4150 | 485 |
| 24 | 3300006048 | Ga0075363_100008802 | Ga0075363_1000088026 | 489 |
| 25 | 3300049572 | Ga0501036_0093816 | Ga0501036_0093816_144_1817 | 491 |
| 26 | 3300049576 | Ga0501040_0007720 | Ga0501040_0007720_654_2327 | 495 |
| 27 | 3300049588 | Ga0501072_0061824 | Ga0501072_0061824_212_1885 | 495 |
| 28 | 3300049592 | Ga0501076_0101740 | Ga0501076_0101740_318_1991 | 495 |
| 29 | 3300009094 | Ga0111539_10119710 | Ga0111539_101197102 | 496 |
| 30 | 3300031456 | Ga0307513_10087156 | Ga0307513_100871562 | 499 |
| 31 | 3300039447 | Ga0436361_0946705 | Ga0436361_0946705_690_2501 | 503 |
| 32 | 3300005466 | Ga0070685_10003083 | Ga0070685_100030834 | 505 |
| 33 | 3300006880 | Ga0075429_100054412 | Ga0075429_1000544123 | 509 |
| 34 | 3300049581 | Ga0501047_0002411 | Ga0501047_0002411_8115_9842 | 510 |
| 35 | 3300049742 | Ga0501080_0002022 | Ga0501080_0002022_10329_12056 | 510 |
| 36 | 3300005518 | Ga0070699_100023100 | Ga0070699_1000231004 | 513 |
| 37 | 3300025922 | Ga0207646_10130152 | Ga0207646_101301522 | 513 |
| 38 | 3300028563 | Ga0265319_1004676 | Ga0265319_10046762 | 513 |
| 39 | 3300042461 | Ga0439460_0000772 | Ga0439460_0000772_2951_4702 | 514 |
| 40 | 3300049568 | Ga0501031_0029252 | Ga0501031_0029252_693_2396 | 514 |
| 41 | 3300049569 | Ga0501032_0001015 | Ga0501032_0001015_19882_21585 | 514 |
| 42 | 3300049572 | Ga0501036_0062076 | Ga0501036_0062076_158_1861 | 514 |
| 43 | 3300049575 | Ga0501039_0031340 | Ga0501039_0031340_2380_4083 | 514 |
| 44 | 3300049822 | Ga0501035_0035638 | Ga0501035_0035638_2502_4205 | 514 |
| 45 | 3300049823 | Ga0501044_0046662 | Ga0501044_0046662_1868_3571 | 514 |
| 46 | 3300046543 | Ga0495645_0010239 | Ga0495645_0010239_2551_4233 | 515 |
| 47 | 3300005518 | Ga0070699_100000089 | Ga0070699_10000008916 | 516 |
| 48 | 3300031240 | Ga0265320_10025393 | Ga0265320_100253933 | 516 |
| 49 | 3300031250 | Ga0265331_10030438 | Ga0265331_100304382 | 516 |
| 50 | 3300031711 | Ga0265314_10006660 | Ga0265314_1000666011 | 516 |
| 51 | 3300050515 | nmdc:mga0a205_8114_c1 | nmdc:mga0a205_8114_c1_1693_3411 | 516 |
| 52 | 3300005367 | Ga0070667_100027783 | Ga0070667_1000277832 | 517 |
| 53 | 3300014326 | Ga0157380_10101358 | Ga0157380_101013582 | 517 |
| 54 | 3300028379 | Ga0268266_10039321 | Ga0268266_100393212 | 517 |
| 55 | 3300049588 | Ga0501072_0084256 | Ga0501072_0084256_28_1680 | 517 |
| 56 | iso_pu_bacteria | 2784132109 | 2784473290 | 518 |
| 57 | 3300046533 | Ga0495640_0029986 | Ga0495640_0029986_462_2378 | 520 |
| 58 | 3300005445 | Ga0070708_100013918 | Ga0070708_1000139184 | 521 |
| 59 | 3300005468 | Ga0070707_100043592 | Ga0070707_1000435924 | 521 |
| 60 | 3300005471 | Ga0070698_100007185 | Ga0070698_1000071854 | 521 |
| 61 | 3300028573 | Ga0265334_10026217 | Ga0265334_100262173 | 521 |
| 62 | 3300031242 | Ga0265329_10009352 | Ga0265329_100093526 | 521 |
| 63 | 3300031251 | Ga0265327_10000887 | Ga0265327_1000088722 | 521 |
| 64 | 3300042876 | Ga0451577_0001507 | Ga0451577_0001507_12619_14364 | 521 |
| 65 | 3300049569 | Ga0501032_0041745 | Ga0501032_0041745_846_2633 | 521 |
| 66 | 3300037853 | Ga0436364_1214207 | Ga0436364_1214207_2219_4030 | 523 |
| 67 | 3300039450 | Ga0436363_0014397 | Ga0436363_0014397_14148_15959 | 523 |
| 68 | 3300005331 | Ga0070670_100084662 | Ga0070670_1000846623 | 524 |
| 69 | 3300005347 | Ga0070668_100042888 | Ga0070668_1000428881 | 524 |
| 70 | 3300005364 | Ga0070673_100041977 | Ga0070673_1000419772 | 524 |
| 71 | 3300005456 | Ga0070678_100111501 | Ga0070678_1001115012 | 524 |
| 72 | 3300005841 | Ga0068863_100028402 | Ga0068863_1000284022 | 524 |
| 73 | 3300005843 | Ga0068860_100032015 | Ga0068860_1000320156 | 524 |
| 74 | 3300006847 | Ga0075431_100173221 | Ga0075431_1001732214 | 524 |
| 75 | 3300014969 | Ga0157376_10096419 | Ga0157376_100964192 | 524 |
| 76 | 3300025901 | Ga0207688_10025054 | Ga0207688_100250542 | 524 |
| 77 | 3300025907 | Ga0207645_10025139 | Ga0207645_100251393 | 524 |
| 78 | 3300025972 | Ga0207668_10046546 | Ga0207668_100465462 | 524 |
| 79 | 3300028381 | Ga0268264_10009366 | Ga0268264_100093666 | 524 |
| 80 | 3300042876 | Ga0451577_0026203 | Ga0451577_0026203_1857_3656 | 524 |
| 81 | 3300046460 | Ga0495638_0000051 | Ga0495638_0000051_155334_157037 | 524 |
| 82 | 3300046524 | Ga0495648_0000032 | Ga0495648_0000032_48947_50650 | 524 |
| 83 | 3300046678 | Ga0495599_0030939 | Ga0495599_0030939_1613_3346 | 525 |
| 84 | 3300048905 | Ga0496102_0166895 | Ga0496102_0166895_14_1726 | 525 |
| 85 | 3300053157 | Ga0500624_000122 | Ga0500624_000122_1505_3208 | 525 |
| 86 | 3300053177 | Ga0500636_0024115 | Ga0500636_0024115_1535_3238 | 525 |
| 87 | 3300049592 | Ga0501076_0117227 | Ga0501076_0117227_18_1712 | 526 |
| 88 | 3300061719 | Ga0466962_0001879 | Ga0466962_0001879_13_1656 | 526 |
| 89 | 3300005617 | Ga0068859_100099460 | Ga0068859_1000994605 | 527 |
| 90 | 3300006931 | Ga0097620_100099458 | Ga0097620_1000994585 | 527 |
| 91 | 3300028800 | Ga0265338_10138038 | Ga0265338_101380381 | 527 |
| 92 | 3300037466 | Ga0395898_0001668 | Ga0395898_0001668_4009_5700 | 527 |
| 93 | 3300039450 | Ga0436363_1479676 | Ga0436363_1479676_2284_4101 | 527 |
| 94 | 3300049571 | Ga0501034_0011410 | Ga0501034_0011410_623_2311 | 527 |
| 95 | 3300053122 | Ga0500608_000185 | Ga0500608_000185_20695_22428 | 527 |
| 96 | 3300005364 | Ga0070673_100020155 | Ga0070673_1000201553 | 528 |
| 97 | 3300005406 | Ga0070703_10000387 | Ga0070703_1000038713 | 528 |
| 98 | 3300005445 | Ga0070708_100208127 | Ga0070708_1002081271 | 528 |
| 99 | 3300006914 | Ga0075436_100044026 | Ga0075436_1000440262 | 528 |
| 100 | 3300025885 | Ga0207653_10000176 | Ga0207653_100001766 | 528 |
| 101 | 3300025910 | Ga0207684_10030423 | Ga0207684_100304233 | 528 |
| 102 | 3300025960 | Ga0207651_10024723 | Ga0207651_100247232 | 528 |
| 103 | 3300031251 | Ga0265327_10026286 | Ga0265327_100262862 | 528 |
| 104 | 3300031344 | Ga0265316_10009016 | Ga0265316_100090162 | 529 |
| 105 | 3300037466 | Ga0395898_0010711 | Ga0395898_0010711_829_2520 | 529 |
| 106 | 3300038443 | Ga0395901_0011719 | Ga0395901_0011719_4686_6377 | 529 |
| 107 | 3300049576 | Ga0501040_0010268 | Ga0501040_0010268_3647_5386 | 529 |
| 108 | 3300049591 | Ga0501075_0134795 | Ga0501075_0134795_128_1867 | 529 |
| 109 | 3300049824 | Ga0501045_0020510 | Ga0501045_0020510_2236_3975 | 529 |
| 110 | 3300005467 | Ga0070706_100002067 | Ga0070706_1000020677 | 530 |
| 111 | 3300025910 | Ga0207684_10001151 | Ga0207684_1000115115 | 530 |
| 112 | 3300031240 | Ga0265320_10000030 | Ga0265320_10000030114 | 530 |
| 113 | 3300031711 | Ga0265314_10002440 | Ga0265314_100024409 | 530 |
| 114 | 3300053087 | Ga0500643_001915 | Ga0500643_001915_4070_5779 | 530 |
| 115 | 3300013306 | Ga0163162_10121945 | Ga0163162_101219452 | 531 |
| 116 | 3300028556 | Ga0265337_1000035 | Ga0265337_10000357 | 531 |
| 117 | 3300028800 | Ga0265338_10003775 | Ga0265338_1000377513 | 531 |
| 118 | 3300028800 | Ga0265338_10006441 | Ga0265338_1000644111 | 531 |
| 119 | 3300028800 | Ga0265338_10025691 | Ga0265338_100256912 | 531 |
| 120 | 3300029957 | Ga0265324_10000028 | Ga0265324_10000028109 | 531 |
| 121 | 3300031344 | Ga0265316_10006896 | Ga0265316_100068962 | 531 |
| 122 | 3300031344 | Ga0265316_10018842 | Ga0265316_100188423 | 531 |
| 123 | 3300031548 | Ga0307408_100008690 | Ga0307408_1000086904 | 531 |
| 124 | 3300031824 | Ga0307413_10014451 | Ga0307413_100144512 | 531 |
| 125 | 3300032004 | Ga0307414_10109670 | Ga0307414_101096703 | 531 |
| 126 | 3300032005 | Ga0307411_10073389 | Ga0307411_100733892 | 531 |
| 127 | 3300032126 | Ga0307415_100009576 | Ga0307415_1000095764 | 531 |
| 128 | 3300049743 | Ga0501081_0008930 | Ga0501081_0008930_3392_5107 | 531 |
| 129 | 3300054114 | Ga0501084_0001331 | Ga0501084_0001331_9347_11062 | 531 |
| 130 | 3300005937 | Ga0081455_10022661 | Ga0081455_100226614 | 532 |
| 131 | 3300006177 | Ga0075362_10008771 | Ga0075362_100087712 | 532 |
| 132 | 3300021441 | Ga0213871_10003745 | Ga0213871_100037452 | 532 |
| 133 | 3300028563 | Ga0265319_1000001 | Ga0265319_100000162 | 532 |
| 134 | 3300028563 | Ga0265319_1000857 | Ga0265319_100085711 | 532 |
| 135 | 3300028577 | Ga0265318_10009527 | Ga0265318_100095272 | 532 |
| 136 | 3300028800 | Ga0265338_10000702 | Ga0265338_1000070236 | 532 |
| 137 | 3300028800 | Ga0265338_10100467 | Ga0265338_101004672 | 532 |
| 138 | 3300031235 | Ga0265330_10001253 | Ga0265330_1000125315 | 532 |
| 139 | 3300031238 | Ga0265332_10011078 | Ga0265332_100110782 | 532 |
| 140 | 3300031240 | Ga0265320_10000318 | Ga0265320_1000031832 | 532 |
| 141 | 3300031240 | Ga0265320_10003614 | Ga0265320_100036143 | 532 |
| 142 | 3300031247 | Ga0265340_10018361 | Ga0265340_100183614 | 532 |
| 143 | 3300031251 | Ga0265327_10000127 | Ga0265327_1000012782 | 532 |
| 144 | 3300031595 | Ga0265313_10000252 | Ga0265313_1000025244 | 532 |
| 145 | 3300031711 | Ga0265314_10000632 | Ga0265314_100006325 | 532 |
| 146 | 3300031712 | Ga0265342_10003002 | Ga0265342_1000300213 | 532 |
| 147 | 3300035724 | Ga0373933_0016693 | Ga0373933_0016693_1737_3536 | 532 |
| 148 | 3300036401 | Ga0373937_0003062 | Ga0373937_0003062_9054_10853 | 532 |
| 149 | 3300039438 | Ga0436360_0509447 | Ga0436360_0509447_2489_4300 | 532 |
| 150 | 3300039438 | Ga0436360_1132709 | Ga0436360_1132709_2035_3846 | 532 |
| 151 | 3300044712 | Ga0453684_0023716 | Ga0453684_0023716_3747_5549 | 532 |
| 152 | 3300046459 | Ga0495629_0026909 | Ga0495629_0026909_1232_3031 | 532 |
| 153 | 3300046514 | Ga0495618_0000975 | Ga0495618_0000975_8507_10306 | 532 |
| 154 | 3300046535 | Ga0495586_0000849 | Ga0495586_0000849_1988_3787 | 532 |
| 155 | 3300046642 | Ga0495634_0002082 | Ga0495634_0002082_2469_4268 | 532 |
| 156 | 3300046689 | Ga0495613_0002258 | Ga0495613_0002258_4531_6330 | 532 |
| 157 | 3300047322 | Ga0495680_0043464 | Ga0495680_0043464_1706_3505 | 532 |
| 158 | 3300049741 | Ga0501079_0134068 | Ga0501079_0134068_64_1776 | 532 |
| 159 | 3300050489 | nmdc:mga03683_2015_c1 | nmdc:mga03683_2015_c1_4057_5868 | 532 |
| 160 | 3300050490 | nmdc:mga03n38_1059_c1 | nmdc:mga03n38_1059_c1_2892_4703 | 532 |
| 161 | 3300050512 | nmdc:mga0n895_80675_c1 | nmdc:mga0n895_80675_c1_429_2144 | 532 |
| 162 | 3300053103 | Ga0500555_000200 | Ga0500555_000200_7479_9290 | 532 |
| 163 | 3300053104 | Ga0500556_0000090 | Ga0500556_0000090_35461_37272 | 532 |
| 164 | 3300053130 | Ga0500642_0007335 | Ga0500642_0007335_1698_3509 | 532 |
| 165 | 3300061734 | Ga0530510_0023032 | Ga0530510_0023032_2090_3802 | 532 |
| 166 | 3300005335 | Ga0070666_10000057 | Ga0070666_1000005740 | 533 |
| 167 | 3300005353 | Ga0070669_100000004 | Ga0070669_10000000465 | 533 |
| 168 | 3300005355 | Ga0070671_100000029 | Ga0070671_10000002961 | 533 |
| 169 | 3300005367 | Ga0070667_100005017 | Ga0070667_1000050174 | 533 |
| 170 | 3300005719 | Ga0068861_100003376 | Ga0068861_1000033767 | 533 |
| 171 | 3300005844 | Ga0068862_100000538 | Ga0068862_10000053824 | 533 |
| 172 | 3300006353 | Ga0075370_10004047 | Ga0075370_100040472 | 533 |
| 173 | 3300009093 | Ga0105240_10000163 | Ga0105240_1000016390 | 533 |
| 174 | 3300009545 | Ga0105237_10003590 | Ga0105237_100035902 | 533 |
| 175 | 3300025315 | Ga0207697_10000301 | Ga0207697_1000030125 | 533 |
| 176 | 3300025900 | Ga0207710_10047055 | Ga0207710_100470551 | 533 |
| 177 | 3300025903 | Ga0207680_10000316 | Ga0207680_1000031615 | 533 |
| 178 | 3300025913 | Ga0207695_10000472 | Ga0207695_1000047222 | 533 |
| 179 | 3300025914 | Ga0207671_10012807 | Ga0207671_100128072 | 533 |
| 180 | 3300025923 | Ga0207681_10000010 | Ga0207681_10000010339 | 533 |
| 181 | 3300025931 | Ga0207644_10000007 | Ga0207644_10000007326 | 533 |
| 182 | 3300025986 | Ga0207658_10001925 | Ga0207658_100019255 | 533 |
| 183 | 3300026118 | Ga0207675_100003014 | Ga0207675_1000030149 | 533 |
| 184 | 3300028380 | Ga0268265_10000255 | Ga0268265_1000025534 | 533 |
| 185 | 3300042876 | Ga0451577_0003252 | Ga0451577_0003252_14296_16014 | 533 |
| 186 | 3300044712 | Ga0453684_0000367 | Ga0453684_0000367_44315_46033 | 533 |
| 187 | 3300045051 | Ga0451576_0000342 | Ga0451576_0000342_44315_46033 | 533 |
| 188 | 3300049570 | Ga0501033_0061252 | Ga0501033_0061252_47_1822 | 533 |
| 189 | 3300049571 | Ga0501034_0002397 | Ga0501034_0002397_18938_20671 | 533 |
| 190 | 3300049581 | Ga0501047_0014871 | Ga0501047_0014871_5036_6763 | 533 |
| 191 | 3300049586 | Ga0501070_0048016 | Ga0501070_0048016_354_2057 | 533 |
| 192 | 3300050491 | nmdc:mga00v17_15437_c2 | nmdc:mga00v17_15437_c2_687_2390 | 533 |
| 193 | 3300050496 | nmdc:mga07m45_3130_c1 | nmdc:mga07m45_3130_c1_3400_5211 | 533 |
| 194 | 3300050516 | nmdc:mga0sz30_8076_c1 | nmdc:mga0sz30_8076_c1_1649_3352 | 533 |
| 195 | 3300005347 | Ga0070668_100024340 | Ga0070668_1000243403 | 534 |
| 196 | 3300005539 | Ga0068853_100021318 | Ga0068853_1000213184 | 534 |
| 197 | 3300028558 | Ga0265326_10004597 | Ga0265326_100045973 | 534 |
| 198 | 3300028563 | Ga0265319_1000080 | Ga0265319_100008058 | 534 |
| 199 | 3300028563 | Ga0265319_1018863 | Ga0265319_10188631 | 534 |
| 200 | 3300028573 | Ga0265334_10025849 | Ga0265334_100258492 | 534 |
| 201 | 3300028577 | Ga0265318_10000833 | Ga0265318_100008336 | 534 |
| 202 | 3300028800 | Ga0265338_10007563 | Ga0265338_1000756312 | 534 |
| 203 | 3300029957 | Ga0265324_10008779 | Ga0265324_100087792 | 534 |
| 204 | 3300031240 | Ga0265320_10010013 | Ga0265320_100100133 | 534 |
| 205 | 3300031249 | Ga0265339_10003494 | Ga0265339_100034944 | 534 |
| 206 | 3300031251 | Ga0265327_10003651 | Ga0265327_1000365111 | 534 |
| 207 | 3300031595 | Ga0265313_10007259 | Ga0265313_100072595 | 534 |
| 208 | 3300031595 | Ga0265313_10024217 | Ga0265313_100242172 | 534 |
| 209 | 3300031711 | Ga0265314_10005606 | Ga0265314_100056065 | 534 |
| 210 | 3300031712 | Ga0265342_10005292 | Ga0265342_100052927 | 534 |
| 211 | 3300049573 | Ga0501037_0003669 | Ga0501037_0003669_1107_2921 | 534 |
| 212 | 3300049581 | Ga0501047_0100119 | Ga0501047_0100119_1009_2712 | 534 |
| 213 | 3300049823 | Ga0501044_0029386 | Ga0501044_0029386_371_2185 | 534 |
| 214 | 3300001977 | JGI24746J21847_1001047 | JGI24746J21847_10010473 | 535 |
| 215 | 3300005295 | Ga0065707_10099641 | Ga0065707_100996411 | 535 |
| 216 | 3300005328 | Ga0070676_10033259 | Ga0070676_100332592 | 535 |
| 217 | 3300005459 | Ga0068867_100000124 | Ga0068867_10000012420 | 535 |
| 218 | 3300005983 | Ga0081540_1000010 | Ga0081540_1000010100 | 535 |
| 219 | 3300006175 | Ga0070712_100061474 | Ga0070712_1000614742 | 535 |
| 220 | 3300006237 | Ga0097621_100077117 | Ga0097621_1000771173 | 535 |
| 221 | 3300006358 | Ga0068871_100005532 | Ga0068871_1000055326 | 535 |
| 222 | 3300009148 | Ga0105243_10000049 | Ga0105243_1000004984 | 535 |
| 223 | 3300014745 | Ga0157377_10000732 | Ga0157377_100007325 | 535 |
| 224 | 3300025907 | Ga0207645_10068074 | Ga0207645_100680743 | 535 |
| 225 | 3300025935 | Ga0207709_10000097 | Ga0207709_1000009770 | 535 |
| 226 | 3300026089 | Ga0207648_10000083 | Ga0207648_1000008321 | 535 |
| 227 | 3300028800 | Ga0265338_10074620 | Ga0265338_100746202 | 535 |
| 228 | 3300035091 | Ga0373951_0009355 | Ga0373951_0009355_277_2094 | 535 |
| 229 | 3300036401 | Ga0373937_0117179 | Ga0373937_0117179_453_2252 | 535 |
| 230 | 3300048904 | Ga0496101_0052333 | Ga0496101_0052333_852_2657 | 535 |
| 231 | 3300048918 | Ga0496115_0018523 | Ga0496115_0018523_2188_3993 | 535 |
| 232 | 3300049580 | Ga0501046_0118875 | Ga0501046_0118875_225_1949 | 535 |
| 233 | 3300049822 | Ga0501035_0049775 | Ga0501035_0049775_428_2152 | 535 |
| 234 | 3300053136 | Ga0500559_0009476 | Ga0500559_0009476_2196_3983 | 535 |
| 235 | 3300005564 | Ga0070664_100011678 | Ga0070664_1000116783 | 536 |
| 236 | 3300009036 | Ga0105244_10002893 | Ga0105244_100028937 | 536 |
| 237 | 3300013307 | Ga0157372_10027415 | Ga0157372_100274154 | 536 |
| 238 | 3300025728 | Ga0207655_1000130 | Ga0207655_100013038 | 536 |
| 239 | 3300031241 | Ga0265325_10015432 | Ga0265325_100154323 | 536 |
| 240 | 3300031901 | Ga0307406_10000672 | Ga0307406_100006727 | 536 |
| 241 | 3300031911 | Ga0307412_10000037 | Ga0307412_1000003748 | 536 |
| 242 | 3300005295 | Ga0065707_10104456 | Ga0065707_101044562 | 537 |
| 243 | 3300005337 | Ga0070682_100009293 | Ga0070682_1000092932 | 537 |
| 244 | 3300005844 | Ga0068862_100001724 | Ga0068862_1000017242 | 537 |
| 245 | 3300006175 | Ga0070712_100015642 | Ga0070712_1000156422 | 537 |
| 246 | 3300009553 | Ga0105249_10000161 | Ga0105249_100001615 | 537 |
| 247 | 3300025961 | Ga0207712_10000059 | Ga0207712_1000005972 | 537 |
| 248 | 3300028380 | Ga0268265_10000281 | Ga0268265_1000028121 | 537 |
| 249 | 3300028577 | Ga0265318_10006104 | Ga0265318_100061045 | 537 |
| 250 | 3300031251 | Ga0265327_10012367 | Ga0265327_100123674 | 537 |
| 251 | 3300031344 | Ga0265316_10045951 | Ga0265316_100459512 | 537 |
| 252 | 3300046689 | Ga0495613_0086269 | Ga0495613_0086269_307_2223 | 537 |
| 253 | 3300049742 | Ga0501080_0007541 | Ga0501080_0007541_3654_5387 | 537 |
| 254 | 3300005340 | Ga0070689_100003098 | Ga0070689_1000030986 | 538 |
| 255 | 3300005456 | Ga0070678_100030709 | Ga0070678_1000307093 | 538 |
| 256 | 3300005577 | Ga0068857_100000176 | Ga0068857_10000017635 | 538 |
| 257 | 3300013308 | Ga0157375_10090254 | Ga0157375_100902543 | 538 |
| 258 | 3300025936 | Ga0207670_10001459 | Ga0207670_100014594 | 538 |
| 259 | 3300026116 | Ga0207674_10001786 | Ga0207674_100017868 | 538 |
| 260 | 3300026121 | Ga0207683_10008702 | Ga0207683_100087024 | 538 |
| 261 | 3300028556 | Ga0265337_1001667 | Ga0265337_10016673 | 538 |
| 262 | 3300028563 | Ga0265319_1010337 | Ga0265319_10103372 | 538 |
| 263 | 3300028563 | Ga0265319_1012344 | Ga0265319_10123442 | 538 |
| 264 | 3300028563 | Ga0265319_1018558 | Ga0265319_10185583 | 538 |
| 265 | 3300028577 | Ga0265318_10002479 | Ga0265318_100024794 | 538 |
| 266 | 3300028800 | Ga0265338_10001819 | Ga0265338_100018192 | 538 |
| 267 | 3300028800 | Ga0265338_10017860 | Ga0265338_100178607 | 538 |
| 268 | 3300029957 | Ga0265324_10012252 | Ga0265324_100122524 | 538 |
| 269 | 3300031240 | Ga0265320_10000290 | Ga0265320_1000029011 | 538 |
| 270 | 3300031240 | Ga0265320_10002752 | Ga0265320_100027529 | 538 |
| 271 | 3300031240 | Ga0265320_10034430 | Ga0265320_100344303 | 538 |
| 272 | 3300031241 | Ga0265325_10004713 | Ga0265325_100047132 | 538 |
| 273 | 3300031250 | Ga0265331_10016731 | Ga0265331_100167312 | 538 |
| 274 | 3300031251 | Ga0265327_10000917 | Ga0265327_100009179 | 538 |
| 275 | 3300031595 | Ga0265313_10000230 | Ga0265313_1000023015 | 538 |
| 276 | 3300047319 | Ga0495674_0060353 | Ga0495674_0060353_707_2422 | 538 |
| 277 | 3300053087 | Ga0500643_004062 | Ga0500643_004062_720_2423 | 538 |
| 278 | 3300053153 | Ga0500616_0005968 | Ga0500616_0005968_5873_7684 | 538 |
| 279 | 3300003320 | rootH2_10055959 | rootH2_100559592 | 539 |
| 280 | 3300005334 | Ga0068869_100000086 | Ga0068869_10000008620 | 539 |
| 281 | 3300005338 | Ga0068868_100047428 | Ga0068868_1000474282 | 539 |
| 282 | 3300005347 | Ga0070668_100017464 | Ga0070668_1000174642 | 539 |
| 283 | 3300005356 | Ga0070674_100044383 | Ga0070674_1000443832 | 539 |
| 284 | 3300005445 | Ga0070708_100011564 | Ga0070708_1000115643 | 539 |
| 285 | 3300005459 | Ga0068867_100000596 | Ga0068867_10000059616 | 539 |
| 286 | 3300005467 | Ga0070706_100035218 | Ga0070706_1000352183 | 539 |
| 287 | 3300005536 | Ga0070697_100004449 | Ga0070697_1000044492 | 539 |
| 288 | 3300006358 | Ga0068871_100004028 | Ga0068871_1000040288 | 539 |
| 289 | 3300006881 | Ga0068865_100001574 | Ga0068865_10000157411 | 539 |
| 290 | 3300013296 | Ga0157374_10010673 | Ga0157374_100106735 | 539 |
| 291 | 3300013297 | Ga0157378_10046360 | Ga0157378_100463603 | 539 |
| 292 | 3300025315 | Ga0207697_10000135 | Ga0207697_1000013519 | 539 |
| 293 | 3300025901 | Ga0207688_10053845 | Ga0207688_100538452 | 539 |
| 294 | 3300025910 | Ga0207684_10017741 | Ga0207684_100177413 | 539 |
| 295 | 3300025922 | Ga0207646_10005357 | Ga0207646_100053578 | 539 |
| 296 | 3300025923 | Ga0207681_10020639 | Ga0207681_100206392 | 539 |
| 297 | 3300025938 | Ga0207704_10047124 | Ga0207704_100471242 | 539 |
| 298 | 3300025942 | Ga0207689_10000023 | Ga0207689_1000002386 | 539 |
| 299 | 3300026089 | Ga0207648_10001277 | Ga0207648_100012775 | 539 |
| 300 | 3300026089 | Ga0207648_10028640 | Ga0207648_100286402 | 539 |
| 301 | 3300044712 | Ga0453684_0013884 | Ga0453684_0013884_10739_12460 | 539 |
| 302 | 3300045051 | Ga0451576_0000255 | Ga0451576_0000255_123408_125222 | 539 |
| 303 | 3300005355 | Ga0070671_100026407 | Ga0070671_1000264072 | 540 |
| 304 | 3300005467 | Ga0070706_100000011 | Ga0070706_100000011164 | 540 |
| 305 | 3300005471 | Ga0070698_100063262 | Ga0070698_1000632622 | 540 |
| 306 | 3300025910 | Ga0207684_10000052 | Ga0207684_10000052178 | 540 |
| 307 | 3300028577 | Ga0265318_10000124 | Ga0265318_1000012421 | 540 |
| 308 | 3300031240 | Ga0265320_10004093 | Ga0265320_100040933 | 540 |
| 309 | 3300031250 | Ga0265331_10005786 | Ga0265331_100057866 | 540 |
| 310 | 3300031595 | Ga0265313_10005682 | Ga0265313_100056826 | 540 |
| 311 | 3300031711 | Ga0265314_10002765 | Ga0265314_1000276510 | 540 |
| 312 | 3300044712 | Ga0453684_0016995 | Ga0453684_0016995_7261_8952 | 540 |
| 313 | 3300048911 | Ga0496108_0049746 | Ga0496108_0049746_33_1832 | 540 |
| 314 | 3300049744 | Ga0501083_0006326 | Ga0501083_0006326_771_2585 | 540 |
| 315 | 3300005518 | Ga0070699_100098764 | Ga0070699_1000987642 | 541 |
| 316 | 3300006028 | Ga0070717_10003667 | Ga0070717_100036677 | 541 |
| 317 | 3300028800 | Ga0265338_10005041 | Ga0265338_1000504111 | 541 |
| 318 | 3300005578 | Ga0068854_100004135 | Ga0068854_1000041354 | 542 |
| 319 | 3300009551 | Ga0105238_10020205 | Ga0105238_100202052 | 542 |
| 320 | 3300014969 | Ga0157376_10094614 | Ga0157376_100946142 | 542 |
| 321 | 3300025924 | Ga0207694_10061439 | Ga0207694_100614392 | 542 |
| 322 | 3300025981 | Ga0207640_10000314 | Ga0207640_100003144 | 542 |
| 323 | 3300026041 | Ga0207639_10033193 | Ga0207639_100331934 | 542 |
| 324 | 3300028653 | Ga0265323_10000012 | Ga0265323_1000001247 | 542 |
| 325 | 3300031251 | Ga0265327_10008488 | Ga0265327_100084886 | 542 |
| 326 | 3300031344 | Ga0265316_10000803 | Ga0265316_1000080320 | 542 |
| 327 | 3300031995 | Ga0307409_100008320 | Ga0307409_1000083204 | 542 |
| 328 | 3300044712 | Ga0453684_0100115 | Ga0453684_0100115_51_1784 | 542 |
| 329 | 3300031247 | Ga0265340_10004505 | Ga0265340_100045053 | 543 |
| 330 | 3300044712 | Ga0453684_0010836 | Ga0453684_0010836_434_2149 | 543 |
| 331 | 3300049574 | Ga0501038_0025144 | Ga0501038_0025144_3239_4969 | 543 |
| 332 | 3300049576 | Ga0501040_0004707 | Ga0501040_0004707_3092_4822 | 543 |
| 333 | 3300049577 | Ga0501041_0064987 | Ga0501041_0064987_416_2146 | 543 |
| 334 | 3300049580 | Ga0501046_0005038 | Ga0501046_0005038_9685_11415 | 543 |
| 335 | 3300049582 | Ga0501048_0032468 | Ga0501048_0032468_287_2017 | 543 |
| 336 | 3300049587 | Ga0501071_0041341 | Ga0501071_0041341_13_1743 | 543 |
| 337 | 3300049591 | Ga0501075_0033713 | Ga0501075_0033713_1954_3684 | 543 |
| 338 | 3300049822 | Ga0501035_0015647 | Ga0501035_0015647_13_1743 | 543 |
| 339 | 3300049824 | Ga0501045_0016386 | Ga0501045_0016386_865_2595 | 543 |
| 340 | 3300053087 | Ga0500643_001053 | Ga0500643_001053_12264_13982 | 543 |
| 341 | 3300053103 | Ga0500555_000003 | Ga0500555_000003_285015_286814 | 543 |
| 342 | 3300061734 | Ga0530510_0027056 | Ga0530510_0027056_426_2156 | 543 |
| 343 | 3300005563 | Ga0068855_100005065 | Ga0068855_10000506511 | 544 |
| 344 | 3300006195 | Ga0075366_10005154 | Ga0075366_100051542 | 544 |
| 345 | 3300006880 | Ga0075429_100166539 | Ga0075429_1001665392 | 544 |
| 346 | 3300009094 | Ga0111539_10011192 | Ga0111539_100111926 | 544 |
| 347 | 3300025916 | Ga0207663_10002821 | Ga0207663_100028213 | 544 |
| 348 | 3300027907 | Ga0207428_10000139 | Ga0207428_1000013973 | 544 |
| 349 | 3300028573 | Ga0265334_10000081 | Ga0265334_1000008126 | 544 |
| 350 | 3300028573 | Ga0265334_10000445 | Ga0265334_100004459 | 544 |
| 351 | 3300029957 | Ga0265324_10009579 | Ga0265324_100095792 | 544 |
| 352 | 3300037471 | Ga0395905_0000257 | Ga0395905_0000257_24764_26494 | 544 |
| 353 | 3300042876 | Ga0451577_0022655 | Ga0451577_0022655_1526_3292 | 544 |
| 354 | 3300044693 | Ga0466961_0016375 | Ga0466961_0016375_1443_3158 | 544 |
| 355 | 3300045051 | Ga0451576_0024921 | Ga0451576_0024921_335_2101 | 544 |
| 356 | 3300046519 | Ga0495632_0000356 | Ga0495632_0000356_35575_37278 | 544 |
| 357 | 3300046692 | Ga0495671_0000020 | Ga0495671_0000020_154704_156407 | 544 |
| 358 | 3300047469 | Ga0495673_0000076 | Ga0495673_0000076_49066_50769 | 544 |
| 359 | 3300050493 | nmdc:mga0k408_8435_c1 | nmdc:mga0k408_8435_c1_1466_3181 | 544 |
| 360 | 3300050511 | nmdc:mga08y16_6925_c1 | nmdc:mga08y16_6925_c1_1135_2850 | 544 |
| 361 | 3300053735 | Ga0500596_004823 | Ga0500596_004823_498_2198 | 544 |
| 362 | 3300005328 | Ga0070676_10058369 | Ga0070676_100583692 | 545 |
| 363 | 3300005355 | Ga0070671_100077042 | Ga0070671_1000770422 | 545 |
| 364 | 3300005544 | Ga0070686_100010603 | Ga0070686_1000106032 | 545 |
| 365 | 3300005549 | Ga0070704_100015233 | Ga0070704_1000152333 | 545 |
| 366 | 3300005985 | Ga0081539_10009526 | Ga0081539_100095265 | 545 |
| 367 | 3300009093 | Ga0105240_10128100 | Ga0105240_101281001 | 545 |
| 368 | 3300013307 | Ga0157372_10147063 | Ga0157372_101470632 | 545 |
| 369 | 3300025298 | Ga0209050_1005294 | Ga0209050_10052944 | 545 |
| 370 | 3300025924 | Ga0207694_10016478 | Ga0207694_100164783 | 545 |
| 371 | 3300028800 | Ga0265338_10000402 | Ga0265338_1000040250 | 545 |
| 372 | 3300028800 | Ga0265338_10017930 | Ga0265338_100179304 | 545 |
| 373 | 3300028800 | Ga0265338_10068580 | Ga0265338_100685804 | 545 |
| 374 | 3300048919 | Ga0496116_0001205 | Ga0496116_0001205_1638_3317 | 545 |
| 375 | 3300048922 | Ga0496119_0000815 | Ga0496119_0000815_10290_11969 | 545 |
| 376 | 3300048923 | Ga0496120_0000854 | Ga0496120_0000854_3710_5389 | 545 |
| 377 | 3300048927 | Ga0496124_0000876 | Ga0496124_0000876_29854_31533 | 545 |
| 378 | 3300002067 | JGI24735J21928_10001887 | JGI24735J21928_100018874 | 546 |
| 379 | 3300002077 | JGI24744J21845_10003434 | JGI24744J21845_100034342 | 546 |
| 380 | 3300003214 | JGI25165J46597_1000173 | JGI25165J46597_100017318 | 546 |
| 381 | 3300005327 | Ga0070658_10001414 | Ga0070658_100014142 | 546 |
| 382 | 3300005328 | Ga0070676_10049757 | Ga0070676_100497572 | 546 |
| 383 | 3300009093 | Ga0105240_10008262 | Ga0105240_100082629 | 546 |
| 384 | 3300013104 | Ga0157370_10000095 | Ga0157370_1000009530 | 546 |
| 385 | 3300013105 | Ga0157369_10007626 | Ga0157369_100076269 | 546 |
| 386 | 3300013306 | Ga0163162_10026948 | Ga0163162_100269483 | 546 |
| 387 | 3300014969 | Ga0157376_10052923 | Ga0157376_100529232 | 546 |
| 388 | 3300025231 | Ga0207427_101282 | Ga0207427_1012827 | 546 |
| 389 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031207 | 546 |
| 390 | 3300025304 | Ga0209257_1001548 | Ga0209257_10015489 | 546 |
| 391 | 3300025907 | Ga0207645_10056150 | Ga0207645_100561503 | 546 |
| 392 | 3300025909 | Ga0207705_10003229 | Ga0207705_100032292 | 546 |
| 393 | 3300025913 | Ga0207695_10025841 | Ga0207695_100258417 | 546 |
| 394 | 3300025913 | Ga0207695_10029573 | Ga0207695_100295732 | 546 |
| 395 | 3300025926 | Ga0207659_10028321 | Ga0207659_100283212 | 546 |
| 396 | 3300025960 | Ga0207651_10045644 | Ga0207651_100456442 | 546 |
| 397 | 3300028800 | Ga0265338_10016162 | Ga0265338_100161627 | 546 |
| 398 | 3300035084 | Ga0373928_0001877 | Ga0373928_0001877_534_2450 | 546 |
| 399 | 3300035085 | Ga0373929_0000185 | Ga0373929_0000185_1820_3736 | 546 |
| 400 | 3300035089 | Ga0373944_0000181 | Ga0373944_0000181_1638_3554 | 546 |
| 401 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1307489_1309405 | 546 |
| 402 | 3300035242 | Ga0373962_0000332 | Ga0373962_0000332_1572_3488 | 546 |
| 403 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_185993_187909 | 546 |
| 404 | 3300035695 | Ga0373927_0003479 | Ga0373927_0003479_8611_10527 | 546 |
| 405 | 3300037068 | Ga0373925_0000215 | Ga0373925_0000215_24679_26595 | 546 |
| 406 | 3300037312 | Ga0395899_0009551 | Ga0395899_0009551_4329_6032 | 546 |
| 407 | 3300045051 | Ga0451576_0026250 | Ga0451576_0026250_4090_5889 | 546 |
| 408 | 3300046660 | Ga0495625_0011513 | Ga0495625_0011513_3467_5170 | 546 |
| 409 | 3300046678 | Ga0495599_0012981 | Ga0495599_0012981_438_2237 | 546 |
| 410 | 3300048921 | Ga0496118_0041732 | Ga0496118_0041732_224_1927 | 546 |
| 411 | 3300048928 | Ga0496125_0083640 | Ga0496125_0083640_694_2397 | 546 |
| 412 | 3300049741 | Ga0501079_0087136 | Ga0501079_0087136_646_2355 | 546 |
| 413 | 3300049824 | Ga0501045_0088826 | Ga0501045_0088826_43_1752 | 546 |
| 414 | 3300061734 | Ga0530510_0008853 | Ga0530510_0008853_4905_6614 | 546 |
| 415 | 3300005293 | Ga0065715_10108316 | Ga0065715_101083162 | 547 |
| 416 | 3300005353 | Ga0070669_100012314 | Ga0070669_1000123142 | 547 |
| 417 | 3300005367 | Ga0070667_100014200 | Ga0070667_1000142003 | 547 |
| 418 | 3300005937 | Ga0081455_10020762 | Ga0081455_100207622 | 547 |
| 419 | 3300005981 | Ga0081538_10001293 | Ga0081538_1000129319 | 547 |
| 420 | 3300013105 | Ga0157369_10242734 | Ga0157369_102427341 | 547 |
| 421 | 3300013306 | Ga0163162_10059451 | Ga0163162_100594513 | 547 |
| 422 | 3300017792 | Ga0163161_10037083 | Ga0163161_100370832 | 547 |
| 423 | 3300025315 | Ga0207697_10001649 | Ga0207697_100016497 | 547 |
| 424 | 3300025901 | Ga0207688_10003054 | Ga0207688_100030544 | 547 |
| 425 | 3300025906 | Ga0207699_10069411 | Ga0207699_100694111 | 547 |
| 426 | 3300025907 | Ga0207645_10009360 | Ga0207645_100093603 | 547 |
| 427 | 3300025916 | Ga0207663_10042639 | Ga0207663_100426391 | 547 |
| 428 | 3300025923 | Ga0207681_10050098 | Ga0207681_100500982 | 547 |
| 429 | 3300025933 | Ga0207706_10006115 | Ga0207706_1000611510 | 547 |
| 430 | 3300025939 | Ga0207665_10048256 | Ga0207665_100482563 | 547 |
| 431 | 3300025972 | Ga0207668_10036247 | Ga0207668_100362473 | 547 |
| 432 | 3300028800 | Ga0265338_10001731 | Ga0265338_1000173122 | 547 |
| 433 | 3300029957 | Ga0265324_10008564 | Ga0265324_100085644 | 547 |
| 434 | 3300031238 | Ga0265332_10012937 | Ga0265332_100129372 | 547 |
| 435 | 3300031240 | Ga0265320_10000376 | Ga0265320_1000037612 | 547 |
| 436 | 3300031251 | Ga0265327_10000313 | Ga0265327_1000031331 | 547 |
| 437 | 3300035116 | Ga0373945_0016905 | Ga0373945_0016905_361_2154 | 547 |
| 438 | 3300037068 | Ga0373925_0066810 | Ga0373925_0066810_589_2388 | 547 |
| 439 | 3300044712 | Ga0453684_0000666 | Ga0453684_0000666_11562_13289 | 547 |
| 440 | 3300046454 | Ga0495592_0000115 | Ga0495592_0000115_27289_29088 | 547 |
| 441 | 3300046477 | Ga0495664_0009171 | Ga0495664_0009171_162_1961 | 547 |
| 442 | 3300046514 | Ga0495618_0001376 | Ga0495618_0001376_5161_6960 | 547 |
| 443 | 3300046517 | Ga0495630_0006172 | Ga0495630_0006172_2514_4313 | 547 |
| 444 | 3300046529 | Ga0495652_0010069 | Ga0495652_0010069_219_2018 | 547 |
| 445 | 3300046535 | Ga0495586_0000653 | Ga0495586_0000653_10041_11840 | 547 |
| 446 | 3300046690 | Ga0495624_0032470 | Ga0495624_0032470_1345_3144 | 547 |
| 447 | 3300047319 | Ga0495674_0018560 | Ga0495674_0018560_1783_3582 | 547 |
| 448 | 3300048903 | Ga0496100_0012063 | Ga0496100_0012063_3082_4881 | 547 |
| 449 | 3300049572 | Ga0501036_0003006 | Ga0501036_0003006_8455_10167 | 547 |
| 450 | 3300049580 | Ga0501046_0004199 | Ga0501046_0004199_11133_12845 | 547 |
| 451 | 3300049588 | Ga0501072_0009262 | Ga0501072_0009262_1114_2826 | 547 |
| 452 | 3300049592 | Ga0501076_0036259 | Ga0501076_0036259_1554_3266 | 547 |
| 453 | 3300049824 | Ga0501045_0019065 | Ga0501045_0019065_2759_4471 | 547 |
| 454 | 3300053087 | Ga0500643_004577 | Ga0500643_004577_1564_3267 | 547 |
| 455 | 3300053104 | Ga0500556_0000044 | Ga0500556_0000044_116524_118227 | 547 |
| 456 | 3300053130 | Ga0500642_0000014 | Ga0500642_0000014_142952_144655 | 547 |
| 457 | 3300053134 | Ga0500658_0001071 | Ga0500658_0001071_1444_3147 | 547 |
| 458 | 3300054114 | Ga0501084_0002721 | Ga0501084_0002721_10792_12504 | 547 |
| 459 | 3300060353 | Ga0501082_0017073 | Ga0501082_0017073_3764_5476 | 547 |
| 460 | 3300005459 | Ga0068867_100037165 | Ga0068867_1000371652 | 548 |
| 461 | 3300005471 | Ga0070698_100028917 | Ga0070698_1000289174 | 548 |
| 462 | 3300009093 | Ga0105240_10002613 | Ga0105240_1000261323 | 548 |
| 463 | 3300009177 | Ga0105248_10064297 | Ga0105248_100642975 | 548 |
| 464 | 3300025913 | Ga0207695_10065360 | Ga0207695_100653602 | 548 |
| 465 | 3300025944 | Ga0207661_10017338 | Ga0207661_100173384 | 548 |
| 466 | iso_pu_bacteria | 2786546517 | 2787438008 | 548 |
| 467 | iso_pu_bacteria | 2786546940 | 2788434621 | 548 |
| 468 | 3300005563 | Ga0068855_100027503 | Ga0068855_1000275032 | 549 |
| 469 | 3300025949 | Ga0207667_10037040 | Ga0207667_100370402 | 549 |
| 470 | 3300028381 | Ga0268264_10105137 | Ga0268264_101051372 | 549 |
| 471 | 3300031251 | Ga0265327_10003676 | Ga0265327_100036769 | 549 |
| 472 | 3300031711 | Ga0265314_10006940 | Ga0265314_100069404 | 549 |
| 473 | 3300032004 | Ga0307414_10029036 | Ga0307414_100290364 | 549 |
| 474 | 3300049823 | Ga0501044_0013063 | Ga0501044_0013063_2502_4214 | 549 |
| 475 | 3300005458 | Ga0070681_10005122 | Ga0070681_100051227 | 550 |
| 476 | 3300028563 | Ga0265319_1001183 | Ga0265319_100118314 | 550 |
| 477 | 3300028577 | Ga0265318_10000213 | Ga0265318_1000021311 | 550 |
| 478 | 3300028577 | Ga0265318_10000325 | Ga0265318_1000032513 | 550 |
| 479 | 3300031235 | Ga0265330_10000469 | Ga0265330_1000046918 | 550 |
| 480 | 3300031238 | Ga0265332_10000178 | Ga0265332_1000017846 | 550 |
| 481 | 3300031239 | Ga0265328_10005781 | Ga0265328_100057813 | 550 |
| 482 | 3300031240 | Ga0265320_10000050 | Ga0265320_1000005079 | 550 |
| 483 | 3300031241 | Ga0265325_10000591 | Ga0265325_1000059113 | 550 |
| 484 | 3300031242 | Ga0265329_10000153 | Ga0265329_1000015325 | 550 |
| 485 | 3300031247 | Ga0265340_10000160 | Ga0265340_100001605 | 550 |
| 486 | 3300031249 | Ga0265339_10003160 | Ga0265339_100031606 | 550 |
| 487 | 3300031250 | Ga0265331_10001723 | Ga0265331_1000172313 | 550 |
| 488 | 3300031251 | Ga0265327_10029584 | Ga0265327_100295842 | 550 |
| 489 | 3300031344 | Ga0265316_10000479 | Ga0265316_100004795 | 550 |
| 490 | 3300031344 | Ga0265316_10003402 | Ga0265316_100034023 | 550 |
| 491 | 3300031595 | Ga0265313_10000040 | Ga0265313_1000004087 | 550 |
| 492 | 3300031595 | Ga0265313_10000687 | Ga0265313_1000068717 | 550 |
| 493 | 3300031711 | Ga0265314_10000600 | Ga0265314_1000060022 | 550 |
| 494 | 3300031712 | Ga0265342_10000037 | Ga0265342_1000003749 | 550 |
| 495 | 3300031824 | Ga0307413_10022978 | Ga0307413_100229785 | 550 |
| 496 | 3300031901 | Ga0307406_10042785 | Ga0307406_100427852 | 550 |
| 497 | 3300031911 | Ga0307412_10035181 | Ga0307412_100351814 | 550 |
| 498 | 3300032004 | Ga0307414_10002397 | Ga0307414_100023974 | 550 |
| 499 | 3300032005 | Ga0307411_10001866 | Ga0307411_100018665 | 550 |
| 500 | 3300044712 | Ga0453684_0000306 | Ga0453684_0000306_122627_124366 | 550 |
| 501 | 3300044712 | Ga0453684_0082530 | Ga0453684_0082530_1916_3658 | 550 |
| 502 | 3300049582 | Ga0501048_0057163 | Ga0501048_0057163_199_1914 | 550 |
| 503 | iso_pu_bacteria | 2522572158 | 2523103710 | 550 |
| 504 | iso_pu_bacteria | 2524023250 | 2524613894 | 550 |
| 505 | iso_pu_bacteria | 2643221541 | 2643729428 | 550 |
| 506 | iso_pu_bacteria | 2643221563 | 2643832839 | 550 |
| 507 | iso_pu_bacteria | 2739367756 | 2739792239 | 550 |
| 508 | iso_pu_bacteria | 2808606401 | 2809065191 | 550 |
| 509 | iso_pu_bacteria | 2852653556 | 2852654248 | 550 |
| 510 | 3300003781 | Ga0055536_1003196 | Ga0055536_10031968 | 551 |
| 511 | 3300003791 | Ga0055530_10000028 | Ga0055530_1000002889 | 551 |
| 512 | 3300003794 | Ga0055531_10000971 | Ga0055531_1000097111 | 551 |
| 513 | 3300003911 | JGI25405J52794_10001065 | JGI25405J52794_100010651 | 551 |
| 514 | 3300005841 | Ga0068863_100000259 | Ga0068863_10000025934 | 551 |
| 515 | 3300005937 | Ga0081455_10001384 | Ga0081455_1000138422 | 551 |
| 516 | 3300025291 | Ga0209675_1000235 | Ga0209675_100023528 | 551 |
| 517 | 3300025292 | Ga0209676_1000220 | Ga0209676_100022030 | 551 |
| 518 | 3300025294 | Ga0209025_1014254 | Ga0209025_10142543 | 551 |
| 519 | 3300025298 | Ga0209050_1000112 | Ga0209050_1000112161 | 551 |
| 520 | 3300025304 | Ga0209257_1000213 | Ga0209257_100021325 | 551 |
| 521 | 3300026088 | Ga0207641_10000482 | Ga0207641_1000048222 | 551 |
| 522 | 3300029957 | Ga0265324_10012106 | Ga0265324_100121063 | 551 |
| 523 | 3300031344 | Ga0265316_10002480 | Ga0265316_100024802 | 551 |
| 524 | 3300031344 | Ga0265316_10013130 | Ga0265316_100131307 | 551 |
| 525 | 3300031711 | Ga0265314_10001043 | Ga0265314_1000104314 | 551 |
| 526 | 3300031711 | Ga0265314_10014825 | Ga0265314_100148252 | 551 |
| 527 | 3300031911 | Ga0307412_10009240 | Ga0307412_100092406 | 551 |
| 528 | 3300039437 | Ga0436365_0010485 | Ga0436365_0010485_278_2104 | 551 |
| 529 | 3300049822 | Ga0501035_0019229 | Ga0501035_0019229_897_2627 | 551 |
| 530 | 3300005289 | Ga0065704_10079831 | Ga0065704_100798312 | 552 |
| 531 | 3300005290 | Ga0065712_10009254 | Ga0065712_100092541 | 552 |
| 532 | 3300005330 | Ga0070690_100053179 | Ga0070690_1000531792 | 552 |
| 533 | 3300005355 | Ga0070671_100021738 | Ga0070671_1000217383 | 552 |
| 534 | 3300005365 | Ga0070688_100067559 | Ga0070688_1000675592 | 552 |
| 535 | 3300005435 | Ga0070714_100001634 | Ga0070714_1000016346 | 552 |
| 536 | 3300005436 | Ga0070713_100153342 | Ga0070713_1001533421 | 552 |
| 537 | 3300005445 | Ga0070708_100042525 | Ga0070708_1000425251 | 552 |
| 538 | 3300005468 | Ga0070707_100110532 | Ga0070707_1001105322 | 552 |
| 539 | 3300005471 | Ga0070698_100002638 | Ga0070698_1000026385 | 552 |
| 540 | 3300005536 | Ga0070697_100001987 | Ga0070697_1000019879 | 552 |
| 541 | 3300005536 | Ga0070697_100011528 | Ga0070697_1000115283 | 552 |
| 542 | 3300005842 | Ga0068858_100000102 | Ga0068858_10000010237 | 552 |
| 543 | 3300005937 | Ga0081455_10000398 | Ga0081455_1000039821 | 552 |
| 544 | 3300005983 | Ga0081540_1045285 | Ga0081540_10452851 | 552 |
| 545 | 3300009101 | Ga0105247_10034777 | Ga0105247_100347774 | 552 |
| 546 | 3300009174 | Ga0105241_10067719 | Ga0105241_100677192 | 552 |
| 547 | 3300009177 | Ga0105248_10000014 | Ga0105248_10000014299 | 552 |
| 548 | 3300009551 | Ga0105238_10013389 | Ga0105238_100133894 | 552 |
| 549 | 3300009553 | Ga0105249_10002596 | Ga0105249_100025969 | 552 |
| 550 | 3300009553 | Ga0105249_10037655 | Ga0105249_100376554 | 552 |
| 551 | 3300013297 | Ga0157378_10002107 | Ga0157378_100021076 | 552 |
| 552 | 3300013308 | Ga0157375_10000040 | Ga0157375_10000040101 | 552 |
| 553 | 3300013308 | Ga0157375_10021788 | Ga0157375_100217882 | 552 |
| 554 | 3300014325 | Ga0163163_10000165 | Ga0163163_1000016526 | 552 |
| 555 | 3300014325 | Ga0163163_10054212 | Ga0163163_100542122 | 552 |
| 556 | 3300014968 | Ga0157379_10034206 | Ga0157379_100342064 | 552 |
| 557 | 3300025900 | Ga0207710_10017369 | Ga0207710_100173692 | 552 |
| 558 | 3300025910 | Ga0207684_10048039 | Ga0207684_100480392 | 552 |
| 559 | 3300025916 | Ga0207663_10026621 | Ga0207663_100266212 | 552 |
| 560 | 3300025922 | Ga0207646_10077903 | Ga0207646_100779032 | 552 |
| 561 | 3300025924 | Ga0207694_10043451 | Ga0207694_100434512 | 552 |
| 562 | 3300025941 | Ga0207711_10000021 | Ga0207711_1000002131 | 552 |
| 563 | 3300025961 | Ga0207712_10001010 | Ga0207712_1000101014 | 552 |
| 564 | 3300025972 | Ga0207668_10019718 | Ga0207668_100197182 | 552 |
| 565 | 3300026035 | Ga0207703_10000190 | Ga0207703_1000019032 | 552 |
| 566 | 3300026078 | Ga0207702_10072844 | Ga0207702_100728442 | 552 |
| 567 | 3300026116 | Ga0207674_10003039 | Ga0207674_100030398 | 552 |
| 568 | 3300028556 | Ga0265337_1000467 | Ga0265337_100046715 | 552 |
| 569 | 3300028556 | Ga0265337_1003994 | Ga0265337_10039942 | 552 |
| 570 | 3300028558 | Ga0265326_10002757 | Ga0265326_100027573 | 552 |
| 571 | 3300028563 | Ga0265319_1000767 | Ga0265319_100076717 | 552 |
| 572 | 3300028577 | Ga0265318_10003845 | Ga0265318_100038455 | 552 |
| 573 | 3300028653 | Ga0265323_10000043 | Ga0265323_100000439 | 552 |
| 574 | 3300028666 | Ga0265336_10000631 | Ga0265336_100006319 | 552 |
| 575 | 3300028800 | Ga0265338_10000008 | Ga0265338_10000008309 | 552 |
| 576 | 3300028800 | Ga0265338_10000041 | Ga0265338_10000041128 | 552 |
| 577 | 3300028800 | Ga0265338_10000710 | Ga0265338_1000071035 | 552 |
| 578 | 3300028800 | Ga0265338_10001171 | Ga0265338_1000117125 | 552 |
| 579 | 3300028800 | Ga0265338_10006519 | Ga0265338_100065192 | 552 |
| 580 | 3300028800 | Ga0265338_10009864 | Ga0265338_100098645 | 552 |
| 581 | 3300028800 | Ga0265338_10011656 | Ga0265338_100116566 | 552 |
| 582 | 3300028800 | Ga0265338_10011925 | Ga0265338_100119255 | 552 |
| 583 | 3300029957 | Ga0265324_10000422 | Ga0265324_100004227 | 552 |
| 584 | 3300031240 | Ga0265320_10000303 | Ga0265320_1000030332 | 552 |
| 585 | 3300031242 | Ga0265329_10005571 | Ga0265329_100055712 | 552 |
| 586 | 3300031251 | Ga0265327_10004123 | Ga0265327_100041235 | 552 |
| 587 | 3300031548 | Ga0307408_100000021 | Ga0307408_10000002187 | 552 |
| 588 | 3300031616 | Ga0307508_10000309 | Ga0307508_1000030920 | 552 |
| 589 | 3300031903 | Ga0307407_10000155 | Ga0307407_1000015518 | 552 |
| 590 | 3300032004 | Ga0307414_10000083 | Ga0307414_1000008354 | 552 |
| 591 | 3300032005 | Ga0307411_10053054 | Ga0307411_100530542 | 552 |
| 592 | 3300035695 | Ga0373927_0001758 | Ga0373927_0001758_11840_13639 | 552 |
| 593 | 3300036401 | Ga0373937_0031350 | Ga0373937_0031350_1260_3053 | 552 |
| 594 | 3300037068 | Ga0373925_0025051 | Ga0373925_0025051_2437_4236 | 552 |
| 595 | 3300041408 | Ga0439453_0001153 | Ga0439453_0001153_1067_2854 | 552 |
| 596 | 3300042127 | Ga0450890_000001 | Ga0450890_000001_119594_121381 | 552 |
| 597 | 3300042130 | Ga0450892_000093 | Ga0450892_000093_1462_3249 | 552 |
| 598 | 3300042532 | Ga0450893_0000243 | Ga0450893_0000243_50_1837 | 552 |
| 599 | 3300042532 | Ga0450893_0000244 | Ga0450893_0000244_4686_6473 | 552 |
| 600 | 3300042876 | Ga0451577_0000347 | Ga0451577_0000347_63143_64942 | 552 |
| 601 | 3300042876 | Ga0451577_0011240 | Ga0451577_0011240_3517_5316 | 552 |
| 602 | 3300044656 | Ga0466969_0001480 | Ga0466969_0001480_8456_10189 | 552 |
| 603 | 3300044673 | Ga0453683_0033209 | Ga0453683_0033209_1384_3198 | 552 |
| 604 | 3300044684 | Ga0466966_0000437 | Ga0466966_0000437_20859_22592 | 552 |
| 605 | 3300044693 | Ga0466961_0036291 | Ga0466961_0036291_939_2672 | 552 |
| 606 | 3300044693 | Ga0466961_0042472 | Ga0466961_0042472_499_2301 | 552 |
| 607 | 3300044694 | Ga0466963_0015003 | Ga0466963_0015003_2830_4563 | 552 |
| 608 | 3300044712 | Ga0453684_0001441 | Ga0453684_0001441_26511_28310 | 552 |
| 609 | 3300044712 | Ga0453684_0017033 | Ga0453684_0017033_7014_8813 | 552 |
| 610 | 3300044719 | Ga0466971_0000095 | Ga0466971_0000095_20929_22662 | 552 |
| 611 | 3300044765 | Ga0466970_0007557 | Ga0466970_0007557_1688_3421 | 552 |
| 612 | 3300044842 | Ga0466957_0000308 | Ga0466957_0000308_701_2434 | 552 |
| 613 | 3300045049 | Ga0466959_0000240 | Ga0466959_0000240_13123_14856 | 552 |
| 614 | 3300045051 | Ga0451576_0126632 | Ga0451576_0126632_793_2592 | 552 |
| 615 | 3300045836 | Ga0466958_0000923 | Ga0466958_0000923_8102_9835 | 552 |
| 616 | 3300046454 | Ga0495592_0011665 | Ga0495592_0011665_2725_4518 | 552 |
| 617 | 3300046473 | Ga0495582_0004637 | Ga0495582_0004637_93_2009 | 552 |
| 618 | 3300046517 | Ga0495630_0000063 | Ga0495630_0000063_40092_42008 | 552 |
| 619 | 3300046517 | Ga0495630_0065897 | Ga0495630_0065897_829_2631 | 552 |
| 620 | 3300046529 | Ga0495652_0012166 | Ga0495652_0012166_3512_5305 | 552 |
| 621 | 3300046535 | Ga0495586_0000009 | Ga0495586_0000009_58445_60361 | 552 |
| 622 | 3300046535 | Ga0495586_0057828 | Ga0495586_0057828_229_2022 | 552 |
| 623 | 3300046536 | Ga0495587_0009829 | Ga0495587_0009829_2451_4244 | 552 |
| 624 | 3300046642 | Ga0495634_0021066 | Ga0495634_0021066_2246_4048 | 552 |
| 625 | 3300046642 | Ga0495634_0028603 | Ga0495634_0028603_98_1891 | 552 |
| 626 | 3300046678 | Ga0495599_0006697 | Ga0495599_0006697_1219_3012 | 552 |
| 627 | 3300046683 | Ga0495658_0016099 | Ga0495658_0016099_2024_3823 | 552 |
| 628 | 3300047319 | Ga0495674_0000451 | Ga0495674_0000451_31900_33816 | 552 |
| 629 | 3300047471 | Ga0495684_0007052 | Ga0495684_0007052_4295_6088 | 552 |
| 630 | 3300048088 | Ga0495602_0019855 | Ga0495602_0019855_4598_6391 | 552 |
| 631 | 3300048904 | Ga0496101_0012929 | Ga0496101_0012929_772_2475 | 552 |
| 632 | 3300048905 | Ga0496102_0055986 | Ga0496102_0055986_1560_3359 | 552 |
| 633 | 3300048912 | Ga0496109_0014517 | Ga0496109_0014517_3627_5420 | 552 |
| 634 | 3300048917 | Ga0496114_0002161 | Ga0496114_0002161_11789_13588 | 552 |
| 635 | 3300048918 | Ga0496115_0001415 | Ga0496115_0001415_7195_9006 | 552 |
| 636 | 3300048918 | Ga0496115_0054063 | Ga0496115_0054063_875_2668 | 552 |
| 637 | 3300049742 | Ga0501080_0008215 | Ga0501080_0008215_763_2604 | 552 |
| 638 | 3300050507 | nmdc:mga05p37_70631_c1 | nmdc:mga05p37_70631_c1_1991_3790 | 552 |
| 639 | 3300050515 | nmdc:mga0a205_174574_c1 | nmdc:mga0a205_174574_c1_204_1997 | 552 |
| 640 | 3300053730 | Ga0500645_002407 | Ga0500645_002407_1561_3264 | 552 |
| 641 | 3300005331 | Ga0070670_100016887 | Ga0070670_1000168872 | 553 |
| 642 | 3300005340 | Ga0070689_100075257 | Ga0070689_1000752572 | 553 |
| 643 | 3300005367 | Ga0070667_100006806 | Ga0070667_1000068065 | 553 |
| 644 | 3300005367 | Ga0070667_100026251 | Ga0070667_1000262512 | 553 |
| 645 | 3300005441 | Ga0070700_100065267 | Ga0070700_1000652672 | 553 |
| 646 | 3300005467 | Ga0070706_100010532 | Ga0070706_1000105326 | 553 |
| 647 | 3300005468 | Ga0070707_100014606 | Ga0070707_1000146065 | 553 |
| 648 | 3300005548 | Ga0070665_100001672 | Ga0070665_1000016722 | 553 |
| 649 | 3300005617 | Ga0068859_100008329 | Ga0068859_1000083293 | 553 |
| 650 | 3300005618 | Ga0068864_100058101 | Ga0068864_1000581016 | 553 |
| 651 | 3300005841 | Ga0068863_100000006 | Ga0068863_100000006227 | 553 |
| 652 | 3300005843 | Ga0068860_100000119 | Ga0068860_10000011945 | 553 |
| 653 | 3300005844 | Ga0068862_100041857 | Ga0068862_1000418574 | 553 |
| 654 | 3300006844 | Ga0075428_100005871 | Ga0075428_1000058716 | 553 |
| 655 | 3300006931 | Ga0097620_100008329 | Ga0097620_1000083293 | 553 |
| 656 | 3300007076 | Ga0075435_100028686 | Ga0075435_1000286862 | 553 |
| 657 | 3300014326 | Ga0157380_10099388 | Ga0157380_100993882 | 553 |
| 658 | 3300014745 | Ga0157377_10030284 | Ga0157377_100302842 | 553 |
| 659 | 3300025908 | Ga0207643_10054706 | Ga0207643_100547063 | 553 |
| 660 | 3300025910 | Ga0207684_10012294 | Ga0207684_100122944 | 553 |
| 661 | 3300025918 | Ga0207662_10005326 | Ga0207662_100053264 | 553 |
| 662 | 3300025922 | Ga0207646_10011262 | Ga0207646_100112626 | 553 |
| 663 | 3300025922 | Ga0207646_10015134 | Ga0207646_100151346 | 553 |
| 664 | 3300025941 | Ga0207711_10138592 | Ga0207711_101385923 | 553 |
| 665 | 3300025986 | Ga0207658_10000749 | Ga0207658_100007494 | 553 |
| 666 | 3300025986 | Ga0207658_10004256 | Ga0207658_100042565 | 553 |
| 667 | 3300026088 | Ga0207641_10000054 | Ga0207641_1000005432 | 553 |
| 668 | 3300026088 | Ga0207641_10155560 | Ga0207641_101555602 | 553 |
| 669 | 3300026118 | Ga0207675_100038057 | Ga0207675_1000380573 | 553 |
| 670 | 3300028379 | Ga0268266_10020391 | Ga0268266_100203913 | 553 |
| 671 | 3300028380 | Ga0268265_10022662 | Ga0268265_100226622 | 553 |
| 672 | 3300028381 | Ga0268264_10000128 | Ga0268264_1000012887 | 553 |
| 673 | 3300048924 | Ga0496121_0002328 | Ga0496121_0002328_16287_17987 | 553 |
| 674 | 3300050512 | nmdc:mga0n895_139263_c1 | nmdc:mga0n895_139263_c1_394_2109 | 553 |
| 675 | 3300053087 | Ga0500643_000135 | Ga0500643_000135_30148_31887 | 553 |
| 676 | 3300053121 | Ga0500607_000011 | Ga0500607_000011_1529_3232 | 553 |
| 677 | 3300001904 | JGI24736J21556_1003251 | JGI24736J21556_10032512 | 554 |
| 678 | 3300001915 | JGI24741J21665_1000047 | JGI24741J21665_10000478 | 554 |
| 679 | 3300001989 | JGI24739J22299_10001426 | JGI24739J22299_100014263 | 554 |
| 680 | 3300002067 | JGI24735J21928_10006499 | JGI24735J21928_100064994 | 554 |
| 681 | 3300002459 | JGI24751J29686_10000055 | JGI24751J29686_1000005557 | 554 |
| 682 | 3300003794 | Ga0055531_10001496 | Ga0055531_100014967 | 554 |
| 683 | 3300005262 | Ga0065165_1010373 | Ga0065165_10103732 | 554 |
| 684 | 3300005295 | Ga0065707_10008947 | Ga0065707_100089472 | 554 |
| 685 | 3300005327 | Ga0070658_10004898 | Ga0070658_100048983 | 554 |
| 686 | 3300005329 | Ga0070683_100111165 | Ga0070683_1001111652 | 554 |
| 687 | 3300005331 | Ga0070670_100001196 | Ga0070670_10000119614 | 554 |
| 688 | 3300005335 | Ga0070666_10011221 | Ga0070666_100112214 | 554 |
| 689 | 3300005347 | Ga0070668_100002466 | Ga0070668_1000024664 | 554 |
| 690 | 3300005356 | Ga0070674_100037553 | Ga0070674_1000375532 | 554 |
| 691 | 3300005366 | Ga0070659_100009846 | Ga0070659_1000098462 | 554 |
| 692 | 3300005457 | Ga0070662_100022504 | Ga0070662_1000225045 | 554 |
| 693 | 3300005563 | Ga0068855_100000921 | Ga0068855_1000009214 | 554 |
| 694 | 3300005577 | Ga0068857_100062408 | Ga0068857_1000624084 | 554 |
| 695 | 3300005614 | Ga0068856_100020716 | Ga0068856_1000207164 | 554 |
| 696 | 3300005616 | Ga0068852_100023583 | Ga0068852_1000235834 | 554 |
| 697 | 3300005617 | Ga0068859_100002609 | Ga0068859_1000026096 | 554 |
| 698 | 3300005618 | Ga0068864_100001088 | Ga0068864_10000108814 | 554 |
| 699 | 3300005618 | Ga0068864_100012451 | Ga0068864_1000124517 | 554 |
| 700 | 3300005841 | Ga0068863_100001229 | Ga0068863_10000122918 | 554 |
| 701 | 3300005841 | Ga0068863_100021158 | Ga0068863_1000211585 | 554 |
| 702 | 3300005843 | Ga0068860_100027677 | Ga0068860_1000276772 | 554 |
| 703 | 3300005981 | Ga0081538_10016797 | Ga0081538_100167972 | 554 |
| 704 | 3300005981 | Ga0081538_10019422 | Ga0081538_100194222 | 554 |
| 705 | 3300006042 | Ga0075368_10000386 | Ga0075368_100003866 | 554 |
| 706 | 3300006048 | Ga0075363_100005451 | Ga0075363_1000054514 | 554 |
| 707 | 3300006178 | Ga0075367_10000494 | Ga0075367_100004944 | 554 |
| 708 | 3300006353 | Ga0075370_10009261 | Ga0075370_100092614 | 554 |
| 709 | 3300009093 | Ga0105240_10040387 | Ga0105240_100403876 | 554 |
| 710 | 3300009098 | Ga0105245_10001046 | Ga0105245_1000104615 | 554 |
| 711 | 3300009174 | Ga0105241_10002560 | Ga0105241_100025604 | 554 |
| 712 | 3300009177 | Ga0105248_10023788 | Ga0105248_100237886 | 554 |
| 713 | 3300009551 | Ga0105238_10004619 | Ga0105238_100046198 | 554 |
| 714 | 3300017792 | Ga0163161_10006031 | Ga0163161_100060319 | 554 |
| 715 | 3300025254 | Ga0209148_1000749 | Ga0209148_100074917 | 554 |
| 716 | 3300025292 | Ga0209676_1000045 | Ga0209676_1000045130 | 554 |
| 717 | 3300025292 | Ga0209676_1000246 | Ga0209676_100024665 | 554 |
| 718 | 3300025298 | Ga0209050_1011460 | Ga0209050_10114602 | 554 |
| 719 | 3300025304 | Ga0209257_1000169 | Ga0209257_100016983 | 554 |
| 720 | 3300025909 | Ga0207705_10000155 | Ga0207705_1000015566 | 554 |
| 721 | 3300025924 | Ga0207694_10016720 | Ga0207694_100167202 | 554 |
| 722 | 3300025924 | Ga0207694_10031665 | Ga0207694_100316652 | 554 |
| 723 | 3300025925 | Ga0207650_10000050 | Ga0207650_10000050171 | 554 |
| 724 | 3300025931 | Ga0207644_10066929 | Ga0207644_100669292 | 554 |
| 725 | 3300025972 | Ga0207668_10000492 | Ga0207668_100004925 | 554 |
| 726 | 3300026041 | Ga0207639_10000511 | Ga0207639_1000051113 | 554 |
| 727 | 3300026067 | Ga0207678_10000053 | Ga0207678_1000005335 | 554 |
| 728 | 3300026078 | Ga0207702_10004291 | Ga0207702_100042919 | 554 |
| 729 | 3300026088 | Ga0207641_10024217 | Ga0207641_100242175 | 554 |
| 730 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004172 | 554 |
| 731 | 3300026142 | Ga0207698_10016690 | Ga0207698_100166904 | 554 |
| 732 | 3300027866 | Ga0209813_10000023 | Ga0209813_100000239 | 554 |
| 733 | 3300028577 | Ga0265318_10001256 | Ga0265318_100012568 | 554 |
| 734 | 3300028654 | Ga0265322_10009724 | Ga0265322_100097244 | 554 |
| 735 | 3300029957 | Ga0265324_10000851 | Ga0265324_100008512 | 554 |
| 736 | 3300029957 | Ga0265324_10004032 | Ga0265324_100040322 | 554 |
| 737 | 3300031235 | Ga0265330_10002312 | Ga0265330_1000231210 | 554 |
| 738 | 3300031235 | Ga0265330_10003836 | Ga0265330_100038367 | 554 |
| 739 | 3300031235 | Ga0265330_10023778 | Ga0265330_100237781 | 554 |
| 740 | 3300031240 | Ga0265320_10011564 | Ga0265320_100115642 | 554 |
| 741 | 3300031242 | Ga0265329_10000822 | Ga0265329_100008226 | 554 |
| 742 | 3300031250 | Ga0265331_10000088 | Ga0265331_1000008820 | 554 |
| 743 | 3300031250 | Ga0265331_10000403 | Ga0265331_100004036 | 554 |
| 744 | 3300031251 | Ga0265327_10000457 | Ga0265327_1000045751 | 554 |
| 745 | 3300031344 | Ga0265316_10129627 | Ga0265316_101296272 | 554 |
| 746 | 3300031548 | Ga0307408_100001362 | Ga0307408_1000013628 | 554 |
| 747 | 3300031595 | Ga0265313_10019596 | Ga0265313_100195962 | 554 |
| 748 | 3300031616 | Ga0307508_10000011 | Ga0307508_10000011174 | 554 |
| 749 | 3300031731 | Ga0307405_10026166 | Ga0307405_100261664 | 554 |
| 750 | 3300031901 | Ga0307406_10004208 | Ga0307406_100042087 | 554 |
| 751 | 3300031911 | Ga0307412_10000844 | Ga0307412_1000084410 | 554 |
| 752 | 3300032002 | Ga0307416_100002045 | Ga0307416_1000020457 | 554 |
| 753 | 3300037312 | Ga0395899_0036822 | Ga0395899_0036822_102_1829 | 554 |
| 754 | 3300038443 | Ga0395901_0002048 | Ga0395901_0002048_10580_12307 | 554 |
| 755 | 3300044712 | Ga0453684_0000147 | Ga0453684_0000147_188447_190168 | 554 |
| 756 | 3300046453 | Ga0495627_013361 | Ga0495627_013361_304_2007 | 554 |
| 757 | 3300046462 | Ga0495651_0018964 | Ga0495651_0018964_3021_4748 | 554 |
| 758 | 3300046471 | Ga0495650_0000756 | Ga0495650_0000756_20834_22537 | 554 |
| 759 | 3300046500 | Ga0495596_0001188 | Ga0495596_0001188_1484_3187 | 554 |
| 760 | 3300046507 | Ga0495606_0009719 | Ga0495606_0009719_844_2547 | 554 |
| 761 | 3300046512 | Ga0495610_0003390 | Ga0495610_0003390_8705_10408 | 554 |
| 762 | 3300046616 | Ga0495668_0000229 | Ga0495668_0000229_71055_72758 | 554 |
| 763 | 3300046660 | Ga0495625_0008293 | Ga0495625_0008293_5888_7591 | 554 |
| 764 | 3300047470 | Ga0495681_0000017 | Ga0495681_0000017_101071_102774 | 554 |
| 765 | 3300048088 | Ga0495602_0035158 | Ga0495602_0035158_1114_2841 | 554 |
| 766 | 3300048091 | Ga0495626_0001137 | Ga0495626_0001137_7370_9073 | 554 |
| 767 | 3300048905 | Ga0496102_0004371 | Ga0496102_0004371_818_2521 | 554 |
| 768 | 3300048909 | Ga0496106_0000319 | Ga0496106_0000319_24749_26452 | 554 |
| 769 | 3300048918 | Ga0496115_0114880 | Ga0496115_0114880_174_1895 | 554 |
| 770 | 3300048921 | Ga0496118_0001488 | Ga0496118_0001488_27277_28980 | 554 |
| 771 | 3300049574 | Ga0501038_0023098 | Ga0501038_0023098_1950_3653 | 554 |
| 772 | 3300049576 | Ga0501040_0052569 | Ga0501040_0052569_910_2646 | 554 |
| 773 | 3300049591 | Ga0501075_0006760 | Ga0501075_0006760_4656_6392 | 554 |
| 774 | 3300049592 | Ga0501076_0139599 | Ga0501076_0139599_129_1865 | 554 |
| 775 | 3300050494 | nmdc:mga06z11_66_c1 | nmdc:mga06z11_66_c1_38613_40316 | 554 |
| 776 | 3300050495 | nmdc:mga04h51_79_c1 | nmdc:mga04h51_79_c1_7706_9409 | 554 |
| 777 | 3300053080 | Ga0500635_0000942 | Ga0500635_0000942_2193_4019 | 554 |
| 778 | 3300053116 | Ga0500592_001159 | Ga0500592_001159_1087_2790 | 554 |
| 779 | 3300061734 | Ga0530510_0016249 | Ga0530510_0016249_255_1991 | 554 |
| 780 | 3300061734 | Ga0530510_0040735 | Ga0530510_0040735_1288_3024 | 554 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nnl-assembly1.cif.gz_A | cryo-em structure of the kdpfabc complex in an e1-atp conformation loaded with k+ | 0.9541 | 1 | 546 |
| 5mrw-assembly2.cif.gz_E | structure of the kdpfabc complex | 0.9529 | 1 | 546 |
| 7nnp-assembly1.cif.gz_A | rb-loaded cryo-em structure of the e1-atp kdpfabc complex. | 0.9481 | 1 | 546 |
| 7nnl-assembly1.cif.gz_A | cryo-em structure of the kdpfabc complex in an e1-atp conformation loaded with k+ | 0.9389 | 1 | 546 |
| 5mrw-assembly2.cif.gz_E | structure of the kdpfabc complex | 0.9376 | 1 | 546 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D4AA82_391_633_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3748 | 103 | 298 | 1.20.1070.10 |
| af_U4PFA8_90_276_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.332 | 366 | 488 | 1.10.287.70 |
| af_D4AA82_391_633_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2927 | 103 | 298 | 1.20.1070.10 |
| af_A0A0R4IU63_604_837_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.287 | 45 | 343 | 1.20.1070.10 |
| af_A3KPM6_590_828_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2867 | 76 | 343 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L3ZV93-F1-model_v4 | deleted | 0.9938 | 1 | 265 |
|
| AF-A0A4Q2ZEI1-F1-model_v4 | Potassium-transporting ATPase subunit A | 0.9897 | 1 | 327 |
GO:0005886
GO:0008556 |
| AF-A0A520D4Y7-F1-model_v4 | deleted | 0.9891 | 1 | 216 |
|
| AF-A0A7Y5VMV4-F1-model_v4 | Potassium-transporting ATPase subunit A | 0.9889 | 1 | 318 |
GO:0005886
GO:0008556 |
| AF-A0A354V3K5-F1-model_v4 | Potassium-transporting ATPase subunit KdpA (EC 3.6.3.12) | 0.9889 | 1 | 277 |
GO:0005886
GO:0008556 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar